1R6VA

Crystal structure of fervidolysin from fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
671
structure length
671
Chain Sequence
b'SKAKDLASLPEIKSQGYHILFGELRDGEYTEGKILVGYNDRSEVDKIVKAVNGKVVLELPQIKVVSIKLNGMTVKQAYDKIKALALKGIRYVEPSYKRELIKPTVVKPNPDMYKIRKPGLNSTARDYGEELSNELWGLEAIGVTQQLWEEASGTNIIVAVVDTGVDGTHPDLEGQVIAGYRPAFDEELPAGTDSSYGGSAGTHVAGTIAAKKDGKGIVGVAPGAKIMPIVIFDDPALVGGNGYVGDDYVAAGIIWATDHGAKVMNHSWGGWGYSYTMKEAFDYAMEHGVVMVVSAGNNTSDSHHQYPAGYPGVIQVAALDYYGGTFRVAGFSSRSDGVSVGAPGVTILSTVPGEDSIGYEGHNENVPATNGGTYDYYQGTSMAAPHVTGVVAVLLQKFPNAKPWQIRKLLENTAFDFNGNGWDHDTGYGLVKLDAALQGPLPTQGGVEEFQVVVTDAKGNFGVPTVFVSMMRDNGSCYYAKTGPDGIARFPHIDSGTYDIFVGGPDHWDRALAPYDGESIPGGYAIALRMAEERQASFVGFGVSPDATQLNVNFNSTLQVKFSTNLSTLKDPQFVVVDPLLRGVYGRVAYARNQTYDLSLLSGQISFGIQTLLPAATDITIQGTVTLNGEDIPVYGVLKAGTTWTIIDDFGGLNLGTDSQPIYVWWTIFGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords subtilisin-like serine protease
publication title Crystal structure of fervidolysin from Fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin.
pubmed doi rcsb
source organism Fervidobacterium pennivorans
molecule tags Hydrolase
total genus 183
structure length 671
sequence length 671
ec nomenclature
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r6vA04
2.60.40.1800 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1r6vA01
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 1r6vA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1r6vA03
2FZ3A 3WFCH 3LDBC 2DAVA 4ZOQI 3GIZH 3QDGB 3EDJA 1CF8L 4UT9H 3PWPA 3RGVC 1T2JA 3ARDC 3BPSA 1OSZB 1MPAH 4QRRE 1F6AB 4OI8A 2P5ED 4LCUB 1RIHL 1P6AB 4U6HB 3C8KA 2F5BL 4HK3J 1IAIL 5K9KA 1SN7A 1DJSA 3ZL4H 4P9HH 4Y4FD 4KVNL 1AE6H 4HEME 3JZ7A 1F90L 2ED8A 4KVCH 3WFZA 4D2NA 3QB7C 4HS6B 3KYMA 3MRNB 2XA3A 5KVEL 4NRXB 1UKSA 3OKDA 1INEH 1UZ8A 2H41A 5FCSH 3OHXA 4ZQKB 3BYYA 4LF3B 3N0PB 1ES0A 3LQZB 1UB5B 2PW2A 4LNRB 2LU3A 3TO2A 4Y5XA 2XTJD 3K8KA 2ZWPA 2J8UF 1HT3A 4KZDL 3D39B 1G7HA 4I18C 5DURB 3TO4B 3BRDA 1IRAY 5A3IC 2VRAA 2X7LB 3SKJH 5BVPL 4LEXL 1LO4H 3DWEX 3X12B 1MLCA 4YNYA 3T65A 1OLLA 5CJ8A 1JZ4A 3EO9L 5IHZB 1T66D 4N9GB 1RULH 1FAKT 3IT8D 1X5KA 2CUMA 1CDCA 2Z8SA 3RWHA 1KGCE 5AYQA 3MA7A 1G6RB 1J12A 5SWSB 1CDYA 1MF2H 4MA7H 3I6LE 4Y8AA 1B4JH 3D25A 4JZNA 4PP2A 3GGWA 3GHBL 3V5HB 2EDLA 3MRIB 4H1LB 4Z7WA 3EYSL 2BRRH 4HUNB 2OYPA 2OI9B 5E5MA 4ZODA 2QQNH 2P5WB 4U1SB 1JTOA 4KMTL 3MNVB 1WZ1L 3MMEB 1KIUA 2XKNA 3EIFA 1YEHH 4RAUA 2JELL 4P3CL 4D0BB 5AQEA 5BOZG 4CJ0A 5F96L 1TTFA 5D8JL 1MFDH 3MR9B 4Y19A 3BH9A 4L5FL 2OTPA 2O61B 1A2YB 2I07A 5IG7B 1HHHA 1NGXB 4QHUA 1PBYA 3WXVH 1R5VB 2C5DC 2O5ZL 4XPHH 3U4BH 4ZFFB 5ESAA 3KG5A 3MRHA 2C9AA 3LB6C 4OT1L 1SVNA 3TV3L 4P9HC 5F7EH 1CTNA 1NBVH 5C0DB 3L7EA 4RISL 3N1QC 1S5IH 5I1HH 5C09E 3VFGH 1X5YA 3CFBB 3PNWB 1FVDA 5D6DA 4YE4H 2G60L 2FX7H 4YEEA 4LBEB 4OLZL 4U4BA 5DJZB 4Z7NE 3SDDA 2R9HC 4OZFA 5DA0B 2VC2H 4N5UA 3GNML 4LHUA 4UNVA 5CMAA 4XZUB 2ZCKL 5KSVB 2E3VA 2PWAA 1T03L 4NQUA 5DUBA 2YPLB 2DQJL 2YUZA 1CVSC 1AQNA 1XIWA 3HZYB 4M61B 5IMKB 5T33H 1JPST 3JUZA 5ANMA 4C55A 2Z2YA 1S5HA 1YN7B 4XI5D 1TM5E 1NC4B 3WV0A 1CE1L 1JP5A 3C87A 3UJIH 4YHLL 5FM4A 4IDJH 2WWKO 3HMWL 5J12C 2VSDA 1NPUA 4ZYKA 1IGYA 1CU4H 4GJTB 5JIIA 4M9OA 1OQXA 4MWFB 3TT1L 5IEHB 4EDWL 1H8NA 2PCPB 1ZKAA 2P24A 4NPYB 4Y1AD 3Q6FA 3ZKMD 3DXAB 4HC1H 1JZ7A 1INQA 5D72H 3OKKA 4Q97A 5I15H 4MAUH 2P8PB 1KLFA 3MRJA 1SMAA 4R90H 3R1GL 4CJ1A 2HYMA 5F1KC 2WUWE 1XF3A 5E24E 3JV4A 3E3QC 3HUJB 3FQNA 3QR2A 1JL8A 1DL7L 2X70B 1M7IB 2W07A 3ARFC 1F4WL 1WTGT 3AAZB 4GW5A 4HXBL 1J8KA 1CFBA 2Z31D 4WV1B 4F7CB 5IJVB 1GL4B 4EIZC 1F42A 3QIUA 1N64H 1X4ZA 1GTG1 3GBLA 3I50H 1GXEA 3S88H 1Y1KE 3IFOA 4JVPA 5A2KH 1IAOB 4WUKL 2V5TA 4MAYD 2Z0BA 5GS2D 2IANB 2CUIA 2ZNWA 4MQ7A 5ICYA 3FB8B 3F58H 4LRNL 4X9GA 1U8HB 2X1OA 5F71A 4UTBL 2XWJB 1ZHBB 1FVEA 2MTPA 4F80A 1U8PB 5DQ9A 5JXHA 3QNXA 3NPSB 3VV3A 3BOVA 3VRJB 1EHAA 4G43A 1Q72L 3BT2H 1PSKH 4LAJH 5FDWB 5MENA 3EYQD 8FABB 2EZ0C 4YJZL 3O3AB 2HLAA 1YY9C 2BSTB 3CZFB 4P5KB 4Q9QH 3MGOB 4POZD 3ROOB 3SOBL 4P5TD 1R3JA 2BNUA 4ODUA 3VWJD 3QFHA 4LLMB 4ONGL 4HGKC 5EPMB 1NMAH 4APQC 3DX7A 4LCWB 5DJXA 3IXAA 1VA9A 2APTA 2GI7A 3NH7H 1KN2L 2X4NB 3TA3A 4LPTA 4NNXA 4D0DB 4CVXB 2YZ1A 4KY1H 4PJIB 1S02A 2JJTA 5GGVL 1ZSDB 4Z77A 1SJEB 5INCB 5HDQL 15C8H 2DTSA 2A0LD 4S2SB 3L3HA 2DN7A 1UXSA 3DO7B 4WI4A 2P4EA 4FTVD 5L8KB 3VG0L 4G7YL 2EEAA 4ZXBD 2BVUA 1KB5B 1JN6A 1MHPH 1RZFH 1TXKA 2R1XA 2X4TB 1S9WB 4IOSD 3MXVH 2RQ8A 3RBSA 4X6DE 4QWWC 3FQTA 1KCVL 4OLXH 2OTWA 4GQPH 1L0XA 2MHAB 1FG2A 4RQQA 4XAKE 4I2XB 5HHNA 3IFNL 3F8UB 2Q3AA 1PFCA 4WI5A 1UA6H 4JO3L 4EUPG 2KZWA 3JWDH 2C7UA 1HXYA 3UYRH 1NLUA 4LL9A 3UCRA 4MHHG 1R6VA 4IOFC 4NZRL 4HJ0D 4TUJB 4NE9C 3QDHA 1A7BA 3P0YH 4D0CA 4L4TA 4HDIA 5LBSL 2DWDB 4BFIB 5E0QA 4RFEA 3PWPD 3MNZB 2PO6A 3ESVF 4NT6A 5I8KL 4ELMB 5JDSB 1FFPB 2YK1H 5DWUL 1GSMA 2JIXD 2ICWI 3LKNA 3QEQB 5FYLE 1GZPB 3KR3L 3WIHA 3DMMC 3GBML 4PG9A 4EVNA 1U92A 2Q86B 2VXSH 2J5LC 5BMFH 5C0CD 4LSQH 2EDFA 4HX1A 4TOYH 3K2UH 2AGJH 5C0FB 5DA4A 1F3JB 1OAYL 5JQ6H 3OSKA 4IOIA 5C8JA 1GGIH 1VKXB 1HN1A 4KUCD 4G42B 1BJMA 3VFOA 2BX5A 5GIRB 3ULUL 3CFKA 3QXDB 1YEGL 2H1PH 4J3VA 1JFQL 5DJDB 5JW3H 2H3NB 1NGZB 4QXGL 1MJ7L 5JXGA 5TE6H 4PJ7A 3BIBX 1G0YR 4KUZH 1LE5B 2W2PA 3BUYB 5T3ZE 1RZJL 4ZUSB 2VDPL 1G7PB 1BF8A 1N6QL 4LRIC 5DJAA 1T4KA 1J7VR 4FFZL 3IDGB 3KLSA 3B5HA 3M1BA 2PTTA 1BZ9B 3E6FA 1R0RE 4J94A 4EI6A 3T1WA 4R4NC 5MERB 4MCZB 2X4UA 4GMTH 2MWCA 3LV3A 1RZGA 3HUJF 3BPOC 3B8YA 2VIRA 3T2OA 5DJCB 4XH2B 4BYHA 1DTUA 3C08H 3TBSB 4HXAL 4JY6B 4WWKC 3RPIA 3IDJB 3GUTB 2FEEI 2JJUA 3D2UA 4L4VB 2XACC 5DI8B 1V5JA 3QXVA 3DI2B 4UDTA 4O4YL 3PQYD 4KJQC 2V2TB 3JTSB 3W82A 1A7RH 3HG1B 3KDMB 2IC2A 3FOMA 4YIQA 4FFYH 5C3TA 2OL3H 4G5ZH 3JWDC 4GG8A 3UEZA 2BY3A 3K74B 5E6ZA 1OB1B 2DS4A 5HYIA 2BDNL 1JGDB 2X2YA 2N7BA 2CQVA 5HGBA 3ES6A 4P2YA 5LJYH 2G9HA 1AFVH 5CSBA 4HWZB 1YEEL 4CADB 3OV6A 5HHVH 4DCQB 5HBBA 4MD4B 3RZCA 4QXUH 2B2XH 5J11B 3C5JA 2FJFA 5L2KA 4Z0XB 2Y25A 4M48L 5H2BA 1K8IA 4RBPK 3WCYA 2Q76A 3TBYA 2EDWA 3BRGC 1RV6X 5KSAC 1DANT 1BIIA 2A1WH 3SJVE 4HUVA 1JHLH 2FJGB 3E3QE 4KGJA 2FECL 4FQ2H 1R64A 1LK2B 5LG1A 3TJEH 3B3IB 3CNQP 3SGDI 4J2XA 3F7VB 3IYLW 3LEVL 1DEEB 4MXWH 4H88H 4PJIF 1D5ZA 3PV6B 4KV5E 4PRPE 5E7FA 3CDGB 4N8VB 3WN5C 1YQVH 2UVFA 4IBLT 5IB1B 3QXTA 5HI3C 4O00A 3FO9B 4MJIE 1OTTC 5E9DB 3S5LG 1Y6KR 4PTUB 4G8GE 4PJXE 3BEWA 1DBAH 1YEKH 1TJGH 5I1JH 5EU7E 2IG2H 2VLKB 5D7IB 4TRPL 3VXME 5IOPB 4YHKL 1HXMB 3MLYH 2DQEL 3RVTD 3TN0A 3ULUE 1FNEB 1ZVSB 2Z91A 5C0IA 3RHWK 1Z6JT 4UTAH 5GRJH 3BP7A 2ZJSL 4X4YA 2Z30A 5IIEA 1T1ZB 4P4KB 1R0AH 4CMMB 1P4IH 1ZVYA 4JKKA 4K8RA 4IHOB 2OS7A 1SEQH 3WLBB 1YMHA 3QO1A 2VLRA 3VHQA 3GSWA 4OZ4A 3LXUX 4N0FB 4DZBB 2E6JA 3PP3H 1IC6A 1U41A 4WW1B 2BFVL 1MWAL 1IGCL 1P84K 1K2DA 2XWBA 2ZSWB 5E70A 5GZOD 4ELMF 5L9DH 3CFDB 1W0WB 3OKEA 4U6YA 5ALBL 1N6UA 3OJDB 5LGKA 4FRWA 4HUXA 5CJOL 2Q8AL 4M7LH 1OD9A 2NTFB 4MVBC 1OGTA 1IQWL 3WIUA 1IFHL 4QCIA 4J4PA 4NQCD 4L1HA 1C08A 2AXHA 3STLA 1RZ7L 2UZIH 5DJ6B 5IW6B 4EQ2A 5FHAL 4F7TB 1ZMYA 5KVGL 3MRBB 3LN4B 5AAMA 2F53A 4R0LA 1DQMH 3INUH 1U8NB 4Z18A 5JA9A 1P4BL 5AD0B 3BN3B 3HE6D 4G6FD 3UTQA 1LO5A 4R4FL 5IHLB 5HYSB 4QHNA 2SICE 1HZHH 1A5FL 1FQ9C 4I3RH 5CEZD 1H3TA 1CXKA 1T5XA 2AABH 5DVLA 2LQRA 3VA2C 3MLXL 1EAPB 4CU8A 2BCKA 4JQXC 4IS6A 2R23B 1BBJB 1JUFA 2L7JA 3KPOA 3L3IA 5DZOA 5FECA 1P7KB 4MA8L 1SVZA 2L0DA 5HHXL 2YD3A 4TUOB 4FQPA 4EBQH 1CFTB 1DLHA 3CMGA 3NZHL 3QFJA 4P4RB 5E8PA 3AU1B 2EDEA 3W9EB 3ZYIA 4E5XB 3D18A 2DM2A 1MJUH 3TA3D 2YS4A 1WMFA 1TQCC 1C1EH 3GM0A 1Y0LA 3DSFH 3MREB 2V7HB 2C4FT 2DICA 1D6VH 4QRPE 3HZKB 5BS0B 3F7QA 4NO2A 4BWGA 2B4CH 3EYVA 2CGRH 1QFUH 4LGRB 2VABA 1C8PA 2XZCL 3NACL 3N9GH 1YMMD 1D5XA 3A6CH 3V7AE 1SHMA 2E5EA 5ITFA 2VAAA 3EGSB 3O6FC 5I18L 1A6VH 5F7YC 4OCXL 1U8KB 5HHOA 3NFNB 1BF2A 3T41A 5CUSH 4F57L 1Z5LB 3RUGE 1K3ZA 2HT3D 2Z35A 5M95B 4MZDA 2IAMD 2J4WL 2NXYB 3MRLA 3OKLB 4YAQA 1NGPH 4A6YB 4DK3A 2ICWJ 3GSNB 4UB0L 4DGIL 2HRPH 1TDQA 4IMLB 5IW1B 2CKBB 4LKXA 3P30L 5ISZB 3SKOB 4NMXA 3HAEG 4P2OA 3BZEA 3IDYB 1DUYB 1XGQA 3QHFH 4X7TB 3UO1L 2VDMH 4CDGC 1ADQA 3J8F7 1P7VA 4OV6F 4UBDC 5EOQL 4PJEA 4AEHL 2PO6D 2R4SH 3AUVA 3O3UN 4BKLB 2QR0B 3VJ6B 2YPKB 3KPSE 1YEIL 2JKXA 1T7YA 2A6DB 2CXGA 3AC0A 2QSCL 4G9FA 5D7JB 3ARQA 4MJ2A 3NOIA 3U6RB 6CGTA 3LN9A 1OAQH 1JWSA 1W0VB 2HKFL 4JHBA 2J8UA 3RWFB 2XRMA 5D7IF 1SCDA 1AGFB 4K7PL 1OP3K 1T66C 1EH9A 4M7JL 2FEDD 5L0QB 3PWNA 1JYVA 3ECBA 3JV6B 5GSVB 3CAFA 4X6BB 2GJ6B 3VXSA 4X6EB 1TZIB 4JLRB 1YPZF 3QUML 5T3XE 4JY4B 5FKPB 4U1JA 2PYZA 4TVPL 1GZQA 4HS3B 4RZCA 5DR5H 5IGXL 3MRFB 4H8WH 4XNZB 1AD9A 3MYZA 3U9PH 2BSED 3O3DA 4PLOB 4JFXB 1U3HD 1AO7B 1IILE 3KAAA 3MV7D 3QIBC 5AEAA 2BP3A 4Y4KA 5EOCH 3HJRA 3LPCA 2W2NP 3G9VA 1VFMA 5F1SA 5KVFL 1PQZA 5I1EH 3QRGL 2B4CC 2ZUSA 1NAMA 1N59B 1JNHA 1J0KA 1U0QA 1J10A 4G6MH 5E8DL 5I1AA 4XBGB 3VGFA 5JNYB 4G7VH 1XT5A 5DEGB 3UROR 3OQ3B 3QDJA 2EYTA 4TTGA 1TNNA 5DJ2A 3HI6H 3ZMRA 1IM9B 1LW6E 3D2UD 4NRZB 1F00I 2YKLH 2KDGA 3DX6A 3P4MA 1FYTA 3IF1B 1VPOL 3MUZ1 3TYFB 5BW7A 3EJZD 1QVOB 4Z7UA 1BVKB 1FV1B 1GRWA 3G6DL 3QNYA 1U93A 2FBOJ 3VV2A 2W2OA 1MCPH 4XPBL 2ZUXA 3Q6GH 4YXHL 3RWCA 1FZJB 4JFOB 4WEUD 4L9DA 4PGEA 4PGJA 1NFKA 4M62L 2OQJB 4ZPVA 5ACLA 5BVJB 2ZOKB 3TYGL 2X1PA 2X4QB 3TEUA 4PRHE 4BSVB 2OJZL 2YPVH 3MOQA 2PKDA 5L2KD 3VXUD 4PBVC 1K6QH 1UWEH 2WWMD 2E7MA 1OTSD 3DE7X 1HI6B 2PETA 1TVBA 4GRWB 3WHE0 1Y34E 1QBLH 4JPKH 1AHWC 1MCHA 4JRYE 4XI5C 1DLFH 5IESL 3DVGA 4LVNC 4JN2A 1MCEA 3CVIH 1DQDH 3IFPA 5I30H 1QUNA 5DD6B 1CNMA 2VZUA 4QRUA 4FQCL 4PRAB 2A6JB 2B0SH 3TH3T 2HMIC 1J05B 1CF8H 5F93C 3H8NA 1UFUA 3MRQB 4YBLC 2OSLB 3H42A 3S36X 5F9JA 2WMPA 3FRUB 4U1LB 3MUGA 4H8WC 2P8MB 1J1OH 3ULVH 5I9SA 2F74A 3R8BB 4WU5B 2EDBA 3GI9H 4FZ8H 4FQQB 1F90H 5CBAA 2NY2B 1ZLVK 1TETL 4IRJA 4BZ2H 4QKXB 3IVKB 1XF1A 2DM3A 4YDVB 4YGAB 4PB0L 2DQHL 2JJVA 5IB2B 4OKVB 2RGSA 4TVPE 3ZDZF 1A8JH 3UTTB 1G1CA 3KLHD 3FCTA 4OB5H 3LKPA 2E9WA 3KPRE 2B5IC 4I0PB 3QDGA 2WLZA 3L5XL 3N1PC 1UBNA 4PJ8B 2ZUTA 4ORZC 4GW1B 5HYFA 5F70A 1OSZA 2XWTB 4OF0A 1F6AA 2OR8A 1Y18B 3DE1X 3T3PE 3DVNB 1FORH 4KTDL 3RVXD 2VLRD 5HGAA 1BE6A 2QADB 3BD4A 5D1QB 3RA7L 3T2NH 2DDQL 2YD4A 4HG4J 3QUKB 2ZUWA 4HS6A 4ZFOL 5BVPH 1KBGL 3LIZL 3MRNA 4NRXA 1L9NA 4DVRH 3B9KB 3BO8B 4WI9A 1OTUD 1PX4A 6FABL 4OQTH 4FQXD 4LF3A 4OLVL 2Z8VC 3FTGB 4Z78B 3LQZA 1UB5A 3T0EB 4LNRA 1BE8A 4IM8A 4X8JB 4HFUL 3IETB 2VUOA 1CVRA 4X6CB 1S8DA 4P5TC 3X11B 5DD5H 4ENEC 5CGYC 3D39A 1A3LL 3TO4A 2XZAH 4NWTH 2P5EE 1DQJB 1M4KA 5F1IA 2X7LA 4KMTH 5I19L 1A7PL 1WQVT 3X12A 3L6FB 5F96H 4HK3N 5SX4H 3BKCL 4MJ5B 3O9WB 4X7DC 5IHZA 4N9GA 3UYOD 2IPUG 1NFDE 1WITA 4YHNB 4ZDHB 1SUCA 4YPGB 1G6RA 4L4JA 5SWSA 2NY3C 3I6GB 4M7ZC 5DMJB 3V5HA 4JJ5B 3MRIA 4FA8A 3QSKB 2EDRA 4H1LA 2B1HL 4CGTA 4CVUA 3ULVC 5KVDL 2XTJE 2ADGB 5A16B 1VSBA 5D93C 2P5WA 4U1SA 1IGTB 5JTWA 1H3VA 3TV3H 4MSWB 3MNVA 3MMEA 1MRDL 4KG7A 1OOAA 2HP4A 2LVEA 4M1DL 4D0BA 1IEAB 2ID4A 1KPUB 3TWCH 5IHUL 3VXQB 1YYLH 2G60H 4N0UE 3MR9A 1RUAH 1OF2B 4OLWH 1XR9B 3S96B 1I75A 3NFSH 3OB0K 2VZOA 1IZJA 2O61A 1IGMH 1A2YA 4UINH 4HJ0C 1YEFH 4OFPA 3SDXE 5ACZB 5IG7A 5J9PA 1NGXA 5FYJD 3ZTJH 1R5VA 4GAGH 1N5YH 1FNLA 4EN3D 2W65B 1XGPA 4ZFFA 3X3FH 3BWAB 2ZCKH 1GGCL 2FHBA 3BZDA 1Y3FE 2NY1B 5C3LD 3NCYS 4O2FA 3AVEA 5HVHC 3CFBA 3PNWA 3S7GA 1SUAA 5ILTH 4IEFB 4AH2B 4LBEA 4RFOL 1F4AA 1ZEAH 1Q0YL 4GRWF 5DJZA 3TPUB 3FZUD 4M7LT 3F49S 1KEMH 2R2HB 1QFWM 2CIKB 3MV11 3MLSL 4G8EB 1S3KH 2CO6B 5BRZB 4MA3B 3DW3X 3EDDA 4XZUA 3NCEB 4OZFH 5DVKA 2YPLA 3LOWA 1J1PL 3L5WB 3L9RB 3HZYA 4M61A 4MJ4A 1VEPA 4Y5XC 3T4AB 1T1GA 1UC6A 1NC4A 4OD1L 2X41A 2V5YA 1NAKH 1A0QL 5CEYB 2YD1A 3TH2T 5GJSL 4XWGL 4U1NB 2OZ4A 1XEDA 5IEHA 1FL6B 3DNKA 1M6OB 5FYJU 2PCPA 4YQXL 4OKDA 4NPYA 2CXKA 4LAQL 5J56B 5DO2D 3DXAA 4OJFL 3VXSD 3EOBB 4GMSH 5ALCL 4PJAE 3U0WL 4BQCA 3HB3D 5EU6D 2P8PA 1DDHB 4HGWB 2HFFB 1OARH 3MLVH 4HCRA 2BNRD 4Y16A 1CL7L 4GBXB 4QRQB 1QA9B 2D0GA 2NR6D 4WRLA 4Y88A 3HUJA 3VRIB 3CSYB 4L8CB 2W38A 1Q72H 4RGMB 4XC3H 4KMQA 3BPLB 3A3PB 2X70A 1M7IA 3BAEL 3SDAB 5CD5D 5DF0A 4OTXL 3AAZA 3QG6B 4AEIH 4JAMB 4WV1A 4F7CA 5IJVA 2AJYH 3OAYK 5KJRL 3ET9F 5HXMA 1GTJ1 5FO9A 1I8KB 1NMCB 2OZ4L 4Y1AE 5HSFA 1IAOA 4KQ4H 4XT1C 1QFHA 5DRZB 4NQDD 5GZND 4EXKA 3QDJD 2IANA 4K3GA 4P99A 2WIMA 3FB8A 2APVA 2FHFA 5D7KD 2H2SC 3ARYA 4X6CF 5F9DC 1D5IL 2XWJA 1ZHBA 1U8PA 4KHXH 4UAOB 4XMLL 5DZNA 3VRJA 4ZNEE 5DZLA 5GGTA 3CLEL 5GGVH 1G9NH 5FDWA 2NQCA 3RY5A 3ZO0A 8FABA 1FH5H 3WFHB 3O3AA 4ODHH 5C07D 3CZFA 4P5KA 5D6DC 3MGOA 3ROOA 1HKLL 3DV4B 5CD3B 3BKYL 3C8HA 4LLMA 1V3KA 5EPMA 1A6AB 4RGNC 3SDDC 3D85D 3GSOB 3I6KB 4LCWA 3SDYL 3U7YH 1NL0H 3DOSA 3H9SD 3T3MF 5LKNA 1XGRA 2DQUH 4PJBE 1FDLL 2BHYA 3TJHD 2X4NA 3MACL 4XXDB 1O7SA 4D0DA 4CVXA 3KPMA 1CGXA 1E4XH 4PJIA 1XIWC 4PTTB 1V6CA 2HFGL 3ZTNL 1T22B 1ZSDA 5I1KL 2JCCB 1SJEA 3CIQA 5INCA 2WINB 3L3JB 1SBIA 4S2SA 4Y5YB 2GK0B 3O41B 3RVTC 3DO7A 1GNSA 3SCMD 4LSUL 5E6IB 2AXJA 1OM3H 1S9WA 3VXTB 2JJWA 3IDIB 4DVBB 5I66B 4PJDB 4G6JL 5KZCB 1MCNA 1U8QA 3ABZA 4QHLB 2MHAA 3P9WB 4I2XA 1BBDL 5J3HD 2VQUA 4L8SB 5B38G 3T2QA 5T5FL 3GBMH 1YJDH 1IKFH 2F5AH 4FFVD 5FAXA 2E27L 4XCFL 1IAMA 4XNUH 3GT3A 4M7KH 4CU6A 4PJ9B 3BN9D 4TUJA 1QBBA 1OAYH 4FTVE 1CD1B 3CU7A 1PG7L 4BFIA 2DWDA 4D8PB 4LCIL 4ZTPL 1OD7A 3MNZA 3JWNC 3B4NA 3JBG7 1TQBC 1EJ6A 4ELMA 1KB5L 5D1XD 5JDSA 1FFPA 3QIUC 3D3VD 1IEHA 3QEQA 5TQ0H 1GZPA 1SY6A 2W91A 2ZOLA 3G6AB 2IPTL 1P5UA 4HEPG 5JXED 3I02B 1TJHL 2Q86A 1CDUA 5GRUL 1S2NA 1P2CB 3OPZL 4YDJA 1G9NC 3S8WA 3RKDD 5FF6B 4ZFZB 3WIHH 4N8PA 1J0ZA 5C0FA 1BZ7B 4JCLA 4FXKB 1F3JA 3IRPX 5JMRA 2R39A 3UTSB 4OFYD 1VKXA 1KTDB 1QSEB 4G42A 2A9NH 5GIRA 2NY0C 1XF5B 3G5YB 3QXDA 2ZNXA 3FAXA 4Y4HB 5DJDA 2H3NA 1NGZA 3MTRA 3TH4T 3PWPE 3AROA 4HAGA 3O4LD 2X4OB 5ADPH 4OF6A 1NGYB 5HGGS 1LE5A 3PL6A 1RURH 4HWEL 2CRIA 4HT1L 1G7PA 4NP4H 1S9KC 2NNAA 3QZWB 2ESVD 4PRIB 1CGVA 2EC9U 3MLTB 2BDNH 1F8TL 3IDGA 1EERB 4JFZL 3TA3C 2OR9L 5B4MD 4ZFGH 1BZ9A 2QKIB 1X5XA 4XVTL 1C9MA 5C0CE 3ROLB 2BHZA 3FO0L 2JJTC 3MBEA 5MERA 4MCZA 4HH9B 4KK6D 2J88H 4IIQB 1QNZL 2DBLH 3FMGH 2BNQD 5DJCA 4JDZB 4XH2A 5SWSD 3LAFA 3TBSA 2XXCB 2Y6SC 4JY6A 5CJXA 3IDJA 3GUTA 1FO0B 4LDOB 5I1GH 1MCFA 5DI8A 1F3DJ 4NC1E 4XCYB 3JTSA 2V2TA 1B90A 2PYFB 2P5WD 2C4XA 3HG1A 3KDMA 3I9GH 4HULB 1U2HA 1YJDC 1A22B 1OB1A 4NFBA 1N6VA 5ID1B 3KJ4C 4KROD 1JGDA 3B2UC 5I74B 5I71B 1GAFL 3I3DA 3R8QA 2V2XB 5MEPB 3V95A 2DLEA 4FNLL 1ZT7B 1Q9OB 2QHRL 4JFEB 4CADA 5IBUG 2BK8A 4G3YL 3U36B 4DW2L 4DCQA 4MD4A 1AKJB 3NGBB 2YWYA 3W39B 4LEOB 3WHIA 4ODSH 1D9KD 2Y5TB 4CNIB 4Z0XA 1EA9C 3UC0L 1GPOH 2E6QA 4TPRH 2PO6C 1CBVL 5J57B 1ZV5A 4TRPH 4JFDD 3LS4L 1QQDB 4YHKH 3SKMB 2IWGA 5AWNH 3T4YB 2FJGA 3IAGC 3EJYC 1KIRB 1R3LB 1LK2A 4KH2A 3B3IA 4YPJA 1OT1A 3DWTA 2R29H 3F7VA 3VXNA 1DEEA 2MMXA 3ZE1F 4OV6A 3PV6A 1A9BB 2GIYA 3CDGA 4N8VA 3HC0B 3WUWG 5IB1A 3B8SA 2K3TA 2FR4B 3FO9A 2QQQA 1I7RB 5E9DA 1SYSB 3VGDA 3RFZC 1F02I 4O9HL 3SEPA 2B8OT 1DBKL 5IK3A 4K71C 4PTUA 2DM7A 1BFSA 3QPQD 5GSRB 3AMLA 3V7AG 1LDPH 1LGVA 5CEZL 2H45A 2VLKA 5D7IA 4PJDF 5IOPA 5ESVB 5IW3A 3ELAT 2WANA 4N8CH 4NQED 4S0SD 1FNEA 4KJYB 5ALBH 3ZKSD 5D2LF 4OD3L 3ARBD 2MCG1 1T1ZA 1LHZA 4P4KA 5TF0A 5CJOH 5ELIA 4CMMA 5EZOL 4MNHB 3O8XD 3L5HA 4P57A 5F8RC 1QFWH 3CFCH 2Z92B 4IHOA 1BFUA 3T09A 5IQ9B 2E7HA 3WLBA 4RGNE 3RY4A 3HE7B 1P8JA 2F58L 1AQDB 4RAVB 1SMOA 4N0FA 4DZBA 4N0CC 4OLYL 3VXRB 5C2UB 4PRNB 3C6LB 4K8RH 4WW1A 4WY7L 4W4OA 4Y2DB 2DQIH 1QRND 3EJJX 3HZMB 4QY8B 2ZSWA 1I1AB 4OM1H 2XYCA 5L7XL 4WCYH 1OY3B 4O2CB 4Y16D 3EJZC 3V5DB 3CFDA 1W0WA 2EYRA 1AGBB 3OJDA 5FO8B 3F6IA 1A5FH 2UZXB 2R0LL 4MMZC 5TE4H 2DQCH 4GLRH 2NTFA 3FL7A 1QO3B 3Q5TA 5EUOB 3GMLB 5IROA 5FGCB 1GA6A 2YMXL 4CN1A 2GKIA 3LEYL 3RAJL 3LS5L 2VWEC 3RDTB 5DJ6A 3WO4C 5AMXA 2J6EA 2H8PB 3ARED 1QR4A 5D7SL 4JEGB 5EIIB 5BOPA 3RZCC 3MRBA 1SEBB 2WWMC 4LVOB 5AD0A 1A7OH 4JPVL 2DYPB 3S5LB 4PG2A 1CD0A 4JE4B 3QG7L 4LK4A 4ZUUB 5HYSA 1CD9B 2MNUA 4QYOB 3QUYA 1BOGB 1N8ZB 1MI5D 4OIAA 4PB9L 1EAPA 1PKQE 2R23A 3VI3E 1ZA6B 1JNJA 1G7IB 1N4XL 2NZ9D 5GS1A 4LASH 4I77H 2QBWA 3NACH 1P7KA 4JG0H 1S01A 4NQCE 2ZSVB 3BDBA 3BFOA 4LCWD 4TUOA 4NO5B 3BQUB 4P4RA 3AU1A 1UKQA 5GJTH 2ICWA 5I18H 5JW4M 4E5XA 4AIXA 1ONQB 4NJAH 2HWZH 5DRNB 3H9HB 4E0RB 1JWUB 3MREA 4M9PA 4QHMB 4MYWB 2J1KA 2V7HA 4KKAD 1DVFD 2R2CA 5I73B 3CVHL 3HZKA 5BS0A 5LQBL 2W2QA 1I9IL 1G7QB 3DE6X 1KV3A 4LLVB 3TN0C 5CEZE 1C5DA 3CK0L 3KLHC 1MEEA 4UIKH 1WZKA 4HIIB 3L5IA 2BOCB 4XBEH 4KJPD 2IPUK 2PRKA 4KAQL 1T6WA 4K8RC 4YC2B 1BQHB 4AEHH 4ALAL 3VFUB 3EGSA 1D3CA 1ZS8B 4JG1H 1U9KA 3SGEH 2VDLH 3RVUD 1U8KA 2FLBT 1JK8B 3NFNA 1JYNA 2FIRT 1Z5LA 2AJZB 3VFMB 5ADOL 5IVZB 3V5KB 2H2PD 3ZE0F 3ZKND 2HKFH 1T1YB 2FNBA 4LARL 4M6ML 5DVNA 3OKLA 4OBRA 3GSNA 1JI1A 4IMLA 2DLHA 3STZB 2VDNH 5A1AA 1A6UH 5ISZA 2ADFH 3SKOA 3VH8G 1N26A 1CLZL 1SIUA 1FFOB 4NWUH 1DUYA 4X7TA 1WIPA 2VLJD 4KK9C 4J4PC 1IAII 1YMME 2PYEB 4U6XB 4X9FA 5M94B 4BKLA 4BK5A 2IY9A 2QR0A 2NYYD 3PGFL 4R7DA 3Q5YA 2YPKA 1C9JA 2V5MA 4J7RA 1ADQH 2FCBA 2A6DA 2E9JA 4FN0A 4PJGF 2X44D 4EJ1C 4R0LC 5D7JA 4PJ5B 4UI2A 3U6RA 4GH7B 4WIQA 3QJHB 1W0VA 3RWFA 1ZT1B 1AGFA 2HT4C 1H3XA 3CSBA 3EW3B 4V1DB 4RMTA 4M6OH 4XPTL 4BZ1L 2DQTL 5J06A 3EE6A 1GGBL 3JV6A 2P45B 5GSVA 3D0VB 4UV7H 4X6BA 2GJ6A 5GRVK 5E8DH 3CDCA 4X6EA 5IFHH 1TZIA 2DQFB 4JLRA 4WUUB 2FX8L 1HINL 4JY4A 2ZKHL 5FKPA 4A6YL 1INDL 3TZVD 3LRGA 5E2TH 3ILQC 4HS3A 4YFLI 2CKBL 3MRFA 3MLWH 4XX1G 2V5RA 4LPVA 1J5OL 2LABA 5J7CC 1VPOH 4WEBL 4OV5B 2HJKA 3RRQA 2AJXL 4JFXA 4AZ8A 3PL6D 4FOMA 1AO7A 4WVRA 3KPQB 4YHZL 3BDYL 2VXTL 3HCVA 1KELL 3M8OL 1L7IL 4NQXB 5GGQL 4XPBH 1T0PB 3IKKA 4AEEA 4EI5B 5AZEL 3V6OE 2GSIB 4XC1H 1SBCA 1N59A 5EBMB 2GHWB 3MBED 3LHPH 4P59H 3DTXB 4XBGA 5JNYA 5ARCA 3HC3L 4M62H 5HY9B 4U0QB 5JZ7C 2R69L 5ACMA 5DEGA 1DN2A 5GS0D 4YHOL 4AKSA 1NAMH 4EN3C 1TCRB 5HDBE 4CMHB 5K59E 5EUOF 1IM9A 4XCCL 2HKHL 4NRZA 3EYUL 5I8OL 5E8OB 3IF1A 5TQ2H 3TYFA 4I9WE 4WHTB 1QVOA 2BMKB 1BVKA 1FV1A 4PJ7E 4YFEA 2F19H 3RWDB 4NNPL 1KEGL 4TUKL 1OWRM 1OPGH 3BPSP 2GJZB 4PFEA 1FZJA 4JFOA 4YFDB 4DGYL 5BO1L 2I9TA 4H20L 3HRZB 4L3EB 2OQJA 5I0ZA 5BV7B 1U3ZA 4XMKH 5BVJA 2ZOKA 1LNUB 4NUGL 2Q87A 4AM0B 4AG4L 1MY5A 1ND0B 2X4QA 4BSVA 1NQBA 4OM0L 1MAMH 4PBWD 4RAHA 1HI6A 4P2OC 4M3JA 4XTRD 4HUUB 3VFSB 2GFBB 2DP4E 3EFDL 1MJ8H 5JOPD 3P0VH 2FATL 3SN6N 4S1RL 1N0XL 4P0DA 1EBPA 1RK0B 4AIZB 2P8LB 2P1YA 4QRRB 2ZUQC 1BQLL 1Z9MA 3QT2A 5DD6A 4LDLB 1HHJB 4GXUN 4PRAA 2A6JA 5CSZB 4JFQB 5C0AD 3AMKA 4KKBD 3MZGB 3MRQA 2OSLA 2NXZB 2VZTA 2VWEE 1QPXA 3FRUA 1BFVL 4HKZA 2XICA 2P8MA 1T83A 4UT6H 4KTDH 4WU5A 5L2KE 3VXUE 1YYML 4JO1L 3H42H 3HB3C 4GQ9H 4FQQA 1RZKH 1KXVC 3GMPB 3IVKA 5IF0A 1TJIH 1Z3GH 2AAVA 4YDVA 3U7WL 2VR4A 2X09A 3N1FC 5IB2A 3IU4H 3BPNC 4OKVA 3UTTA 5E2UH 1UXWB 2FB4L 3VFNB 3MJ9L 2VZVA 4KZEL 4Z7QF 3C5ZB 2VDRH 3HNVH 4URTB 4Y4KC 4I0PA 5C86A 3L3OB 3VWKB 4GG6F 3KYOB 5LCVL 5FXCH 4PJ8A 4BH7B 4OLEA 1CGSH 3D48R 4GW1A 4HAFA 4RNRB 2XWTA 1MREH 4WFED 1Y18A 5D71H 4K23H 3DVNA 4MS8D 1YECL 5DUPL 1BVLB 3T0DA 3O6LL 4F3FB 4UIMB 3QHZL 5CSGA 5D1QA 4L8BB 3D87B 1D5MB 3QUKA 3WXWL 4YDLB 3A67L 3QWRD 2HRLA 2XQBL 1RJZB 3B9KA 4L9LB 4NZDA 1WMEA 5FYJL 5BW7C 3JV0A 4K3EL 5IT2L 1I8LA 1VACB 3CXDL 3FTGA 4YUEL 4Z78A 3T0EA 3CD4A 4U7MA 5FCUH 4JR9H 4R8WH 4X8JA 3IETA 3X11A 4X6CA 3K80A 3I2YX 3GCXA 2VDQL 4H25B 5DHVB 4HMDA 5AZ2H 2PN5A 1KPRB 1T04B 2GTWB 1U42A 3ZYJA 2NY6C 4Z76B 3GSRB 1DQJA 5JO5B 4PGBB 4WW2B 4AL8L 4DKEH 1MRDH 2VLRE 2VXUH 3L6FA 5HYJA 1S78D 1WBZB 5IV2A 1IL1B 2B7DT 4LSSH 4MJ5A 4QGTA 3O9WA 1IZKA 4PY8J 2HG5B 4I5BB 1FE8L 2IGFH 1T7WA 2YRZA 4TN9A 4YHNA 4ZDHA 3BKML 4YPGA 2IBGA 3QUYD 4OCYH 2DIAA 5C09B 3OF6D 4J3TA 4F58L 1QHPA 4HHAB 3I6GA 4JJ5A 1EFXD 5F9WC 3N1MC 2C3VB 4DQOL 1G6RH 1QYGH 1PZ5B 2ADGA 5A16A 3TF7C 1FBIH 1IGTA 4MXVE 3OXSA 5ETUB 4MSWA 1RZKC 1M7XA 5DSCB 2LU7A 4NZTH 4H1LH 1MUJB 4OQ1A 5J3HC 1I9RL 1OGAD 1T1WB 1IEAA 1KPUA 4WTXA 1ZHNB 1RFDH 3WS3B 4ZTOL 5AG8A 1OF2A 1P9MA 1HSAB 4IRJC 4FFVC 4HPYH 3TGXA 1XR9A 3S96A 5EOTB 1EGJL 3RVWC 3ZXXA 5BS0D 2MJWA 1S9XB 1EMTH 1TM4E 1IC5L 5ACZA 1OAKL 3EYFA 3MUY1 1HKFA 2W65A 4NM4H 3QUXD 4XPFH 4FHBD 3GO1L 3NA9H 4X6FB 1K4CB 3BE1H 3DRQB 4YHIB 1NCCH 4PLKD 1BIHA 3V2AR 1J1PH 3RTQB 3B5TA 4GAJH 1OL0A 2XPGA 3ALPA 5EIVA 2R2EB 4Z7VF 4NQVB 3REWB 1MRCL 3BIKB 4AH2A 1AQKH 1BQSA 1X5HA 4JO2L 3TPUA 5JR1H 1CXHA 4XWGH 3DE3X 3C2AL 5J6HB 3FN0L 2R2HA 1HNGA 3SICE 2CIKA 1ZLSH 2TECE 3ZSSA 4G8EA 3QCVL 2D03L 1F11B 5BRZA 4MA3A 4R96B 1EXUB 3L3KB 3DVQX 1FHGA 4K3JL 5FYJE 3IS0X 4YWGL 4ODVH 2MQCA 3IB4A 3L5WA 1UCBH 3L9RA 5F7LB 3QFDA 1LO0H 1REIA 3T4AA 2FX9L 5C70A 2B20A 1L7TL 4OFDA 3WIIH 1CZ8H 3QHTC 3TO4C 4P2RD 1CL7H 2EDKA 2UYLB 1S7WB 2UY7A 5CEYA 1JRHL 1QSZA 1ZLUH 4BSJA 5ITBH 4U1NA 2B39A 4RWYL 2BXYA 1FL6A 3V4UL 1M6OA 4HWBA 2A73B 2LAGB 3TFKC 4GRLB 3LN5B 2OZ4H 2GJ6D 1RSFA 3EOBA 4RFNB 2YXFA 4LQFL 1T5WB 3DRTB 1DDHA 1FZMB 1P1ZB 3GMNB 2HFFA 1HIML 1SUDA 3HR5A 2CH8A 2OI9C 3PABB 4HKBA 4GBXA 4QRQA 1DP0A 1QA9A 1WFTA 1KLGB 2IEPA 4FQIL 3RGVB 4UT7L 4R3SB 3VRIA 3CSYA 4L8CA 5I1IH 3BGFB 5F7FA 4HCRH 2VERN 5HYQB 2AKRB 2ORBL 2NY4D 3QEGH 3QG6A 1EDQA 1HHKB 1NCAH 4OCWH 1HKLH 4QLRA 1K8DB 1I8KA 3MFGB 2V6HA 5F7DA 3S35L 2HT2D 4HWBL 1E27A 1ZE3C 5EZIH 2VSCA 5DRZA 1GHFL 2EXYD 2EXWC 5EZLB 3VXSE 2DL9A 3FFCD 1IM9D 1MNUL 5EU6E 5F7UA 1EHLL 2R1YB 4F7MB 1SVCP 4PJFB 2CD0A 2BNRE 2HFGH 5I9QB 4FABL 3S36H 2JTDA 1XCQB 2DB8A 1CIDA 3WD5L 2IADB 4N5ED 2EIEA 3WFHA 5ARBA 4FZEH 4CL7A 3NA4A 4PV8B 4ONFH 5A43C 3AM8A 3DV4A 4JO4L 1UM5H 5GGTH 5CD3A 4P2QD 1PJ9A 5ICZA 3JV5A 1I3UA 1P7QB 2JK5B 4FQ1L 4ZO6A 1A6AA 1PD6A 5FHBH 5JIPA 2Z8RA 5IM7B 3FRPA 3GSOA 4M43H 4UUJB 2X4SB 3V52L 4PGCB 3WMSA 4XXDA 5C0RL 4NQDE 4F2MB 3C6SA 3R0MA 3QDJE 5IQ7L 2YOCA 3QPQC 3KWWB 3Q48A 4HUMB 5T5FH 5D7KE 4PTTA 2AEPH 1T22A 4DGVL 2FHCA 4WNQB 2JCCA 4Z7NF 2E27H 2GK0A 1CN4A 3O41A 1RUPH 1X3DA 1V3JA 2WWKT 3L95B 2CLVB 2GUOB 1I1RA 5E6IA 4YLQT 5C07E 3VXTA 3C5SB 3IDIA 4DVBA 5I66A 1OSPL 4PJDA 5DMKB 3NTCH 5EU4B 2DJSA 2W2PP 1BM3H 1TVHB 4UU9B 4FFWC 4QHLA 1XGYH 1BFKA 2O26U 3K2MC 4DKFH 3H9SE 4L8SA 2HVJB 4KTEL 5D2LA 3LCYA 5I75B 1BECA 4HJJH 4M6AA 3QDMD 4D9RD 3F5WB 4C57C 2NLJB 4X5WB 1FFNA 2WQRA 4Y16C 1WEJH 3BXNB 5DQDL 4PJ9A 5FB8A 1QLRB 3MV9A 1TNMA 3MUHL 4K3HA 1FNGB 4NHCH 3VDBA 2DTML 4D8PA 2IF7A 3IKCA 2W0LA 3ZTJG 5EBGA 1OAZL 1Q9LA 4TSCH 3ARDD 1JHTB 1SCBA 2N56A 1BHGA 4WFHD 1IC4L 2O5XH 2AJSL 3T77B 1MAJA 4C3UA 3TIEB 1I7UB 5D1QD 3G6AA 1E4KA 3I02A 5HDLA 4UOW1 1P2CA 4KPGA 1Q1JL 4F33B 4PIRF 2AVGA 3F7MA 1GCIA 4XRCB 5FF6A 5JXAL 4ZFZA 1UCTA 3VGAB 1SY6H 4XVTH 1A7QH 3NPSC 4FXKA 3OR6B 4Z0BL 4ZOCA 3DLQR 1Y3CE 1JJUA 1CWVA 3KNBB 2C26A 3NIGE 4U1HB 1FC1A 1KTDA 1QSEA 1PEZA 1LK3L 1XF5A 1H3PH 5DD3H 2DIBA 3DUHA 3QDGE 4Y4HA 5J12B 5ABDE 3L1OH 4OZFG 5F7KC 1UB6B 2X4OA 5C0BD 3RKPA 1RD6A 4LHUG 1NGYA 5F7NC 3T04D 3QUZD 3D3VE 4R2GB 1EA7A 2W9EL 5A3ID 1FRGL 3QZWA 3RNKB 4PRIA 3MLTA 4LCCB 1SQ2N 4BFGA 1A6WH 5A2FA 2IPKB 5HYJD 5TDPB 5CW1A 1GAFH 2EH7H 2QKIA 1RIVL 1NKRA 3ROLA 3U1SH 1DBML 3OAYH 4OMCA 5ESQB 4HH9A 3PDOB 2A74B 4IIQA 2V9TA 3WKML 2ZCHL 4DW2H 4JDZA 1TK2A 2V17H 4DEPB 1FO0A 3SJVB 2KZ1B 3H7BB 5FA4B 5JMOA 4GSDH 3S3SA 1AJ7L 3SE8L 1MY7A 4M5ZH 2YUVA 3ARFB 4XCYA 2Y06H 3EOYG 2PYFA 1VCAA 3SQOA 4PRPB 3MCLL 5K93A 3U79A 5ID1A 3T0BA 5HI5C 2V2XA 5J89A 5IR1B 1GOHA 2ESVE 1GIGL 1NFIB 1X4YA 2BVTA 4HMCA 3TM6A 1FIGH 4R97B 5E1HB 4PJXB 3ZKNC 4PJFF 1Q9OA 3LMJL 4JFEA 3FHQA 4ONHA 3U36A 4BQ8A 4YN3A 4U1MB 1UT9A 1AKJA 4MMXC 4ORGB 1G6VK 3NBNA 4TSAL 5H35B 3T08A 3W39A 3RIAK 3WNNA 3U48A 2BNQE 5SWSE 1SIOA 1T1XB 4LLAA 2Y5TA 4CNIA 4I0KA 1DBKH 3TBWB 5IB4B 2VKWA 5JHDD 2NPLX 1E4JA 2NY1D 3PWVB 2R4RH 2AK4A 4Q2ZB 2NYYC 2A83B 1QQDA 2P5WE 3SKMA 1CS6A 3T4YA 1KIRA 1R3LA 3GT4A 3PP3K 1FC2D 1LO3L 1MFEL 5F3BB 3WJJA 3MLZL 4KI5F 3NMEA 4OD3H 4F7PB 2BC4B 4PYGA 3HC0A 5JPMB 4HIHB 5EZOH 1KPVA 1Z9LA 4PY7B 4L29A 2R9HD 2FR4A 3QXWA 2MCPH 2N7AA 4PGDB 1S7RA 1I7RA 1QSFD 1SYSA 1MFBL 2YN3A 2F58H 4NM8L 3VMPA 3ARVA 3J7HA 4OLYH 2OMNA 5JUEL 3HI5H 5GSRA 4XNQB 4P46B 4OI7A 5AVKA 4NE7A 2LE9A 3EKCA 5ESVA 2JB6B 4LSPH 1JNLH 2W0PA 5MP6H 3QIWB 4Q9BA 3RI5F 4L3CB 4JFDE 4XNXH 3E8UL 2R56H 4KJYA 1U36A 3PL6C 4DTGL 2G75B 5IVXE 5T1LB 3HC4H 3VA6A 5DVMA 1QZ1A 2Q8BL 4MNHA 3MOAH 4N1CA 4G8FB 2Z92A 3UJTL 43C9B 1KCSH 3MBEC 3HE7A 7FABH 1AQDA 4RAVA 3VXRA 2YRLA 4PRNA 3C6LA 1RHFA 2GITB 5CCKH 1EZVX 4Y2DA 2EDNA 5CJXC 1HQRB 4QY8A 1I1AA 4N0YL 1DQLL 1DANU 4O2CA 1MCDA 3V5DA 2R8SH 3ZZ1A 1NLBH 5FO8A 4BQ6A 4NQEE 3P9LB 5CFHA 2NX5D 3RVVC 1QO3A 1ZA3B 5GRXG 4OFKA 5EUOA 3GMLA 2PR4L 5IMLB 4LP4A 3RDTA 2J5LB 3WFDH 4XWOD 2H8PA 2FD6L 2A2QT 5EIIA 4WU7A 5C0EB 4MJID 4QRPB 2DM4A 4TVSa 1IQDB 5J11C 3GB7B 3BP6B 2GEEA 2RR3A 3WNLA 3QO0B 4MB5A 4JN1H 3W81A 2J6EH 5HI4C 4XTRC 1NUNB 1QRNE 3RZWA 3BP4B 1GYAA 2DYPA 1RUKH 1GA1A 3VXMD 1TMGE 4ZUUA 1K4DB 2E9BA 4QYOA 5D1ZB 3M07A 1BOGA 4I1NB 3AS2A 1N8ZA 1C7TA 3B9EA 4UQ2B 4PREB 3HUJE 1YC8A 2WSKA 1I9IH 3WHXB 2EZ0D 1BQUA 1ITBB 4U05A 4QNPF 4NJ9L 3U0PB 1ZA6A 1G7IA 1YY9D 5KSUB 1FLTX 4PJHE 3UYPA 2ZSVA 3RUGB 1KSRA 1VGEL 4AYFA 1ORQB 2WW8A 4NO5A 1Z0MA 3BQUA 3PP4L 3TVMB 4ALAH 4D3CH 5IWLA 1MWAB 4LPCA 5HGDA 3L3GB 1FGVL 1NEZB 1ONQA 4RSVA 4N68A 5DRNA 4E0RA 3H9HA 4JB9L 2AQ1A 1JWUA 3BKJL 4QHMA 1T1EA 1FAIL 1F4XL 4K3DL 3G6JE 1NUDA 4KV5F 3O0RL 3MV8D 3K46A 1G7QA 4LARH 5KANG 4LLVA 4YXKH 2MKLC 3KPSB 4KKNA 1CDBA 2FLRT 4HIIA 4OGYH 1EO8L 2BOCA 4P4KC 2WAHA 3V6FB 2IBZX 2AI0H 1NH6A 5C71A 2A77L 4PJXF 4ONOA 2X89A 1BQHA 3ZDYE 2CPCA 3VFUA 1CTOA 1ZS8A 4LCWE 3DI3B 4OCLC 3ARXA 1U8MA 2JJSA 3LQAL 2CMRH 1YJAA 3L7FB 1JK8A 4J3WA 3ULUF 3BGMB 1ZOXA 2AJZA 3VFMA 4W4OC 3WNPA 2D7PA 5EZJB 2Y1VA 1ZGLB 1GC1H 3V5KA 3LRSB 4MB3A 1T1YA 4ETQB 1QR1B 4HZLB 3CMOL 4LSTL 3UTZB 1CLYL 3STZA 4IRSB 3MV9D 3SY0B 4TTDC 4XNMB 3IDNB 5TF1L 4JANB 1MIEL 5MHSD 2YD7A 1B6DA 4HQQL 1FFOA 5IROC 2WQ8A 3GSNH 1WT5A 1H0DB 4OGXH 2BXZA 2PYEA 4U6XA 2E1PA 1SIBE 1SBSL 1KCUH 2IQ9L 5KN5B 4U6VH 3QAZC 3EOTL 1KFAL 1N7MH 2W2OP 3QULB 2WBJB 4XBPB 1J5OH 4N0RA 4XMPH 4WEBH 3DE0X 1KT2A 3DMMD 4YHZH 1SJXA 3QJHA 1VERA 4EOWL 1ZT1A 1Y6NR 2EDYA 4V1DA 1OCWH 4HGMA 4PG2C 5AZEH 3K1KC 2PXYA 2H32A 3QUYC 1ORSB 2DQFA 5SICE 4WUUA 1TLKA 1AD0A 4UDUB 1QSED 5EFIB 5FA3B 2Y9RT 3QNZB 1X5FA 2CJUL 2VLJE 5GS1C 1V5IB 3H7LA 5I8OH 1YC7A 1EJOL 4OV5A 3IFLL 1WGOA 2UV3A 3MLRL 3KPQA 3HR6A 1KCKA 3HMXL 4JRWA 4KU1A 5EN2B 4PRHB 1ZLWH 4OSUL 3WDHA 3QYCA 4NSKB 4NQXA 1G9ML 4X80H 4EI5A 2GSIA 1D6EB 2N1KA 3DPBA 5EBMA 5D2NE 3DTXA 2IH3B 3DUUB 5HY9A 5C7XL 3K1DA 4HKJB 3MLPA 3SGDH 4O58L 1BWWA 1JNNH 4ZAKB 2VQ1B 4DN4L 1TCRA 2QV2A 3QUXC 5I1DB 1U8JB 4WWKD 2VXVH 1ED3A 5E8OA 4BJLA 4WHTA 2BMKA 1E6OH 4OZHF 4KJQD 3VGHA 3W2DH 2QQKL 5E00B 3EFDH 3JXAA 4C59B 1GC1C 5I1CH 4S1RH 3OKOB 4O2EB 2A9ML 1FVCB 3GMRB 5FYKH 3EOAB 1GVIA 2GJZA 4HBQA 5B39B 2BVOB 4RGOL 4J6RH 3FKUS 3QQ4B 1RUML 2OJEB 3HRZA 4L3EA 1ST2A 5HHMD 1NUGA 1LNUA 2AEIT 4AM0A 2NXYC 4QRSB 4TSBH 2VDOL 1H3GA 1ND0A 4JKMA 3VYVA 3QUMB 1HEZB 3QXAB 5EWIH 2XQYG 2BHUA 4OAWB 2M26A 3IDYC 1LP9F 1YYMH 3KPRB 2IQAA 3VFSA 1NLDL 2GFBA 5E99H 3NCYP 2X05A 4LIQH 5DT1L 2AK4D 5KTEH 1RK0A 4AIZA 2P8LA 4QRRA 5KSAD 3QEHB 1A4KB 1Y33E 4JPWH 4GRWH 3DYMA 4NGHL 3CUPB 3UJJH 2FB4H 3QI9B 1HHJA 3O2WL 2AJUH 3MODH 2Q1EA 5CSZA 5D7JC 4JFQA 4JRXD 3UZEA 1KDZA 4DAGL 3DROB 1CDHA 5EG6C 5LCVH 4NC2B 2L7UA 4CDHA 1RMFL 4KQ3L 1SUPA 4KC3B 1MELA 3MRPB 3TBTB 5L0QC 1PAMA 3W0WD 5HI3D 4I4WB 5EC2B 1X5LA 1C5CH 1A6ZB 1OTTD 4S1QL 4NO0B 1ZK9A 4X99B 3O6LH 4LFHG 4NZUL 3AY4A 4RRPA 1YNKL 3GMPA 4C58B 1WIOA 1NMBH 1U8IB 4U7SA 4XNZC 2XQBH 5FUZL 4L8DB 1HE7A 5JOPE 3KPPB 1WFOA 1ODAA 1CFVL 5KW9L 1UXWA 3VFNA 1HYSC 1HH9A 4JHWL 5H94B 2EDTA 2P5EB 4YR6B 3CXDH 5E95B 4ETYA 3L3OA 3AGVA 3VWKA 3KYOA 4BH7A 4OF3A 4Y4FB 5C0AE 2VITB 4RNRA 2ZWOA 4YX2L 4JQVA 4QGYA 4LSVH 1WBXB 5F1NB 4ZNCD 4JHAH 5KOVC 4M00A 1BVLA 4XNYL 4F3FA 4UIMA 1IE5A 2YZ8A 4L8BA 1NC2A 4U7KA 1MVUB 4OI9A 3H3PL 3D9QX 2ICES 1P6FA 1UQSB 1I1AD 4XPAH 4L9LA 1YJBA 2G2RA 2VLKE 5D7IE 4JRYD 2RBLA 4PS4L 2XTJB 1VACA 1V3MA 1FE8H 2DMCA 1F13A 1RU9H 1OW0C 3GI8L 1EHNA 4ZS7L 1YPZE 1U58B 3O2VH 4F58H 5D7LD 2XIDA 4OZGB 4H25A 4I3SH 4X98B 5E8EB 1KPRA 3RY6A 1T04A 4N0UB 3S9DB 2GTWA 4ODWB 3FT4A 4WFEE 4DWHA 1ZANH 2V9RA 1KLUB 3PHQB 4FP8H 5KOMC 4PGBA 4WW2A 5JO5A 3O6ML 4OBSA 3MFFB 3SDXB 3GEWB 1WBZA 1RHHB 1IL1A 3ORJA 3NZ8B 5TE7H 4YHMH 2NMSA 2HG5A 4I5BA 4KKLD 1EVTC 2AV1B 3HNSL 5LXGL 2CLRA 35C8L 3KXFD 4K7FB 2CSPA 5JW4Q 1KTLB 4HHAA 1OAKH 2YBRB 1JPSL 3VCLB 1FSKB 2C3VA 1UJTA 4E41A 4XP6L 1PZ5A 1ZVKA 4O02H 4HV8B 2XN9A 5BJTB 3FB7B 5CILL 1BX2B 2FGWH 4M1CD 2J2ZA 1JMZA 1LD9B 1UJ3B 1MUJA 2FBJL 1I9JL 2VUYA 1ETZB 1S7UB 1T1WA 1T83C 4ZFOB 4XP1L 4ODTL 4PPTA 1ZHNA 3RU8L 1AP2B 2DJ4A 3WS3A 1P7WA 2NY2C 1HSAA 5EOTA 4HX2A 1S9XA 1T0MB 1WV7T 3QTLA 2WUBL 1KJ3H 1L9MA 4I8DA 4FQLL 1L6ZA 4I0PC 4X6FA 1K4CA 5FM5O 3DRQA 3A6OA 1A14L 4YHIA 4CAGA 5E2VL 1VFUA 1CFQB 3MX0A 5FUOH 2P7TB 1MFAL 2R2EA 4NQVA 5IBTL 5K33A 3O6FD 1XR8B 4KK8C 4FQJL 4OD2B 1RQ5A 3REWA 3S3JA 1OLZA 1FGNH 4F37F 3HN3A 3BIKA 2FJHB 4XP5H 5D1QC 5INDA 3SPVB 1OGAE 2EDJA 1D7FA 3U83A 3PGDB 3AB0C 3I37X 4RIRB 1IGIL 1IAKB 1MFNA 5J6HA 5L88L 3B9KC 4JFFA 4PJEF 1FFQA 4X9HA 3DGGB 4XCEB 1I8LC 2ZCLL 2D7TL 1V7NL 5BS0E 3G5ZA 1F11A 1L0YA 4R96A 5E4EB 1EXUA 3T3PF 5HGHB 1ZXQA 4QXWA 4LVNB 4HBCH 1BAFL 4JVWA 5C0JB 3K8MA 2NY7L 3UDWA 2PYED 4UBDD 1KC5L 3ME0A 4JFYA 4ERSH 2QTWA 1X5AA 1YN6B 1OAUL 4QTIL 2UYLA 1S7WA 3S34H 3QUZC 3ZDZE 4YBLB 5EA0H 4Y1AB 1FNFA 3VXPB 1GOFA 3ULSB 4DFHA 3RWJB 3O2DL 2Q6WB 3BESR 4J1UB 4M1GL 1NSNH 4TULL 2XZQL 4LCYA 3O9WC 1UYWH 2A73A 2X42A 1AXIB 4YDIL 2PXYD 5GISL 4GRLA 4RX4D 3AS3A 4FMKA 1CDIA 3N06B 4P2CG 1I3GL 4HWBH 4WUUD 3GMOB 3EO0B 4LDEB 1GHFH 3DRTA 4LLWB 3TNNB 1FZMA 2RJMA 5CKGA 1EEYB 1P1ZA 1WWWX 1Q0XH 3CLFH 2RCSL 3GMNA 3SE9H 3PABA 2B5IB 3V0WL 4H0IA 4LSRH 3VFTB 1FLRH 5F7WC 2DLIA 1KLGA 3MJ6A 2Z31B 1NCBH 3RGVA 4R3SA 4P2RE 1MEXL 3GJEB 2VZ1A 4JKPH 4JKWA 4U1GB 3B83A 4E42B 3WD5H 3WO3B 1NCWL 3QIBD 2AJVH 4NFCA 2AKRA 5HYQA 1CXFA 4PJBB 4ISVB 1HHKA 3KJ6H 4W6WB 4MAYB 1MCWM 2V7NB 1FL5A 1P9MC 4MA1B 3UBXI 4ZPTB 1K8DA 2CDEB 4L1DA 2JB5L 4GXVH 3IDXH 1RUQL 4Z7UF 2JF1A 2GJ6E 5EZLA 3MRCB 3BH8A 5ARDA 3ZLQC 4TQEH 1ZHLB 2OTUB 2R1YA 3LZFL 4YXLH 1T2QL 3MXWH 4RMVA 4OZGF 4F7MA 1JGLH 4PJFA 2HJFA 2X9YA 1AI1L 1N2RB 4Z95L 2NY1C 4P5TB 5B1DA 3ZHKA 3PXHA 1DBJL 1XCQA 3VWJB 1KYOJ 2IFFH 2IADA 2B1AH 4PV8A 1T89A 3WQBA 1IEBB 2YD5A 3SDXF 2I60H 1KJMB 2X40A 3QP3A 1C9NA 3GRWL 3FFDB 1P7QA 2JK5A 4R4BB 5IM7A 2D0FA 4UNUA 1CK0H 2R0KH 1IMHC 3FB6B 2X4SA 1A3RH 4PGCA 3A0OA 1YDPB 1BD2D 5DC0A 5GRVL 4F2MA 3GKWL 3MJ8B 3OZ9H 3EFFB 2COQA 4KTEH 4Y5VB 1VDGA 1J1XH 3KWWA 3FFCE 4FTVB 5JDJA 5JHLH 1E6JL 1JGVL 2C3GA 4WNQA 1ZAGA 4ZXBB 5FOJA 3KPNB 4EEEA 1UH2A 3MRMB 2KKQA 3G08B 3L95A 2CLVA 2GUOA 5DQDH 5T1KD 1BGXH 2BZDA 4B5EA 1JGUH 2EDDA 4HF5L 3C5SA 5DMKA 2GW5A 2ZPKH 3GKZA 4P2QE 5GGSB 2EIDA 5EU4A 4OLUH 2HMID 1IGJA 3MLUL 1TVHA 4K2UL 4UU9A 5C0ND 1A7NL 2PMWB 3NCJL 3Q1SH 5L6YL 1CXLA 1IC4H 4CRPA 5J6GB 4LIQE 4H1LG 3F5WA 4JDTL 3O3BB 2NLJA 2IXTA 1R3IH 4XAWL 2EYSB 2VDKH 4GBXC 1WWAX 2H26B 5FO7B 4KKCC 4HPOH 3BXNA 1QLRA 3ZDXF 4Z0BH 5E03A 4RGMC 1FNGA 3BPLC 4J8RB 1MFCL 2JIXB 2QSQA 2WK2A 1C5BH 3RWGB 1SCAA 4H5SB 2GYSA 8CGTA 5FYLL 2AP2A 4JVUA 5DMIH 2P48B 1JHTA 3RJDA 5C0CB 3KYMB 1IAVA 4XWOC 3EO1B 1NMCC 2BJML 1C7SA 1PKOA 4Q9RL 3T77A 1TTUA 2DQDH 3TIEA 1I7UA 3C2SA 1MQKL 1NC2D 4HJGA 1A1OB 5EORL 3WFCL 2ADIB 1JF6A 4F33A 3GIZL 5DEZA 3QDME 1NCDH 4XRCA 4D9RE 4UT9L 4Q6YA 1EGQA 1R5IB 4UAOC 2V9QA 1AXSB 3GM8A 3OR6A 1MPAL 1OVZA 5CZXD 2R0ZH 2Y5EA 1VESA 3L3DB 1JZ3A 1G7HB 3KNBA 4U1HA 3NCCB 4NN7B 3ZL4L 4P9HL 4NCDA 3AM8C 1AE6L 2D31B 1F3DH 4BUHA 4KVCL 3OB8A 5DHXB 1PG7W 4WFFD 4ENED 5T3ZL 1UB6A 5CGYD 2XZZA 1INEL 3DARA 5I8EB 1NBQA 2R0WH 3MCLH 4EZMA 4WFHE 3O4OB 1ULVA 5KS9E 3RNKA 3EYOB 4LCCA 1WAAE 4ZD3H 1EUTA 2IPKA 3ZYZA 5TDPA 4M5YL 1UM4H 1OT2A 4PR5B 4XGZB 5ESQA 5AYUH 3PDOA 3GSUB 2A74A 3LMJH 1PX3A 1JWMB 2XKUA 3CXHJ 3PQYB 2EKJA 3SO5A 1B9ZA 2RFXA 1FPTH 3SJVA 2NY3D 3H7BA 1UWGH 3H6JA 3SKJL 3G5XB 4PJBF 5E6IC 5GQBA 1LO4L 5DFTA 2FDBP 4E41D 2XN9D 3ULVD 1NGWB 4DKDC 4TNWK 1DN0B 1FO0H 4PRPA 4HLZH 5C0BE 1KCRH 2EE9A 1I85A 2VN7A 5J1TC 2XY2A 3NVQA 4L8SC 3VDAA 2ERJB 3CX2A 4X0KB 3RPKA 5LWYL 3SQOH 4MA7L 5IR1A 1UEMA 1NFIA 1B4JL 4QHUB 5HYJE 4PJXA 3MLZH 4BELD 5B21A 1W8NA 3X14B 2BRRL 3V0VB 4U1MA 3GJFB 2QQNL 4ORGA 1BFTA 5H35A 2ATKB 4J12A 4U2ZA 3T3ME 4XB8A 1MFBH 4HUKB 5JXJA 1S7QA 1YEHL 2CDFB 3MO1B 4NO3B 3TBWA 3C09C 4NN6B 4TNVF 1HK6A 3QEUB 1MFDL 3PWVA 5AUMA 2V8BA 4K94L 5JOFA 3QMPA 2A83A 1VB9A 3P4NB 5MEOB 4XVSL 1F4YH 3F7YB 4ZUTB 5L2JB 3P40A 5C2BH 5F3BA 1E4KC 1OYVA 2LFGA 3PHOB 1SM3H 1KXTB 4XPHL 3U4BL 4F7PA 2BC4A 3IJSB 4LPXA 3VE0A 2Q8BH 4HIHA 5JPMA 4JFFD 1GOGA 3LKQA 5F7EL 1NBVL 3UBXB 2IMMA 4PGDA 1EIBA 1S5IL 3ARGA 3RL1B 5I1HL 1IBGH 2CRYA 3VFGL 5EU5B 4UMGA 4AMKH 5IUSA 3NIDF 3FQUB 4YE4L 4XNQA 4P46A 2FX7L 3A6BH 4Y4HC 3SBWA 1TPXB 3V6BR 2JB6A 5SWZB 3QIWA 5JHDE 1CLOL 4K7PX 2XQYK 2VC2L 1Y4DE 2P24B 5E5RB 2G75A 3D6GA 5T1LA 1M7DB 5DUML 2YA1A 3SE3A 4G8FA 2PR4H 2Z57B 4CU7A 1IGFH 5T33L 1G7JB 5EO0A 1RI8A 2W0KA 4IIQC 3RIFF 1QSFE 1WBYB 4LLQB 2GITA 3UJIL 4M6NH 4N9OB 4IDJL 1HQRA 1QACA 5JMOC 1QPPA 1CU4L 1PKQB 1AXTH 2W2QP 1LE9B 5I0DA 5H37H 4GT7A 3LRHA 1G84A 4P23A 4MLSA 4NQCB 3CO0P 1UZ6E 2QJDA 1CR9H 4HC1L 5CBEB 3OSZA 3M17B 1ZA3A 2OLDA 5D72L 3IFOB 5I74C 1NGQL 5I71C 3CX5K 4PP1D 5JORB 3HNTL 4ZO8A 5I15L 4MAUL 1H5BB 3P0GB 4KUCF 4OZHA 4S1SH 1DSFH 4Y19D 4U0RC 3HE6B 2HTLD 4G6FB 3T1FB 5C0EA 5C6WH 5I1LB 1IQDA 3GB7A 3BP6A 3PP4H 1BJ1J 3OMZA 1XZ0A 2AK1H 1IAIM 2H2SD 2MQ3A 3BP4A 4GKOA 1K4DA 2RIKA 4FS0A 1R3JB 1F4XH 5D1ZA 2BNUB 1SCJB 1N64L 4U31A 2Y7QB 3I50L 3S88L 4PREA 4X7SL 3MOBH 3WHXA 3DX7B 2NX5E 3GK8H 2H6PB 3U0PA 5TFSH 1IT9H 3WJJC 2X4PB 1LP9A 5KSUA 3PDGA 2HA1A 3MRRB 4PRDB 5DYOB 3ZKXC 1OWWA 3ZXYA 3TA3B 3X3GH 4CVZB 5GPRA 1F3RB 2E8ZA 1ORQA 4RGND 3SDDD 3TVMA 3DE5X 1IC7H 1MWAA 4Z9KB 3BT2L 1PSKL 3L3GA 4HW6A 4LHUD 4NKIH 1NEZA 4X4ZA 2X1QA 3FOLB 4KI5D 5TPWH 4Q9QL 2J7LA 3UP1A 1WSDA 1XIWD 1RVFL 2WP3O 3TBVB 2WBWB 3HFMH 3MGAA 1YMMB 2C3XA 5LGHH 1NMAL 2P47B 2CR3A 3T8XB 4LSTH 4Q6IB 3KPSA 5DDHB 1MRFH 1F4HA 2AEQH 3IGAA 1Y3DE 3NH7L 1MIEH 3V6FA 4RQQB 1QLFB 1VFBB 3GHEH 4KY1L 4RMUA 3HE7C 1HXYB 2EC9T 2IAMB 15C8L 4QF1A 1BEYH 3C6LC 3BGMA 3L1KA 1D5BA 4Y2DC 1ZGLA 3LRSA 1I1AC 1MHPL 1RZFL 5SWQB 4ETQA 3MXVL 1QR1A 4HZLA 4I48B 5FIEA 3UTZA 3WHE1 4DZ8B 3DX8A 4UILL 3WDJA 4IRSA 2PO6B 3MV8E 4OLXL 4XNMA 3IDNA 1OQOA 5FGRA 1PVHA 4JANA 4B41A 1MCIA 3GBNH 1VADB 3L5JA 2FH8A 1H0DA 1UA6L 1WFUA 3JWDL 3BWUC 5KN5A 2OK0H 3UYRL 2VXQH 3RDTC 3OTTA 2E7BA 4CVWA 3QIUD 3QULA 2WBJA 1PGRB 4XBPA 2QTEA 3F12B 5EBLB 4GS7B 5D2LE 3P0YL 1JF1B 4OSUH 3HPJB 3CVHB 4PBXA 1KCLA 4KKLC 3H0TB 5T3XL 4MDJB 2YK1L 3VW3L 4EXPX 1ORSA 5CKAA 1LWRA 1WLHA 3MV9E 5MEND 4PJ7B 4UDUA 4O58H 3VFPB 5EFIA 5MHSE 1KNOB 5CJ5A 5FA3A 1UM6H 3MROB 4WTZA 3QNZA 1U3HB 2H32H 2YD6A 3MV7B 2NY0D 4N8VG 2M1KA 1PYWB 5BMFL 3BPCB 4LSQL 3I2CH 3NABL 2F54A 3OGCB 1YNLH 3M1BB 4M1CC 3K2UL 3B2VH 2AGJL 4RCAA 1CI5A 3BQUC 3GCWA 1JF5A 2DMKA 4R2GD 3LQMA 3V6ZB 5IWLC 4ACPA 1R24A 5JQ6L 1GJIA 5EN2A 4PRHA 4PUBH 5HVFB 4NSKA 3CSGA 3SKNB 1WVMA 1D6EA 4JGJA 1ERNA 1QG3A 2VLMD 3VI3F 3WIFB 5K9QI 2H1PL 3GIVB 2IH3A 3DUUA 4P49A 5I73C 3I3BA 3F6LA 5TE6L 4HKJA 3X13B 4ZAKA 5ERWB 2EO1A 2VQ1A 4KUZL 5I6XB 2QQLH 3FOMB 1U8JA 2Y6SD 1QSEE 1WFNA 2SBTA 4Z8FH 2XA8H 4YC2C 1WUNT 3SDCA 1FN4B 5E00A 1AH2A 2NY5H 1UACL 1L0QA 4Y8DC 4GMTL 3H9YA 2JJSC 3OKOA 5E08H 4O2EA 1FVCA 3GMRA 3B2UD 3C08L 3EOAA 4N90D 1F97A 4PRIE 1KIQB 2BVOA 3QCTH 5B39A 4XPGH 5L2KB 3VXUB 4XVJL 3P77B 3ZE2E 5IKCB 3QQ4A 2OJEA 4QRSA 1UH3A 4XHQA 4KXZI 3UPAA 1A7RL 1S7XB 3QUMA 1HEZA 3QXAA 2OL3L 4G5ZL 5C6TH 4OAWA 5BV7H 2AEWA 5C1MB 4LQ1A 3X17A 3KPRA 3PTLA 4L4TD 4QOKB 2Y07H 1WT5C 2OM5A 4C54A 1AFVL 5C0GB 4GOSA 4MNGE 5F6HI 3WSQH 4Z7OE 5HHVL 3QEHA 1A4KA 5HYEA 3CUPA 2B2XL 1CGTA 1JPTL 3QI9A 3EJYD 3E2HB 4JHWH 3GCXP 1TZGH 4YHPB 3DROA 3WYRA 5HYSG 2KUTA 4LOUC 3TP4A 5HHME 1SBTA 3MRPA 3TBTA 2L4OA 2PXYC 4I4WA 4MDIB 5EC2A 3ARGD 1Q94B 1A6ZA 4MD0B 2A1WL 4X99A 1LEGB 3LH2H 4FQ2L 4HS8H 1N3NB 3BVNB 3TJEL 4GKZB 4F8QA 5T1DH 2I5YL 2WUCH 4AJ0A 3H3PH 5E4IA 5FDYA 1U8IA 3MNWB 4PYHA 1EEZB 4I9WD 4MXWL 3S98A 3ZE0E 4GI3A 4H88L 2GCYB 4L8DA 1JRHI 3P2TA 1YQVL 3KPPA 3MBXH 1BWMA 2AK4E 2XRAH 4PS4H 5H94A 2P5EA 2UWEE 5T1LD 3S4SB 2EIBA 3GI8H 4ZG1A 1P69B 2VLRB 4Y4FA 4MX7B 1CDJA 2VITA 4JRXE 4EI5C 1TJGL 5I1JL 4ZS6C 2IG2L 1JZ8A 1WBXA 5F1NA 3QISA 2Q7NA 4B5LA 2IJ0C 4JJHA 3MLYL 4NKQB 4IRZL 3W0WE 3N85H 1A1NB 4N0CD 1FNSH 4FQXB 1GGYA 4Z6AT 4PJGE 3MV01 4HK0A 4CMHC 4UTAL 4LPUA 2NY5C 1UQSA 2OXGA 2Y36L 5DK0B 1P4IL 4JM2B 1KYOK 5DHYA 5IB5B 5TGBA 4R26H 1SEQL 4P23D 2XTJA 3DVSX 4OFVA 3THML 3HNSH 1JMXA 4O5LH 5F89A 4IJ3B 1DZBA 1WISA 5CJQH 1U58A 2YA0A 2N4IA 4WOCA 5K59F 3H3KA 4OZGA 5E8EA 4X98A 1BH6A 4NN5C 5F3HB 4N0UA 5BV7C 1JI2A 2D2OA 4ODWA 4U6TA 1XFPA 1DUZA 5L9DL 2ZWLT 5CILH 3FT2B 3PHQA 1EZVY 5EBWB 3UAJD 4JQIL 3RZCD 4QHNB 2D9CA 3MFFA 3SDXA 4OGAC 1YZZA 2FBJH 3S37H 1RHHA 4M7LL 1G7MB 1T5XB 3NZ8A 4XP1H 4MNQB 3RU8H 1Q38A 4IS6B 5CINH 1B6UA 1UEYA 2AV1A 3L3IB 5D1ZD 3OR7B 2UZIL 4K7FA 4C56B 3D9AH 1KTLA 2WUBH 2YBRA 1UGNA 4ZSOE 1HH6B 3CSPA 4FQLH 1NANI 3KYNB 1MHCB 3KYKH 5EUOE 1DQML 5HPMB 5D7LE 5FGCE 2PQ2A 3INUL 1A2QA 4DZTA 4HV8A 5BJTA 2K9UA 3FB7A 2XFXB 2NXZC 2Q7YB 5C0NC 1V8HA 1LD9A 4C4KT 1UJ3A 4I3RL 5DK3A 1RIHH 1ETZA 1S7UA 4ZFOA 5I8CB 1I7TB 2AABL 2F5BH 1IAIH 3JWOL 3OWEA 2V2WA 1AP2A 3AY4C 1CT8B 3RX8A 4KVNH 3F7OA 4EN3B 4QRTA 4NUJA 1IM3A 1T0MA 5D6CB 5KVEH 3VD7A 4EBQL 3KXFE 1RJYB 2D7TH 3MCG1 4KPHL 3TN0D 2GKOA 1JCKA 1ZLUK 5J1SC 1SH7A 3VWKC 4V2CB 1C1EL 1BAFH 2W60B 2W92A 1YUHB 1CFQA 3DSFL 4F15C 4K8RD 3HPLB 4JQVC 3VG9B 1D6VL 4F9PA 4LCUA 4KZDH 4U6HA 5IBLC 4PJCE 4OD2A 4XX1E 1KXQE 3RL2B 1FCGA 2FJHA 2AS5M 3SPVA 2B4CL 2CGRL 1QFUL 2YUWA 3PGDA 4YDLC 4DUXA 2OXHA 3QWQB 4RIRA 3WE6B 1IAKA 1PG7X 4LEXH 3N9GL 4WO4B 4HIJB 4L9LC 3SO3B 4M1GH 3A6CL 2XZQH 4CN6A 1MOEA 2P49B 4XCEA 3U46B 5CZXC 3EO9H 3LEXB 4ZQKA 1WCBB 1O7VA 2BSRB 3PRKE 2IBZY 3QA3B 4R7NB 3AJ8A 5C0JA 5CUSL 4KK9D 3UZVB 1X44A 4J4PD 3GHBH 2APWA 1E4WL 1YN6A 3RY6C 3V0WH 3BEVB 3EYSH 5C08B 1NGPL 2VKXA 2E7LA 4Y1AA 2HRPL 3VXPA 1MEXH 1WZ1H 2HJLB 3PWNB 3ULSA 4X7CC 3RWJA 4Z7QE 2F53D 4J1UA 4GG6E 2JELH 4P3CH 1LILA 3QHFL 5IHBA 2VDML 2HT4D 3CXHK 5EU6B 5D8JH 4G80B 1T2XA 4JFPB 2BNRB 2EEDA 4L5FH 1CXEA 3GMOA 1X6NA 3EO0A 5DRXB 1YEDB 3TNNA 1TIUA 4KK5C 3ILQD 4LMQI 1WZMA 2FRGP 4LFHD 1UG9A 2O5ZH 1LMKA 3EZJB 3VFTA 43CAB 3Q2CA 2PYEE 4KJWC 2F54D 4WJ5B 2Z31A 1AI1H 1PQZB 3N50A 4OT1H 3GJEA 4KHTL 1DBJH 4RISH 3SGKA 2DMBA 4E42A 1U2CA 1DFBL 3QFJD 1A9EB 4PJBA 4ISVA 3VFWB 4MAYA 4NQDB 4XP9L 5DMGC 2V7NA 3QJFB 5DR5L 4JFHD 4JM2F 4ZPTA 2CDEA 3DVFA 2I25N 2ATPB 3TI7A 4OLZH 3U9PL 5MI0C 3VFRB 4MXVF 5JZ7D 2DI9A 5DGQA 1EEUA 3JUYA 2HVKB 3FN3A 3MRCA 3GNMH 4S1DD 1VEMA 4HIXL 4WUUE 3T0VA 3VGBA 5EOCL 1ZHLA 2OTUA 3U9UB 3QNYB 3AS0A 2DL2A 5C07B 1N2RA 3IRZA 5I1EL 5KBNC 1T03H 1XMWA 5IP4A 2DQJH 1E6JH 1JGVH 5C0DA 3SDCD 3VWJA 4W81A 4FQHB 4PGEB 1G9EA 4G6ML 4ZPVB 2GAZB 3D85B 1CE1H 4G7VL 1IEBA 3QH3B 5IVNA 1S7VB 3H9SB 4YHLH 1KJMA 5HHOD 3E6HB 3HMWH 1A47A 3FFDA 4HF5H 3RWIB 2UZYB 4R4BA 3IS1X 5F6HJ 4RYDA 1TVBB 3TT1H 4EDWH 1B2WL 3FB6A 3K0WA 1I7ZB 1YDPA 1A7NH 1F2QA 5FM5M 4MHHI 3MJ8A 3EFFA 4Y5VA 5IJKA 1Y9ZA 1MCPL 4X7FC 5KSVA 4WWID 4FTVA 4P2OD 3VGEA 3SCMB 3Q6GL 1CSEE 4ZXBA 3UDWC 5IMKA 1YN7A 2C1OB 3KPLB 3PIQB 5F9WB 3R1GH 2YSSB 3G08A 3BUTA 4RMSA 1KB9J 1ZGLM 2HN7B 2YPVL 1UWEL 4G9FD 1ITCA 1DL7H 2F74B 1NCUA 1KTKE 5GGSA 4MWFA 1J0YA 5IFJB 1F4WH 2P42B 4HXBH 1QBLL 4LLUB 4JPKL 1LO2L 3RP1A 1DLFL 2PMWA 5IFAL 4GRLC 4Z7VE 2OX5A 3P73B 2EECA 3CVIL 1BD2E 1DQDL 4RFNC 5J6GA 1MHHB 5I30L 4WUKH 1XF2B 3O3BA 3FCTB 2DKSA 4PD4J 2B0SL 4LRNH 3VD9A 1N5AB 2H26A 5FO7A 4UTBH 2E7CA 5D1XB 3BGFC 4J8RA 3D3VB 1P53A 2JIXA 3ULVL 1J1OL 4PP1C 2X4RB 4Y4KD 5HGAB 4P9ML 3GI9L 3RWGA 1OT5A 4FZ8L 4H5SA 3SQOP 4P48A 4OQTA 4BZ2L 3SOBH 3VMNA 5C0CA 3EO1A 5T3ZH 2HTLC 1DE4B 5JW4N 4ONGH 4F8TA 4IMKA 3B6SB 3RHWF 1MIML 3DIFB 1C12B 1A1OA 4OB5L 5F9AC 4ZOAA 4QTHB 2ADIA 5E1AB 4GUPB 4HZAA 4D9LL 1CE6B 1KN2H 1U8HA 5FAAA 1B0RB 2YD8A 1QBML 4M5YH 1R5IA 1FYTD 1AXSA 1O0VA 5JW4R 1S8DB 2QLVB 5I9QC 3L3DA 3DVIA 4ZUWB 3O4LB 5M7QA 1P4LB 1FORL 3BHBB 5HDQH 1T89C 4HIEB 2X9XA 2D31A 2OP4L 3T2NL 4HSQA 5F1IB 2BSTA 3VG0H 4G7YH 2ESVB 3O81A 4Q0XL 5D5MB 3TPKA 4DVRL 5I8EA 4OQTL 2NY6D 4GRMB 2ZZUT 4NNYB 2EKSB 1JGEB 2YEZB 3QWOB 1KCVH 3EYOA 1FG9C 2F8VA 3I85A 2BNQB 4LP5A 4KI5C 4TYUA 5LWYH 1HQ4B 3IFNH 3WDIA 4PR5A 4XGZA 3VRLF 1I8IB 5DD5L 3RJQB 3NN8B 4JO3H 4WFGD 3GSUA 3CFEB 1JWMA 2YUXA 3FB5B 3PQYA 2XZAL 4NWTL 2HFEB 4X9IA 4NZRH 1FNHA 4YHYB 3G5XA 3V7MA 5F6IB 2AQ3A 1KB5A 4KROB 2DOCA 3H3BC 2X4TA 2W2MA 1NGWA 4WFFE 4NRYB 5LBSH 1OP9A 1DN0A 12E8L 4K94H 5I8KH 4X0KA 2BRQA 2VNCA 4XVSH 5DWUH 1Q9KB 1WWBX 5EDXA 5EH1A 5I75C 3KR3H 5T5NG 2PF6A 5J9PB 1XGPB 1D9KB 3X14A 4YDKL 4IRJD 3V0VA 3QQ9C 1T7XA 1KOAA 3GJFA 3RVWD 5SX5H 2ATKA 4O2FB 2BERA 1KF9B 1DBIA 4JFDB 4H6WA 2CDFA 3MO1A 4NO3A 4AT6B 5IVXB 3TWCL 5HPOA 3QDGD 4OZIE 3QEUA 4KRLB 1YYLL 4E41E 5GGVY 1RUAL 3ULUH 4OLWL 2XN9E 4OF5A 1YEGH 3ULVE 3P4NA 5MEOA 1JFQH 3NFSL 4QXGH 5F8QC 1CLOH 1MJ7H 1IGML 2EICA 3F7YA 4OGZA 4ZUTA 5L2JA 4UINL 4AK1A 1YEFL 3OGOE 2SEBB 2ZP0T 3U2SB 2Z2ZA 3PHOA 4GAGL 3C9NB 1N5YL 3C8DA 3X3FL 1RZJH 3K7UA 2VDPH 4XCNB 3IJSA 5DUMH 1N6QH 2FWOB 3VGAC 4FFZH 5CIPB 3A3OB 2VL4A 3UBXA 3WFBL 3RL1A 1CICB 3CC5B 5JIHA 5EU5A 4BA8A 4NQEB 1HOCB 1RK1B 3HZVB 5IMOB 3FQUA 5D96B 4ELKB 4XP4L 3RNQB 5ILTL 4HXAH 1IC1A 3ARBB 3FRPG 1ZEAL 5SWZA 3D39D 1KEML 3O8XB 1SUEA 5DURD 3TO4D 4O4YH 1NUFA 1LVEA 1T80A 32C2B 1ITPA 4R2GC 1S3KL 3BUYA 1M7DA 4ZUSA 2LTQB 5EO9B 4LCCC 3NIGF 4HVLA 3U7AA 1NGQH 1QFPA 3MSPA 2VL5B 3HNTH 2Z57A 3TCLB 5T5NF 1QRNB 1HHGB 1G7JA 2HLFC 4JFFE 3TFKD 3DYOA 1ZT4B 3GSVB 1G7LB 5CP3A 4Y16B 1WBYA 4LLQA 4EUPB 1YEEH 1X5ZA 1NAKL 2DKMA 1J0HA 1EBAA 4WI6A 4DEPC 5B3JF 3WBDA 4K94C 5CLTA 1PKQA 4L4VA 1LE9A 5I2IB 3KS0J 2YR3A 4M48H 4PJHB 4NQCA 3WEXB 1Y6MR 1I85C 5CBEA 2VJXA 4LPYA 4HWNA 3M17A 5FO9B 5JORA 1TCMA 4HH8A 3AREB 4X7SH 2APFA 5JQHC 4GMSL 3BGOP 1I8MB 3FT3B 3W5NA 4YK4B 1H5BA 2R2BB 2XY1A 4R97C 1W0YT 4Q58C 1OARL 3LEVH 3MLVL 5EU7C 2DLFL 3HE6A 4HWZA 3T1FA 3ZT5A 5I1LA 1AC6A 3B9AA 3G6JB 3BRFA 3FQXB 4UZGA 3ULUC 4XC3L 2EXWD 4UOJA 1MI5B 3TC9A 1BMGA 4Y0GA 4AEIL 1U91B 2VAJA 1T7ZA 2AJYL 5D5MF 1KDYA 4Z7WE 1SCJA 1QLEL 1RVFH 2Y7QA 1RZJC 4HFWB 3UMTA