1R6TA

Crystal structure of human tryptophanyl-trna synthetase
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
461
structure length
440
Chain Sequence
b'ASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKAEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYGDAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophanyl-tRNA synthetase
publication title Crystal structures that suggest late development of genetic code components for differentiating aromatic side chains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 155
structure length 440
sequence length 461
chains with identical sequence B
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2003-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1r6tA03
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1r6tA01
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1r6tA02
3VU8A 3TZEA 5HUJA 5TS2A 3OP1A 4ZT3A 3AL0C 4LF9O 2WQ7A 1JIJA 1YI8A 1PFYA 4ZT6A 2QTNA 3SEZA 1N2IA 3IOBA 2DEUA 1N33O 4ND7A 2QUIA 4DR3O 1T9GS 2VQEO 2HHHO 1WXHA 2A4MA 2AKEA 3ISJA 2A1TS 1I6MA 1R1BA 3G59A 3N9IA 1JECA 3AG5A 1N78A 3FH0A 3ZUGA 3DV2A 1N2GA 4MUKA 1M83A 5TGTA 5LLTA 4WSOA 1EFPA 2XRZA 4I6GA 2UUCO 1H3EA 4DV5O 4XSVA 3CLRC 1J20A 3UC5A 1OWOA 4NAHA 3D6UA 3RHSA 1OWMA 4OUDA 3T1HO 4JI7O 1F9AA 3IOCA 1EFVB 2FKXA 2X1MA 1WJGA 4GRIA 4X64O 4WNYA 2A1TR 1NUQA 1HR0O 3IUEA 1IQRA 1J21A 1WKBA 2H2AA 2OQ2A 2CT8A 2QJTA 3IMCA 5LM3A 4MWDA 4QREA 4ZCPA 1ZH6A 5F23A 4XFJA 1XNGA 3FWKA 1B6TA 4DR1O 3FOCA 3JAMN 3FNRA 5BXZA 2E18A 1H3FA 2ZUFA 4DDKA 2J07A 3H97A 3ZJVA 3P0JA 3K32A 3ND5A 2ZP1A 4MW9A 5EKDA 4LFAO 3H9CA 2EL7A 4JFAA 3J80N 2WSIA 2O8VA 4DE5A 4EG3A 2X3FA 1MOPA 3MUEA 1MBZA 4MW4A 1O97C 2PZ8A 2X1LA 2DPLA 1GTSA 4FZJA 1KQNA 3N05A 1N1DA 1O94D 3LE8A 3J7AU 4DR7O 5J59A 3X1JA 4EG6A 4J75A 1T6XA 4JYAO 1M8GA 1O95D 2R5WA 1KP3A 4JI6O 1MC1A 3FG9A 3H99A 1I6LA 3FY4A 1JZQA 1KKUA 4ZT2A 1IVSA 1N2BA 1U3DA 2PXHA 2VXOA 1LW7A 1OWNA 4EG4A 3CA8A 1JEDA 4DV4O 3NV7A 3FI0A 1Q11A 1I94O 4YBRA 3CLSD 2D54A 4LF6O 3COZA 4MW2A 1XJQA 4MWCA 1DK1A 4G5YA 1N2JA 4DR5O 3A04A 1KUQA 1HYBA 1N3LA 4ZT5A 3M5WA 4DNXA 4DV1O 4DV7O 4DLPA 3D6VA 5DK4A 2IJGX 1MB9A 3ND6A 2YXNA 1F4LA 5DB4A 4HJXA 4TS1A 2Z08A 4KPUB 4NZPA 3VGJA 1QJCA 2BYTA 4YY3O 4DUYO 4EG8A 3CVXA 3DPIA 1J1UA 2BTEA 2GOYA 4AQ7A 4ZCRA 1EXDA 1NUSA 1WY5A 3ZXSA 3R66A 3ELBA 5J58A 4MULA 1ZH0A 1MAWA 2A1UB 2CYAA 4JI2O 2A7XA 1UFVA 3KT3A 1BS2A 4KKVA 1T6YA 1O96B 5TEVA 1EFVA 2CYCA 3Q4GA 1EUQA 1TYCA 3KFLA 3SEQA 3TQOA 4NDAA 3CLRD 2NSYA 1G8FA 3KT8A 1MB2A 4NXMO 1VLHA 1YIDA 1NSYA 1U7DA 2NZ2A 1IHOA 4UZEA 2J5BA 2QTRA 3X1MA 1LI5A 1GLNA 2QUJA 1XEQA 4ARIA 1O0CA 3I05A 2GM3A 5KHAA 3GMIA 2V0CA 1PFVA 4LF4O 1IH8A 1WOYA 2Z3VA 4KR9A 4AS1A 2V0GA 2VQFO 2HGZA 1F7YA 1H3NA 4MVCA 4ZT7A 1J09A 2TS1A 3NBAA 2PG3A 3GLVA 5FO0A 4JI3O 2F4VO 2X0KA 4JI8O 3CVWA 1NUUA 2G36A 4PBTA 1HNXO 2YWCA 4DUZO 4B3TO 1O97D 4L2IB 1ZJWA 4MUFA 3KT6A 5LMNO 1JIKA 1DNPA 1JHDA 2UUBO 5FLXN 4LF8O 3P0HA 1K4MA 1JZSA 4JI5O 1J70A 2HZ7A 3SP1A 2I1LA 2RE8A 1GPMA 3RK1A 4MUEA 4EFKA 4ZT4A 1T9GR 3JXEA 1O5TA 2DR2A 2DOSA 1G1XB 3CR8A 3RK0A 1J5EO 3K9WA 2DERA 3IMEA 2A86A 2UUAO 3AIIA 1KAQA 2YWBA 1X6VA 3ZIUA 1A32A 3F3MA 1WZ2A 3ZGZA 4KHPO 1EUYA 1TYAE 4X66O 3S3TA 2E21A 2O5RA 1ZUNA 4KPUA 1EJ2A 2DLCX 3IOEA 4EG5A 4OJMX 3PNVA 2JA2A 4DV0O 3DO8A 4PY2A 4MQ6A 4LF7O 1TQ8A 1IBKO 4UZFA 4U8HA 2WB2A 4HJRA 1PFUA 3IVGA 4YMIA 4CQNA 4RPIA 2AG6A 2A1UA 2D13A 3IODA 1LI7A 2CSXA 3H9BA 4U7JA 3HZRA 3J81N 4ND6A 2ZM6O 5FNZA 1O96A 1QRTA 2QUHA 2GKSA 3UOWA 3COYA 3HV0A 5IWAO 3T1YO 1P7PA 4R0NA 3AFHA 2QUKA 4MW5A 2CYBA 5KWVA 2DETA 2IP1A 1HNZO 5K0TA 3PRHA 1QU2A 5IT9N 3HL4A 3FHJA 5A2QN 3TQIA 2CV2A 3OTOO 4YP5A 5KCMA 3TNJA 1WXEA 1GZUA 3IH5A 4YHHO 4I6JA 2J08A 2EJCA 4YP6A 1MRZA 3A05A 1FYJA 1XNQO 1CT9A 2PFSA 4G6ZA 4A91A 2JRIA 3E27A 3A2KA 4K0RA 1AB3A 1GTRA 1WXFA 4JXZA 1NYLA 1I6KA 5IJXA 3RBAA 1G8GA 3UY4A 1VBKA 4DR2O 5H7XA 4EGAA 2QJFA 1Q77A 1Q19A 3HFJA 1TEZA 2AGAA 4Q16A 4L2IA 4MVWA 3P0IA 2Z0AA 4F3RA 3CLUC 4S1OA 4CDMA 4MVXA 4J76A 3AKZA 2XRYA 1NP7A 3PNBA 5J5AA 1K4KA 5FO1A 3IUBA 1KH2A 1G59A 1KH1A 1R6TA 4DV2O 2PIDA 3F5TA 4KR7A 2E5LO 4JZYA 3ZJTA 3INNA 3L93A 4GU5A 4DV3O 4K03A 4DR4O 1N2EA 1NI5A 3G6KA 3H05A 3IVXA 5IHXA 1N2OA 4EG1A 3QTTA 1A8HA 3IDFA 3HMQA 4DV6O 2DUMA 1TFUA 4MW0A 4NXNO 4EG7A 4P2BA 3O65A 1HNWO 1ULHA 1KQOA 4NX2A 4QRDA 4CT0A 5TEWA 1QTQA 3RJZA 4HK4A 2CUZA 3SZ3A 4DDHA 3KT0A 2WQ6A 5H5NA 1ILEA 1G8HA 4JXXA 1XMOO 2ZUEA 4OPAA 1KQPA 2A88A 2D5BA 1NS1A 3VRHA 5BR8O 4F4HA 4ZCQA 3MMXA 3LOQA 1YUMA 2H29A 3TS1A 3X1KA 3FIUA 1KH3A 3HGMA 1M8JA 4GKKO 1NUTA 3CVUA 1N36O 1NZJA 2QTMA 5HUHA 1MJHA 4KR6A 2ZKOA 4LFBO 1PFWA 3UK2A 4I6EA 1U7XA 2VTBB 2J09A 3LCJA 1VBMA 2RD2A 1X59A 2DJVA 1D2RA 3SZGA 2PZAA 2JAXA 1PG0A 3N8HA 1T6ZA 3SDBA 1M8KA 1OWPA 1Q15A 1WXGA 4ARCA 1H1TA 2LW7A 1U0BB 4MLPA 3G5AA 3COVA 3NBKA 1SURA 3MXTA 1NUPA 2A84A 4R2LA 1VL2A 1IFXA 3N2YA 1IQUA 3GUZA 1JGTA 1TYBE 2UXDO 1JILA 3Q10A 4BWVA 1OD6A 3MLBA 1X8XA 1O6BA 1R6XA 5BNZA 3CVYA 1TYDE 1OBCA 4NATA 3CLTC 4X62O 1GN8A 1F7VA 1WXIA 2CV0A 1YIAA 3ND7A 3P52A 1QU3A 2JANA 4MAFA 1IBMO 1RQGA 5LL6Y 1IRXA 3U1VA 3QTBA 4ZCTA 4NAUA 4GKJO 1YUNA 3Q12A 3SDLA 4RUKA 4JI4O 3OTWA 1OWLA 4DDMA 1N34O 3CLUD 3UMVA 1K97A 1O0BA 1JIIA 3MLAA 1AILA 3AG6A 1GAXA 1XMQO 1QRUA 2E89A 1Y42X 2CV1A 4EF6A 4A5UB 1U3CA 5LFAA 4MW1A 1WQ4A 3FDXA 3M8AA 1I2DA 1VBNA 1JEEA 2UXBO 4MW6A 1FKAO 1M8FA 3IMGA 1NURA 4YP7A 3A4IA 3L92A 4MUIA 4E1AA 3DLAA 4DR6O 1J1ZA 1K92A 3SYTA 4B3SO 5H16A 1M8PA 1F7UA 1OBHA 1N32O 3C8ZA 1FFYA 1EFPB 4JV5O 5AHWA 4LFCO 4AQYO 5BY1A 4HPWA 4X0EA 1M1ZA 5HG0A 4U63A 4OX9O 2AZXA 4QBTA 3TZLA 1JMVA 2QJOA 4CDNA 4OUDB 2N74A 1IQ0A 4PBRA 1PG2A 3RFFA 4MUHA 4LF5O 1KP2A 3FETA 1COZA 2CFOA 4PBSA 5DASA 5K0SA 1N77A 2HMAA 4X65O 4MUNA 4K0KO 1N2HA 4G5FA 2PZBA 1XNJA 2VTBA 3QE4A 1YULA 1QNFA 2C5SA 3COWA 5DEOA 4Q93A 1KR2A 2YY5A 1V47A 4JI1O 4ZCSA 4B3RO 3PNYA 4MWEA 1R6UA 4OPHA 3RT3C 1N75A 1O94C 1XNHA 1KORA 2Z09A 4MVYA 3IVCA 3ILVA 1V8FA 1XNRO 4MW7A 1EE1A 3CVVA 3ZJUA 1O95C 4MWBA 4XFDA 3BL5A 1FJGO 4MUGA 2UU9O 1WQ3A 1S4MA 2E0IA 1MAUA 1IBLO 2B7LA 5LMUO 3ZXIA 4MUJA 1YZBA 4R2MA 1KAMA 3PXUA 2UXCO 1QRSA 1FYDA 5JBNA 2J4DA 4B3MO 4DJAA 4JI0O 1QQTA 2IELA 3CLSC 1D2DA 2OV4A 4JYZA 4H3SA 2DXIA 3CLTD
chains in the Genus database with same CATH superfamily
1HQCA 3OIYA 2XUDA 4R2KA 4OL0A 3DLCA 3FM9A 4MMYB 3WRXC 4C4XA 5K8VA 3BJMA 4I5IA 4Z9FA 3LKDA 5L40A 4Y6LA 2WFLB 4O5OA 4IL6Z 3F96A 1Q90D 2DUUA 4HXYA 3CISA 4MS3B 4CVNA 2P6RA 1J21A 4KREA 4BTLA 2MCFA 4KYTA 3PFNA 2G38A 2C97A 1SCAA 4AJLA 2J07A 3L0BA 2W43A 1XLUA 1OJHA 3B3GA 4GZLA 1GN3A 2R751 1CE8B 1N6NA 3RYIA 3OESA 4BO5A 1CRZA 5FUYA 5EA2A 1QKKA 2PL5A 3V6MA 4C30A 3NVDA 1D04A 1NTOA 3PC3A 3EJ6A 1BS9A 2PY6A 5KX5A 5T6BA 2I65A 5JVDA 1P9RA 1VZ2A 4KXUA 1SG6A 2JRLA 4G65A 3ND6A 2M32A 1GITA 1VFPA 4WW0A 4CM1A 1MAAA 3ECSA 3L8MA 3WWPA 1NC3A 2PGNA 1NUHA 5B37A 1NTRA 4AQ7A 2PDAA 5CD9A 1M57B 2B36A 3SI7A 5KNCD 3GW8A 5LGNA 3EGWA 2FMKA 3COJA 2QTCA 1AJEA 1CZOA 3UT5B 1DGQA 3FPLA 2HN9A 5I7SA 4K9RA 4JLPA 3JALB 1PNVA 3NBMA 2F3PA 2I4MA 3PXEA 4MVCA 3KR9A 1HFEL 4CCSA 4GVPA 1F8YA 3ROEA 5E9WA 2OZEA 2ZS7A 3K0DA 1JLRA 4MDEA 5C7OO 4U2GA 1CG6A 2PSFA 4EH1A 4DNQA 2IU0A 1AP5A 5K0ZA 5KJEA 2OHXA 1DOAA 2O5RA 5FWNA 5EQTA 2HX1A 3W7AA 4KIFA 1BD4A 5E7QA 5I5GA 2ZEJA 1GG2A 1FXKA 3H9QA 1Z74A 5A4DA 2C88A 3CBQA 1WSBA 4M46A 1MQAA 1TUEB 3P9NA 2DECA 3RWRD 4EQ6A 1J2YA 2EX4A 1F38A 3DF7A 4NH0A 1N5JA 2O4UX 4OJQA 1T5OA 5DFAA 4BVLA 5CH8A 2DYRB 3OU2A 4I9FA 1Q3EA 2HTFA 1TVEA 3BJRA 5F4ZA 1TT5B 4W5TA 1TZJA 2E3CA 4DWJA 1E1RD 1FTNA 3NV9A 4QQFA 4R71A 2GLUA 4X92A 1T36A 3KEMA 2F3QA 1SA0B 1GUDA 3T1OA 1KEKA 1IB0A 3ZZTA 1HUQA 3A26A 2WF5A 4QRDA 3U3ZA 4UCOA 1YE5A 5LB2A 3H17A 5EEGA 2C7PA 2REXB 5FBLB 1J0CA 2DWUA 4RKRA 5DOZA 1E3IA 1VIVA 2WJGA 1Z5VA 3E86A 3D36A 4W7IA 1N36O 2DCUA 4R2JA 1U1IA 4BNGA 1Z8DA 3EA0A 3LC7O 1XAJA 4EPTA 2Q8VA 1KYYA 1IM8A 4WVFA 4BWVA 4WZBE 4XGNA 4BLUA 1DAGA 4PLWA 3DMDA 3VC1A 4R2XA 3USCS 1EU1A 2Z95A 4XUDA 2H51A 2RIPA 2VJKA 2VAVA 3TUZC 4W6QA 2Z8YM 3KLPX 4ZJUA 3BIWA 2D1YA 1M8PA 1RJFA 3STHA 5BUZA 3S3WA 3SIXA 1XZ8A 2NZUG 4N12A 1JDSA 1UQRA 4C2TA 1CBUA 2E3JA 3DXFA 3RF6A 2P9HA 5EPOA 4TTSA 5JSKA 1UBFA 3D7KA 3ZWVA 4WA7A 1W0KG 2GBOA 5EZSA 4NMHA 1CR6A 5FEUA 1XL6A 4AMVA 3NAZA 3LIPA 5H3CA 1QSGA 5KAFZ 2BBTA 1O87A 1EE1A 3CUYA 3TW4A 4IVQA 3CX6A 5LMUO 4WKCA 4MVJP 5DX8A 2YWXA 5AKLA 2X2EA 4E22A 3G2NA 3EGXB 2CLOB 5HF6A 2NZVG 4OXQA 3V8EA 2RJNA 5SICE 4A73A 4HTFB 2JJ2G 1NXVA 4FLZA 1OHHG 2ASVA 2V6MA 2BTQB 1SC3A 3UHJA 3M9LA 3M49A 4B8YA 3O7MA 2E4UA 1VKZA 2XEDA 2L42A 1B0ZA 5CW2A 3CUTA 2CFIA 3UCEA 2LUOA 4F2WA 1OLSB 3AUYA 4M0CA 5ALFA 1B6RA 3RYFB 4BN0A 1ECJA 521PA 1Y5LA 1NRIA 3SFTA 4ND4A 3I23A 4QEDA 1P1BA 2J0EA 1AROP 3EIHA 3H9CA 5GVRA 1QHGA 1JH9A 4FB5A 1UINA 4FK8A 3NC1C 3BMOA 4ZYVA 3K79A 3MIZA 1VGRA 1QV9A 2RG1A 4WEQA 3HCNA 3BS4A 4Y6PA 1W48A 4X20A 2J9RA 2IWRA 2QMEA 1GGMA 3FDIA 2XOKG 4M9ZA 3M5WA 2GDJA 3WTBA 4XLTA 3KFXA 4EY7A 2ORVA 2BGNA 5T5QA 1I7NA 3OX1A 2OFOA 5EJFA 2IH4A 5KIAA 1YCGA 1ZXLA 4PQGA 1XXHA 1U7DA 2B1RA 5CT9A 1E0KA 3FB5C 3QXSA 5KI6A 4AJ4A 8AT1A 4B7AA 1M34E 4ERXA 1GG5A 1XRQA 5ADWA 4ZO6A 1LK0A 2LP4Y 4K6HA 1W47A 1EJ0A 4MRSA 4BQSA 1Y74A 1R16A 2G82A 1U7TA 4DLNA 2R8PA 4FCWA 1WIWA 1NASA 4C4OA 2NSJA 2EBUA 3LC1O 1VP3A 2WILA 1TYAE 2BFNA 1GDTA 3CP1A 1CHDA 1GO2A 4NCIA 2OV1A 1W8DA 3SG0A 5DJ5A 3OEEA 3SBDA 3WKBA 2X19A 2ZDIA 4MGYR 1CUWA 3K9GA 3RROA 4KN6A 3V46A 1WXEA 2C3MA 2AOVA 1RM5A 4AP5A 3K2QA 5IVPA 2B30A 4OUKX 4PX5A 5DBOA 2IPAB 1P75A 2XYVA 1Z6XA 3TLZA 4KNWA 4AVYA 2AGAA 4Y1RA 3PX3A 3KYDB 2M6KA 2H11A 2KM1A 2CGNA 3DF9A 2RKOA 3A36A 5EIBC 4E1BA 3HKEA 3N0WA 3AEYA 1LEHA 1L4FA 1XD9A 1F5SA 2PZEA 4PIPA 2O9JA 3ZE7A 2FOIA 4YRBA 1OFIA 1DIOB 3RVRA 4DUGA 3GXOA 3NHMA 4UEWA 5F5NA 1FMJA 1LV8A 4LW8A 3PPWA 5C1IA 1ULHA 1G20B 3JSAA 4FVMA 1SZDA 4NB5A 2NT3A 2IBMA 4REOA 4BQEA 3B09A 5IULC 1QHHB 2BFFB 1VSBA 3DS8A 1NUTA 1SXJA 3R7WB 5ETJA 1PR3A 5I7VA 3UFBA 1P62B 5EP1A 2R7KA 3IA7A 3IQIX 4MCIA 1EI9A 3KZMA 3LWDA 4JR2A 3KTFA 3KSBC 4G37A 1PW5A 1VA4A 4ZEOA 1DJLA 4L0MA 2CV0A 2B78A 5CBGA 3SY8A 7MHTA 1E9RA 1CUAA 3R5XA 3MAQA 5HZHA 2EFJA 1ECBA 4Y2GA 2F43G 2Q3HA 2PD3A 4H1HA 5T8KA 5KLVH 1ODFA 3Q5EA 3H04A 2UZ0A 4EPVA 1RWMA 5D5QA 1BDHA 5CIQA 3TBKA 1H0HA 2WWGA 4LWQA 3E9EA 2PRIA 1XB2A 5J2TA 2HSDA 5CDSA 3C8ZA 3WGNA 4JV5O 3EZ2A 3T9EA 2P77A 4G0VA 1OUMA 4S1NA 2I55A 5FKJA 2H4XA 3L7AA 5LZ5A 1XWIA 4CTOA 4F0JA 1YULA 5BV2P 1QRRA 1AI6A 5JISA 2YY5A 3F8SA 4ZCSA 1XRSB 4F4IA 3K04A 2YIVX 2JAHA 3QUSA 3W1WA 3E9CA 1TZKA 4YMHA 3TDNA 5I7WA 4KXYA 4W9MC 4CLOA 2OOSA 4S3MA 1KQ3A 2HJVA 4MJ3A 1B04A 1Z6AA 4E5DA 2BSAA 4PDRA 3CMMA 4M0KA 4RZIA 2OOKA 5TS2A 4PG6A 1HRDA 4HDKA 3ZZUA 1O8BA 3NAQA 2IXBA 1LDGA 1QG0A 2YYAA 4L5IA 1QH0A 1EJBA 1M7BA 3A0RA 5TGTA 4FEEA 3ZDDA 5KU1A 3DBIA 1R9GA 3CIFA 2X0RA 4LWPA 5HKKA 1IBLB 4ZCPA 5KNDH 5TJ9A 4RH1A 2VWPA 1IN8A 3VR2D 2O2XA 3MMNA 2EL7A 3FIJA 5BQOA 3R7NA 3SX0A 3UWPA 5ALPA 2XITA 1PV0A 3NTRA 4G4SO 1EBOA 1DARA 2O4CA 4I5EA 3JATA 2HHCA 2PO5A 1SCQA 1E6CA 1OGYA 4LE0A 4D4GA 4V0ME 2DQKA 1UMDA 2QTAA 1P72A 4ALKA 5AXAA 4A6DA 4ZO8A 1LLUA 1TA8A 1Q0HA 3AR9A 4PA3A 2YXNA 3I1YA 5KAPA 4BAYA 2DQ0A 2BCGY 1U63A 4FPPA 2G5CA 4G81A 4OK3A 3QKRB 1F1JA 4DLKA 5SY6A 1AI4A 2F55A 2B98A 4DT1A 3L1JA 2QMOA 4LRYA 1DB3A 2Q3EA 3KAPA 4YQYA 4DQXA 1L5FA 4DDTA 4O2LA 2P3SA 3BQMB 5FLKA 4RULA 1G64A 1CZHA 4H7PA 2XIQA 2GEFA 1A4UA 1DQPA 2AMLA 3SC2B 1EQ2A 5AJTA 1UBRS 3NTXA 1HE4A 9LDBA 1ST3A 5EQDA 4OQXA 1Q21A 3U44B 3UH0A 2DOSA 4Y2YA 1OX4B 2HPAA 1NR1A 1UODA 3UANA 4UTNA 3VKHA 2O07A 9MHTA 1MD9A 1YZYA 1RLJA 2PS0A 2VPQA 3ZE1B 1Y4DE 5B7NA 2XRMA 3ICEA 3UIEA 3VYWA 1JVMA 1THZA 5E7MA 3IELA 3OMLA 5AK6A 1RMYA 5FOSA 2WY2D 2GAOA 1FAFA 2ONJA 4KL1A 4OTZA 5L53A 4YP6A 4Z8YA 4LJ8A 2Y1WA 3JQ9A 2WPDD 1JJFA 4PPQA 3QNEA 3WISA 2P9GA 2C96A 2I3GA 1EVIA 4TTRA 1ACJA 3K92A 2G5TA 3BE4A 2W8BA 3EPPA 3UKMA 3X2SA 5IDXA 3UICA 3PCRB 3AK1A 4DRXA 3W6OA 4P2BA 2IJKA 2XD4A 3AX6A 3IUNA 1SVKA 4DBVO 2EIMB 2XNDG 5HUHA 2PWYA 3ZLVA 4NK4A 4I6EA 4M7PA 2P4VA 4LZZA 2WAYA 2HPVA 2B3DA 1NDHA 4C4TA 2V4DA 3ODPA 4RJTA 2H2FA 5EE3A 1I14A 3BD8A 1C5KA 5BNZA 1L8LA 4IS2A 4H3KB 2X1VA 1TJ4A 4Y9RA 3CZMA 3KQKA 4AKIA 1CY4A 1S8NA 5KSWB 2A7WA 3EVZA 3HA7A 1T2EA 4K1XA 2CFSA 2X0IA 4ZCLA 4IYJA 2Z2IA 4FNAA 1RIFA 3AFGA 1J6UA 1ABEA 1T5EA 1VG8A 4GKKB 1T0IA 4TTAA 2XQKA 4RXMA 5C3MA 3M89A 5CH5A 3O90A 4QZVA 1KI1A 1FQKA 3CRMA 2ZGVA 1KRWA 1IK6A 1P1HA 4B3JA 1SERA 3VPBA 1Y76B 3WLEA 2HDNB 2IXDA 1S2MA 1A9OA 4YRJA 2F1KA 4KO2S 1UJ6A 5JNUA 4MVRA 3EIUA 2GHRA 4CV3A 5LGTA 3PWSA 1AQYA 3AV3A 4HQ0A 2C8KA 1LLFA 3K30A 2P41A 1CQPA 4NEQA 2JLVA 4BO4A 3QQPA 2WZDA 2NQ2C 2GS9A 2YQ4A 1O9GA 3AI3A 3A0HZ 1NONA 4EW1A 3ZU3A 3K6JA 4FE7A 2E1PA 1JXOA 5SZIA 3C1OA 5K3FA 5IDYA 5L3EA 3Q7IA 4HUQA 1Z5PA 3IUYA 1WPRA 5BOSB 5DU2A 2HHHO 3T9AA 4QDKA 3B6EA 2CE2X 1H8HD 1K5PA 4D6YA 3N53A 4A23A 2R5NA 4MK4A 2IIBA 1YC5A 2YY7A 2CNNA 3S1SA 2JAUA 1GU0A 2YW9A 4EG0A 1EBBA 4KE6A 3OF2A 5BW6B 4MTGA 1H2GA 5FJIA 5FBVB 3DMRA 4BVFA 3FOZA 1T2NA 3FN4A 1NJSA 1JIUA 4NBRA 3JQAD 3IURA 1N1DA 3KU4A 5KJFA 2DBVO 4KQHA 3CWQA 5HIMA 1UFIA 2QP9X 2CMKA 2ZDQA 1DHTA 3AUSA 2Y4UA 2ZCVA 4IKEA 4F5DA 5CDYA 5T6MA 2AUTA 2WNIA 1BXKA 2VLBA 2R7AA 5JJ5A 1HR0B 3MQ4A 3CPWU 3R0JA 5EINA 2QVCA 4ZVQA 4WLFA 1J2JA 2H48A 4LX0A 1DTWB 1UBUS 5H81A 3SYCA 1DADA 2YJ4A 1DC6A 3CH6A 1HYHA 4DF3A 1PFVA 1E2QA 3AHHA 4CEJA 2PUEA 4YQFA 1LX7A 3K8YA 1T3HA 2FUCA 4MIEA 5LQRA 4A2PA 3HLKA 4HC4A 3H8SA 4GM1A 4W4TA 3LRXA 2GRUA 2HZ7A 2IODA 4ZAGA 5CLJA 2RE8A 1KJZA 2ZSKA 2M1XA 4IDPA 3S81A 5L4LA 1UPAA 3SDZA 2O1WA 1T0UA 2FN4A 2IFTA 1T3TA 2IW1A 2JIZA 1SRRA 2RGUA 2O8CB 1MRSA 2O7QA 1PNOA 2O7SA 1TMYA 4BMDA 5JNWA 1HM5A 2Y0DA 1QZUA 2YUIA 3H9JA 4E09A 2C5EA 1YJXA 4QYMA 1SM4A 4KLNA 1R3UA 4C7UA 5A6SB 3P2EA 2D1TA 1ZVKA 1TF7A 3CUVA 3U5ZB 5A3JA 9GPBA 3EX7C 4GHWA 2DYSB 3DQZA 4MVJE 4MKXA 4ZVRA 4DW1A 4X85A 1Z5GA 1K9MW 2CVZA 4HL6A 4PXAA 1VJ0A 3OLQA 5DF1A 1T5BA 2HV9A 4L3WA 5IANA 1I7FA 3A6GA 4E12A 3CLHA 2HA0A 4UW9A 3BK1A 1VSQA 4X00A 2IHYA 2XKBA 2JIPA 2WP0A 3ZD7A 3VR3D 4ABTA 1P39A 1U7OA 2XODA 1ISSA 1Q7BA 1ABFA 3EXAA 2FX3A 5DBEX 4D3XA 3QQ5A 1MEJA 3GROA 2JAXA 5FOWA 4IIDA 4CI9A 1BN7A 4GR4A 5JTUA 5IJ9B 1GN4A 2O7NA 4OB6A 2HWYA 1MX5A 4DR4B 5HQTA 2AFHE 3LLCA 3DGFC 2Q45A 1SQVH 3O2NA 4JF3A 2ZYTX 3P30A 1ZVJA 1LCIA 4NPCA 4ND8B 2BHTA 4MP8A 5CURA 4WFAV 5CEFA 1N7JA 1JR3A 3HO6A 4WY5A 5BNIA 4AC9A 4C89A 1MU0A 2RK3A 3F6PA 1Z22A 2Q4DA 4JGGA 4CS2A 1VHQA 2GUWA 3ZRSA 1MB0A 2O6HA 1C1XA 4BLPA 1DTEA 3OUTA 2BEWA 1GPBA 2RBEA 5F1PA 3VC7A 3G2LA 1XRMA 4HCJA 1YDHA 3R5JA 1M2OB 2BEUB 4RTNA 3ZHTA 1Q5PA 4PG4A 2O2IA 4L3VA 1M5RA 4AX8A 4ZVLA 3OH8A 5HOQA 2ZR0A 2RKWA 3PX2A 3QPWA 1H2BA 3LCVB 1H9BA 2VRWA 3H84A 2BMWA 3AUUA 3WWEA 4OHPA 1Z4MA 1EGAA 3GVXA 2ZS9A 5CX4A 1L7AA 3KUUA 3PFIA 5CIWA 1IHPA 5H82A 3C74A 1Q3TA 5L3SA 4QREA 4QKQA 1Y3IA 1YTUA 3KK0A 2ZUFA 1WCIB 3E6AA 1DCKA 5D5PA 2GCOB 2AXPA 4N5HX 3TQFA 4D44A 3GB7C 3R5KA 4PZYA 2LDXA 1YTFD 1VE9A 1T9BA 1NQOA 5K3DA 4ZEVA 3T7IA 4EG4A 4X3OA 3MINA 2VEDA 3JWEA 4NR0A 1QUEA 4S1VA 5TT0A 4L4SA 2DKFA 1RZRD 2I2XB 4URFA 4H60A 3W7BA 3B51X 4YY3O 1N2ZA 1ZRHA 2IS6A 1D4ZA 4RGQA 4ZD6A 1BC5A 3FNBA 5AVOA 5E3JA 1RAHA 3L01A 5IJ0A 2B20A 5EXEA 4BMSA 2RC6A 3RVQA 3HRIA 3U9SA 1DL5A 2QWPB 2EG9A 4ARIA 2ZIAA 2GF9A 3L4KA 1STOA 5IEBA 4IOMA 1XWFA 3EZGA 3QW2A 2OCXA 3H1KH 2NVOA 2M6SA 5FPPA 1RKXA 4FN4A 2X1HA 4QNNA 5DVZA 4COOA 5KYXA 4L6IA 2V8OA 1GZVA 4FX2A 2R9IA 2NO0A 5J2UB 3GU3A 3ET5A 1I4WA 4P8RA 3PL1A 4XJSA 5L51A 1PD0A 1K8QA 3IQWA 2HJHA 3A1NA 4JI2B 4MUYA 1G2OA 5BWBA 1G21B 1CIJA 4QDJA 2C92A 3LT1A 4U2FA 1MJNA 3TWOA 3SHFA 1V1RA 4BIOA 4NXMB 1DPGA 2DR0A 3H42B 4DLXA 2BGTA 4G1VA 3CXRA 5U9CA 3REGA 4MW5A 5JYEA 4LF4B 2Q1XA 4XDKA 2HU7A 2MWMA 3T7EA 1E9VA 4RFSA 2GTSA 3I64A 3L40A 5YASA 2R2AA 3NEPX 3L84A 5CU7A 4J7XA 3HA3A 3JQRA 4QOFA 4JI5B 4BVBA 2HNBA 2D1QA 4Q16A 2XECA 3G9XA 4IEFB 1IAVA 1X7ZB 1W2BU 2N75A 3HJBA 4JVMA 3B9RA 3S28A 1UJNA 5B2FA 4DV0B 2EC5A 5JY6A 3NOXA 4HQRA 3M6XA 3RN4A 5G4KA 2QTGA 3QNMA 4BMZA 4UHJA 1JDBB 5ALSA 1T9AA 3DV0A 2JRCA 2V9ZA 1G8HA 2JATA 4Z1MA 3M6LA 1ZCJA 1JDUA 2VF8A 1XEFA 4UB8Z 5I7RA 3IGFA 3C97A 4LNHA 4F06A 2MW2B 1D7AA 3HGMA 1A8SA 4U6NA 3OFND 4AJEA 1O58A 3EY4A 1R5BA 2VZ8A 4KOEC 3WIOA 4II7A 1CR2A 4H15A 4B3DA 1MSWD 3UXYA 1QTIA 1WDMA 4FSHA 1TVMA 4PLCA 2NX2A 4BNDA 2ZYHA 1GG9A 1H0RA 5ILQA 4AIIA 4POAA 4F6RB 3STVA 5C8ZA 5EESA 5FA5A 3GOHA 1N6PA 3EGVA 3VAYA 4QASA 4CG2A 1Z16A 1QE5A 4QPKA 5BR8B 4AM8A 4JT9A 4BIIA 1SUEA 2DY0A 4CUKA 3SYTA 3KYIB 2JVJA 3KVVA 1AKVA 4TZKA 4YFYA 1YITV 1EFHA 4LFCO 4NBLA 3CLVA 4YRPA 2AJCA 2NZYA 2VIIA 1SKVA 4IXTA 1Y4MA 4RVHA 1TTPB 1P80A 3WMGA 1YGPA 4OHUA 1VI2A 2O5CA 1FXSA 5EVJA 2QSJA 1FP7A 5IWCA 1I5OA 3RADC 1HFKA 3DFIA 1OKKD 1R0KA 3TL2A 4JKIA 1QHEA 2VCYA 2H92A 2OORA 1QQTA 1MW8X 2ZI5A 1LBQA 2WW8A 2R4QA 4C0KA 2REQA 1M56C 4O08A 4PFJA 5FLXA 1JSZA 1Y8RA 3DDHA 1FEZA 4G5OA 1KYVA 4Z49A 4EELA 2PMEA 1C0KA 4DR2B 1P60A 2DW4A 4I9QA 2R7NA 3WLOA 2AF3C 3WYDA 5CX1A 3E61A 1BVYF 3IAEA 5TMPA 4TKMA 1VJ1A 3SJUA 5DGHA 2LDBA 4ZI7A 4MI3A 2YTZA 1WJGA 3LXRA 3KKNA 3OU6A 2MDTA 3JPWA 3II6X 2Z04A 2SBTA 1Z25A 2XUGA 3OOWA 3DMFA 2PLWA 2Q68A 2Y69C 3QKSB 2Z5GA 4U02A 2GHQA 2ZPAA 5HIKA 1V5FA 2AHYA 4JI6O 4ZAYA 4BQQA 1JZQA 2X6RA 4XDJA 2C4TA 2F8SA 1TJPB 1KU6A 1OZAA 3B8EA 2QI9F 1GCUA 4FONA 4D3FA 3ZN1A 2DFPA 3EVNA 3WIBA 2QEXV 2ZJ0A 2NU8A 3V80A 5BR4A 3KTAA 3VGJA 3T1HB 3WU2Z 1TKBA 2J30A 2QD2A 5BP7A 4JA0A 1CPYA 5F9HA 2ODMA 3VPDA 1V1JA 1F2UB 3MT8A 3Q4GA 2LXNA 2EIXA 5F51A 4A8JA 3PWKA 5CHEA 3ABMC 4P5DA 4ZJPA 3OJEA 2IHUA 3QF7A 1L7OA 2N9UA 4O3MA 3JWPA 3BICA 1WD7A 4XIYA 1ESZA 1SUFA 2C9CA 2YN0A 5J43A 2NZJA 2DHDA 2J0UA 4TX1A 4JTDB 4C3VA 2EKBA 1EE2A 2R87A 2L6LA 1XRRA 4AXBA 2K2WA 2BI7A 2DGDA 5H1YA 3Q7EA 1RQPA 1P3DA 4M60A 4RQBA 4WKNA 3U4MA 1SZTA 2BJVA 4LAFA 1FW6A 4DL9A 3LFHA 4YUVA 1Z62A 1IBKO 3S8EA 5DP1A 1U3UA 3ANYB 5BV1A 3W4JA 5KYNA 4L1KA 2DMXA 5KTMA 4UNPA 5HCIA 5DYGA 3TAUA 3FSGA 4D9HA 5LMCA 3N7AA 1Y4UA 3SDSA 5A5GA 1RCTE 4UCUA 1P2TA 3MFQA 3GLFE 2QY6A 2O59A 1NG9A 4DR2O 5CCEA 4MTOA 2EW8A 2SHKA 4Z99A 4FIZA 4LC1A 3K0GA 1SY7A 3Q7PA 4F3RA 3HB3B 3FWHA 4ZVMA 1L5KA 2JHCA 3QBDA 2AEJA 4OXIA 4DIFA 5CVVA 4I1YA 4NOLA 3OSUA 4HOYA 4BTVA 1R0WA 1SOVA 2TYSB 3LCRA 4OHOA 4GEKA 3H1HH 3T7RA 3RJZA 1HNZB 3TTYA 4EJSA 1XMOO 1X0XA 4FMTA 1P61B 4BPRA 1IXKA 2A0YA 4LC9A 5FT9A 4OLJA 1GPLA 3THRA 1WTCA 3F5MA 4MKIA 3OLWA 4O2BB 1ODTC 4BKMA 1L7QA 1XEXB 3E7DA 4DRYA 3TVDA 2A4KA 3JQGB 2HRZA 3F4BA 4X62O 621PA 4G2NA 5A4AA 4RKEA 2JANA 4MQLA 1VHJA 2GAFA 5FF9A 5IYZF 5ALJA 2QXTA 5B1IA 2VNAA 4PRLA 3TZHA 3U4QA 4EW6A 2VA8A 1CHNA 3OAAA 4NZZA 1TLFA 4DR6O 2J9YB 2IZ0A 5HKLA 3E8BA 2BISA 4D6PA 4PBRA 1FNSA 1UT8A 3IP3A 1ZL0A 1HRKA 3W3AH 4J16C 2I78A 4RJIA 4WF9V 1WVGA 2D2CB 2LW1A 4DQLA 5AVYA 1VYVA 4GDMA 1JPNA 3D3KA 3ZW8A 1YRLA 3LQ2A 1I4LD 4NYMR 1N4AA 2AFIB 3LV8A 4BBJA 5IK2A 4P32A 3SKXA 2B0JA 3ZHRA 2EBOA 1LK5A 3CBGA 1P2SA 3JQFA 3N3BC 2YVUA 4KIWA 4Y0VA 1VQ8V 5LHHA 1N2CA 2GJ4A 3FWNA 4J1TC 4HZGA 3TUIC 3IO5A 3R7SA 3PUYA 1ZK3A 4FZ5A 1U90A 4R7CA 2UVDA 4YDHB 2BR5A 4L9SA 2FPGA 2QZ4A 3R0ZA 3R09A 4MS2A 5I5EA 3T4PA 2CL6X 4BDSA 5LXTB 3TNLA 5IKXA 1NWHA 2QRQA 5WRFA 4EPRA 5A2QA 2VAPA 3LT0A 2Q8QA 2JFHA 1Y0BA 1AUVA 1YOBA 1AKUA 1NKTA 4E7OA 5LL6P 1HV8A 4RVUA 3HTXA 1FP2A 3QPAA 2JFPA 3R7AA 1XLTA 3HVRA 4IIVA 1K6EA 3R9IA 1JP7A 1AMUA 2O3UA 1UBNA 4EX6A 2CC2A 1MJFA 3V2IA 1NI8A 4TMKA 1QHXA 3VVMA 5LQKA 2RI6A 5HQJA 3DKVA 1UFVA 4WJLA 2JW5A 3WGMA 4QATA 4I1UA 4LY6A 5BWLA 2DJ5A 4ZDWA 3I6IA 1BSMA 1U8UA 3MUOA 3KBBA 3DCJA 3R0IA 4JC8A 2GZRA 4F4DA 2UZ4A 2WMDA 3S8YA 4LXUA 4QAJA 1FUYB 2PH3A 3BY6A 1S3IA 4GSYA 1MX9A 3QFRA 4MXDA 2ZIUB 1N6HA 1CWUA 1OT3A 1GM7A 3KHTA 4QUHA 1JDPA 2I2WA 3CEIA 2CXTA 1A97A 2ZXWB 2H52A 4EG5A 1V55C 3PA6A 4OK5A 5HKOA 2LD4A 3C6YA 2D2XA 2Y0EA 4UVGA 4CQMB 3TX2A 3V3TA 1YBAA 5G40A 3IP6A 1B6GA 4DIDA 4JN6B 3IQXA 2QWRB 5EJMA 4JT4A 1U4OA 2IBTA 3LUPA 2QVLA 1XLWA 4HGYA 2ZUDA 2Q3CA 3IB3A 3U4CA 4ZEXA 3P0IA 4MVXA 2CKDA 3VR4D 1G19A 2CLDX 3ZW7A 4E11A 5FL7G 1O4WA 5TF0A 2WI8A 1IU9A 4BE7B 4URXR 3QWBA 1W52X 1E2DA 4F4CA 3C4JA 2OZPA 4MW0A 1YDFA 4L3OA 3O8CA 3PUWA 4IXNA 1KSGA 5AJYA 5KYYB 1M0EA 2QT9A 2A9PA 4JGBA 1E1YA 1CUJA 2D5BA 1NS1A 2EW1A 2XMPA 4ECEA 4RTJA 2PYZA 5LBUA 1GKUB 1ACMA 1M2HA 2FCAA 4IKPA 2VNIA 2AZDA 3UCFA 4B2IA 5CK5A 1PJ4A 4BNWA 1SURA 4J0HA 4D0SA 4KLAA 2P65A 4UUOA 2RKBA 3DDNA 2Q7XA 5B3JA 1XQ1A 2A9VA 4XJVA 5D86A 3V8QA 4JLVA 1TIKA 3ZV4A 3S44A 1RPRA 3QWAA 3ER9A 1NF2A 1YB5A 1ZGJA 4LV5B 3PITA 3DOFA 1J1ZA 1P4GA 4F6LA 1N36B 4XCQA 3F6CA 2XZOA 1IJEA 4TM7A 2IC5A 2X5XA 1W581 4QICA 1Q0SA 3FPKA 1VLLA 4MJ7A 1IM5A 3HDJA 5C5EA 2Y1LA 1BGYH 3ENWA 1MVOA 1FJHA 1MXFA 1AS0A 4KJZA 4PLPA 5HUQA 2G9ZA 1WB9A 4MX8A 2IWHA 4DA9A 3BL5A 2F43B 4DMFA 1M1NB 4AG3A 1LDEA 5EZYB 3ROKA 1MIOA 3N8KA 4Q34A 1L6IA 4BLTA 4JYZA 1E3WA 1ZAKA 3JPYA 2VDOB 2UYOA 1B3BA 3CEAA 1QMPA 1NR5A 3C4QA 1JPVA 3VDXA 1QOPB 4ID3A 3DYBA 1I6MA 3LTEA 3QUBA 3R5TA 1V25A 3VAAA 1M1YA 3LFUA 4KRYA 1O77A 4FSDA 1Z5NA 2KKWA 4F97A 4WLEA 3KVYA 1OI4A 2EERA 5AICA 3QI2A 3IMCA 1WDKA 5LMUB 1E6LA 1CY7A 2P75A 5FBQB 1KDYA 1ZRNA 3D3NA 3CURA 4FCTA 1FUKA 4G84A 1JQBA 4XVQA 1UC4B 2RHGB 4GLBA 2ZXFA 3PQFA 2HSJA 2VZEA 4R9UC 3IDZA 4LZJA 4NYKA 3FZYA 4HFJA 3CG4A 1F48A 2OZVA 3DAYA 4TZTA 5HTOA 2DRIA 4EO9A 4RD3A 5KAIZ 1ORWA 3GUHA 5FUQA 3AL2A 4Y1EA 2LNDA 1V9PA 2FFJA 2BAGA 1F5NA 1I2BA 3GLIE 4FLWA 3ICWA 1LS6A 5AI8A 1G0OA 1V5IA 1XHLA 4UMFA 2ZR2A 2BE7A 3CZAA 2VS0A 5EOVA 3RGWS 5IBQA 1PGJA 4IGGA 2OCAA 2P3LA 2QTVA 3OICA 3LDHA 2XA1A 4ZVPA 3KX2A 3M70A 4QGSA 1N9KA 2IYAA 2QRHA 1JR9A 4QTTB 5T4FA 4PZ0A 3EVGA 3WZ2A 1JIKA 4MICA 3LQ4A 4MKFA 3HWRA 1VQ6V 3AP1A 4ZYWA 4RMGA 1BKDR 3Q15C 3GG9A 2BFCB 3WJ1A 4XPIB 3D8BA 3W5SA 1MP0A 1TD1A 4IZOA 4HDNA 1HNNA 4Z9XA 3A1CA 1AKNA 3O03A 3F3KA 1NI4A 3T06B 4ZVSA 1R73A 1W2WB 2E5WA 3DT6A 2Q5HA 4N4AA 4NNJA 4BFTA 1OIWA 4X7PA 4E4TA 4R4JA 3WDKA 3DBRA 3L0YA 5JJLA 2DTEA 1AHIA 1ODLA 3Q11A 3A58B 3UTDA 2R00C 3ROTA 4PHGA 1UKYA 3QA9A 4FM0A 3CUSA 1E9BA 4HAZA 1JTFA 5FYQA 3HFJA 4KBGA 1PSDA 2HQRA 3GGSA 3RQIA 1S0UA 3LWNA 3AF2A 1E79D 1G9XA 2CMDA 4RKQA 4N7RA 4IXMA 1QCEA 3OM3B 1GTL1 5DW3A 4CMJA 1L4GA 1W5TA 5DMHA 5A4MS 3B20A 3OZIA 1WWKA 3QK7A 3AF1A 5JH7B 3GXBA 3ANXA 1Y48E 3KJEA 1EDOA 5DM60 3AMVA 1GTOA 4RKYA 4EZBA 2Q9CA 3VHRA 2GARA 4WOJA 3G8YA 5G4LA 5H3LA 4FFVA 2OCYC 1VIMA 5JNTA 4ZPJA 4GS5A 1JQJC 4NQZA 2IEBA 5CLGA 5JC8A 4TTPA 3MWDB 1F8XA 4K35A 1U5BA 4QHYA 3JASB 2R1VA 2FMHA 4P4UA 1LZKA 2UZ3A 2C59A 4LZPA 5COBA 4RFLA 4F1WA 1GA6A 5JEEA 2XEXA 1OCEA 4IMRA 1FFAA 1SETA 4XQ9A 3SF8B 2Y27A 5MN4A 4JBYA 4CV1A 2X23A 3EUEA 5JFGA 5HGXA 3THSA 3IUJA 1Q7EA 2XMZA 3OO0A 2JBAA 1XTVA 1H2MA 1K66A 5K4GA 4KN8A 2COUA 4KQIA 1SBQA 5K99A 1GQYA 3FPGA 1WW2A 1EPUA 3MGAA 4PIVA 5ALIA 2N47A 2GTPA 3KOXA 3L8YA 4UCQA 1ISJA 3GCZA 5A62A 2XMGA 3O8OA 1NY5A 4L72A 1MTZA 3GHYA 1ZWLA 1QYVA 2AOTB 1XZKA 3I0NA 4JQZA 1A5TA 3RODA 2OV6A 1RP7A 2R8RA 2YMQA 3VDRA 5BQFA 1RQ7A 3EQZA 3A9SA 3OT5A 3FHOA 1YJWV 3V34A 4JV5B 1SKBA 3G9QA 1GMGA 2R1TB 1AVTA 2E7ZA 3RKUA 4FOTA 4H7HA 1WPGA 1JFTA 3I42A 3NWPA 1ZNQO 1NXOA 3R74A 1E3EA 4RV4A 3G0OA 3AJAA 1GL7A 2QJTA 4HWSA 4L9AA 3H7IA 1E20A 2BLLA 1TRKA 2AX4A 4NJOA 2HQBA 3KDAA 3NHJA 2G28A 1HYQA 5K6RA 3A6PC 1JBQA 1KQNA 5JAMA 4OP3A 1DKNA 1E2EA 3C39A 1T3ZA 1LC3A 2EWMA 2PZKA 1U96A 1YQTA 1LI4A 1KKUA 3IP1A 4BNXA 4TZ6A 1MX1A 1CUYA 4M98A 3MMPA 3FNQA 4CCYA 3GJQA 1OLOA 2RBGA 1A8IA 3OEHA 4MV1A 1KB9F 4G8CA 5AVTA 4IIUA 4G5HA 1MB9A 4OLAA 1YVPA 3QYPA 1ZUNB 4KPUB 2ALJA 4YJ2A 4YMLA 3BWBA 3KKMA 3S2EA 5FTJA 4N21A 2ZWAA 4BLOA 3V8BA 2P2SA 5F4BA 3TGWA 2IGTA 4KXQA 5EIAA 1XZGA 2ODEA 2J5BA 1TU3A 3CYOA 3CW2A 1EIWA 4UXNA 1A8QA 1HOXA 1OT5A 4GW3A 4B40A 4G1UC 4TXNA 2IK8A 3KJFA 3C6KA 1A8PA 5A7FA 2JCYA 4BQPA 4EBFA 5FNVB 4KO1S 3D43A 4NBVA 3V1TC 2Q2WA 3EXHA 3LVBA 3RW0A 1JJ7A 4ZYUA 4NCNA 2D3WA 4HNSA 2CZGA 2EZTA 1G6OA 3HB5X 4Z5XA 2OMEA 5CBPB 2VDJA 4NMXB 1D2AA 2Y4TA 4I99A 1KJWA 1H1DA 3TXQA 3CCLV 1FXWA 5IYCO 2ZCUA 2HLDA 4ITVA 1CIVA 1LI7A 4ND6A 4M1KA 4E30A 5KYTA 1N0NA 3IAHA 1GUFA 2EF0A 2PGXA 5FXMA 2QU8A 1ESEA 1BEEA 4Q37A 3Q3GE 3H7AA 1BHJA 4CF4A 1H0SA 2H5LA 2YC0A 1H2WA 2JLQA 3X44A 1T34A 3PKIA 2C5HA 4DZRA 4TLCA 4C5CA 4KP4A 1ZBDA 1B6SA 2H59A 3KJZA 3TZBA 1KRXA 2XZDA 3F4LA 1R27A 3Q3CA 4HAUA 5DBGA 4P54A 2QLBA 3WSTA 2VDKB 2PYLA 1B2RA 3B1YA 5JG7A 4K03A 4CQLB 3IDFA 1KFJB 4OGKA 3DMHA 4X8OA 3SR3A 2YWRA 5AKYA 5BRJA 3GF4A 4ILEA 1RIIA 2HBQA 1V1MA 2VH5R 4XUCA 2AG1A 3EA4A 3HKCB 4IYIA 4L6CA 4MSUA 1T0JB 5CXXA 2YZGA 1E4YA 5GJCA 1XLVA 1II8B 2X6BA 4BXOB 2RSLA 2B82A 1P45A 5LOVB 1FNCA 2VRBA 3K1AB 1MC4A 3IERA 1DX6A 5F7XA 1VQMV 2VQ3A 3COVA 4RQTA 1SC9A 1C9YA 3H5WA 3ESRA 5EMNA 1DIGA 1PE0A 3F74A 1WXIA 3HN2A 1W0JG 2ZREA 2LKCA 1AMOA 4MGKR 3Q5GA 4GP7A 4OD0A 2F3TA 3EA5A 3Q41A 1OWLA 1RBZA 2I34A 1WZIA 4CUZA 3VR4H 5FORA 4TPKA 5ALOA 1GSHA 4DBLC 1KKCA 1ONSA 4QT0A 4NHEA 3S1LA 1NV8A 1O5IA 3UN1A 1PGNA 1RE0A 1PU2A 3NETA 1FZQA 1QLEB 4U63A 4PIMA 2A0FA 4QBTA 2QJOA 2XNHA 2W0MA 3VO2A 4HNAA 3KXDA 4BP3A 3RKRA 1NYRA 1XJCA 2RGBA 5DN6D 1XDCA 5LNK1 3CB2A 4E3WA 4J9UE 2XDAA 4QXAA 4MPDA 3HDQA 3THXA 5HE8A 1B74A 1OXSC 2Y9PB 2V59A 3L6EA 1SUBA 1LBHA 3P71T 5DNCA 2JJ1D 4FTWA 3OBIA 1EKXA 1HMYA 4KQXA 4ZKDA 2ZWOA 1ICEA 3OJLA 3QVJA 4QOEA 3AEUA 3SSOA 5KQGA 5HPYB 4FE4A 1K6MA 1O2DA 3MS2A 3OJWA 3FMPB 4EGJA 1J24A 5LR6A 4O4IA 1NNSA 1NBME 2O8BA 4TMVA 5IAJA 5BNTA 1T4CA 3E1GA 2V7QG 1HKHA 4Z4CA 3QH4A 5F1YA 1S5HC 2D5LA 2E18A 2Z2ZA 1CDEA 2OYQA 2DPLA 5JNRA 3AG2B 1NVDA 1J7KA 1G2QA 5HF5A 3H6HA 4R54A 2PXHA 5BYKA 5BORA 5KNCH 1WUYA 5I7AA 2HHHB 5EXPA 4AWAA 3EPRA 4OM8A 4RZSA 3I2HA 1GRCA 1TCCA 2ZJ8A 3PNOA 2IJGX 1OH6A 3UK6A 1U9IA 3W5CA 2HLNA 1JQ3A 3H18A 1L3IA 4WUVA 2M6YA 4WESB 2LGWA 4UCXA 3QFHA 3LY7A 3NOQA 4JJ7A 4MEAA 2OWEA 1BCSB 3MPOA 1JQDA 4IMIB 3WYBA 3KT8A 2R8OA 5LZ8A 4ICIA 1Q22A 1TK2A 1M33A 4IDCA 5E4JA 2QUJA 1LTKA 2G40A 5DT9A 2VP0A 4L27A 2P0YA 4X7MA 5JWOA 4AO7A 1U7ZA 4R16A 3L0DA 1DXHA 1XAGA 4ZK2A 1XQVA 4Z4IA 3ICOA 1ZK1A 1KMQA 1ADGA 2GPWA 1BW9B 1KKLA 2PZSA 3P3NA 3HYSA 2HMUA 2PU7A 4B3RB 1VIAA 3VA7A 4E4EA 4M99A 2O0MA 3K9WA 4WFFA 3LYLA 4J6EA 4HSEA 1I10A 4DMCA 3WNZA 3LDCA 1W4RA 3OQ1A 4RESA 2D4AA 2A5LA 5JAIA 2XYRA 2VK8A 1M6VB 3IODA 2M9MA 3FUVA 2Y1KA 3A25A 2GKSA 4C9BA 1K6XA 1UCFA 5C7YA 3K9LA 1LR1A 3OCVA 1SIWA 2FMUA 1X87A 1L8QA 1DKMA 2J08A 1DWUA 2W4MA 4ES6A 2C2AA 1V3QE 1ZOSA 3R6LA 2VP9A 4GZRB 2XOXA 1BKYA 4C2UA 1VARA 1Z28A 3FXAA 1NN0A 3R5HA 4AMGA 6AT1A 1KAOA 1JQLB 3FPFA 3IRVA 4MPRA 1POWA 2ECQA 3FCEA 1HDOA 3K06A 5K3OA 2FPPB 5CGZA 2NUTB 2IDJA 5EKXA 5EKTA 3JD4A 3OPYB 4FLVA 3ZVRA 1KNXA 3RSHA 3AI2A 4ZYLA 4CMKA 1N2OA 5JDIA 1E1MA 1SULA 1TFUA 3L77A 2XJ4A 5CA3A 5TEWA 2IV2X 3U10A 1J0XO 1N5OX 1UFRA 1Z88A 1U99A 1JEYB 4OHVA 1KH3A 1S9DA 3KXKA 4Q47A 4Y2VA 4HR7A 4H27A 3FB1A 4QEKA 1V8BA 2QG4A 1NV9A 4Z54A 1T2DA 2LW7A 5I6DA 5JARA 3U39A 3QVGA 3T3DA 4Q9JA 2UVPA 4LHZA 2WF7A 4N23A 2H4WA 2UYCA 1MB3A 3A9CA 3D7SA 3DYVA 2GVNA 2UUOA 4WHMA 4CWAA 1YR8A 4P35A 1BXRA 3RC8A 3EXG1 5C1PA 2HQ1A 4C3ZA 2W7TA 4LY0A 3KR1A 1QIMA 4MW1A 2IJIA 3QOWA 1CRWG 4A0QA 1ZWKA 3Q88A 4YT8A 1L5GB 1ZX3A 3QBJA 1P3Y1 5JJBA 4E1AA 4I9WA 2UYYA 1HT3A 4IICA 3HS3A 1THGA 1DAEA 3W05A 5LDHA 2WWYA 2AN5A 1ETUA 4Q4AB 4Z1MD 3GMSA 4X97A 2IEZA 2B21A 2AZ4A 4EMUA 4H7JA 4EMBA 4QM6A 4HDMB 4JI1O 1QVWA 4Z3KA 4B3RO 2Z3ZA 5AI5A 4BNTA 4QSMA 1NZFA 3MCZA 3ZJ5A 1I30A 4TLLB 1ISMA 3KLBA 3K15A 1HC7A 1SOMA 1XZMA 3LQQA 3OZTA 3AVTA 4Y67A 3A10A 3X2QC 4OMUA 5CFPA 4KFTA 3M9XA 4N5DA 3RFVA 1U6JA 1FFEA 1WF3A 3VAZA 4IWYA 3G59A 1GNLA 4N54A 4I55B 4I19A 1U7UA 3AF4A 1ZD1A 3FLEA 5A5DA 2WLIA 5IAEA 3KJGA 2C83A 4RTOA 1P2VA 3IEIA 4REQA 5K2OA 1OE0A 3ZWCA 4NE7A 5JD5A 2R8ZA 2PFKA 3W6UA 1IN7A 2AFHB 4DDUA 4DCVA 3P0JA 1DBPA 2G4LA 4C7XA 2YZ7A 1UFOA 3CZ4A 4DTCA 4DSUA 3BK2A 1YL5A 3ONNA 2QX6A 5T3YA 1ECPA 4KI7A 5CDFA 2G4VA 3HO8A 1JXQA 3GFBA 3LSTA 1OWNA 3PHGA 4YCNA 4P36A 4CG1A 3ZRVA 3V7WA 2WPNA 2GYWA 3FWPA 4PSUA 5EWMA 4R69A 3NHPA 3CC8A 4MJXA 3NM6B 1DUSA 2QM7A 4DUYO 4I4TB 2VYVD 2H9IA 3WKCA 3HBFA 1PSWA 1R5JA 3DVAA 1OCOB 4N9QA 1KEEB 1I0HA 1ZN9A 1P2BA 2KJQA 5AVUA 4AURA 3PUZA 5HFLA 2GPSA 1VQOV 4LXQA 3B7WA 3CVWA 4L2IB 3ISVA 1NMSA 1QFMA 3MTBA 2QWQB 4YY3B 1RWBA 1NX9A 4N41A 4EKEA 1GNRA 4DC0A 3PEFA 5FI5A 3AG1C 3HI6A 1QLJA 1YJBA 4O2RA 4FNOA 2LKDA 3I73A 5FLYA 1M0TA 4PHHA 1LQ2A 3U9LA 1J2UA 4YMIA 3B40A 2GDSA 4GOMD 3T8YA 1O96A 3WADA 4M8LA 3MCTA 3CW9A 5J2UF 1T24A 1GSAA 3LDGA 3IH5A 1ZCFA 3FNHA 3JWIA 2CH7B 2FHSA 3MD9A 3WK5A 2QMYA 1GTRA 5DM6V 4MV5A 1JE0A 2W37A 1OVMA 4CKEB 2PRJA 1Z5OA 3HJGA 2FHPA 4NU0A 4R2IA 5G3YA 4NH4A 2FFQA 4EYOA 1WEHA 1YRBA 3KKLA 2OO7A 1OCZC 5IAAA 3F5TA 3ZDAA 3WVNA 4NJMA 4HLUA 3CJTA 2WMYA 4BYMA 5K4HA 3O8QA 4RKFA 3HZHA 4FW9A 5BVHB 4IVNA 1JQ5A 1Y9EA 1DLBA 3DOUA 1CQIA 2Y2VA 3OCUA 3MJVA 4MR7A 1I08A 4ARBA 3CPJB 3BWVA 3I5MA 1OREA 2H29A 4PRYA 5SYNA 4JLSA 1E9EA 3I5YA 3VUEA 2QMZA 3GFOA 1ZLZA 1X59A 2AQKA 3HLTA 3FSGD 3PTAA 3MWKA 3EZLA 4Q12A 1N57A 1G4HA 1RZ3A 3EAQA 4QBGB 1KJJA 1Y3DE 4PWZA 3O21A 3PDUA 1LNSA 4MVMA 5T8KC 1KJ9A 3KSDO 4Q4DA 3ZWBA 3TW8A 4MWTA 3SICE 2I8AA 3OW2U 1IY2A 3FPSA 4IILA 1O9BA 3ZHOA 3AK4A 4PZUA 2JBWA 2CJWA 5JZBA 2VDNB 3PF8A 4HQNA 4BN5A 3LP8A 4QFBA 1JA9A 5M04A 1QHSA 3KEFA 4RANA 4OHRA 1Q74A 3U4IA 2W6QA 3JQ8B 4WFIA 1UFQA 5JXHA 3D02A 3VSCA 1Z12A 5BQ3A 3T4XA 1A2QA 3E03A 5HDBB 2AE1A 1X7GA 4QQRA 5DWVA 4GGMX 3CC4V 3EFEA 3ZXIA 3O3OB 6ADHA 4EKNB 5REQA 3CC7V 3DLTA 1KBOA 3VU8A 2Y3IA 2X5KO 3SJ7A 3TGPA 1MHTA 2ZZNA 2O52A 5DNDA 5I4KA 1DBWA 3F1LA 4LFCB 1NAHA 3IHWA 2UDPA 4R3WA 3TTWA 3OUUA 4DM7A 4UNQA 1M5IA 1W0CA 1KR5A 1ENOA 1QFSA 1AUQA 4NIMA 2QTLA 3W8NA 5C1OA 4OUDA 4FLMA 5FWXB 4WNYA 1GJRA 2G0NA 4YCCA 3RRBA 5JNSA 3KB6A 3D7RA 3VNQA 1PCXA 3OR6C 3W2IA 3K09C 2P22C 3R7FA 4JS0A 4GBJA 5G41A 4RK0A 4F3KA 2HEGA 4EA8A 1D6SA 2AXNA 2WU8A 4EOGA 2QENA 3QVWA 3IAYA 1QG2A 4M3NA 1ZISA 2FZLA 5CDUA 4DLYA 3IJPA 2QL6A 2FZVA 1UQUA 5LP6B 1QJCA 1BT8A 3E0QA 2ESRA 4CEHA 1BH6A 1AUPA 4XGKA 3A0UA 4GUNA 1JEOA 3ETQA 4ZJZA 5G3ZA 4NCXA 1H2LA 1A9TA 3O1HB 1NQ5A 4RL6A 1SUIA 2CK3A 3OZCA 1WHSB 3M83A 1MDBA 4FUTA 3E35A 3A70A 4NOKA 4JI6B 2ENWA 3SZOA 4IUCS 1TC2A 2VPWA 1UMBA 2P6OA 4YPVA 1AT1A 4YA6A 4GI2A 3OF3A 1XL4A 3MSCA 1OZFA 2GCPA 5C32A 3PDHA 5FYDA 1VFNA 2Q6OA 2I1LA 5KNLA 4ZICA 2EZPA 1CEYA 2REBA 1SQ6A 3EIWA 3AIOA 4MVJG 1E61A 4MQEA 3CKLA 1E1QD 4HMOA 1USUA 2PRKA 3CN9A 2QUHA 3SC3A 2PUVA 1I13A 2GPJA 4C7OA 3LNTA 1W4AA 3JR7A 3X1WA 4H0LB 4DIEA 4EB6B 3A2FA 4CI0B 5HNKA 5AXCA 3WIUA 5JS8A 1UJCA 1D09A 4D4KA 2VF5X 3I34X 3QOXA 2JA1A 4CG3A 3ZKWB 4RWEA 1VDZA 4EENA 2R8YA 1WLYA 3OM9A 4UNRA 2Y1EA 1GUZA 4W9NC 3LX6A 4IIJB 1IBKB 4TV8B 1LF5A 2Z0MA 3WB0A 1N5MA 1U3WA 5CAEB 2EFDB 3JRWA 4OAPA 2XW6A 4ZRNA 5GOZA 2O2DA 4KWIA 4ILKA 2FWPA 2J9XB 3CVUA 2IYXA 3L4EA 3ZGNA 5B3SB 1QB7A 1UWVA 2RD2A 2G5GX 2WTEA 4UDXX 2WJPA 3GRZA 2GFHA 1JG7A 4UHFA 1KDPA 2CJYA 3KQNA 2K4MA 4DA8A 2DCMA 5FA6A 1XDBA 2A8YA 3PGJA 5M34A 2BZSA 1D2HA 1PIWA 4PC3A 1GAXA 4O2BF 5BR7A 4AZ0B 3BAFA 1XMOB 3V1KA 5I9IA 5B58C 2NSLA 3U2QA 1NN1A 2Y0PA 2DPYA 2ATIA 1Q0PA 4QXRA 4PYLA 3EQ9A 4R5HA 5DULA 3GLFB 1IXBA 4D9GA 3WE7A 3LO8A 4LOAA 3Q3HA 2W6PA 1KR2A 4X62B 5JECA 4RL4A 1S4QA 3VI3B 1SUDA 6PFKA 2ZD9A 3CCUV 2F8LA 2NU7B 1FDRA 5J1TB 4HB2A 2X13A 2QIPA 5B5EZ 1DAOA 1CB7A 3KJNA 1Q17A 3ICQB 5EJAA 1G2PA 1IB6A 3W7WA 2ZJ6A 1TJ3A 4DR6B 4PTZA 2YIDA 2XHZA 4PFSA 4Q20A 3E8GA 1AX9A 3MHHC 4G26A 5ES3A 2BUBA 3BTVA 4M1MA 3OIWA 5T64A 4WCFC 3ZDQA 821PA 2JAWA 4GXTA 1N5LA 3ZUGA 1ZH2A 3EYWA 1FDVA 2XCIA 3MB5A 4JJ6A 4UULA 1X8JA 4QPNA 1Y63A 3T9BA 2WB4A 4LN1A 4LK2A 2O2SA 3GEPA 3TLJA 3EMDA 3PXDA 4BCDA 4P38A 4XM0A 5CNKA 3QVXA 2HZBA 3A1TA 1OB2A 4MV0A 1ZK4A 3GJRA 3JVDA 4GNRA 4HVAA 4JKYA 1MOPA 1IPFA 2OSVA 2JGIA 2FZKA 4GPD1 2HEIA 4H44B 2EFCB 3STWA 4KRXA 3GT4A 1I94O 5LXTF 4OGWA 3ONWA 1U11A 2WM9B 2IKSA 4GOND 5KYGA 1NF3A 4HJXA 3ZBUA 2YMPA 3AM3A 3D8NA 1J56A 5JADA 1WDLA 4Q1EA 1V8ZA 3SJCC 1NI3A 1UEXC 1GTG1 5IJWA 1GRQA 4KUMA 1RD4A 1YS2X 5J23A 2CYCA 1CQZA 3K0KA 4URHA 4F2DA 3THYA 1IUKA 3WBKA 1VE7A 3OETA 2IZ6A 1WMBA 2FPSA 3JQ6A 3G8CA 2ZB3A 4DK0A 4FOSA 2J48A 1KO7A 3O8RA 1DQRA 1NQWA 3WQHA 1YQWA 3Q3IA 3IPLA 1V96A 5HFAA 1ZH8A 3LLSA 2Y2UA 3JQCA 2D8AA 3BGOS 4DJTA 4Z4GA 5A4IS 4ER0A 4Y1FA 2MMGA 5JWHA 1M2VB 4RM3A 3ZD6A 3Q7QA 3RUEA 3AGQA 1YQEA 1ZSYA 1A9SA 1T8TA 4OJMX 1VQ7V 3ZWXA 4EY4A 3ZS8A 5IVHA 3AF3A 2Y1OA 3RSLA 3ADBA 3VU3A 3FFTA 4XWKA 4LDJA 2I7DA 2ZIEA 4LYHA 3D6MA 2XKKA 5BWNA 1AQNA 2PX0A 2G8NA 2JGRA 4LCEA 5P21A 2F9FA 1RKQA 4RETA 1JH8A 1IEVA 5L7YA 4RD4A 2JS5A 2X40A 4F12A 1H6BA 3H2GA 4HYTA 4U7PB 1L5HA 2PYDA 4P3OA 2X0DA 4LECA 3SHWA 4LOHA 4YIKA 1B0UA 4HS4A 1R4ZA 3VI4B 1RYNA 2IPMA 3L0IB 2HHJA 4RDIA 5H3HA 4LKOA 3IAAA 4AHCA 3WHLA 5B1YA 4LXYA 1XQWA 3FWZA 2HIHA 2UKDA 2PBZA 2HREA 2IUEA 2WC1A 4N3CA 4LWSA 1J4AA 3PDJA 3E3AA 2H3OA 3D8RA 5LYJA 2ITDC 3KB1A 4PGAA 1AO3A 3TS1A 3ZV6A 3PC8A 3LA6A 1EE9A 3WG7B 3AEQB 1GGVA 2OIEA 2ODNA 2QE7A 2QORA 3F8TA 5FUBA 1G7CA 3IDQA 3Q7SA 2VJMB 5DXJA 2EILB 4B81A 3E18A 3EC2A 3RGBA 3TMKA 4NMMA 2WSMA 4A16A 5K1PA 4CS3A 3EXG2 1DQSA 1GGFA 1FSGA 4G0NA 1G1AA 1K8ZB 2EZ9A 3QTBA 2MYNA 3BL6A 5LBIA 1T2FA 5ICGA 1Q1ZA 1K97A 3LHSA 4NV3A 5KQSA 1RFGE 4XDHA 3BB4A 3ESXA 4QUAA 2FTKA 2Z6AA 2HGSA 1ISRA 2WWIA 1W5FA 2XT0A 2QAGC 4LHSA 1JU9A 2H8GA 2NNUA 2H06A 4JP2A 4IH9A 4YXWA 3K3PA 3MWLA 4YIPA 1QTRA 5CFRA 3OHMA 4KFCA 3JAWA 3ASVA 5ES4B 1UMKA 3CS5A 3IKTA 3JD3A 5AUNB 3S3XA 2W22A 1L1FA 3GLHA 3DGEA 3AHIA 2HV8A 2H17A 4OJNA 3FRJA 1GT6A 4ZDKA 1VMEA 2IYVA 3PUJA 3V3KA 4GSKA 5B1SA 1VHTA 4KGVA 1N33O 1PR1A 3HCAA 1C81A 1EFRA 2VQEO 3A6DA 4RD2A 2W4IA 5EZYF 3OQIB 2PL1A 1KU9A 2OCLA 1WHTB 1UXOA 2WG2A 2M6RA 2HSGA 3C6MA 3L6UA 3CSXA 1LSUA 3JSXA 1DEHA 2R8XA 4JASA 2HCTA 2XZTA 2VHEA 2D4HA 3H97A 1HW7A 1H2YA 2FWNA 2O8VA 3B1WA 4NV0A 2VJQA 5ALQA 1UAGA 1ZONA 4ZOEA 5EQFA 4C6TA 5A9SB 2NZXA 1RU3A 4AF8A 2Q07A 5IF9A 2X5JO 2JGNA 1LBIA 5K8LA 4CH5A 5AJUA 1N2JA 1YAHA 3W90A 2XE4A 4KQ9A 4EUSA 1UT5A 1UIMA 3M2TA 3C90A 4J9VA 3KPJA 3HBAA 4QYIA 3AU9A 3WDLA 1MJ5A 1E3DA 4PVCA 3WMWA 1L4MA 2IIVA 3PIDA 1O95A 1TKCA 3VDQA 1CJTC 4ZQHA 3EG9B 2YZ2A 3KLNA 1RYBA 3TRIA 4KO3S 3U7JA 1NYQA 1YIDA 2YJTD 4IQFA 4LJKA 3YASA 2F1OA 2FJUA 2HA5A 2GWRA 2XAAA 3K05A 4I1SA 5DPMA 4DLAA 1GM5A 4X45A 3CN7A 3FOBA 3MWYW 5DN9A 4B80A 3LL7A 3OEED 3ADPA 4RGVA 1UXKA 4OO3A 1VMDA 1LSSA 3QG5A 4PYMA 1UJWB 2F4NA 2ISQA 5LYYA 3MAAC 1NBWB 1XEAA 2QA5A 4W8HA 3JYNA 2J7PA 3T0GA 4QO7A 2FEOA 1T3GA 3OEHD 1QBZA 4C4SA 1G63A 3TQRA 2EDCA 4RHCA 2E21A 4FOLA 3UAGA 2RH8A 3G0HA 1V43A 2WOJA 2JHGA 3VKVA 2FPKA 5FUXA 4JLAA 1AG9A 3IPCA 4O29A 4KXRA 1NLUA 4WX2B 2ZM6O 1BVUA 3KELA 3IAS1 2I87A 4WV3A 3KOWA 3TLBA 1YCHA 2O7RA 3AR2A 1F3LA 3E9DA 3CE9A 4DA0A 3MQFA 4KN5A 5BMVB 4DUGD 2XVYA 2DKOA 3UV3A 3DR5A 4ENUA 2TMDA 3MTGA 3WYGA 4GOXA 2QM3A 3IQZA 1XEWY 4YCMA 3DFUA 5CA1A 1IDN1 1SXJD 2CHGA 1JHUA 1JA1A 2DT5A 3C15C 1DO2A 3PEUA 4UHKA 2WNSA 3GLIB 3CEJA 3DD1A 4CEIB 2GR9A 4PN3A 2FMFA 2JI4A 1NDUA 1KPGA 4RD1A 5K0GA 1JDZA 3LZDA 2CXOA 3F67A 3VX3A 4FKBA 2Q6AA 4BNHA 5JRZA 4BBPA 2JGMA 2HWUA 7AT1A 3G6WA 3IJEB 5ALTA 1BE3H 2FR8C 4V1CA 2I6FA 4UD2A 1U28C 2L35A 2DQ4A 4RKWA 1N1EA 5JH7F 3CNBA 1V7QA 3FCCA 2PTMA 2QUBA 4J1NA 3KSUA 1U1DA 3DPSA 3ROZA 3B5EA 3H8JA 4AJPA 4WZBB 3PFHA 3TQTA 4JR1A 1CIPA 4N5IX 3E8XA 2XCOA 5JPDA 1TK3A 2QSYA 1G3IA 1D7OA 3DLAA 3LYUA 4J0EA 5A5EA 5JJNB 4K6CA 2IJJA 1M0SA 1CEXA 1GA4A 3TZLA 2YHAA 2J3HA 2XSZA 4WN3A 5F1KA 4CL0A 2MSEB 1S6YA 2IY7A 4BBAA 1DX9A 1NA5A 4CNQA 3DL7A 4I9HA 5DCWA 1P5RA 3HP4A 3MWEA 3B9QA 2ENUA 4DC1A 1BYIA 4XI9A 5TPWB 4LNUA 4ETIA 4BZZA 3PHCA 2B0CA 2RB5A 1DKOA 3WC4A 5AI9A 5HKKD 1KI6A 2IBZH 1ECFA 3HH8A 3R3UA 2J3EA 5EMJA 2P2ZA 4O25A 3E5HA 1MNGA 3U0ZA 1B8UA 3ZE8A 1PAUA 2NXJA 4YP9A 5JHHB 5H9WA 1J20A 4O4JA 3HJUA 1ZGZA 1VTKA 1KFEB 1Q6ZA 1DGSA 4NOMA 4RY2A 4O1IA 4Y98A 5JZVA 1AHNA 3CT4A 2I66A 1GZDA 4DAOA 1ORDA 5KQMA 4EG6A 4TT3A 1YA8A 3H6GA 2ZATA 3N1UA 2PUJA 2GJ9A 4RUFA 4HH4A 3M4JA 4LF6O 1G6KA 2DY1A 3PFBA 5EPUA 3T7AA 1N3LA 1DJOA 3NHYA 5KPDA 3K70D 5FTKA 1D2MA 3AF6A 3Q8XB 3H1LH 4Z3OA 2PEYA 3ZEDA 1TCUA 3CU5A 4F71A 3HCWA 3EVKA 3OOSA 1AF7A 1XL0A 1ISPA 3TXYA 2BELA 1XCOA 1CUVA 1OLXB 3F78A 4H4CA 4M9CA 1Q0TA 4QLAA 4K28A 1A5AB 3QFFA 1R8JA 1BROA 3H11B 1SQXH 1VIDA 2W11A 2ZYSA 3GMIA 3U7IA 2L18A 2O8DB 3DD5A 4MYSA 3PYXA 3FTFA 1TVKA 3I55V 4BQOA 4LWZA 1M34B 3B6JA 4BGDA 3STLC 2OCDA 4G0QA 1R6DA 1QK4A 4BFZA 1U4SA 4UUJC 5DRTA 3P4XA 5BN3B 4JENA 2AHRA 4IDQA 1SKAA 3K9SA 2WWHA 2HRBA 2B61A 3LU1A 5C93A 3WYEA 3FAVA 1HE3A 4Y30A 5FNVF 4LV8B 2EFYA 3RFRA 3ZMSA 1HZZA 3BDVA 3WJ2A 4CHTA 4Y6RA 3LCCA 1N7GA 3ZDCA 1RZVA 3N70A 3I6ZA 3WLNA 3TQIA 3O93A 4OGGA 1WXQA 4FYJA 4MO9A 3SOZA 4HDRA 1NYLA 1TMGE 2ZZKA 4IYRA 4JJFA 5KOIA 1CX9B 1K89A 3L7LA 3AERB 4BVHA 1AR1B 4JOCA 3PYMA 5IC4A 4V3CA 3IJRA 3RS4A 1NP3A 3B2EA 2ATVA 3HDHA 4N0DA 5GZ1A 2D7DA 3BXGA 5F12A 4ALJA 3K6RA 1ZD3A 1JE1A 2BP7B 3CJRA 1EFTA 4JXXA 1SQFA 2BGJA 1HDIA 4GDFA 3E1KA 4JGSA 1GDDA 4EA6A 1LPNA 2BSQA 2BFDA 1I8TA 4R40A 3NCHA 1ZJJA 1AJPA 2QZJA 2V7XA 1PV2A 3IPRA 3NJRA 1IPHA 1XVIA 1U9CA 4NATA 1GKYA 4FDAA 2K7FA 3ZC3A 1UBGA 1RKUA 3AR7A 1KFBB 4URYR 1TEHA 3UCSC 5LOVF 1XSEA 4QC2A 1RQ2A 2A0XA 5F2NA 4YMWA 2OBFA 4LBYA 1RLMA 3FUWA 1NURA 4CU2A 2PUSA 2RHDA 5A9GA 1V8PA 2ZAOA 5AH0A 2XT6A 4DWVA 5IXSA 3RYHB 3K5HA 3I4LA 1VJDA 1M66A 4RE5A 3IC9A 2BFMA 4E2YA 4MQBA 3ZWKA 2HU8A 3FPCA 1GL6A 3EPKA 3ZMTA 1YHYA 2ZR8A 1XI1A 5C8YB 3ONVA 2IJHA 3KD3A 4LYFA 3SLRA 4CE6A 3GJ4A 2ZI4A 3WY9A 3MF4A 2VLIA 2QLFA 1R66A 3FYIB 1AUXA 4CTMA 4TTJA 1YMVA 1SMKA 3AWDA 2AJTA 3LJKA 2LFRA 1ZNWA 4QHSA 1MH1A 3INTA 3WTCA 3ROFA 1RAEA 1JIJA 4X6LA 1BGVA 1BG6A 3L7OA 2NUPB 4M1WA 5BWOA 2J3MA 1PR0A 1R4NB 1U7WA 3BHIA 2HNKA 5JE8A 4A15A 4PZCA 4L6AA 5DNVA 3LDUA 3EOAI 4XSVA 1CS4C 3AW9A 3C6QA 1PEKE 3GCDA 4C03A 3QYFA 1QM5A 4DR1O 2RMKB 2UYGA 1BGXT 2VK1A 4TYNA 3U7RA 3ASOB 1OW3B 4RVGA 2J3LA 4NTZA 4DIOA 4OYHA 3PCXA 4MVJM 1DRJA 4LRUA 5KDLA 2OQIA 1R6NA 4E70A 2AQHA 1WX1A 5EXSA 1DBVO 4S0XA 2F64A 3DAGA 1NLZA 4TV9A 2VAWA 3ICXA 3REFA 3M3PA 3PE4A 4E2LA 4CKCA 3LDEA 2B8NA 1N0WA 2E6KA 4P93A 4U3JB 2R9RB 2PKWA 2R1UA 3V8PA 5JV5A 1XPUA 5F1OA 2DLDA 3HHEA 4JIGA 5CT5A 4K9KA 3GFSA 3W1EA 2GT1A 1EP3B 3UHOA 3ABKC 4BNNA 5KDOA 4J3NA 3CLRD 2H57A 4OOEA 4ZPXA 1OCCC 4ZQBA 2RHBA 1EESA 3D4NA 1WETA 1NE7A 3UXHA 1X7HA 2JIZD 4AIRA 2AN9A 4UM5A 4O6VA 5AT1A 5AW5A 3Q8MA 2ZRIA 4AMBA 5ECGC 3LZCA 3ZHUA 4TL9A 1U6IA 3ECAA 4B3TO 4G9GA 3ETCA 3AJEA 2PT7A 2J32A 4UTVA 3SYAA 2YIMA 1PGOA 1KOLA 2G70A 1KEWA 1PJSA 3BKWA 1TUBA 2VH2A 4YUWA 4UQOA 5BSMA 3GFFA 4HPJB 2UYHA 3WB1A 3O2SB 3GC6A 3LDDA 4NHOA 4U5XA 4LJLA 5BNFA 3PLRA 2X22A 3FVVA 4X8AA 1QNLA 2IUSA 1LPSA 4HJRA 3PQ5A 1RR6A 2GN1A 3DNMA 4MR9B 4BX9A 4CMEC 1WBDA 1GXSB 4Q3BA 1K9VF 4LDZA 2HRDA 4H7EA 3QO5A 4EECA 2HF7A 1FX1A 4BB5A 5DYYA 4E5KA 4JL8A 2PMWB 1POXA 3NM4A 1VQPV 2BUAA 1SHJA 2EW2A 2DPMA 5IZCA 2WF8A 1ZH4A 2WLMA 1O57A 4NYIQ 2GYYA 5CXUA 4ENSA 3EGDA 4BNLA 2JLRA 2OCKA 3BRWA 1QYWA 2PSJA 3IVXA 1SPXA 4YJFA 5DI3B 4F6EA 3U4AA 3C3DA 4DCPA 1JR2A 2ECKA 3SNKA 4CT0A 4TS3A 4G0PA 4Z9AA 5H5NA 3BAZA 1CXZB 1SCIA 2R6R1 4OI0A 4F45A 1X2BA 3NJ8A 1YJ5A 2IYEA 1PWYE 3IBCA 3KALA 3TW0A 1Y4AE 1N7HA 2VZ9A 3T35A 4CF5A 2VPYA 4MKHA 5IP5A 2QP4A 1QH8A 3BD7A 1JR3D 3U3KA 4OQDA 1PZFA 5CT4A 1PS0A 3RVSA 1Z0JA 1VCNA 2C0PA 3OM1A 5GINE 2OWOA 4F04A 5B3JC 4MAFA 3Q98A 3T5DA 2VAMA 2W2MA 3OE5A 2RGWA 4QT4A 4ZCMA 1NF8A 3H1GA 3NYIA 5LFAA 3D59A 2RHHA 4UVHA 3DAHA 4MW6A 1M8FA 2EJWA 4FGUA 3W9BA 5GIOE 4IDDA 4B7UA 1Y4SA 1E0SA 2OG1A 4RXTA 4MYHA 5TQ0B 5DHRA 2JFYA 4LQDA 3AM5A 2JI7A 4YR9A 3PNYA 1YB2A 1CR0A 3KE8A 2DM6A 4BVGA 4FZVA 1VLQA 1YZBA 4DEXA 4MARA 4FBGA 2O54A 3QYAA 1DEKA 3SN6A 3KUDA 3AVVA 4MVJF 3DSQA 2IBSA 2CNBA 1AB6A 3SEZA 2B25A 1Z0UA 3IDOA 3AQIA 2ORED 1MJGA 1VPLA 2XH8A 4UKDA 1N8RW 3DV2A 3VR5A 3MRSA 1SU7A 4QPDA 3PUVA 3QBEA 1MVNA 3WLSA 4UVAA 4JI1B 1MO5A 2HA4A 3HXLA 3RHSA 1J06A 1PDVA 4KHZA 3O8BA 1RHRA 3TSWA 4ESEA 2GO1A 2H2AA 5K7SA 3GGGA 3J7TA 1J8MF 2XTJA 5TX7A 1W2GA 5KVVA 1R4MB 1WXXA 5DSZA 5ECWA 2BDTA 1T5SA 3KYCA 3F9IA 1FXKC 4WK2B 1XVAA 1UJMA 3KZVA 2BBSA 5FTMA 4F3NA 3ST7A 4FGLA 4IQ4A 3N2KB 3F97A 1SIUA 4EHJA 1X7WA 1NULA 3HFGA 1SB9A 4I55F 2Q50A 3GGDA 3O91A 1ADBA 2QVXX 5DNAA 1EFKA 2V1UA 3LT2A 4PCUA 2Q3MA 3CTPA 3OP4A 1JTEA 2WD7A 4PG5A 2Q41A 4OK6A 1TGVA 4M9RA 3QO7A 4WN9A 5JEDA 1EJ6A 3C48A 3QXGA 3B52X 3WL7A 4OKSA 4JI4B 3LW7A 4IYHA 4MR8A 2KW5A 2YV1A 4UASA 3ZU4A 4EI7A 4NECA 3B38A 1MZEA 2QV7A 1FOEB 1QGZA 1R00A 4X1KA 3JTMA 4FXOA 1XU4A 1IJBA 4I4TF 1H3NA 2BFEB 4XIGS 1GLGA 3HN7A 2Q7OE 3B6KA 2R7LA 3D36C 1TJ5A 3D8CA 4F9FA 3ITNA 3CF4G 1AE1A 4EHAA 1U9ZA 4Q05A 4TVKA 3P0HA 3VUFA 1K4MA 4QRIA 2DE0X 4DUYB 3QWIA 1Z2AA 3EC7A 1I1QB 3AVWA 3MT7A 4B6QA 4F5ZA 2QSUA 1QG6A 2I7TA 4LJYA 4BFSA 3DLPX 3QVUA 3PXXA 3HPLC 4B44A 2AVDA 4HQFA 4LIPD 2JDIG 5K0TA 1UZUA 4XB2A 5EMHA 3VQVA 2CV2A 2IYSA 4BX3A 3L71H 2RGGA 3C2QA 3EIFA 5K8TA 2XCSB 2C3PA 3MPUA 3BZBA 3G88A 2VJNA 1T9HA 3ILSA 3EUWA 1OX6A 1UJ5A 4H1WA 1HEUA 1U9YA 1ZD9A 3G71V 2JIBA 4MQFB 4NONA 4ZOLB 3WGGA 1SXPA 1EN6A 4JBXA 2E5LO 3E5RA 2VHVA 1T2CA 1SS3A 1NXXA 1DLJA 4CIBA 1F8GA 1E98A 3FOEC 1T0PA 3C5CA 4K87A 4TMYA 4B7EA 4EY5A 3KT0A 2PT9A 4N0PA 3KWJA 3URKA 3K8OE 2SECE 2YHIA 4YO8A 3W7TA 1Z0AA 2E5FA 3D1JA 4JEMA 5LD2B 3CCSV 2ANCA 2I6TA 1HY3A 3GJ7A 5H70A 3RVDA 5FQOA 3MDSA 3KD2A 2QW0X 4BCCA 2D8MA 4ZXFA 1SZPA 3CMAV 1P0CA 2HXGA 5AQEA 1XALA 2P2YA 2FE1A 2EULA 1RMQA 3RUFA 2WEKA 4JI4O 1ZHOA 3RM3A 2VPXA 5K6TA 5JAPA 3P97A 5LDDC 5I9MA 1FDOA 5JAZA 4DVGA 2PQ0A 4DLWA 2AMFA 3HCDA 3L06A 4WNAA 2XB2A 3Q8WA 1Q81W 3E8HA 1RCUA 4R81A 4M2LA 2QW1A 1MMMA 1NVPD 2BM0A 2QWNB 2Q4RA 3CRCA 3Q6IA 2N74A 5CB0A 2XKJE 3FMGA 3RFFA 1H5QA 3I5AA 1P5JA 3O75A 1N77A 3U9TA 3U3OA 1EGMB 2JJQA 3ESAA 1SR8A 3O4HA 3IVCA 1U8CB 1NBMG 5ESRA 1E1CA 4L0CA 4C08A 1FMCA 2Y6UA 2YJ6A 1VMKA 4LJSA 3WBB