1R6TA

Crystal structure of human tryptophanyl-trna synthetase
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
461
structure length
440
Chain Sequence
ASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKAEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYGDAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophanyl-tRNA synthetase
publication title Crystal structures that suggest late development of genetic code components for differentiating aromatic side chains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 155
structure length 440
sequence length 461
chains with identical sequence B
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2003-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1r6tA03
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1r6tA01
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1r6tA02
4J75A 4FZJA 4KPUA 4ZT3A 5K0SA 3RJZA 3G5AA 2WQ7A 4MULA 2D54A 3VGJA 4R2LA 3N05A 3QE4A 2CT8A 1R1BA 5LMUO 3MLBA 4OPAA 4YP6A 3I05A 1GZUA 2RE8A 3GUZA 5TS2A 2PZ8A 5JBNA 4G5FA 2PXHA 2QUIA 3M8AA 4LF5O 1N1DA 1NUTA 1TYAE 1ILEA 4YY3O 1WOYA 4PBRA 4RPIA 4MUKA 1J5EO 4MVWA 4G5YA 4YBRA 5HUHA 3M5WA 3J80N 3AKZA 1N2OA 3DLAA 1FYJA 2QJTA 3OTOO 3CLUC 3HL4A 3ND6A 1X8XA 2DLCX 1N2EA 3IUEA 1XEQA 1DNPA 1YUMA 4JXZA 3FY4A 1G8HA 1NZJA 3H97A 4I6EA 1QU2A 4ZCRA 4MVCA 5H5NA 1M1ZA 4DUYO 1WXGA 4F4HA 3S3TA 1TEZA 1AILA 2BYTA 1IBMO 3X1JA 1XNRO 1V8FA 4XFDA 4GU5A 1ZH0A 1AB3A 5DASA 3SZGA 2BTEA 1FYDA 4YHHO 2E0IA 2QJFA 3CLSC 4CT0A 3FNRA 1TYCA 1JEDA 1I2DA 4L2IA 4DR7O 4P2BA 4YP7A 1R6UA 3A2KA 1N32O 4I6GA 4E1AA 5LMNO 4DV6O 1K97A 3ND7A 4PBTA 5IHXA 4QBTA 2CUZA 4TS1A 1A32A 5KHAA 4DNXA 1ZH6A 3ELBA 3COZA 1O95C 1ULHA 3RK0A 5F23A 3JAMN 4JI0O 1T9GS 2X1LA 3NBKA 5H16A 2X3FA 3SDLA 2CV0A 2VXOA 1I6KA 1NURA 1IRXA 1K92A 1JIKA 4MUEA 1XNJA 1KH3A 2JRIA 3CLRD 1QRUA 3BL5A 4ZT2A 3KT0A 3IODA 2RD2A 1VLHA 1GLNA 5LFAA 1N3LA 5BXZA 1ZUNA 2IELA 1Q15A 1HR0O 1U7XA 3A05A 2UUAO 2YWBA 3GMIA 1NI5A 4ZCQA 3CR8A 2DPLA 4XSVA 5FO1A 3IDFA 1WJGA 3CA8A 3DPIA 1T6XA 5TEVA 2DEUA 1VBNA 2HMAA 3CLUD 3TZLA 4JI5O 3K9WA 1JILA 2OQ2A 3LCJA 2DJVA 1T6ZA 1R6TA 3G6KA 2ZM6O 4DR3O 4DR2O 4DR4O 3UOWA 4EG5A 2A84A 3F5TA 3NV7A 4HK4A 1O0CA 2A1TS 3N8HA 4JV5O 1QQTA 4NXNO 4EG6A 1NUPA 2E21A 4MWCA 1I6MA 4DDKA 4KKVA 2QTMA 4JXXA 1EUYA 2XRZA 2J08A 1WQ4A 4LF8O 1H3FA 4NDAA 1EE1A 4ZT4A 3L92A 1XNQO 1NYLA 1OBHA 1FFYA 2CYAA 3GLVA 4DV3O 2AZXA 1HNXO 3ZIUA 3ZJUA 2CYBA 1GAXA 1O96A 1WXIA 2EL7A 1F9AA 1NSYA 2R5WA 1UFVA 3H9BA 1Q11A 1U3CA 3ZJTA 4MW1A 1O95D 4DLPA 1G8GA 1JECA 3MXTA 3U1VA 4DV0O 4OJMX 1MJHA 3T1HO 3C8ZA 3RHSA 1G8FA 3OP1A 1N2BA 3ILVA 3IVGA 1KQNA 4DJAA 1N2JA 3CLRC 3E27A 4B3RO 1XNGA 3N2YA 1EUQA 1J21A 1QU3A 1O5TA 1J1ZA 3P52A 2VTBB 1XJQA 3RT3C 5IWAO 5J59A 2IJGX 4OX9O 3CLTD 1QTQA 3KT8A 3HGMA 1N34O 4F3RA 5IJXA 1Q77A 3DO8A 1FKAO 4JI2O 2ZKOA 4MUFA 3D6VA 4DUZO 1H3NA 1EFPA 1V47A 5K0TA 1KH1A 3H05A 4MUIA 4DE5A 4MQ6A 4X64O 1LW7A 1SURA 4B3TO 3IH5A 3COWA 1OWPA 2CV2A 3F3MA 4QREA 1XMOO 3Q10A 3FETA 3QTTA 4OUDB 2A88A 3SP1A 3P0JA 1JMVA 5DEOA 1BS2A 1I94O 2E5LO 4MW2A 1EFVB 1KQPA 3VU8A 1KP3A 1NP7A 3ZXSA 1P7PA 1JIJA 4JI7O 2O8VA 5AHWA 4A91A 3N9IA 3TZEA 1KR2A 4KR6A 1JIIA 2H29A 3PXUA 2JA2A 5HG0A 3KT6A 4GKKO 2QJOA 2GM3A 2GKSA 3COVA 4ZT7A 2A1UB 3SDBA 2QUKA 2LW7A 3T1YO 1JHDA 4K03A 1WQ3A 1M83A 4XFJA 1F7UA 3ISJA 2TS1A 4KR7A 1TQ8A 4LFBO 3LE8A 3AG5A 4K0RA 2A7XA 2D13A 5BY1A 2JANA 1RQGA 1KUQA 1GPMA 4MW4A 1IBKO 4MW9A 4OPHA 3J7AU 2V0GA 4KPUB 3A04A 3SZ3A 2E89A 4NAUA 2PG3A 4EG1A 1MB9A 1IH8A 2UXDO 1PFYA 4H3SA 4AS1A 2ZUEA 4UZEA 1DK1A 3CLTC 2HZ7A 1NUUA 1YUNA 1PFUA 4CDNA 2PIDA 5DB4A 1N33O 1WZ2A 1X6VA 1O6BA 2CFOA 4PBSA 4MUJA 1QRTA 2CYCA 1N2GA 2N74A 2VQEO 4ZT6A 4JYAO 1K4KA 4MW7A 3VRHA 3AG6A 3AL0C 1OBCA 1WXHA 1XNHA 4A5UB 4NX2A 1MAUA 2C5SA 2UUCO 1J1UA 3PNVA 1ZJWA 1NS1A 2VQFO 5FNZA 1H3EA 1WKBA 3DV2A 2GOYA 4J76A 2B7LA 5LLTA 3FI0A 1PG2A 4JFAA 2YWCA 2I1LA 4EG8A 4DR5O 4LFCO 3RBAA 4JI6O 1G1XB 2XRYA 1PFVA 4UZFA 1KKUA 3TQIA 3D6UA 4MWEA 4EG3A 5KWVA 1TYDE 3IMGA 3FG9A 2ZUFA 3LOQA 4ND6A 1JGTA 3JXEA 1IQUA 2AG6A 4X65O 1WXFA 1D2RA 4EG4A 1KAMA 5TGTA 4L2IB 1MOPA 2E18A 5H7XA 1WXEA 1O94D 4MW6A 4JI3O 5LL6Y 3J81N 3KT3A 5A2QN 2OV4A 4ARIA 3R66A 4B3SO 1J70A 2X0KA 3UY4A 5LM3A 4ZT5A 3PRHA 3A4IA 3UK2A 4BWVA 1IQRA 1OWMA 3Q4GA 4MWDA 4WNYA 3ZGZA 5HUJA 3UMVA 4DV1O 3MMXA 3SEZA 1EXDA 1GTSA 2Z08A 4JYZA 3MUEA 1MC1A 4HJRA 4GKJO 1T9GR 1IHOA 1D2DA 3SYTA 1QRSA 2H2AA 3IMEA 4LF6O 4DV4O 5J5AA 2A4MA 4LF4O 3CVVA 2A86A 4NAHA 4JI8O 2O5RA 1X59A 4PY2A 4B3MO 4RUKA 4LF7O 4DV5O 1IBLO 2F4VO 4MW5A 4DR6O 1N77A 3IVXA 1N36O 4WSOA 4HJXA 4Q93A 1QNFA 2FKXA 4LF9O 1O97C 4KR9A 1M8GA 1NUSA 1OWOA 2QUHA 4JI4O 2X1MA 2Z3VA 1F7VA 5J58A 4HPWA 2J07A 1O0BA 1YZBA 1JZQA 4JZYA 4ZCSA 3IMCA 3G59A 1G59A 2DETA 2Z09A 4DDMA 4KHPO 4LFAO 4MVYA 3IUBA 3OTWA 3TS1A 1YI8A 2AGAA 3O65A 2UXCO 2A1TR 4EG7A 3CVWA 3HV0A 2Z0AA 4DDHA 2UUBO 2QUJA 3RFFA 1H1TA 1Q19A 4R0NA 2WSIA 3FHJA 1OD6A 1O96B 1KORA 1PG0A 1O94C 3UC5A 4I6JA 4X62O 4NZPA 5FO0A 1PFWA 2AKEA 4Q16A 1J09A 2QTRA 2YXNA 2PZBA 4K0KO 4MUNA 5TEWA 1JEEA 4CDMA 4GRIA 4ZCTA 1KQOA 3TQOA 3HZRA 1IFXA 5FLXN 4DR1O 3TNJA 1N2HA 3IOCA 2V0CA 3INNA 1U3DA 2IP1A 4X66O 3FH0A 3FIUA 1MBZA 1S4MA 4ARCA 3H9CA 1M8PA 3HFJA 4X0EA 4MW0A 5IT9N 2D5BA 3COYA 4MUGA 5BR8O 1U7DA 1VBMA 1JZSA 2DOSA 3ZXIA 3PNYA 4U8HA 1MRZA 4JI1O 1EFPB 2VTBA 1M8FA 2EJCA 3AIIA 3ZJVA 1KAQA 1N2IA 3FOCA 4QRDA 4YP5A 4DV2O 1YIDA 3L93A 1TYBE 1LI7A 1OWLA 4MAFA 3ND5A 3IOBA 1COZA 1U0BB 2PZAA 1VL2A 1KP2A 1YIAA 4AQYO 2JAXA 2NZ2A 3IVCA 1HNZO 1O97D 4R2MA 3FWKA 4S1OA 4EF6A 4AQ7A 1EJ2A 2NSYA 1KH2A 1OWNA 3P0HA 1T6YA 2HHHO 3CVYA 5EKDA 1N75A 3X1KA 1K4MA 5DK4A 2DUMA 2ZP1A 4ZCPA 4MVXA 3PNBA 3K32A 2QTNA 3KFLA 2DXIA 1HYBA 4ND7A 2HGZA 4OUDA 2DR2A 1QJCA 2WQ6A 2CV1A 1M8KA 2J09A 3X1MA 1FJGO 5BNZA 3HMQA 3CVUA 1CT9A 3RK1A 1F7YA 1B6TA 1EFVA 4MWBA 2UU9O 2DERA 4MUHA 3SEQA 1N78A 1A8HA 1YULA 4NXMO 4MLPA 4CQNA 1LI5A 3MLAA 1VBKA 1M8JA 3CVXA 1R6XA 1Y42X 3ZUGA 1HNWO 1MB2A 3Q12A 4G6ZA 1IQ0A 5KCMA 3P0IA 1XMQO 3NBAA 3CLSD 2A1UA 4EFKA 4EGAA 2WB2A 4U63A 3AFHA 2CSXA 1IVSA 2PFSA 3IOEA 1I6LA 1WY5A 1GTRA 1F4LA 4YMIA 2UXBO 1NUQA 3FDXA 2G36A 4DV7O 3QTBA 2J4DA 1J20A 3H99A 1MAWA 2YY5A 4U7JA 1GN8A 1TFUA 4NATA 2J5BA
chains in the Genus database with same CATH superfamily
2Q50A 4KPUA 4A6XA 4W99A 4NSNA 3KZOA 2HFEC 4LAFA 5B30A 4JLDA 5EJGA 1KDTA 1MX3A 2Q27A 4OSPA 1SUIA 3IHKA 1W8IA 4TLDA 1SZCA 4DUZB 4DARA 4EA8A 3BYZA 1SBTA 2X0DA 5HYVA 1R5NA 3LP6A 1E7MA 5EXDA 2ANCA 2IZOA 5JYDA 2X0LA 2ZBGA 1VG9B 1SHKA 2ORVA 1G20B 4JYMA 1SPBS 3WL8A 1ZH6A 4YACA 1O95C 1QKKA 5FORA 1CRLA 3JYPA 4QUGA 1EFLA 1MIOA 1CS0A 1CP3A 2RMKB 2R62A 5T8KC 1ZUNA 2BH9A 2HF2A 4EL0A 1JQBA 3H8WA 1USUA 5E3HA 1FU8A 2GZ3A 1YZHA 2WICA 4URHA 4ZK2A 1EUDB 4ZGWA 2DQ3A 1E3EA 3RROA 1I6MA 4K26A 5MN5A 1MENA 2YMQA 3KPYA 2ADMA 2JDID 2ZI4A 5HOEA 4M76B 3PVCA 1LK0A 1UL1X 4RZ3A 4U7GA 1CVIA 3A32A 4JLSA 4F1KA 5JMOA 1P9NA 1OBVA 3EFFK 3Q5GA 3O4IA 4E15A 4Y6SA 1A7KA 2HLHA 3BH0A 4IV0A 5FTJA 4HDMA 2NU8A 4KO2S 5A5EA 4FYIA 1TJ3A 2BMAA 3ZY4A 3E3MA 3W7WA 1ZJZA 5DYGA 2H29A 4B74A 3SYCA 3K1ZA 1XCOA 3JWJA 4H13B 4RTQA 1RM0A 4X62B 3BQ9A 1L7MA 4KO1S 5DOZA 1W4CA 3WSTA 3QNUA 2Q9LA 5B1OA 1NU6A 4RY8A 1A72A 4EG1A 4F2HA 1O54A 2B4YA 5AKLA 4R0MA 2WIFA 2YMMA 3MBKA 3GGGA 1AUOA 2P30A 4IYJA 2IEDA 2VS0A 1S8FA 3TRIA 4DY4A 1DEKA 2VWPA 3DTYA 3JVDA 1OCOC 1RRFA 1YH3A 1UPFA 3ZV7A 3G2NA 3G7NA 3OLQA 4MQEB 2C7VA 3AF4A 3P5SA 4TKZA 2DFDA 1NMXA 3W2IA 1MRNA 2Y1WA 5KHLB 4E5MA 4IIJF 1PK8A 1SXJC 4BWVA 2N47A 4JYZA 3SX0A 1EQAA 4IQFA 3NHWA 3EG9A 5LD2B 1ZL2A 4HUJA 4C04A 5CYFA 2FP4A 3C8MA 3QNEA 2P4EA 3NDRA 2XAFA 3WVNA 1NVTA 3EB9A 3NH6A 2Y0DA 2RKWA 1M1KW 4PPNA 3ER9A 3RC1A 3RR2A 2W5UA 4WZBA 3AETB 4ZGGA 4KAFA 4U9HS 3FI9A 4KO4S 3WWPA 1CF4A 3RWMB 2VHWA 1XRLA 3CB4A 4RXTA 4JI7B 3ECAA 5FTMA 4TOIA 5FO0A 4NU6A 2P4KA 1FNNA 3INNA 1ZH2A 1KYYA 3ER6A 1Y74A 2C94A 3QVMA 1ISJA 1UBCA 4RGVA 3E9RA 1MO5A 4PFQA 2I1QA 3OO1A 4K5QA 1OFVA 1RJGA 1O2DA 2OE2A 4P32A 2BEUA 2QR4A 5DTMA 3VPGA 2B61A 4UPDA 2VTKA 3CUWA 4NIMA 4PQGA 3OFKA 3NRBA 1RI1A 5JZSA 1NI4A 1RYFA 3Q3EA 3JYHA 1J0AA 4W5NA 3IXLA 2I29A 3TTWA 4EFKA 2OXIA 3IXMA 1GTRA 3ZRXA 2K9PA 4X24A 2G36A 2FEWB 1FLNA 1E9FA 3I9OA 3LC2O 1ZRNA 1X3SA 3Q7SA 2C2AA 2D62A 2XDAA 2B1GA 2R6R1 4UEKA 2NNWB 2B98A 1LTQA 4L9RA 1T8YA 3OHSX 1E98A 2PMFA 5HW0A 1ZEMA 4LRSB 2Q73A 4Q15A 3UPTA 1V5WA 1I94B 4HC4A 1M2JA 4AKGA 2YXDA 3C7KA 1XNRO 3F7VC 3H1PA 5B7GA 2VBIA 5E1BA 3K9QO 2X41A 2BTEA 2QQGA 1FVOA 1WEKA 5EXSA 2GTHA 3PQ2A 3ZPXA 3DE4X 1ZJ5A 2P40A 3UM7A 5BT8A 1CR6A 3NBKA 4GZ6A 3JWGA 4MUBA 2WILA 2WTUA 1MZVA 5BRNA 4TXLA 3ZXYA 6LDHA 4ZT2A 5HDQA 2JGIA 1UZAA 2FFBA 2P91A 1Q15A 1RYNA 2FVXA 4M60A 4G4SP 1Y3IA 1YBVA 2GI4A 3NZEA 4LE2A 3SWWA 3TZLA 1W46A 4JI5O 3LCJA 1Q8IA 3WL4A 4DR2O 5GINE 2RGNC 4H37A 2JS7A 1M93A 5IAEA 3P30A 4KNWA 4F06A 1YDWA 2HW8A 4UHHA 2C2WA 1MX9A 4RLQA 2GZMA 2QJWA 4IDNA 1L7NA 2Z83A 2I2CA 1IZ0A 1BOOA 2JFGA 3EQ7A 2I2FA 1U3WA 4XVQA 2WTXA 1CFJA 5K4AA 1OYYA 2VTBB 2J0SA 1TZKA 1KJYA 2J9RA 2YW2A 3EMKA 3DO8A 1GA6A 3U3DA 2PE5A 5EYPA 2Q3JA 4FYXA 2FEMA 1DHTA 3IP9A 1RPAA 5A4AA 5EJ6A 3J80A 2H1CA 2CHVA 3C87A 2KLHA 4DK1A 1KI6B 3ZE2B 4LDNA 3V5NA 2QQFA 1FIUA 3REQB 2FX2A 1P2TA 5HS4A 3ZWKA 2WVJA 3CE9A 3DE6X 2FPXA 3O1JC 5EHXA 2BZ0A 2BEJA 3BXZA 1K75A 1INLA 4BO5A 3HUDA 3TNFA 1NNUA 3LWDA 1XD9A 2FN4A 3TX6A 3MA0A 3TUJC 4TL9A 4UXIA 2RHHA 4CDNA 2CFOA 2O6LA 4AY6A 2I4NA 2Y4NA 2TSYB 4CN8A 2N74A 5E9JA 1ZMRA 4GMDA 3EDRA 4YIKA 4PXSA 3GJ8A 3ZMUA 4TTJA 1U0NA 2PYDA 3PD7A 1COWG 4WEQA 1G9TA 4CMIA 3MELA 1P0IA 5HFNA 2QWNB 2FLWA 4DR5O 2ZUFA 7REQA 3L79A 5EWJA 4G0XA 1DOHA 3UUEA 3UMYA 2QX9A 3FCSB 2EU8A 1KKMA 4BMSA 3UMMA 3A4IA 2Z3YA 3BE6A 4G26A 2FUG1 3ASOB 5KPDA 4ZMRA 3QY9A 3F6RA 4JEHA 1OR8A 3E82A 4P2ZA 2F3TA 9LDBA 5F3DA 3IUQA 1KR5A 2O7RA 1JHOA 3D7NA 4IMPA 5KX5A 4ZMBA 1PJ2A 2WNHA 4M9ZA 3A6LA 3ZDZB 1R2QA 4YCLA 4TT8A 3A14A 2OZLA 1EWVA 4ZOBA 3W7TA 4YMSA 1Y8QA 4PLVA 4QRHA 4F5DA 4XOIA 4ZBMA 2R6JA 5J4HA 3HBJA 3IRUA 4K0KO 1NT2A 3RKSA 4V0QA 3OKFA 3U4MA 3OJOA 2GN4A 3FNFA 3IAUA 3PDUA 5K45A 2F64A 4TL6A 5C8VA 1DDGA 2DOSA 1JG6A 4GNKA 3SM3A 4L8YA 3TOSA 2ZROA 3RDPA 3SZLA 5MFZA 1GEGA 1ZSVA 2BTQA 1DOZA 2AC2A 1ZNYA 4D8TA 4U9UA 4A92A 4YT4A 5LD2C 2RK4A 1P4AA 1R66A 4Q7LA 2WLTA 3AUUA 1R6XA 1GJRA 3SBEA 4DBZA 4ZVLA 1XLWA 1AA9A 3TZQA 5DW3A 4WPGA 1U8UA 4KH1A 2BONA 1YDHA 1KBZA 1NGSA 3A9UA 3WQSB 3W6OA 3ANSA 1JL3A 3EC1A 3I6MA 1OXKB 3ONNA 3I09A 4XDZA 1MG5A 3NC0C 3RD5A 4BMVA 3W1WA 2H3EA 1F9EA 1JQEA 1EVJA 4X8LA 1PFKA 3K9NA 3IE2A 2ZI3A 4KH0A 2CH7A 2P9TA 1GN2A 4RIEA 4CF3A 5BR4A 3OIDA 2O0LA 5CW2A 3MQFA 3TR0A 3GLHB 1R4ZA 1KO5A 3LFUA 1CDZA 2N9UA 5JFTA 3ELBA 1N5DA 3WWZA 5CAEA 2W6OA 3U7JA 1GVHA 3VZBA 3B1XA 3EA5A 1GDHA 5JV5A 1AKWA 1BA2A 4RIFA 4ZOCA 4YJDA 3O8OB 3WRXA 4JN6B 1MV8A 2XMSA 5EG5A 3ETGA 5AVVA 4R2JA 1W6RA 1FFSA 2JGRA 3AY7A 4G56A 4IG4A 2XADA 4PS1A 1B76A 2VRZA 4RPCA 3VI4B 1P1JA 3DL0A 1OBFO 5AK6A 3WWOA 4WMLA 5J2UA 1JTFA 3TWOA 1H6DA 1NJSA 4CIYA 1WULS 1O5OA 3ELUA 4N9QA 4ZHQA 2AJCA 1SKVA 1WETA 1FX0B 4D46A 2R7MA 2FHSA 5AOCA 4DLWA 2DKFA 1AQIA 4OHFA 2WYHA 4YPOA 1OYVA 3S1AB 4MQ6A 2AR0A 4CR8A 4LF7B 2YHIA 1Z4JA 1NVPD 1K7XB 1QIKA 1LDYA 1EUZA 1Z4LA 4Q37A 3A0RA 3VJRA 1TUEA 2C7BA 1JIJA 1Y76B 1TK3A 2CNWD 4EY8A 5LIRA 5LZ8A 3WLAA 4KUEA 5T7BA 2ZQ5A 3VOTA 1J2UA 4UCUA 1R6NA 5BY1A 1VLZA 1G21E 2ZSDA 1Z83A 1JIUA 3MAGA 3MS2A 1VA5A 4KIUA 1I3NA 5DB4A 1V8DA 4Z9XA 4HF7A 2O5CA 3ZCVA 1ZIDA 5FNVF 2IOHA 2PS1A 4CC5A 3JQ9A 3W5BA 3H42B 2EX4A 5EBWC 2EINB 2RHTA 1JQDA 3K9AA 4A26A 3D6UA 1KGSA 4J0FA 4CODB 1SQGA 5EIBC 1PF7E 2ZSKA 5B6IA 3OF5A 1NOKA 1VJ0A 1KP9A 3S27A 3EPRA 3J81N 2W6ZA 4RELA 1FDVA 4HWGA 1IQRA 3PGLA 3SEZA 1QZZA 2CNLA 1C29B 3QFRA 2FWAA 1L8LA 2PZJA 4GMGA 3AQ4A 2CDBA 1AXGA 2A9VA 4BIOA 2C92A 4WRRA 4EARA 2FEKA 1NJ6A 1N3IA 1IBLO 1U0GA 2GCOA 3SJUA 1PSZA 4DYDA 2FFQA 3ZDCA 1PYGA 3NPAA 4W5OA 4L87A 1U97A 5FBWB 1B0AA 4PPGA 2FY8A 3DBRB 2HY7A 3T5MA 1E7RA 2EC5A 1IBMB 1TM7E 4AJEA 2GD0A 1IHDA 5K7SA 1RZRA 1A4UA 3MT7A 4WJKB 4OKNA 1NDUA 3RLIA 3UG6A 1TQ4A 4P80A 2Z2XA 4JCOA 4DSAA 2HBYA 4UHEA 4IJVA 4GI3A 2X7RB 2ECPA 3KEGA 1D0IA 4JFRA 4MITA 1KMMA 1OIXA 4BJ1A 4B3HA 3I6QA 3LL4A 2PZAA 4GYJA 1JR3D 3CSUA 1G3MA 1NP3A 3ASOC 3RB8A 4AKEA 1GYPA 1LZKA 1ULZA 2QZ9A 3X1MA 4BJ3A 2BOVA 2DTXA 4KYUA 3A1UA 3L6CA 4MLPA 1XXLA 2PKYX 1L5KA 2WJWA 2YQ4A 1P3DA 4KYIB 4ND8B 4W1QA 3FPGA 4PO3X 4QFBA 1NN0A 3MWFA 4YMWA 2AGVA 3AKEA 5GMOA 3Q8KA 1VIBA 2WQ7A 3GJ7A 4Y18A 1I3LA 4M8NE 2X42A 4O1MA 2ZD9A 2NUPB 1UT8A 5BSTA 4JI2B 2G09A 1QWSA 1FFAA 4UTPA 3RIMA 5HDBB 1U8EA 1TO2E 3A0HZ 3FYTA 3Q72A 5FL3A 3ZIAG 3EGDA 3MSCA 5DM70 4MV9A 5E6UB 4Q5IA 2K7FA 3D0KA 1QV9A 1F1BA 2QN9A 1OVGA 4GU5A 1NQWA 2XMZA 4ES6A 3TM5A 3DM5A 2Q2NA 3P4YA 3A4MA 4RJIA 4EA7A 4X89A 2YL2A 4YAIA 1D9XA 5L95A 3HU5A 1KPIA 2ZYTX 5KC9A 4JAVC 1EIZA 1USKA 2YNMA 4L7VA 5ICFA 2GAFA 5KYVA 1P2DA 4V1CI 3DPIA 2KWIA 4TSRA 4XWOA 3QEKA 3QMVA 2ZSAA 4XTRA 3WLLA 3MM4A 4Z99A 2G80A 2J3DA 3CZQA 1RWVA 3F7OA 1ZCAA 1OGIA 2VYND 3VZPA 5L53A 4BAUA 2JI6A 4B73A 3FYHA 1HLDA 1UWVA 4IEFB 1GAXA 2XKJE 3ZIUA 1SGWA 1A9ZA 5BQPA 3D6JA 2HF9A 4ARAA 4Z3OA 4FFLA 4M1SA 4R9UC 3EVGA 2VNKA 1KEEB 2B8WA 3MJVA 4ABMA 1NE2A 3EVZA 2C58A 3VZSA 1E3SA 3L4KA 4B45A 2ZJ2A 3EIXA 3E7DA 4B3TO 1T4MA 4AKHA 3C70A 1ZGHA 5CJJA 3NC1C 1XMJA 4OOFA 2JI4A 2Z1MA 4IWNA 4U2KA 3FTPA 1KK1A 4DW1A 3BWEA 2IHNA 3VZCA 1UKYA 3IC7A 1A8UA 1M1NA 1KYOF 4OXYA 1SUBA 5JXGA 1WB9A 3Q7PA 4OGFA 4IVPA 4J4TA 4AURA 2Z1DA 4NARA 2X0JA 3E9ZA 1YU9A 3QF7A 4JR1A 4KQ2A 4DYVA 5TJ9A 3UM9A 1GM5A 3WB1A 4KUGA 1R37A 1M33A 2UZ1B 2R6GA 5AYVA 3GRCA 4QGHA 4Z9FA 3VZRA 4UB8Z 2JCXA 1L7DA 1WSWA 2K6GA 2YC2C 3RAPR 5FL7G 1WKCA 2YHSA 4KLRA 1YB6A 2ZPUA 2FRDC 5B57C 1R6DA 5TQ2A 1T3ZA 3GX1A 1USGA 2ZRMA 4OB6A 4KOAA 1DMSA 4QYTA 1U6KA 1RSZA 1RVV1 3B2QA 4B6OA 5JNLA 3P20A 3I2FA 3L77A 4RLSA 4ZT5A 3F1LA 2XQIA 1LGYA 4QWMA 5SZHB 1UOOA 1FDTA 4BNGA 5CMUA 4DV4O 1R8XA 4QE9A 4PNPA 2X4GA 1ID8A 5B4TA 3DLIA 2IHYA 4F3NA 3UANA 2MMGA 1OXTA 5DULA 1Y8RA 2DN9A 3RI3A 1TUGA 1VQMV 3FNBA 1G41A 3LOUA 4PAWA 3TD6A 4LFAO 3LIIA 2NGRA 3PA8A 2EFCB 1P75A 5KQSA 1AT1A 3IPRA 4I5SA 1DFIA 2G7MC 2ZDIA 5JFGA 2EINC 2XGMA 4ARBA 1MOZA 1E6LA 5BP7A 3HA5A 5LQCA 2WD8A 4KQIA 2GBFA 2I1WA 4WN9A 4HRAA 3RG8A 5E0OA 1DARA 1WPBA 2FE1A 1SULA 4WKPA 5CK4A 3WK6A 4OXRA 3ZHXA 3OOJA 1N75A 4WI1A 1AA6A 1KFKB 2NW6A 4FCWA 1Q92A 1W30A 5I5EA 3WQRA 2FSVC 4CCAA 2XUIA 3L7OA 2P9JA 2HVKC 3E7PA 4TMXA 5KTMA 1QGUB 1AP6A 4LTMA 1CVRA 4EKNB 1IULA 2H63A 1E9BA 4N76A 4KWIA 4TT3D 2OK8A 2INGX 4P4SB 4UW9A 2GNOA 2CLOB 1S3JA 1S2NA 2FWPA 5GADl 2ZTHA 3VH4A 2H31A 4JJIA 4LV5B 5B1DA 5E9QA 2R4QA 4G97A 1U90A 2Y6VA 3N2ZB 1G55A 1XMVA 3U4HA 3JQBA 4IDOA 1ZOOA 2GLTA 4LXXA 3IUEA 4LN1A 1FZQA 1ICIA 2VDNB 2OV6A 4FCVA 1OROA 4XLLA 3H9JA 3ANYB 3HXPA 2BC9A 5THQA 3VQYA 4CKEA 3GFPA 4AB1A 4OK3A 1W93A 4I6GA 1M56B 2FOXA 5JS2A 4F9TA 5HIKA 4AS2A 2CB0A 2IYTA 3D8SA 4PV7A 2WIAA 4OP2A 2FPGB 1P49A 4Y67A 4QUHA 4LGMA 1I7NA 1GDTA 1NA5A 3T3DA 4I5EA 4HOYA 2XRFA 3EPKA 4FLXA 4HDSB 4ZVKA 4BRZA 2QR3A 2HO4A 2YS7A 5JJCA 4LWOA 4FZVA 5KWIA 3S40A 4YT8A 4DB2A 5K3BA 2R97A 4MIOA 2JJQA 4CU2A 4OQDA 4MVJM 1E4YA 2V8BA 2H54A 2VZLA 4Q9AA 5EKSA 5IFKA 5GQSA 1QIGA 3PHLA 1T8TA 4M46A 1V5GA 1J2TA 3EFEA 2B6NA 4HDCA 1H3NA 1FQKA 1W52X 4Z86A 5AM0A 3IP5A 1Q57A 4QVIA 2FW0A 5AW9A 2C97A 2XE6A 5AHWA 3HS3A 4MLZA 4JEMA 1YGPA 2WF7A 3KQYA 2G7ZA 1P4SA 3QO8A 3TOXA 1VCIA 4YLYA 4EKEA 2TRSB 2EWMA 5BUQA 1JAHA 4TVBA 3LDCA 1WCWA 2QRUA 3QWFA 5AK5A 1U7OA 2CD7A 3DHVA 3E58A 1CZNA 1W0JG 4YUZA 4BGVA 2XCUA 4Q9DA 5C2JB 5JAPA 4G8CA 1IN1A 1X94A 2I6SA 1XQXA 1D4OA 1IBCA 5FLYA 4UE6A 1NVFA 3OQJA 5B1IA 4HYOA 4EQ6B 4GOMD 3BIJA 5CFRA 3LCCA 3BVPA 1X1TA 3KO8A 3W8FA 4EPVA 2JD0A 2RJNA 1W9HA 1YA8A 2H8PC 4IOJA 3N0VA 5DI9A 3UMSA 2GZSA 2G40A 1NLMA 1D6JA 3GCZA 5ALSA 3RU2A 2HU7A 3HCEA 2K5UA 2WDPA 3GJ5A 4H0CA 3ZZMA 3C0KA 3EWIA 2WVGA 1W5TA 4HEHA 3P96A 3R7WA 3OLYA 4DZTA 5FJIA 1MORA 3OKPA 3QE3A 3V1UA 5DXJA 3FPEA 2Y27A 1DX6A 1NYQA 2O9JA 1DPGA 2PKRA 4HX2A 3VPHA 5J2TA 2WJ3A 4I6JA 1NUAA 3H1LH 4AU1A 1UFRA 3FTDA 2XYVA 1U3DA 1B14A 1E6MA 1YR7A 5A0TA 1AMNA 3VC2A 1QG6A 3OQVA 3AZQA 4L07A 4IO1A 1BGXT 4YP5A 3CWCA 3PFFA 3ND5A 1HR0B 2LCQA 4WKNA 1SWVA 3OZXA 1MJNA 1PZGA 4POAA 2IUEA 4HEJA 2HNKA 3P0HA 3F8WA 1H1DA 5EHQA 2DG2A 2I2AA 4OMCA 3YASA 2Q4TA 2Z5GA 2QD5A 4F93B 1OZ0A 2XNKA 3RVRA 4YV2A 1N9ZA 2QY6A 3D31A 2JW5A 3CLSD 1X1DA 5TPZA 2BN4A 1GPBA 1QZXA 3GJZA 5JSHA 2ZR9A 4BVAA 4WASA 3AVTA 1Z22A 2FFHA 4XFKA 3HZZA 1Q3TA 4X61A 2IH5A 3HJTA 4OPAA 5LYYA 3A4VA 4OX9B 1MB4A 4UVAA 4YAFA 4I9QA 5DM2A 5HF6A 1U1EA 4KC0A 4U00A 4WXHA 2C2HA 1E61A 3OMIB 1HY3A 2XSZA 4E94A 5LWQA 4AP5A 3OWXA 4M9UA 1EP2B 4H7JA 1R7RA 1GILA 2QGNA 3DNFA 2PA3A 4DV6O 4G63A 1UJMA 3LUDA 3QPVA 5AJWA 2C99A 1BE0A 3AESB 4ZC1A 4EA6A 3C6ZA 3N7AA 2SBTA 2HCFA 2Q6LA 1KJNA 4BZQA 5H9WA 4C6HA 4ZKIA 1TQDA 4GX2A 4X8HA 4RIGA 1JG7A 4UMEA 3DC5A 4ZIRB 3GFFA 3JWEA 1T8SA 4S24A 1PNMA 1XD2A 2YQ5A 2RK6A 3MWKA 1WCXA 2ZM6O 4UU7A 3HGTA 1PGNA 4NXNO 1Y1QA 4JXXA 2JH3A 1EX7A 3L92A 1B26A 3A8TA 3F6YA 2D1YA 4PLZA 2V4DA 3F73A 3JSNA 1J2EA 3RSOA 1Y67A 2UYYA 3BK7A 1IOZA 2P77A 4ZVQA 1TA9A 5IVDA 1T1GA 4EHJA 2VXCA 2BLNA 4LEIA 4B8ZA 2Q2OA 1JG3A 4LW8A 1ISSA 1M56C 1YRHA 1OU0A 2HHLA 1FNCA 3CCFA 3IH5A 4ON9A 1ECLA 2P9GA 3RYHA 3FM9A 2CJXA 2YIJA 3LECA 3RS5A 4E5VA 4KUMA 4HDRA 1X7ZB 3B3FA 4Z4IA 3BRWD 1GN4A 4Q4JA 3P94A 3F7YC 4B6PA 1JIIA 4RORA 2XUQA 3GC6A 2AI3A 1NG9A 1TI7A 5ALZA 2NAFA 1Z7GA 4FB5A 1NJ8A 2A7XA 4IJUA 4XWWA 4WZAE 3UK0A 4N48A 4N0PA 4FFPA 2VXBA 4CH3A 1PEDA 4YJHA 4QJ5A 4UTVA 5ESDA 1BCRB 1T2DA 3R8CA 1PDVA 3V8BA 4FYJA 3ZBTA 3IPAA 1UJ5A 3DE7X 4OJNA 1JE0A 3UIEA 1SQQH 3FOZA 2VR1A 4LVUA 4F91B 3R3UA 2YEVB 3P45A 5B55A 3JQGB 2WLIA 4BATA 2IBMA 4R01A 2WQZA 3NUQA 5LNK1 1IZZA 1R0KA 1M6EX 5E1OA 3ZCXA 4E2XA 1AS3A 4W8HA 1AI5A 5I7WA 1GZSA 3SM9A 2DTEA 3E1GA 4G8JA 5C8YB 2P7IA 4CF7A 2D1TA 5CDTA 5BRAA 2GPYA 1C8BA 1S76D 4JI8O 1KA9H 3USZA 4NBWA 5TIIA 2IL1A 3UXMA 3GEBA 2A0WA 4GDFA 1GHTA 1AHHA 1DMRA 3EE6A 2G25A 1J5EB 1S5LZ 3G5UA 4BBZA 4G0MA 3C6QA 4I1RA 2X1MA 4J2TA 3SX4A 4I0WB 1V7QA 4ESVA 4DFDA 4FSXA 1VCHA 5HBGA 1JYFA 3VSBA 3VPAA 3QX7A 1IY1A 3GCXA 4AMBA 3OZAA 1QKIA 1II8B 1ABEA 3QSYA 4Q24A 2YC0A 1I51A 4BLQA 4I99A 5EMNA 1E8MA 4KQGA 1R73A 3OJWA 5BOSA 3JQPA 1YQTA 5EHZA 2CL0X 1G8KA 4C0AC 1KB9F 4DMUB 4XVRA 2X5NA 5T3YA 4AQYO 5ULLA 5FUXA 5EJ4A 3E8FA 4GXNA 4DLUA 2YZ2A 2IXBA 4P22A 2X3YA 3KAQA 1Z7EA 4MWBA 4EW1A 1K5GA 4CKBB 4CQNA 4OHKA 3I58A 3ZUGA 3Q12A 4MYRA 3D54D 2HCTA 1N57A 4OFBA 1V7ZA 5THXA 2DMXA 1ZNQO 1M9NA 5G4LA 3ZH9B 4REQA 4Q05A 3RWRD 5JTTA 2DUJA 1M90W 2OGUA 2ZIAA 4GEKA 4OHXA 3MLBA 2AE2A 1HWYA 2V6BA 3ICPA 1UM9B 4ZICA 4EFNA 1RPOA 4A2QA 1XU9A 5IF3A 4C3VA 4LF6B 1N9KA 5C1BA 2VC2B 4G5YA 5EXXA 3QXHA 1QP7A 4Y1GA 3VOBA 3CLUC 3OTOO 3FW1A 3I8OA 1FYXA 1L8DA 4P31A 2X7HA 2I91A 1ETUA 1YZFA 2YN2A 2VDWA 3BDAA 4O2AA 2NTEA 1Q74A 1ZTEA 4ER5A 2Q5HA 4IIHA 2OCGA 3AKYA 3IESA 1N9GB 4QOIA 2F67A 1Q22A 3A3YA 1D2CA 3BX1A 5FUMA 4OPMA 3VJKA 4PYQA 5L3DA 3ZOZA 3CPJB 1GRRA 1G4AE 3P4UA 4QE3A 1NPTO 4KIFA 4B48A 3EGXA 3UC9A 1NFQA 4CJXA 3VYSB 2BKUA 5KTKA 1L7AA 2B5UA 3OT1A 3HKDA 4CLOB 3TRDA 1X9IA 3L4BA 4BLWA 1T6XA 2DEUA 4EJ0A 2XZOA 1CUZA 2UUCB 1NJ2A 2XB4A 4HGRA 3SIXA 2C0QA 2YDYA 2A33A 1D0VA 1W0KA 2ZB4A 2ETVA 2JJ1D 2PLNA 4TQGA 3HKEA 1LJUA 4NBNA 2XNHA 4WFIA 3OOHA 2PO5A 5CLLA 3ZZ0A 3PLNA 4ZOLB 1ODFA 3RARA 3ZV5A 4MVJA 3U5TA 4LDPA 1Z35A 3TLYA 4YJFB 3MUNA 1SQ0A 4QE7A 3H4IA 1V47A 3FTQA 1KH1A 4TVKA 2XT0A 2Q3BA 8ABPA 3ED5A 1UP4A 4PQEA 3B70A 3WISA 4Z51A 1QC5B 3U10A 1G7CA 4H1HA 1T3LA 1JLMA 2FSIA 4P7GA 3UPDA 3HJBA 4EY7A 2VSOA 4MMXB 3G8AA 3T3MB 8GPBA 1USIA 3ZXUB 3FHTA 2JARA 3ETCA 1KEZA 1F2DA 4D1YA 4IIEA 1F4PA 3GIWA 3N2IA 1HO3A 4EKWA 1MT0A 4OLFA 3DNPA 3UA3A 4F72A 3GUVA 2O8DB 4F1WA 3HYLA 4PINA 4PF1A 2P9QA 1Q7GA 3O9MA 2C7RA 2F17A 2GZ2A 1Z28A 1QIIA 1IAVA 3SQWA 4E4TA 5B4UA 4G41A 4EHFA 3LXRA 4EBBA 1DHRA 5CK5A 4Y2PA 5CT5A 3FSEA 4BZZA 1VOTA 4I5FA 4U3JB 3PIIA 2JGFA 2H08A 3GJ3A 1Y4UA 2ZFUA 4PX5A 2GX6A 2QF7A 1R0YA 1PP9H 2HB6A 4I3HA 2PXXA 1K9SA 1E0JA 1A88A 1IIRA 3SQXA 1QHHA 1SOUA 1UPBA 2JLAA 1GU7A 2D3TA 2JBAB 3I2HA 5AI5A 4YJ2B 1CJKC 2HJVA 2RI0A 2BGWA 3EH2A 1TVMA 5BN1A 2BHSA 3VV2A 4FZ1A 4A1FA 4EW2A 5LQMA 2OZEA 2KB1A 3GLFA 3F6BX 4QTYA 1E7QA 3C24A 3RSZA 1ZK3A 2Y0EA 2OGSA 2B5WA 5CDUA 2VNIA 2I6XA 1QVAA 4ZZ3A 3LQRA 1VQLV 2IHVA 4GI2A 3E8HA 4XUDA 3TXQA 2A0YA 4LH6A 1NXWA 4BQQA 2ZBPA 1K33A 1PT5A 2KE5A 5FWYB 4DMGA 4JJGA 4N47A 1E3JA 3QA9A 1SVNA 1TF5A 5CA0A 5JRJA 4EF6A 3H75A 1QFZA 2GILA 3BJZA 3HB1A 2QIOA 2DR2A 3CJQA 4ZQFA 4KGDA 3MJ4A 1JXMA 3ZTTA 2H9IA 5L3VA 1QZUA 4AWAA 3DVAB 3WV5A 3TIGA 2VP3A 4FD3A 3I61A 5ALQA 1A5BB 3TNDA 3DDOA 2ODAA 5LUBA 4UEJA 1CDDA 4KV9A 2BUAA 3AVYA 4OYLA 4XWTA 2B20A 5HXAA 3E7FA 2PBLA 3JY6A 4DW8A 4JUCA 1P2VA 2QTFA 4H7FA 1RCTE 3K0SA 2QL6A 4J4BA 3U62A 5G0WA 2AN5A 1N2OA 5DZSA 3FE2A 3KDSE 4EKDA 2GO7A 1S72V 3KQNA 4H59A 3CRCA 3GMDA 2NO9A 4DUYO 1XALA 3SOPA 4MS2A 3P9RA 5AOAA 1UBNA 2IYYA 4LY0A 2NUAB 2ZSHA 2OV3A 3OE5A 2CUZA 2QM3A 1P18A 2YXEA 4LZOA 5CB4B 3WFZA 2XTAA 1EBBA 4JL6A 2GBPA 5EFZA 1RS0A 4P6VF 2LCFA 4HNGA 3O8BA 1N3LA 2VA8A 4B3BA 1VI6A 4LBWA 2MSKA 4PZEA 3IULA 5FTNA 1R18A 3DZBA 2REXB 3ABOB 4MCAA 1A3CA 3H7IA 5SZIA 4WBNB 5EJMA 3WG9A 4QUJA 2W22A 4FE3A 3PRKE 2QTBA 2PKEA 4MWCA 3MW8A 3JU3A 1CP2A 4E2FA 1ZOLA 3C1OA 1AQ6A 5BOVA 4LK2A 2P68A 1P1FA 3LF2A 3PL1A 3I4FA 3QVOA 2DT8A 4GXRA 2DLDA 3SGLA 5FOSA 2H4WA 3ZC3A 4JLOA 2JIQA 3M6UA 3JD2A 3RVPA 4IJ6A 4GE0A 2QRVA 4OF4A 4P7KA 3AB8A 2A78A 3ACBA 2TMYA 3PUWA 1OQAA 2QLJA 3MT8A 3KZXA 3RHZA 1GUAA 1PU2A 1P3Y1 4MAAA 2UYGA 3CIOA 3QFHA 2QMQA 4WLNA 1BS2A 4HCJA 2FK8A 1UJ6A 3SE0A 2ZQZA 4PCAA 1CY0A 5BV1A 2EJTA 1RLMA 4RZHA 3CMMA 1KDVA 4YHBA 1GXSA 3QKSB 4COOA 2J8ZA 2GQ0A 3L82B 4KRYA 1CUBA 3ONVA 2ZXWB 2HJFC 8LDHA 4XQCA 3TUIC 3NRJA 2E89A 1OVMA 1DKPA 4IRUB 4D3FA 2G88A 2O1XA 1ZMTA 4CKYA 3VU1A 2MWMA 2TYSB 2IK8A 5A3QA 1TX4B 5IULC 3JD0A 1FP4B 1KDRA 5H0IA 4ZEOA 3N27A 2RAFA 4IHKA 4LRTB 1E1LA 3K05A 3VU9B 3KFVA 5AJUA 1SUCA 4E2YA 5E7JA 5KAIZ 1CRZA 1WP9A 3LOQA 2CZQA 1NPYA 2FKNA 3MDSA 5JTUA 2W58A 1F48A 3K0FB 3DMYA 3M3DA 3DWIA 1T4CB 1XBTA 2JNWA 3R66A 1NI8A 1WSDA 3F67A 4O33A 2EV9A 4KGZA 3GMSA 1MRSA 3ZQUA 1NR5A 1ODKA 2Q7DA 1M1YE 2VFAA 2YVQA 4W1PA 5EPUA 3RVSA 3BGIA 2AR9A 3THYA 5C3MA 3GLRA 3Q40A 1GPKA 4XRRA 5KNCH 3G89A 4OHRA 2I6QA 1OB5A 4RGQA 4NJOA 1ODTC 2VT2A 4YJGA 2I87A 2EJRA 4FFKA 1YZYA 3K70B 1WMAA 4N01A 1EE9A 2ZQMA 3PFBA 4I0XA 3GEIA 3PVZA 4R83A 2VYVA 3O5AA 1Z26A 2DR0A 2IA5A 3E5MA 3Q9NA 2GLXA 5B1NA 1G6OA 2SKEA 1RBQA 4HAWA 5ITZA 2J6IA 5CR9A 3KU4A 3P0FA 2JKZA 1YQWA 4UHFA 1R5JA 4TKMA 1OUMA 3NX4A 1KOJA 4I55F 4Q19A 4BEWA 5M2QA 1RFYA 2X0EA 4O4LF 2M9MA 4ZCPA 3I2IA 3B1JA 1RWNA 2NTYC 4DS3A 4LCEA 2IV7A 1R74A 4FOSA 4QVGA 5IK2A 4DR4B 2OMEA 4GM1A 2ZDQA 4YI5A 2LP7A 1P7WA 1V35A 1F3OA 4L27A 1X8JA 5MHTA 1LI5A 5AVXA 4AO6A 1C7QA 3B3JA 3TLBA 3SJAC 3ANMA 3L7BA 4HBGA 3L6DA 4CM5A 4R16A 2BSAA 3LQQA 2AL7A 3WXBA 4X1YA 3OCZA 4U2BA 5LP6A 3KKOA 4PYMA 2FW9A 1O1YA 2I6GA 3N05A 4LQLA 4NEGA 3Q7RA 4MDEA 1Z73A 3B77A 1F12A 5JWHA 1BOFA 1B2LA 4KL1A 4URUR 5G0VA 3TFWA 2CCJA 4QX6A 5C53B 1DNPA 3FAKA 3ONDA 4YLGA 2F4VB 1N36B 3H97A 2JIDA 4IJ5A 2C8KA 3MJHA 4ENQA 5G4KB 4BXOA 3N0TA 1OFIA 1O4WA 4CG1A 3OX2A 2I67A 5ENZA 3B6IA 4MS1A 4YP7A 3RUHA 1UQTA 2BFCB 2LUOA 2ZIUB 2XDQB 3IALA 5DN6G 3BXGA 4GG1A 4GM0A 4OFXA 1NT4A 1WD7A 5KHGA 5BVHA 1UK8A 5K09A 2AF4C 1Y4MA 3ER8A 5E3IA 5TF4A 3CA8A 4BWAA 3JV7A 2V6MA 3UOWA 4O8ZA 2A84A 5JSUA 4YLEA 1VRVA 3LGXA 1VJ5A 2GPWA 3MTBA 2XRZA 4J03A 5EIEA 4HP8A 5I7UA 4AWXA 3TI9A 4OQLA 1YCHA 5FTWA 3G2JA 3V1LA 1ENVA 3M34A 2JAUA 4U4AA 1NSYA 3SN6A 3CZ9A 4YAUA 1XZGA 2QOEA 2IH4A 4PLTA 5AVYA 2AFIB 1PBNA 2QD4A 4BV9A 2JHAA 2GDJA 1RYZA 2FPPA 2QEXV 4TTRA 4Y9TA 1E1NA 4YVFA 5KNBD 2HADA 1ZGJA 4R8MA 1JTEA 4HWTA 1JEYA 3GGJA 2ANBA 4J3NA 4G23A 3HR4A 3SBXA 3KXDA 4HSEA 1T4GA 2YDXA 2WF6A 2EJWA 1KP3A 2QWXA 4K9PA 5C9ZA 1VE1A 2OY0A 4JBGA 4IX9A 4Y2RA 5CURA 4X6LA 2ERXA 4IILA 2FRVA 3TQHA 3ZWNA 3GOQA 3QUQA 1I7DA 3LVFO 1P1HA 2I9KA 1PSWA 1BZYA 4NCIA 4JGSA 4CVNA 2O57A 3STVA 1PEYA 1QB8A 1XO1A 4C6SA 4FT4A 3UO8B 2ZBVA 1E3TA 2ESRA 4PU0A 4FM1A 1AQJA 2YV2A 4F9GA 5DHPA 1PS9A 2XYGA 3IJEB 2FG5A 1C9JA 5EI5A 1GUZA 3QNWA 2PMWB 4NK5A 3G2OA 1B8PA 4MT8A 5LDDC 1IG3A 4FILA 4AXXA 2AG5A 4ZEWA 1NVVR 2RCNA 2ZTSA 2VJYA 3RAEC 3I32A 2WLNA 4QRIA 1YBFA 1NW8A 3SR2C 2P2LA 1MABA 1C4XA 2MW2B 1QV6A 1LQ2A 2L0XA 4NHOA 2HLPA 3PGXA 2PN1A 4BEVA 3U09A 5K3FA 3PNPA 2QRGA 3TAXA 2V1UA 3OQMA 1BD3A 1TUIA 4H1TA 2E2WA 4FKBA 4HQLA 1P62B 3A0UA 2ZBRA 2NU6B 4FCCA 3PDJA 2ZXWC 2PUVA 3CNEA 1S5HC 1XQ9A 1XJ0A 4MVRA 4KFMA 4TMZA 1N77A 4UVDA 3USCS 1OWOA 5F2NA 5K8IA 2QLTA 5M34A 2E55A 3OFNG 3CG4A 1DIGA 1GA1A 3DLTA 3ILXA 3W8EA 3EZLA 4UXHA 1W5FA 2DZDA 3H9UA 3G0HA 1ZD9A 5JYEA 3C7CB 5TT0A 3SVTA 3WNVA 5HKLA 5KLVH 3DEYX 2W83A 4IFTA 3UOAB 3AW9A 3GI1A 2WFLA 4TLEA 1IUOA 2PKXA 2Z56A 1I3CA 1I2CA 3DMDA 3FB1A 3FWKA 2F1IA 1W4RA 2ZRKA 4GC9A 1DIBA 1Q16A 4MQLA 5KNDH 4UV8A 3QVNA 3OUFA 4C4TA 4IH4A 3EQ9A 2GBIA 3R2JA 2O7VA 3OIWA 1SEVA 2C83A 5C37A 2JFOA 2C5AA 3I5MA 1TW2A 4JP8A 5DCWA 3L49A 2QTVB 3K70C 4NATA 3UZUA 2OSVA 2ZIXB 3H6KA 5B64A 2P2GA 2ZCUA 3ZLBA 4RGYA 2XCQA 3IT1A 5DNEA 5K6TA 5EIHA 2IOQA 1W25A 5J9PC 1QCYA 4D43A 3EZ6A 2X6BA 4HUQB 2AEEA 3S81A 3PU6A 3PFNA 3R75A 3T94A 5H5NA 1UWKA 3NGMA 2IUUA 3OZBA 4CEHB 2AFHE 3I9V6 1CUCA 2M6KA 3WLKX 1DC4A 2D5CA 2YCBA 1U0SY 2Q2VA 2C04A 3RLFA 4QDZA 3LLUA 5LCXA 2J41A 2VUHB 3D8CA 3PQCA 1I6WA 3SQLA 2M7WA 1F2TB 4KXLA 4QDOA 1OYOA 2AK3A 5B7PA 2JLUA 1QRUA 3HY3A 3DOUA 1Q0LA 5E7QA 4E5DA 1I7FA 1Y9AA 1JT2A 2OECA 1W48A 3KL2A 1KY3A 1I9CA 4J0GA 1ZW6A 4RJ2A 2LP4Y 2Q1YA 1KJWA 2J33A 3ML0A 3JPYA 3X2FA 4KKVA 4X3PA 1A69A 4P0PB 4CKCA 1P9WA 2GFHA 1RPRA 1CJMA 3WDSA 4X6YA 1X1RA 1Q11A 1T26A 2NAPA 2G3YA 3K1AA 4Z0PA 4MQ4A 3TZCA 2IUSA 3U1BA 2CXQA 3FWYA 2NO1A 4RA6A 5FULA 2PUEA 2HT1A 1HMPA 1Q0TA 4KQ1A 3WRWA 4DXDA 4RNDB 9MHTA 2CBXA 3IRVA 1VSTA 3KLMX 3JQAB 4LF4B 2C07A 3CNLA 1YCFA 3NW9A 5LYJF 4CGYA 2OXCA 1ORHA 3WZLA 2XWBF 4L8LA 5G0UA 1K66A 1NBME 5A3JA 5KYKA 2QL5A 4JI4B 2EIXA 3A06A 5FBRB 3FVRA 3LX6A 2JLBA 1RPTA 5E4JA 1N8RW 4EGQA 5GV7A 2ONYA 1EBFA 1ZCFA 4BV8A 3LP5A 2I2BA 2VDRB 5IJ0B 4B6QA 5JH7F 5AVWA 3AXTA 4COKA 2RHDA 4JA2A 4XGQA 3KUUA 1IXKA 1Y6XA 2QX6A 5CRIA 2PTHA 4Q34A 2RGBA 4KITB 4MH0R 3H8JA 1N2GA 3A1FA 2ZPAA 1ESCA 5JNWA 2HA4A 3QGMA 4UNIA 3NM4A 3D6MA 3RU7A 5CLGA 4R7TA 3DGEC 2QWOB 3S4YA 3SF0A 2GNAA 2VQDA 3T7IA 4XM0A 5MN4A 5TGZA 2VLIA 2BD0A 1P4HA 2X0IA 3IMGA 1MXFA 6PFKA 3F0TA 1M5TA 3CC2V 4NCNA 2QVBA 5IFLA 2F23A 2Y1FA 4RTMA 1UBSB 5T3UA 2WYUA 4F6LA 3FBWA 5JEEA 3V48A 2YUTA 4QYIB 4QFMA 3AO0B 2QMEA 1JV2B 4HJRA 3QF4B 4YT2A 3G7SA 4D4LA 4DWVA 5AW1A 2XKKA 3QENA 2AMYA 2NR5A 2ZVJA 4BC0A 2BCGY 3NV9A 2WBLC 3I3SR 1XXHA 4ABYA 3UFXB 3TSCA 1OW3B 4KXRA 3KSAC 4S0XA 2UZIR 4LYGA 3MNFA 4KVGA 4MQFA 4P92A 5F4ZA 3G1WA 1E4VA 3GH3A 2Y1LA 5LMNB 5D87A 3LYLA 4DUPA 4RIIA 5B5SA 4E07A 2I22A 4MKGA 3O7WA 3JYQA 3LLSA 5EJ7A 2R11A 3CCQV 3BORA 4I4TF 5KJ6A 4OQ4A 2ZT5A 4F11A 1DV2A 4F45A 2RDCA 4LC0A 4DIOA 3K0KA 1KJZA 4RANA 4BLUA 3L05A 3TI7A 1PM9A 6ABPA 2GFQA 1L4YA 3KFLA 1C4WA 1ZISA 1SKAA 5EGNA 3D3IA 2FV8A 2ONKA 3FPHA 3OEED 4L6AA 4IKEA 1R0WA 1U7WA 1YD7A 1X1QA 2RJ3A 4IIJB 2P5SA 2J48A 4ANFA 4BNNA 3KKNA 1C8VB 4BKPA 1EZJA 3R77A 1WY5A 3ZW7A 3DZFA 2G70A 2Y0IA 4DJ5X 2UAGA 3V2UA 1Y5LA 3OWOA 2B3TA 3OAAD 1JQ5A 4DDUA 1F2UA 5KTTA 2NWQA 3QHPA 4HB4A 3FXAA 2HIGA 5FQNA 3PD1A 1Z6TA 5BURA 1KY5A 4DWJA 2NLOA 3ENWA 3L7IA 2IS6A 1VKRA 1YJWV 4IMJB 3ZBPA 1GD1O 3HKCB 3ZWDA 4JUBA 3B6JA 7AT1A 4QTUB 4L08A 5KDOA 1W0KD 4G09A 4XEHA 5B3SB 3PHBE 2C31A 5FTLA 4YQEA 5G1OA 4Z8XA 3EEYA 1GN6A 3K0AB 2AX4A 4HAOA 3KSZO 2FI1A 4M22A 4QOSA 1IRXA 4IXWA 3K5LA 2RD2A 2GDSA 1ND5A 2V5UA 4MVJD 2C4HA 1NC1A 1H2AS 1Z3CA 2GYYA 4Q4DA 2XQGA 4HFRA 1AG9A 1GIAA 2GEKA 4H0LB 4RF4A 5J4VA 2A1TS 3QRWA 3E2PA 2VP2A 4PZLA 1C41A 1BN6A 4G89A 3DVRX 1C0PA 4ZT4A 2O2SA 2X1HA 3BB3A 4MUAA 1E4EB 3OO0A 3DC2A 4CKZA 3BEHA 4IVRA 2IV2X 4WBXC 1ONSA 3AEZA 4INZA 1NW7A 3BD7A 2QMZA 4N6NA 5IXJA 3R09A 3K0DA 1T5IA 3FDZA 1DRKA 3T7TA 5F2KA 2PKCA 1YFKA 5COQA 1WCIB 3WK4A 4HNRA 3J81k 1VIVA 4WOKA 3GL9A 2BCCH 1UANA 3D81A 3N0XA 4AIIA 3ACDA 1EAYA 1Y7TA 4FLWA 3UJ7A 4E4EA 4QOHA 3SDBA 4DF3A 3KJQA 2NP7A 2H0RA 2E1RA 5G1NA 2P2CA 3AFGA 5L3BA 1BHSA 4QM6A 2QAJA 2PMCA 2Q0QA 4HYYA 3PYMA 5KB3A 1QVVA 4XZ3A 3WC4A 1MPXA 2BUBA 3M5CA 1U1CA 4W1RA 4H3KB 4YR7A 3C3MA 2KX7A 3RJMA 2P9FA 2XH8A 1MVLA 4AN1A 1EB9A 3TH5A 1XKQA 5IC4A 1T4DA 1TKRA 2ERCA 2I8AA 3OUSA 1CUWA 4EATA 2O07A 2RI6A 3FN4A 5TARA 4H1VA 1M2GA 4CT4B 2FPUA 2CLCX 1L7XA 4TLAA 3LI2A 3CEJA 2QW0X 2WPDA 2HKOA 3DFZA 2WC1A 3TQCA 3SLGA 1XB2A 2X0FA 4PGMA 4O1IA 3WRVA 1E8DA 3Q2IA 1CNFA 3KPJA 5DOVA 3M1YA 1OPRA 2I2DA 1UBOS 2VJKA 1LJLA 4BMXA 4HDKB 5IZ4A 1P5ZB 4TMVA 4J8PA 3W9SA 2D6FA 2YXHA 4NENA 4Y2VA 2FDCA 2OILA 1DT5A 1X74A 5A7GA 1NG1A 2NVOA 1DXYA 4JNCA 3IC5A 2F4NA 3VU3A 4MWZA 3BL6A 4IVQA 4MHTA 3AZOA 2GF2A 2IDMA 4RKWA 3OUUA 4XSGA 5B2EA 1IWPB 5L4SA 5JPCA 4GOKA 4YGYA 1U2DA 2XYRA 3LBAA 1UH5A 4X7BA 4WKCA 3IAS6 3AB7A 3AG2B 1YOVB 1C0LA 4WKOA 3WKDA 1MRZA 4EPWA 1PR9A 3F5SA 1KAQA 5FR1A 5ILOA 4O59O 3IVMA 3ZWAA 1G9XA 3ILHA 1O6FA 1PO7A 2GK3A 2HHHO 2RARA 1ODSA 3C98A 1GGHA 3AVVA 1F06A 2ZS9A 2UKDA 3ZS9A 4FJ2A 1LSSA 3MUOA 5FTKA 4S3MA 3U4QA 2AOXA 1V8BA 1FXSA 3IQGX 4AVYA 3AJAA 3ABMB 3VYTB 3CKMA 3SF8A 1M2WA 2AE1A 4F2WA 2IE8A 4B3JA 4R2KA 5JWOA 2HMWA 1ZONA 4V1CA 3NHAA 3L8MA 2EZ4A 3K79A 3OX4A 3DTUB 2IYXA 4Q9KA 1CQXA 3BE4A 4F0JA 4B4OA 5AWFC 3DFUA 5CBFA 1OXSC 1I2MA 3BD9A 1RQNA 3G8YA 3JQFC 2VDUE 3RHTA 4C7JA 3LVRE 4LH7A 1SVSA 4MB2A 2L17A 1KE2A 2Q62A 4DR7O 2H51A 1GNLA 2YW9A 4JU9A 2J7KA 1QLEB 1J9GA 3VFDA 4DRXA 1NYRA 4Z7OB 3PEFA 1QHNA 4ZOEA 3LGSA 4MUEA 5CM2Z 2UXDB 2Q4OA 2WUDA 3W2HA 2N42A 5T57A 3QU4A 2DHCA 4FT2A 2QUBA 4OJKA 3I55V 3NI2A 4YDHB 3HKBA 4U2CA 3OQ6A 2WWHA 4C3UA 1VGVA 4Y0VA 4TWBA 3HYNA 3DBHB 1JH8A 4Y1EA 1P2FA 3KJXA 1XLVA 5KHOC 1AQUA 1DXOA 2MK3A 2CXHA 4GYKA 4WTOA 2IV3A 2Z2JA 1U3FA 2QU7A 1G6KA 4GBJA 4ER3A 2YVUA 5FOTA 4CTOA 5DBOA 1VE9A 2P11A 3DDHA 1WXIA 1O03A 5KTSA 1L4EA 2AKAB 4ARVA 4H7PA 2O48X 3R6TA 3WHLA 4LY6A 1GTJ1 3H3XA 2A1IA 1Y81A 4BMOB 2I3DA 3O2QB 5B3SC 4B4UA 3NAGA 1P84F 1Q77A 1UXOA 4G0OA 3KSDO 1U28C 4RD6A 2G4VA 3RODA 4EO7A 5BORA 1ZUHA 2CXSA 2RAPA 1J56A 1Z5PA 3LIPA 4PA9A 3SP1A 3E2EA 4HEQA 3MWDB 1C1DA 3WOHA 3O03A 3GP5A 3FZYA 4BYMA 4GKKO 4BASA 3VSDA 4LXUA 4JC4A 1GAEO 3T12A 1N0JA 2XAJA 5I48A 1I5RA 3VR2A 4D3XA 4CMEC 5KJEA 2QS9A 3EVBA 1Z36A 1AZTA 1TLTA 3AHJA 2C3MA 4KQMA 1KDZA 4OQNA 2Z8YM 1R0XA 3CCMV 1T3GA 1IOVA 2X14A 3UKJA 1XNHA 1HZZA 4XIFA 3PRJA 2ECFA 2YV4A 1NH2D 1ZK4A 3M2PA 1RI2A 2B7LA 2XE4A 3BF7A 1VQ8V 3WLHA 2ZR3A 4E7OA 2D7CA 4BZXA 1DO2A 3MHHC 5EE3A 1NTKH 1T8WA 1N6KA 4ZQHA 4E2ZA 2Q3HA 2LRHA 5B3JC 1PR4A 2VI5A 3CMAV 2DY1A 5TRTA 4XA8A 4LWSB 3FOWA 2H2AA 1AGXA 4C7KA 4BEBA 1PVDA 4C0LA 3IDQA 4KODA 2NUTB 3THRA 4D9IA 1Z4PX 1JQ3A 5IYCO 4K35A 1IDSA 3AEUA 4WSOA 3EK2A 1SKYB 4YRZA 1N7JA 1FJ2A 1EN6A 3KE8A 3PQEA 3FCCA 1EX9A 4ZO4A 2QAGB 3Q1KA 3A2LA 3NAQA 3WQHA 4DM3A 1BN7A 1UBFA 1C9EA 4D9BA 3Q7QA 1QCZA 4UVIA 3RJ9A 3LNNA 1IFXA 2F90A 3OY2A 4G1UC 4Y6RA 3WMGA 3K5HA 3BXHA 5AJYA 3OP4A 3ZI4A 1L5MA 5KOHA 4DCTA 2PMBA 4FYYA 3LDDA 1ENPA 2Q6TA 3QG5A 1O97D 4RZUA 1JLKA 2D5AA 3KB2A 4ZYUA 3TSYA 4US1R 4CH5A 1FJGO 3DZ8A 4FYMA 2UZ3A 2JS3A 2FN7A 4UHJA 1GV1A 1MB2A 1H22A 3NBAA 1E5XA 3C4VA 2Z95A 3STUA 2VK8A 1FX1A 2JJMA 5F77A 1YFLA 1T5EA 2J4DA 4TUYB 2XCRB 2QE6A 1QAMA 1YKGA 4HNTA 1DJOA 3OQBA 1VSUA 4RAQA 1R1BA 1RKBA 121PA 3E1KA 3TPFA 2R8YA 4G1MB 5K05A 5KKNB 5K3DA 2Z4SA 1QG4A 5EPEA 1K7EB 2CN1A 2HH9A 4HADA 1M76A 3TW8B 2FPKA 1PHRA 2QTOA 2DLCX 3AG2C 2AFVA 3E22A 4B3DA 2IS4A 4JT8A 2IHJA 1UKVY 1EDZA 5DASA 1JBEA 1CY4A 1CDOA 2YV3A 1I2DA 1R6UA 4E1AA 3OSUA 2PKQP 3LOPA 3HVJA 2ZNJA 2GN2A 4HZ3A 1I3OA 3ITDA 1JJBA 2HXSA 2JHPA 3LQKA 3I5YA 3ABMC 4HXEB 2EX3A 3D4LA 4X20A 1BW9B 4H7IA 4FR2A 3KSMA 3BMOA 4F21A 5GM2A 2OTCA 2QZPA 3QWIA 4N7RA 3NAMA 4DILA 1UXJA 3I0MA 2ILMA 1C5KA 4BVJA 3OF3A 2D1QA 2YJNA 1VMDA 3R6LA 3TK1A 3QUAA 4AMUA 5AW8A 4B6FA 4IZOA 1HQYE 1Q5PA 3LX5A 1F5SA 1JI3A 4BO2A 3P9ZA 3KQOA 4U1RA 4I7EA 2QBYB 2JEXA 3BJRA 1T3SA 5AVSA 1ZM7A 3E27A 4YN3A 1IY0A 3FDJA 2G38A 1XL0A 2XNJA 5JNUA 4HT3B 1GUYA 5K0TA 1U3UA 1QLEC 3KV3O 5EJAA 1AV6A 4OK5A 2ZWOA 2QTTA 1NNLA 4DMMA 3FETA 4AF8A 2NSLA 3ZY5A 2II6A 1L4GA 2BFPA 3WJ1A 3PDIA 1KR2A 3CCLV 4UFNA 2EFYA 4CNBA 5BW5A 4OKSA 2VATA 4RPLA 4TQUS 4XFJA 3SBDA 5GOTA 4FQ7A 3BDIA 4Z1MA 1DIAA 3LKVA 2H2HA 1PR1A 3SZ3A 1I32A 1ORRA 3BHIA 5JO9A 1EG2A 3HB7A 3QKTA 3LO5A 2F95B 1VQKV 1TVEA 1LPBB 3DT8A 4C21A 4HNAA 3THXA 2GOYA 3MVEA 2V1XA 1U7UA 1R0RE 4MKXA 3A1NA 2PPLA 1DJMA 3H13A 2WAMA 3Q87B 4EG4A 4RZ2A 3H11B 1DDOA 3VTZA 4C87A 1PV1A 4O4IF 1IZ3A 4AMGA 4HKTA 3H2JA 2FB9A 4W6ZA 1KIMA 2ZRFA 4H7EA 2O5VA 3L6UA 2JLZA 3TNLA 4DC1A 2E5FA 2BP7B 3W1VA 1EBUA 3C3JA 2V3WA 1NLYA 4B3GA 4R98A 2G9ZA 4ERNA 4QAJA 5GONF 5CX4A 1ZIXA 4UD2A 3KPUA 4NRDA 1W19A 3FYCA 2J07A 4ZI7A 1U5BA 3HSYA 2WHYA 3O0TA 3NP7A 4NTZA 4QFCA 1KDOA 3V1YA 1A5ZA 3KXIA 2PZLA 1FVHA 2B83A 3LY9A 2R1ZA 1XILA 2YV5A 5FLXN 1EG7A 2WMOB 1JQJC 1N8KA 3IAM1 4RSHA 2R9IA 1VKNA 3UJBA 1Y3BE 2VSXA 3STWA 1YHQV 1P2BA 4MCJA 2EJCA 2RB5A 4S05A 4WZZA 4HNVA 4MI9A 5CDHA 1QGYA 3K0BA 5B58C 4PC6A 2VUSA 2J0EA 3X3HA 3THWA 3PWTA 2B8NA 4DMKA 3AERB 3SEQA 3H1IH 1Z6YA 2XE8A 2FGJA 2J31A 3SMQA 5C3UA 2QNIA 2XGGA 3WDKA 1RRKA 1R12A 4JIGA 1T2UA 2Q6KA 1L4FA 4GYWA 2H07A 4DV7O 4GSYA 1DL5A 3H99A 2QAGC 6AT1A 4MTOA 4G4SO 3WKEA 4FZJA 1SU8A 1DQSA 2KG7B 1MJGM 4IPTA 1TL7C 3WBJA 1HGXA 3OCJA 1CP9A 3ZGLA 2K2WA 1G291 3HU1A 5FPPA 4LCBA 1JE1A 3IIJA 5BN4B 1XMOB 1UT5A 1VRWA 2UYCA 3PUJA 3HYCA 4HBZA 1P7YA 2VNJA 3HGQA 2HXGA 4II7A 1AILA 1LSOA 3VR5A 2PSFA 2AD5A 2HBQA 1RC8A 5JXWA 2P9EA 2VCYA 1POXA 2QJFA 1I8TA 1EM8A 3OU6A 3HDTA 4DL9A 2J87A 1RHQA 1DT3A 4AYTA 1AUQA 1NN5A 2WTMA 4TS1A 1U7TA 2PGLA 2O3UA 5A4MS 1WB6A 1G5RA 1C9NA 3KYIB 2DBRA 3ZVRA 5D6OA 4AG3A 1PNRA 3LCVB 3WL5A 5GTHZ 2MCFA 1XTUA 3CPSA 3MCAA 2IRWA 3T1QA 4U7HA 1D2EA 3G79A 1O0CA 3SGIA 1KFJB 4FFBB 1V54B 2J08A 4YDSA 2YXLA 4CTMA 3CC7V 1JJOA 4MA5A 1AKYA 4CS2A 1G20E 1KNQA 2JCSA 1SESA 2F1KA 4B1FA 1SBIA 1UFQA 5SY6A 2E3JA 2R8OA 2JD2A 1RZRD 1MIHA 1R10A 2DWUA 1K98A 3QA3E 3U61B 3E48A 2QRJA 1WVMA 3D5EA 2F9MA 3A1WA 2QVLA 5AHOA 4QREA 1XELA 3SQOA 5DYYA 4JBXA 4AG5A 2MINA 4H7DA 1XIVA 2APJA 1WMDA 4PZUA 4C43A 4QQFA 5DWDA 2AQKA 5E4TA 4OBWA 4DIUA 1JWBB 3W6ZA 2GN9A 4OIMA 4RQUA 3ISJA 4E46A 3WWCA 3LV8A 1H8EA 3TD2A 4CXMA 3DJFA 3FKSG 4KLZA 5D5QA 3RANA 1AI6A 4QDUA 4N0QA 2OSBA 1MB9A 4NECA 5H1YA 2ZSEA 5KVVA 1OT5A 1SVWA 4YUAA 3BXFA 3JZDA 4QGSA 1HETA 1EGAA 4NBTA 3L1JA 1HDJA 3U7QB 5CDYA 4EPRA 2Z8YA 1B3BA 2DUWA 2V3VA 4IDPA 4XH9B 2B9EA 4BBJA 2IU0A 1WKBA 3KQVA 1XQ6A 3C14C 2VZEA 1U1FA 4CF5A 1I9GA 4ZVRA 2PX5A 1Z4IA 3RN4A 5JZOA 5LU9A 2F66C 1G4YB 4PPYA 3WLJA 1Y8AA 2FJ0A 5JJKA 4WHMA 2MJLA 4UDOA 1A9OA 3GGOA 1U7ZA 4M6WA 5BN3A 1FFWA 3B3QA 3PPVA 3WZ2A 2NO0A 1AS2A 4H6XA 2NNUA 2A4MA 4QD3A 3L1KA 3EHEA 3F3YA 3NNDA 4FEGA 5AW7A 2H16A 4UFZA 1OLUA 4BLPA 3V4FA 2XLBA 3IT3A 2NN4A 3CRQA 4YMVA 6YASA 3QLEA 3WK9A 1RRGA 2YNMD 2TMDA 3RFCA 3T9EA 3DWEX 3BB4A 4G8BA 4HDNB 4JYPA 1KOFA 2GBLA 2V4MA 3QPDA 1QH1A 2Q07A 5E6RA 4FNOA 3TGPA 3DYIA 4WFHA 3HDYA 4M49A 2EWWA 5TQJA 3DCNA 4U7TB 2B25A 1T9BA 1SRRA 3RSGA 4Y2XA 1NRIA 4Y2YA 3COYA 5EXPA 1VQNV 3I4CA 3I23A 4N40A 1F6BA 5FUVA 1II0A 3H87A 2AF3C 5IVKA 2ATEA 4J11A 5ALMA 2RH4A 4IX1A 1H1LA 5C5EA 1GUBA 4AROA 5L3RA 4OUDA 3QU7A 3PE4A 4CM6A 5E6SB 2Z1NA 4TWIA 3TZ6A 1U9YA 1SEPA 4LZAA 2O0KA 4BNFA 3GCGA 2AKYA 3EVCA 4E5SA 3U0BA 5H3CA 4RAIA 1ZXXA 2E6KA 4ZT3A 4DIEA 3FJOA 4NB5A 1UKAA 2QX8A 3Q3IA 5H02A 4EAQA 2RE8A 3AGQA 2W37A 2OG1A 4AYXA 4IS2A 2VZ9A 4TROA 3AUYA 3ZN1A 4QYXA 5AXAA 1OJHA 4RE5A 3KS9A 1YUMA 2OCCB 5JAOA 1PGOA 3T9BA 5F9HA 1TEZA 3M6WA 1QCDA 4WUVA 5HFAA 5CCEA 4UEQA 3LQYA 1R8SA 5COBA 4ZTUB 2ZPTX 5J43A 4MIKA 5BSUA 2HRDA 1K97A 3FCYA 4QBTA 4AKSA 3HB0A 1AKQA 2JJ8A 2ZT7A 4QNNA 1QIFA 1GQ2A 4NG5A 2GD1O 1S2MA 2EJBA 5TXGA 1YIOA 3A11A 2WRZA 2DT5A 5F76A 1YZGA 2ZI9A 3PXDA 6Q21A 3B1YA 1SH7A 1ZICA 3B82A 1RAHA 1VBNA 4FX5A 5GM1A 1Z18A 2AUTA 2YVAA 1M54A 4UM8B 3OQ1A 1U0RA 5DRYA 4FDAA 4FMCF 4DDKA 2QRZA 1RM3A 5A2GA 1C4KA 2GN6A 4BQIA 3GUUA 4OEHA 2NTNA 1Q6HA 4JF3A 1VHLA 1OXXK 4BNWA 1DAMA 1BVYF 2XI4A 3LWBA 5FUQA 1FNBA 5CGQB 3VVLA 2IZ7A 2RBKA 4M36A 4B3SB 2QGZA 3BF8A 4DLAA 4LCUC 4ESEA 2C5FA 3N2YA 2BBTA 2FEPA 3H4TA 1JHZA 3JATB 2YIMA 4UPEA 4UBOA 4I2NA 1LPMA 5FKJA 4NFYA 4CKWB 2HN9A 1BXGA 1H5NA 4BGEA 3T3GA 1KQPA 2F8TA 3B85A 5DX1A 4PI0A 5JG7A 4ONEA 2C0PA 1C3OA 2PT9A 4JH0A 4GAEA 2GKSA 3DE1X 1G0NA 4AM8A 2XZTA 2OUIA 2EG5A 1GCOA 1M83A 4I7ZB 2AUMA 3H1BA 1DWQA 4GBGA 2LGQA 4J1QA 1YCGA 1SUAA 1V54C 4OQQA 3AEKB 5KCZA 1Z2PX 1A7UA 4B7KA 1Y0BA 2BH2A 1E2BA 5HQ3A 4FWIB 3RABA 2I4OA 3SC2B 4JC0A 2BKAA 2GD6A 2NQ8A 3SYMA 2BPOA 1RHRA 2OLKA 4G27B 2Q8NA 1O8BA 3O1LA 1ZZEA 1V45E 4ND6A 3BT7A 3K5MA 3PG5A 1VB5A 3OSZA 4FYHA 1LLUA 2ADOA 2F8SA 4Q4LA 5G2OA 1M6WA 1Y5MA 2OV4A 2VKQA 2G1JA 1G9SA 1M72A 1T2CA 5A9RA 1BH2A 1WDTA 4UUOA 4QGPA 1B6GA 3J81A 3PX3A 5EJEA 2D00A 4GXTA 1T9GR 2R3SA 1Q6IA 4DV0B 3O47A 3VDMA 1A98A 3COPA 3ORQA 4W82A 4F8JA 3VUEA 3KQPA 1BS9A 3CUTA 5HFMA 3T3PB 3ROTA 1A4XA 2SKDA 2XB8A 1G59A 1I7QB 2JVJA 2XYQA 1VCOA 5TQ0B 4G36A 3L7MA 1F8XA 1GL6A 2AR7A 1MP0A 5DXAA 3G2QA 1N5KA 1P1RA 2QN7A 4II2A 4DGSA 3AFIA 3B9QA 2G83A 5BMVA 3OZSA 4G5RA 4Y9SA 1GZDA 4J42A 2RQ6A 1TC2A 3LCUA 4EA9A 1EI9A 3IKJA 5IYZF 1VBMA 3RUAA 5FPRA 4V3BA 3F97A 4LYHA 4NMMA 5A9SB 1UK9A 3IJ5A 1KAGA 4O02B 1J0CA 4M8KA 3ZS8A 1W4AA 2I2XB 3PPXA 4AL4A 3VYUB 3VKFA 1D7AA 3Q5DA 3E0QA 3DUFB 1SHTX 2H7VA 1V4VA 1R5BA 4B4VA 1NF8A 5I7EA 3KL4A 4MO9A 1TZJA 1PQPA 3IO3A 4FGJA 4EABA 3NVKI 4HWRA 4R2WA 3DV0B 3E03A 4FNMA 1YS9A 5DVZA 5TGDA 5SYMA 4DCSA 1LDGA 4YAOA 4RSGA 1GZ6A 5LUAA 4S1VA 2YR0A 3M8AA 1ONPA 4AP6A 4FM9A 3V42A 4A6EA 1JQLB 1MJGA 3CSDA 3ZHUA 1FMJA 4RGBA 4JOCA 5AUPB 2QN2A 4V0RA 1TTTA 3KJFA 1G8HA 4BL5A 5LXTA 3J7AC 4JSYA 2PCLA 1TT7A 1L7PA 2O5EA 2J7PA 2QRMA 2A5JA 3OCCA 4DCPA 1BDMA 1XTRA 2M2IA 4N4AA 2HIHA 3HPLC 4MGHA 3SDSA 3CF6R 2GA9A 4JI0O 3DP7A 1CV2A 4LECA 3GNTA 4KRFA 2BHNA 1QU7A 3OCXA 4QDKA 2W9XA 2VRNA 3I76A 2EGHA 5LB2A 2WEKA 3I6ZA 3SZMA 2YJ6A 3GMIA 4B08A 2XUOA 3RW0A 3E3NA 5FO1A 5E2BA 3QO7A 1M57B 3O8CA 4B87A 1R4NA 5CA1A 2H2DA 4IOMA 1MTOA 5K6RA 1VP3A 3S2YA 4IY1A 5JDCC 3PEUA 4UVCA 3IC9A 5D5HA 5HM6A 3GLHE 3DXRA 4JZKA 3EZYA 4MW1A 4JELA 4B46A 3KB1A 5B53A 4EYSA 2REQB 2H9YA 1YB5A 1GSAA 3OOYA 2XCIA 5ERGB 3PPIA 4FWBA 3U9SA 3RYCA 2ZRAA 4RM3A 1NHWA 3FTNA 4QG7A 2FGKA 1MVNA 1SR8A 4FYWA 1W5SA 2Z04A 2OXRA 2VIIA 4CDRA 3U7HB 3GP8A 4PQYA 4QOGA 1FAFA 1TFRA 3SR4A 2A88A 3ZWOA 3ZCRA 2E5LO 4ISBA 2PWAA 2R47A 4YMTA 4ZVVA 3RGGA 4KHPB 1QYRA 2FMTA 4R5MA 2DJIA 1OT3A 1V1RB 1U8CB 3BFRA 2G28A 2ZDGA 1FRVA 4D82A 3KZIZ 3IPYA 3RT9A 4V0SA 1FXKB 4GQAA 4X1IA 1JXAA 5DIZA 3GPLA 3X2EA 3GGSA 4LJ5A 1XCGB 5F12A 4G2TA 5TPZD 3PFIA 4KKXB 4GIBA 5F1PA 1CETA 3BFJA 4JI1B 4O4JF 2VAMA 1VTKA 3W8DA 4ZC8A 3D7KA 1V1MB 3ZBUA 5DX0A 5E2AA 4KYTA 1M66A 1SWWA 4CL0A 2WA3A 4KJZA 4RD3A 3UGJA 5MDHA 1K34A 1QIJA 3BRQA 3DR3A 2O8FB 4EGSA 4J0EA 3OW2U 3KYCB 2PAAA 3GLSA 2OZPA 2VWQA 2FL4A 2BFBB 2XSZD 2HWKA 1O58A 1K8YB 1WWKA 4N12A 2XGOA 4K8ZA 3IVRA 4JEIA 3NVDA 5AOBA 2EATA 1BL8A 4RUKA 4MB6A 1Z5NA 5F51A 4Q12A 4QBGB 4YPVA 4OGGA 5IS2A 5CDFA 1ML4A 2IW5A 4BBPA 1NTZH 1DWPA 5HSGA 2QUZA 4S2UA 4AJ1A 2F8MA 1SQBH 2C0CA 2AJBA 4I1SA 4HLUC 1Y66A 2J0VA 1IWOA 4LGCA 2OAQ1 2XMGA 1ZNZA 1CE8A 1JBKA 3LUCA 1PW5A 2O7QA 5BR8O 3GFQA 3O9ZA 4NPHA 5DHRA 4QHSA 1U9ZA 2PSDA 3I04M 3IVCA 3MC1A 3HJFA 2ID4A 3SBOA 4G07A 5P21A 4F4LA 2IXAA 1TM1E 5ADVA 2A5FA 3M89A 4M7RA 4C7XA 9ABPA 4FGSA 3HMQA 4AULA 1XBLA 1X8LA 3HBNA 3KEFA 3GN1A 4F8EA 5JR3A 3N2EA 2R86A 4N3AA 3ENKA 2YZMA 2EZTA 2ZYRA 4IHJF 1C30A 5AKHA 1USVA 4YCJA 2IPOA 2NNLD 1G8JA 2C82A 1XWWA 2ZJ4A 1WDWB 3MZ0A 2CT8A 1E2IA 3FUUA 3B20A 1LLDA 1VL5A 1JBQA 5D2CA 3KOXA 4M1YA 3AKZA 2R6CA 1SBHA 1TU4A 1P33A 1I2ZA 3M33A 4J6FA 5FPKA 4KYVA 1M2NA 4F4HA 3DW1X 1BQ0A 3CRZA 4MP6A 2PXCA 2Q0XA 3L7AA 2PX4A 3C7TA 4CT0A 4BCCA 4B83A 3AI3A 1DBRA 1AXEA 4MQBA 4KO3S 2ODQA 3CZ5A 2X4LA 1KAOA 4MHOA 2A5LA 2CV0A 4JBHA 4ZJYA 2I8CA 3KCNA 1VQ9V 5HQJA 3CS3A 5BXZA 2Q29A 4M9CA 1PUIA 4GPBA 2R6HA 2YZKA 3ZVMA 3JASB 3AM5A 4WN3A 5GOZA 2Y0CA 1FFHA 1P60A 3K3PA 3WLTA 3DBOB 1NBIA 1LDEA 1MCZA 1QDUA 1Z3IX 2J9YB 5GTDA 4WCFB 4QDTA 4RENA 2Z58A 4BLVA 1PN3A 3K03A 4BNIA 5F78A 2GR9A 5FX2A 2FN9A 3ULKA 2DFVA 1BDHA 2Q0OC 1YE3A 2HNAA 3AHHA 1CRPA 1A9XA 4RULA 2R96A 4Y7DA 3RS3A 4GKJB 2IJGX 3GFSA 3C85A 1TU0A 3BCSA 2Z9BA 1T5TA 4L72A 2ID8A 4KGXA 1HX7A 1OIWA 4R1PA 4GXQA 3SKYA 3C3XA 5I7VA 4D4KA 1TM2A 5DI3A 1U98A 3ZXSA 4EDHA 1VYVA 2GTPA 5HNKA 2JA2A 1MGPA 1GFSA 3ZRVA 1WB5A 1M57C 2HYDA 2QUKA 1X13A 3EGWA 3A6FA 1P6QA 3MTEA 2O1SA 3FGZA 4MK4A 2DU8A 4HH1A 2ZIEA 4YO8A 3GOHA 2H4YA 1QIHA 4XGNA 2GV9A 1V43A 5KVQA 2J3HA 3KJHA 3NHUA 4GOND 1QTNA 3U26A 1KYQA 1ISFA 2WKQA 3M5DA 1X1SA 3FPBA 3OA0A 3ZCQA 4I5GA 4PS0A 1VIAA 4WOBA 5FV4A 4W9NA 1P72A 4GR5A 3LD9A 4OAQA 3I53A 1QE3A 4FFVA 3CF4G 3X1DA 4OMUA 1NJ1A 4UJ5A 6REQB 1AQNA 2AOTB 1BE6A 4JJ8A 1UBHS 2EIJB 4RBNA 4TQFA 2QROA 1GPYA 3AJ8A 2PH5A 1NW5A 4J29A 4A8JA 1NV9A 3RUEA 3K30A 3AI1A 3G0CA 2Q5ZA 1W1WA 4F4IA 2OHHA 5CXQA 3OPQA 4GNRA 4N5HX 4D8VA 1TEXA 2GJ4A 1FXKC 4W63A 4L4UA 1SKMA 4DR6O 4AZ3B 1IU9A 2XWJI 4F84A 2AOWA 1OMOA 2CLSA 1L4KA 3X1XA 4RD1A 3AR4A 3I9KA 2FLKA 2HMTA 1UZLA 3TCUA 3EIOA 1X7YA 3OLVA 2OC4A 1DEAA 3L4SO 3QV1A 2XB6A 2YSUB 1J09A 3G0BA 1SD2A 3PGMA 1QR8A 3D8TA 1SHUX 3ABZA 4PSDA 5A4IS 4MSUA 1EEHA 5CX1A 1SU7A 4C4YA 5A4KA 4OSOA 5FRDA 4MAFA 2IXFA 2YDEA 1URPA 1KS2A 2CVHA 3JWPA 1BHJA 4KNVA 4I9HA 4W5QA 4OY3A 1T1SA</