1R6VA

Crystal structure of fervidolysin from fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
671
structure length
671
Chain Sequence
SKAKDLASLPEIKSQGYHILFGELRDGEYTEGKILVGYNDRSEVDKIVKAVNGKVVLELPQIKVVSIKLNGMTVKQAYDKIKALALKGIRYVEPSYKRELIKPTVVKPNPDMYKIRKPGLNSTARDYGEELSNELWGLEAIGVTQQLWEEASGTNIIVAVVDTGVDGTHPDLEGQVIAGYRPAFDEELPAGTDSSYGGSAGTHVAGTIAAKKDGKGIVGVAPGAKIMPIVIFDDPALVGGNGYVGDDYVAAGIIWATDHGAKVMNHSWGGWGYSYTMKEAFDYAMEHGVVMVVSAGNNTSDSHHQYPAGYPGVIQVAALDYYGGTFRVAGFSSRSDGVSVGAPGVTILSTVPGEDSIGYEGHNENVPATNGGTYDYYQGTSMAAPHVTGVVAVLLQKFPNAKPWQIRKLLENTAFDFNGNGWDHDTGYGLVKLDAALQGPLPTQGGVEEFQVVVTDAKGNFGVPTVFVSMMRDNGSCYYAKTGPDGIARFPHIDSGTYDIFVGGPDHWDRALAPYDGESIPGGYAIALRMAEERQASFVGFGVSPDATQLNVNFNSTLQVKFSTNLSTLKDPQFVVVDPLLRGVYGRVAYARNQTYDLSLLSGQISFGIQTLLPAATDITIQGTVTLNGEDIPVYGVLKAGTTWTIIDDFGGLNLGTDSQPIYVWWTIFGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of fervidolysin from Fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin.
pubmed doi rcsb
molecule keywords subtilisin-like serine protease
source organism Fervidobacterium pennivorans
molecule tags Hydrolase
total genus 183
structure length 671
sequence length 671
ec nomenclature
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r6vA04
2.60.40.1800 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1r6vA01
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 1r6vA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1r6vA03
4JY5H 4I0PB 1CXEA 3LKRA 1IKNA 4F7CA 1YEFL 2IMNA 4XNUL 2OXHA 4BQCA 5IMOB 1UBNA 1BIIB 2FECI 3NN8A 1TFHA 2IBGA 4W68A 1ZT7B 4L3CB 3PNWB 2VLJB 4FQLL 1XCTB 4DEPC 4NQDA 1ZTXL 3IDUA 4FXLA 3V6OA 1FLRH 3CMOL 5CSZA 1S3KH 4N0CC 1DUZB 5CW1A 2CXKA 1G9NH 3KJ4C 3C5JB 4JFFB 5ABDE 4L3EE 3P77B 1B3JA 1ORQB 3RQ3A 4MQSB 2VDML 2DQGH 2X8JA 3H3KA 4LASH 1M7XA 4YHYB 3UAJD 5IB5B 2PR4H 4OCWH 1DLFL 1MVUA 3WNNA 5DLMH 1S7VA 3BPCB 4V1DA 5EOQH 4PJ8B 4DTGL 3NA9L 2J12B 4OV6B 3REWA 2NPLX 4U1KB 3I6KA 4DZ8B 1T2QH 3NZHH 1NL0L 1YY9D 3A6OA 2VIRB 2P24A 3WIFB 3WKNA 1TPXC 4YBQD 5D72L 4ZUVB 1JYVA 2VWEE 1GTJ1 1TM3E 3UTPD 3SDDA 2W65A 5L2JA 3SKMB 5ITFA 4CVWA 4OIIL 4MS8D 1PGRB 4ELKA 3RL1A 4NZDA 4DFIA 1A7NH 4PJ5E 1NQBA 3OAZK 2GITB 3TO4A 4DKAA 1IGIL 4G7VL 3PXJA 2V17L 1OTTD 1THMA 4KTDH 4UBDD 4HK3N 3VGGA 2VDPL 3QQ3B 1P7QA 1NDUA 4I3RL 5T1KA 1R3HB 4U0RB 3GUTA 2E6QA 3DVGB 3LKOB 1JNJA 5HI3C 1WIUA 5E1AB 4HGWA 3DW1X 3BIKB 4NRXA 3ZXXA 3GSXB 4XAKE 1MUJB 4LVNA 1F58H 1Q9WB 2GFBA 4R3SA 5AZ2L 1NFKA 4OB5H 5GGUA 3HPJB 4MA7H 1A2YA 2BVYA 1KCVL 4NNYB 2B20A 2YKLL 2JJUA 3W0WE 3AFGA 2FR4A 1NMBH 1KCSH 1XF3B 4L1DA 4HIXL 5FYKH 1QNZH 4XPAL 4ERSH 3BO8B 2YRLA 4JB9H 3QO0B 5BO1L 3VDAA 3IFNH 3DE1X 1HEZA 4KAQH 5HHOA 4QCIB 4Z6AT 4X7SL 2QQLL 4JKWA 2L4OA 3DUUB 3DE6X 4NNXB 3ISWA 2FBOJ 4OFDA 3QWOA 4TQEL 2AJSL 4DN3L 4WJ5B 4HX1A 5DHXB 5MP6H 4KK5C 5IT2H 1FL6A 5L9DH 4RMVA 4YHIA 5EBWB 2PTUA 5FYJD 3QUZB 2ZWPA 1N3NB 1MCRA 5HVHC 1NGYB 1JF1B 5K9QI 3MRPA 2P5ED 4JR9L 5JHLL 4I0PD 3AAZB 4Q97A 1UCBH 1ZT1A 2I60L 1T2JA 3ULVD 3BGMA 3EDJA 4ZSOE 1JGUH 3JV4A 3O0RL 3QIWB 5E9DD 3BYTA 5KS9E 3C60B 3BZEB 4MNHA 1XGUA 2BFVL 3O3DA 1ONQA 5DJXA 4KKBD 5GGQL 1FL3A 3S4SB 5C2BH 2JJTC 2EEBA 3IT8D 5ARBA 1FLTX 2ID8A 4RAHA 4YEFA 2XTLA 4RFNC 4XP4H 5DO2D 1YPZF 2HJFA 4QXUL 2E9BA 5DJCA 1YQVH 4WCYH 3BKMH 3ZLQC 2FX9H 1GGBL 4JFFD 1CICB 2X2YA 1PKQA 4UTBL 4YDVA 1YYMH 3KPSE 4KK6C 5LGJA 2OZ4H 1BJ1H 3EGSB 2WINA 1F00I 3DV4A 1TQBB 4MA3A 2XWJB 1DBJH 3T0DA 5MEND 3UTSB 3GIVA 3D69A 3QIBD 4WI4A 4PJ8D 3MLWL 5ETUA 3RWEB 4QTIH 2XQYK 3VSBA 3F5WA 3TYFA 2VQTA 2ZUSA 1JFQL 5KOMC 1F97A 4C83A 4GRLA 4MZ3A 5HYIA 5C2UB 2CR6A 4OM0H 2V2XA 1UM4H 3JWDC 1KLFA 3CNKA 2ITDB 1NMAH 1GJIA 4N0YH 4U3HA 1CDCA 3HS0B 1SY6A 1IEAA 1YECH 4NJAL 3MRHB 4I5BA 3QZWB 5E8DL 5I1JH 5LAXB 1QO3B 3G5VA 2A9MH 4Y4HD 2VXQL 4NHUB 4P9MH 4PJBA 1KIQB 2D0HA 1J5OL 5F1NB 3QA3A 1MIML 2C1OA 3HC0A 5ESQA 3VW3H 3BP5A 2R69H 5EULV 5L7XH 4PREA 2Y06L 3GMLA 1KEGL 5SV4A 4D9RE 5HPMB 4LPVA 4NFDA 3RUGA 5F21B 4N8VG 3S3SA 4ZPVB 3X13B 1C5DB 4M7ZC 1U92B 1Q72H 3EYUL 1MCJA 3KG5A 1INEH 5LCVL 3MRGA 1X4ZA 2Q87A 3U30C 3WE6B 5C0EA 5CILL 1HOCB 1JZ5A 1U8JA 3DGGB 1YEFH 4WTXA 3T0ED 2J7LA 2FL5B 4TTDC 4XHJC 5GIRA 4CL7A 5KS9F 1F11A 4XNUH 5HJ3A 3D48R 5FYJE 2C7UB 5T1LD 5GZOD 3KPLB 1TM7E 1BJRE 4FQLH 1BF2A 2Q3ZA 4M4RA 2P5EE 3UX9B 1ZTXH 1NBVL 2W9DL 3RWGA 2CIIA 3CMOH 4LU5L 4Y5XC 5JXAL 3ULVE 2NNAA 1CIUA 8CGTA 5E9DE 1FVCB 2ZCHL 3DO3A 2D4DA 4Q2ZB 2VDMH 4Y1AB 4NN7C 1AVTA 1NANI 2JF1A 3QUZD 2JTDA 3TF7C 2ZWLT 3M8OL 2UZXB 2A83A 4FFZL 2NZ9D 1DLFH 2X4TA 4UMGA 4YFLI 2OTWA 2VAJA 2FWOA 4DTGH 4I0KA 3NA9H 6CGTA 2QJDA 3DO7A 5E7FA 3C60D 2R15A 3ARFD 3MUHL 4IRSD 5F1SA 3BQUA 1NL0H 3U9PL 4C59B 1RURL 2GTWA 4H8WC 2R2HA 1EIBA 2ATPB 2H9GB 5D72H 4WU7B 1A6VL 5F7YC 3PWPB 1IC5L 3MV7A 4HAGA 5KSAA 5MENE 2YD1A 4OI9A 3ZTNL 2OTUA 1R3LA 3ZSTA 4JFOA 5DVLA 1SJEB 1VGEL 4OIIH 1CICD 3SGEI 2X89D 4LOUD 4ORGA 4QOKD 3OR6A 4ONFL 4XH2B 3CFJA 3IDMA 1UXSB 5DSCB 2HMID 3S34H 1NGPL 4MDIB 1YJBA 1IGIH 1EERB 2VXTL 4G7VH 2V17H 2CLRA 4JVUA 1QSEB 1OAXL 2VDPH 1ZAGA 3MPCA 1N7ML 4I3RH 2VN4A 1LE9A 1DQJB 1KLUA 4M00A 4UDUA 1B0GA 2H8PA 3BOVA 1IEBB 2FIRT 2VZ1A 5E99L 4NYLB 3UTZB 4FQQA 4NBXB 5MEPA 5HGGS 5JDSA 4QXGL 4NE9A 3ARWA 4F9PA 4PRAA 3DXAD 5I0DA 3EO1A 2WK2A 2ZCLL 3HRPA 4OZ4B 5AZ2H 1C9JA 4QHLB 1KCVH 1MQKL 1YDPB 5FF6B 2YKLH 4NQXB 4BM7A 1T7WA 4G43A 2Z31C 1JHTB 4HIXH 4P5MA 5ESVB 4XPAH 5A16B 4FXKB 5EU3B 5BO1H 1S7RB 3JSSA 3D25A 2XRAL 4QHNA 3WLWC 4X7SH 2QQLH 4X99A 1DJSA 3ULVF 3SE4C 2NMSA 3T0EE 2G2RB 1RAMA 2YZ8A 2BNQA 4OFYD 2XN9A 4TQEH 3GMMB 5CD3B 3BX1A 2AJSH 3QUXD 5TGBB 3QSKB 3CSGA 4DN3H 5GRYA 3RVUD 3F58L 3PDOB 2OQJA 4HS8L 3OAZH 2X4PA 3ARDB 1KIPA 1W0WA 4UB0L 5A2JH 4JR9H 5JHLH 2C3VA 3NPZB 1CIDA 5D2NB 3MNWB 4AT6B 2I60H 1EO5A 5T5NF 1FNEB 4HDIA 3VRIB 1RIHL 3V8OA 1OWWA 2XXCB 1KXTB 3HAEG 5IR1B 3O0RH 3OKKB 2B6NA 4LBEA 4E41D 2BFVH 5J06A 4GG6A 3MJGX 5B39B 5KVEL 1YU6A 5GGQH 3RBGA 5CKGA 5DTFA 2FATL 4ZUSB 3BZ4A 2BJML 4U1LA 1A6ZB 1I8LC 5DJAB 4QXUH 5I75B 4M93B 1RV6X 1UCTA 4PR5A 1QR1A 1GGBH 4G6AC 1DL7L 3I6LD 1RZIA 2BSSA 4EDWL 4UTBH 4Y1AD 2BOBB 2P48B 2Y5EA 4LNVA 4YHZL 1RZKL 5E8PA 5D1QA 4NKOB 1XGPB 1H8OA 4X7TB 4X5XA 2IBZY 2NW3A 3MLWH 3QXTA 5FO7A 3KPOA 3VGBA 1HXMB 4OD2B 1NBYB 2DQTL 5JLZA 4JFPB 4ZUWB 1YN6A 4QOKE 1SYSB 1JFQH 1JMXA 3PV7A 1ST3A 1W0YT 5FGCB 1HNFA 3L7FA 3FJTA 3PWPD 3F7VA 3RGVD 1I7TB 2D7MA 4Q7DA 5IGXL 3VJ6B 2ICWA 3BP6B 3K8KA 1KJVA 3KPTA 4IMKC 1FYTD 4LP4A 1U8QB 4J8RB 2IMMA 2I26N 4PJDB 1F42A 4NJAH 5JXEC 3QUYC 1DBML 4JLRB 1XF5B 5E8DH 3ABZA 4L5FL 2UVFA 1ZHKA 2C9AA 2X05A 4LVOA 5CSBA 2VXQH 1KPRB 2GJ6D 3DXAE 3TJEL 2APXA 4HUUA 1J5OH 1MIMH 1QSED 1Y34E 3EJZD 3L5WA 4MA8L 4ZFZA 5F1IA 5DUPL 3WL9B 2Y06H 1KEGH 4CDGC 1HINL 3QZWG 1EEZB 1S7UB 1Y0LB 3CH1A 4OCLC 4GOSA 5CP3H 3HZMB 4KJWC 4RMTA 2R1WB 2PXYD 5IMMB 3EYUH 4WO4B 1WITA 4G9FB 4K3DL 2Z35B 4YXLL 2H3NB 5I8KL 5LCVH 2Z57A 4ODTL 4M6ML 4EZMA 4IBLT 4EN3A 1UKTA 1UWXK 5CILH 1D9KC 3VXRD 4J1UB 4QRPE 3EOAB 1U8MB 4L4TE 5C0AA 3KLAB 4N1EA 2NYYC 3NA4A 5D2LB 1WFNA 3JTTA 4QXTB 4IOSD 4PJCA 2DQHL 3OTTA 3UROR 3PWNA 1HKFA 2VISA 4IIQC 1NKOA 1NBVH 2W9DH 3TO2A 2O93L 4TVPD 2BVPA 4LU5H 3QULA 1B6UA 5JXAH 1QFUL 5FOJA 2ZCHH 4E41E 3BSZL 4KJYB 4GBXA 1DQML 3QEQB 1OSPL 4WIQA 1LP9A 1J0YA 3ARDD 3M8OH 1JGDB 4GW1A 4FFZH 2BDNL 5E2JA 2CKNA 1FNGA 4G8FA 5C7XL 3QAZC 3WBDA 1CLOL 3I6LE 4NMXB 2XTJC 3U9PH 1RURH 4CNIA 4XCNB 4M1CD 1JK8B 3O6FC 5DD6A 4C3UA 1F3DH 1XT5A 3GCXA 3S88L 1CXIA 1K2DA 1A6VH 1IC5H 1W72L 3O4OB 4JRXD 3ZTNH 2I5YL 4ENED 5FK9B 4MD0A 4WHYG 4QY8A 1VGEH 3BJ91 3QQNA 1SEBB 5ANMB 4HGMA 4X6EA 3SBWC 4PPTA 3T4AA 1OT2A 2AEIT 1B9ZA 1NUDA 4PUBL 3UTTD 3PWPE 3OJDA 1EBPA 3JUZA 1NGPH 1PAMA 5BZDA 2ADJA 1GYAA 4NQSA 2VXTH 4MZ2A 3MV8A 1H3PL 4JG0L 1JI2A 2Q86A 1OAXH 3AU1A 1FYTE 1N7MH 2B4CC 2QBWA 3RZCD 1X44A 2OR8A 1AE6L 1F3JA 3IJHB 4PY8J 1BQHB 5E99H 1YPZA 3O9WA 1DUYB 5MEQB 1LDSA 4LCCA 4HKXB 1KFAL 3P30L 2GJ6E 4MNGB 1SHMA 3JTSB 5DJ8A 4CMMB 4QXGH 1ZA6B 1IAVA 3DRTB 5EZJA 3WFHA 3LMJL 1OT1A 3MRJB 2P5WB 4HUWA 2ZCLH 2VLRD 4ZAKC 2EDXA 2VZSA 4HUXB 4NKIL 5LG1A 1MQKH 1ZHLA 5CGMA 2NY4D 2R1XB 2GUOA 3ZKMD 2XNAA 1PKQE 1FZMB 4OIBA 4WEMB 3O41B 1DQLH 5J1SC 2FJGB 3S96B 1DR9A 1EHXA 2H45A 4G3YL 2P46B 4HUVA 2C1PB 3V7AG 3V7AE 4TUOA 2X9WA 2XRAH 1A1MA 1EHNA 4G8EA 3VXRE 1F4YL 3GSVA 5CJQL 5CJXC 1ZVYA 1I1AA 2CDGB 2P7TB 1A02N 3QBTB 5EB9A 1U8HB 4MD5B 3FT2A 3F58H 4M6NL 1YEEL 4Q9CA 5FUCE 4WO4D 1VCAA 4HS8H 4NO2A 2A73A 4UB0H 3HI6L 4TVPE 5EC2A 3E6HB 5JW4N 1ES0B 2ICEB 2A6KA 4H1LG 1MSPA 4D94A 5L6YL 3CX2A 4OAWA 5D6CB 2DBJA 1RIHH 2EDFA 3PHOB 3TGXA 2DF3A 2F8VA 5FYJU 4MJ5A 3HC4L 5KVEH 2QSTA 4C56A 4LHUB 3MR9B 2FATH 3FAXA 2BJMH 2PWAA 2AAVA 3QDMD 1TXKA 3ARBC 4AJ0A 5DFWH 4BFIB 3P9MB 7FABL 4IRJB 4RFEB 4HIHB 3SO5A 2WP3O 4YAQA 1UVQA 7CGTA 1DL7H 2BVEA 5EA0L 4Y4KA 2CLVA 4EDWH 1S7TB 3GSNL 3QEQD 1SYVB 1SBCA 3VV2A 4YHZH 1RZKH 5D1XB 4JRXE 3CFCL 4X8JA 3NBNA 3FQTB 4BZ1L 4I13B 4U31A 3ZE0E 3GKZA 4P23B 5DGQA 5IV2B 2UY7A 5AZEL 5CZXC 4FFWC 4M43L 1M71B 3GSWA 4I2XE 3LEYL 3QDGD 1FBIL 2DQTH 4JN1L 5GS0L 4YHLL 3RVTD 3UTTE 1EVTC 2IALA 3ARGC 3DX7A 3HB3C 2DLHA 1LD9A 5EIQA 1EMTL 3IKCB 5IGXH 4HJJL 1A21A 3S97C 3EOBB 3GBMH 4J4PC 5J1AB 4DWWA 4L9LC 4X98B 4Z18A 3D3VA 3MOQA 5A2KH 2HFFA 2W0LA 1DBMH 1WLHA 1AFVL 5E2WL 1FFOA 3U9UB 4L5FH 5DJYB 1FAKT 1T21A 5CINL 2HT4C 3S5LG 1NBQA 3CDGA 1ZVKA 2MHAA 3TJEH 4GRMB 2VLRE 5HGBA 2WIIB 1MVFA 4MA8H 4MMXC 2OCFD 5DUPH 3ZT5A 5FKAA 1FJ1A 3L6FA 1XF2B 4TSAH 4PJDE 5H35A 1HINH 1NGQL 5EO1A 1MCNA 2LV4A 3LRSA 3SY0B 5F88B 4DN4L 2BY3A 3AB0B 3K2MC 3I34X 4K3DH 2GAZB 4HIEB 4YXLH 2P5WD 3D0LB 5I8KH 4JG1L 4M6MH 4ODTH 1T66C 1VFBB 4M02A 5HHPB 3WFCL 3RX7A 4Z76A 2MWCA 4MCYA 2YN3A 1AHWA 1P69B 2X9XA 1B0WA 4AM0B 3MOAL 3ZYOA 1HXYB 2DQHH 2H2SD 3NZ8A 1JE6A 2X4UB 2G9HA 4GMTL 4G6MH 4ALAL 4XWGL 5IEKB 4X4YA 3HZVB 1ZHNB 4ZFOA 1QFUH 3VFVA 4XI5C 3AROA 4KZDL 3BSZH 1MJJA 1IAMA 3V5HA 1ZGLM 5D2LE 2ED7A 1OSPH 2SECE 2PTTB 5IW1B 2CSPA 1QQDA 3UYPA 3QDME 3V9FA 3P9LB 4IOFD 3F12B 2BDNH 3OB8A 2I9LB 2NW2A 3ZE0F 1QBBA 4ONHA 4S1DD 3V6FB 5DRZB 1RHHB 5GJTL 4LSSL 4I0PA 2J8HA 3LB6D 1SCJB 1W72B 2E7HA 5C7XH 3FHAA 1CLOH 1G9ML 1H0DB 1B90A 1OAZL 3TM6A 5C71A 1BD2D 1WFUA 2QLVB 3GSOB 3GB7B 4LHUD 1K85A 1BIIA 2VAAB 3S88H 1ZT7A 4L3CA 4XXDB 1W72H 2VLJA 3SCMA 3VFTA 3VMPA 4JM2A 2I5YH 4IRJD 3L3OB 1KC5L 3QDGE 2YUZA 1UWXH 3RIFF 4QLRA 3T0WA 4HK3J 1DUZA 3GT3A 4GI3A 3TJHC 1CDBA 3H2WA 4JFFA 2XA8L 3P77A 4PLJC 4X83A 4PUBH 4PJIE 5AYUL 3C6LC 4J3OC 2P45B 3OG6B 1SBSL 1MCFA 1H3PH 1XR8A 4JG0H 4PJFA 1ZS8B 5TFSL 4BELD 4PJDF 3RNQB 3BPCA 3V95A 3MCKB 1AE6H 4PJ8A 1HCFX 3ZTJH 4WWID 1JGLL 1ERNA 4OV6A 4U1KA 4PGEB 1JZ4A 3NGBC 4U6XA 3EFFB 4DZ8A 3STLB 5K9JL 3P30H 5F7KC 4FG6D 2FO4B 4WV1B 3WIFA 3QXDB 4ZUVA 3LMJH 1JZ6A 5I1HL 2IFFL 4NKIH 5DFTA 4EXKA 3BIAX 3TCLB 4L8DB 1U8LA 5D93C 3SKMA 3BRGC 3N1QC 3AS2A 1KJ3L 4NT6B 3HKFA 3RX5A 3DLQR 1HHHB 5ID0B 1KB5L 4V2CB 2VWEC 4I3SL 1RJLB 2XZCL 4G3YH 1IGML 4YDLC 2A6IA 4U1JB 4M61B 4WI7A 1MELA 4KKAD 4OD1L 1F4YH 3DX9B 5CJQH 3FQNB 2J2ZA 5GS3A 4O51B 1E6JL 5I71B 1R3HA 3DVGA 1J87A 3LKOA 5B4MD 2F8OA 3SDCB 4BFEA 4PJ9C 1IAOB 5D2LF 1EUTA 5E1AA 4M6NH 3QO1B 1YEEH 3BIKA 1AH2A 3X11B 3GIZL 1F13A 3GSXA 1MUJA 4GQ9L 4JPIA 1Y3BE 3T3PE 3V4PL 3HI6H 1Q9WA 1CL7L 2QSVA 1MAJA 4NO3A 5L6YH 4FNLL 4NNYA 2BNUB 4W81A 3HC4H 2Z8RA 1K3ZA 3DE0X 2IANB 3BO8A 5BV7C 2DUJA 4HD9A 1KN4L 3EHBD 3QO0A 1G7LB 3GSNB 4DAGL 4QRQA 2CR3A 7FABH 1KSRA 4QCIA 3BN3B 3NAAL 4LHJB 4OZIA 3DUUA 4NNXA 5DURB 3SHSA 5MI0C 5CLWA 2OL3L 3OG4B 5EA0H 5L8KB 2DKSA 3JV5A 1BD2E 3NPSB 5C08B 5DYOA 3GSNH 4WJ5A 4PJIF 4JFHD 5HHVL 1FAIL 5EBWA 1AO7D 1G9EA 1NGYA 1JF1A 3CFCH 4P2RB 4WI8A 4BZ1H 4R0LB 3WO3B 4KJQD 5AZEH 4M43H 3LDBC 3LEYH 1FBIH 4OCYL 4JN1H 5GS0H 1FFPB 1PEZA 3QIWA 3P9WB 4YHLH 2FX7L 3C60A 3BZEA 4RAUB 2B7DT 4UZGA 3MRCB 1Q0XL 1EMTH 3S4SA 3EOYG 1CF8L 4HJJH 2DYPB 5FAXA 5GS2H 5J56B 2PO6C 2ESVA 2NXYC 4YHPB 4KUZL 1MAKA 3DWEX 4EDXB 1J1OL 4LPUA 3WIHL 1AFVH 5E2WH 1I1CA 4NNPL 5CINH 1KGCD 3UAJC 4KMQA 3GZKA 1I3VA 4F58L 3SICE 4MYWB 3EGSA 3IDXL 1YMMB 3OF6A 4F33B 2XWJA 3UTSA 2DQEL 1HYSC 5DWUL 1YY9C 3JVGC 4TUKL 3RWEA 2RGSA 1NGQH 1T1ZB 1KT2B 2H6PB 4P3DB 1AI1L 4JFDB 4KRPB 3DVFA 1CLYH 4DN4H 4XT1C 5CJBA 2LVCA 3JV6B 1KELL 4JG1H 5E6IB 2ITDA 5FM5M 3WFCH 1KB9J 3HS0A 1AGCB 4PRNB 5F6IC 5AWNL 3CNQS 2MFNA 3MRHA 2XG5A 5LAXA 5FGRA 4XNXL 5DD0L 1QO3A 3AS1A 3U46B 5JW4M 1OTTC 3HTLX 3VFWB 3IFPB 3MQIA 4NHUA 3MOAH 2HG5B 1KIQA 4H25B 4TRPL 2IXTA 5F1NA 4D0DB 4K07A 3VD5A 4ALAH 4XWGH 4LVHC 3VGFA 4GW5A 3RKPA 4NN6C 5D96C 1CG9B 4NQEB 3ARQA 4NKMB 2DQUL 5DZLA 5B8CB 2KZ1B 4MQ7B 3SDCD 5HPMA 5ISZD 4OFYA 4KZDH 4TSBL 1H3UA 4JGUA 5J6GB 3GDBA 5HXMA 1MJUL 3X13A 1CQYA 5TDNB 1T1YB 4HUNB 5EU4B 4P5TD 4LPTA 4F2MB 5GJTH 4LSSH 2W0PA 3FQRA 3WE6A 3BWUC 1HOCA 4NQCD 3DGGA 2G4VA 3QUKA 1OAZH 4Z0BL 4JFHE 1U8IB 4JJHA 1AO7E 2C7UA 2NY0D 3KPLA 5FGBA 3THML 2OI9B 1SUEA 2X1PA 1TTFA 2EIEA 1KC5H 3SQOP 1YEJL 2FCBA 4JY4B 4WDIB 3VGEA 1WFTA 2XA8H 4Q2ZA 1J8HB 4CVXB 4Y1AA 5AYUH 5GS0D 1CGXA 3CZFB 3PJSB 1SBSH 4LLYA 4P2RD 1HWHB 3O4LD 3FO0L 4PG9B 2O61A 1AXTL 3OKNB 5TFSH 4XTRD 3HE7C 2MQ3A 2V7NB 3TVMB 3MV01 5E95B 3WNOA 1JGLH 3BPOC 4I48B 2TECE 3EAKA 5L8JB 1MLCB 1KGCE 5K9JH 4OV5B 3B9KD 5JIPA 1NSNL 4OZFB 5DO2C 2ID4A 2IF7A 2VDQL 2H9GA 3FTGB 5I66B 4AKSA 2P4AB 4WU7A 2QTWA 2DYPD 5CMAB 1CE1L 1KB5B 1U8OB 4YR6A 3N85L 5I1HH 4Y16B 2IFFH 4BQ9A 4LLMB 1O5DT 32C2B 3FHQA 5HHQB 1C8PA 3IGAB 1YEGL 3BE1L 4OZFH 1SJEA 5ICZA 3PGFL 2XXMB 1PZ5B 1KJ3H 3V7MA 2PQ2A 1CD8A 2NY6B 5E5MB 1KB5H 1A7QL 1EFQA 2NY7L 4XH2A 4P48A 4I3SH 2W38A 2XZCH 3RU8H 1IGMH 5DSCA 1YMMD 2WV3A 4NC0B 1FIEA 4FZ8L 4HJGA 4MDIA 3O3BB 4HH8A 1QSEA 4OD1H 5TH2A 5C0DB 2DQDL 1E6JH 4OF8A 3WCYA 5HSFA 1IC6A 4L8BA 1DQJA 2A74B 4JFDD 4NYLA 3MA9L 2IJ0C 4LPXA 3LKSA 2AXFB 5KN5B 3UTZA 5CBEA 5I8OL 3IETB 1G7HB 3KYMB 3TYGL 3GIZH 1VFOA 4MLSA 4NHCL 4JHBA 3T77B 4GQ9H 2Z2XA 2AJVL 3QPQC 5E6ID 4TPRL 3V4PH 1CL7H 1KJMB 4NZTL 4OZ4A 5HHMD 5T3ZL 1H15B 3QJFB 2DL2A 4L8SA 1YDPA 4FNLH 2QR0B 5ISZE 1BH6A 3R8QA 4NQXA 4P4KC 2BC4B 1JHTA 4UIKL 1HKLL 5A16A 4RZCB 2OL3B 3LRHA 1KN4H 4FXKA 1LK2B 1DVFA 2YPVL 4Z7UB 3ARPA 1H9VA 4DAGH 5M94B 3PP3K 2W2QA 3VXMD 3SKOA 1GNVA 4YEEA 2CDFB 3NAAH 4NQCE 5C0CB 2G2RA 2OL3H 4P2OB 3GMMA 5CD3A 4E0RB 3IRZA 1CXLA 3FT3A 5TGBA 2AP2A 5F89B 1T7VA 3MXWL 5HHVH 2MJWA 1MI5A 5CJ8A 5D7LD 2W2PA 1FAIH 4RAVA 1H3VA 2XTJP 1IQDB 4P2QA 2ARJB 5JIKA 1T5XA 5HYQB 5FO9B 5IP4A 4CFZA 4GT7A 1NUFA 1CBVL 3CFEB 1ND0B 2CXGA 5D2NA 3MNWA 3QEHB 1FNEA 2HVKB 3DX8B 3VRIA 3QEUB 4OCYH 3NFSL 4XB7A 5IR1A 3Q40A 2FX7H 2JK5A 4Y5YB 5E8OA 5L2KD 1EJ6A 5B39A 4P2RE 1Q0XH 3O4LE 1UM6L 5FXCH 2AXHA 3WJJA 3ZXYA 1CF8H 4JCMA 4M8VA 1A6ZA 4M4PA 1WAAE 1IFHL 5TE7L 3ORJA 3E1F1 3C09C 1ZGLP 4KHTL 2GJZB 1FVDA 4KUZH 3KLSA 4UILL 2Z2YB 1NDGB 1J1OH 3WIHH 1N6VA 3TN0B 3LIZL 4NNPH 1J8HD 1OGTB 1B4RA 3MRKA 4U1SB 5F6HJ 2C4XA 2BOBA 4F58H 1G7QB 1T3FB 4ZOCA 4X7DC 4NKOA 2F8XC 1XGPA 2DM3A 3N1GC 3IDXH 5EU6B 1P7WA 1I9JL 4X7TA 3OJVC 1E4JA 1DEDA 4J12A 3CNQP 4CN6A 2DQEH 2LAGB 3TVMD 1QLRB 4X5LA 5DWUH 2Z8SA 5BS0E 4TUKH 1HXMA 4OD2A 1NBYA 1AI1H 4ZUWA 1SYSA 3BWAB 3NACL 4PJXE 4DUXA 5IB4B 3RX8A 4MJIB 1L4IA 1VEPA 1QR4A 1I7TA 1KELH 1IJ9A 4PD4J 3TV3L 1MRDL 3U82B 1IKNC 3IU3A 3VJ6A 1Y48E 3D2UB 4S1QL 5HDQL 1GGUA 2QQQA 1CU4L 5AWNH 1M05B 4J8RA 4WVRA 5IFHL 5H2BA 3VXSB 2NY6D 2MNUA 3DV6B 1XF5A 4XNXH 5DD0H 1GAFL 4XX1E 4XX1G 4G8GD 1BFSA 5SX4H 3V5DB 2VDRL 4TRPH 1PEWA 5C9JB 3HI1A 2GIYA 3AREC 3MLSL 2IPKB 5CP3A 5HHME 4PJFE 5IOPB 2DJ4A 3SE9L 3MBXL 2JJVA 4WU5A 2DQUH 3WL9A 4Y8AA 3GMNB 1EEZA 1S7UA 1Y0LA 3G5XB 2UYLB 4Z8FL 5JOFB 4L4VA 3HZMA 3DTXB 1MJUH 3NMEA 4KROC 5C09B 2R1WA 1RHFA 1QFWI 4LQ1A 5IMMA 4WO4A 1H3TA 4G9FA 1NC4B 2Z35A 4JREB 1OARH 1MHHB 3VFPB 3VXME 1C9NA 2H3NA 4LDOB 2ED9A 4HFUL 4K71B 4ZOEA 1LNUB 1CE6B 2I27N 1YQ2A 2H26B 2QADC 4J1UA 4Z0BH 3E3QC 2Y4SA 3EOAA 4NN5C 4I18C 1U8MA 4HF5L 4ZFFB 1KACB 5D7LE 2F53D 4Z77B 3KLAA 3THMH 4PJEB 5CD5D 1NFDB 3PGDB 4QXTA 4DKFL 3SDDC 3RKDD 5DA0B 1MCKA 1WAAF 4PRPB 1A22B 1A7PL 3WDJA 3MZTA 5E70A 5C0CD 3RVUC 1RY7B 1LEIB 5HI5D 3MRQB 4P2OD 3ZKXC 5J6HB 4KI5E 4KJYA 3PABB 5L2KE 4GAYB 5JXIA 3QEQA 5LWYL 3ET9F 1WC7A 3L1OL 1JGDA 4UAOC 4BYHA 1YEKL 3FO0H 5HGAB 5T3XL 5L0QC 1AXTH 2DMCA 4P46B 1J05B 2APWA 1L9MA 2M1KA 1TNNA 3P11L 2NY3B 4RA0C 2P43B 3GMOB 2E9JA 4PJAB 3RWIA 5ACLA 5BRZD 1J8HE 4NMXA 4PJXF 1I8IA 2EKSB 1L6ZA 2YD6A 2E9IA 4LVNC 1NSNH 2YBRB 4LSRL 1JK8A 1J9CT 2VDQH 4PS4L 3QWRA 3EYVB 1WISA 5F9OL 3KYNB 1CE1H 4OM1L 3N85H 4Q6IC 3WO4C 2NY2B 5FK9A 2P1YA 2XICA 3IXTB 1YEGH 3BE1H 3PGFH 3MZGB 5C0NC 1SEBA 3UBXI 3PG2A 5ANMA 4WWKB 1UA6L 3AFLA 2A38A 1VKXB 2DLEA 1A7QH 1I7UA 2NY7H 1Z3GH 3OGOE 2IEPA 4FZ8H 3NCMA 5DEFB 1KCLA 5JHDB 3OKDA 4GH7B 4XNMB 2DQDH 4LGSB 4AEEA 1EDQA 3UPAA 3IJHA 1FZJB 3BRDA 3CC5B 1BQHA 1T83A 3RTQB 3TT1L 1DUYA 3MA9H 5MEQA 5HYJE 4HKXA 3V0WL 3DDZX 4DEPB 4G8GE 3FL7A 2VR9A 4JHWL 4MJID 5I8OH 4MNGA 2I9TB 4PRHB 2LFGA 3TYGH 1EFXD 4CMMA 4NHCH 2AJVH 3BH9A 1ZA6A 4FQPA 4TPRH 1WSST 4LLDB 2P5WA 4NZTH 5T3ZH 2CJUL 3H0TA 4PB9L 2NCMA 3KJ4B 1ITCA 2DKMA 4HUXA 5KSBB 1KLGB 3HPLB 4NO0B 2R1XA 3VXSD 1BLNB 4S2SB 4UIKH 2W91A 5ILTL 1J1XL 4YDIL 2FIKB 3O41A 5HYSB 1HKLH 2FJGA 3S96A 5TF0A 2Q7YB 3RVVC 2C1PA 1N59B 2RQ8A 4HCRL 4WW1B 4U3XA 4UUJB 1MCIA 2A77L 2GY5A 5I76B 1BJMA 5E1HB 2XKSA 2CDGA 3C87A 2BCKB 5ALCL 1TPXB 1CDUA 2P7TA 4PRIB 2F53E 5IW6B 1P2CA 3MXWH 4MD5A 2OR9L 1DSFL 4P4RB 4QHUB 2CH8A 3TA3A 4B7IA 1JRHI 1EEUA 4U1IB 4AY0A 1NC4D 4U7KA 4H6XA 4H8WL 5DS8B 1RUMH 4MNQB 2NXZD 3E6HA 4H6WA 1ES0A 1CBVH 1TETL 3L3HB 5KVGL 4CJ1A 2G60L 3DE2X 1WQVT 5D6CA 3ME0A 4LCYB 3NCFB 3Q48A 4GRLC 3NFSH 4TULL 2VDNL 3ZDYE 1PDKA 2EXYC 1FSKC 1MEXL 2WWKT 1UM6H 1L6XA 4LKCB 4LHUA 3VRLE 3MR9A 2ZSWA 1NFIB 4YPGB 4BFIA 1T6VN 1IFHH 3P9MA 5AG9A 3O3AA 4HIHA 4KHTH 4Y89A 3DRQB 4ZO6A 5BRZE 4UILH 4UOJA 5E4IA 2Z56B 3O8XC 5DEZA 4EUPB 35C8L 3LIZH 3ARXA 2X70A 4N90D 1I1FB 1S7TA 3RA7L 4O2EB 4OLZL 1OB1B 2W2OP 5D1XA 1FGVL 3A3PB 1I9JH 1UQSA 3NCYS 4M8QB 4X4MA 1P53A 4P46D 3FQTA 4YBLB 4EUPH 4ZPTB 4POYA 3PP3H 1T22B 4P23A 2FGZA 1GT91 5IV2A 3MRIA 1M71A 5BQ7A 2HT2D 1S7WB 1YY8B 5L8LB 4PP1D 4LSQL 2ZG1A 3HHRB 3NACH 1A8JH 4M5YL 5ADOL 2C3GA 4LIQE 4JKLA 5ADPL 3F62A 3WS3A 4KK8D 3TV3H 1MRDH 5I19L 5EZLA 2GTZA 4S1QH 5HDQH 1QHPA 2AXGB 3UBXG 1CU4H 3QDJB 4X98A 3IAPA 2MKLC 5IFHH 2B0SL 2DM2A 5ESAB 1IRAY 4MJIE 3U9UA 5DJYA 5JNYB 4MX7B 2DQKA 1GAFH 1NEZB 1CFQB 2PYFB 5FIEA 2VDRH 1JZ2A 1F6AB 3RZCC 3MLSH 4GRMA 5DJ0B 4XPFL 3RNKB 3SE9H 3MBXH 4MAYD 2YC1B 1QZ1A 1RJZB 3VXSE 4Q0XL 3W5MA 3L3DB 2BOCB 3INUL 1WBXB 4Z8FH 3R4DA 4M5ZL 2F54B 1MCOL 2IFGA 4GUPB 3VXTB 3M17B 4F7PB 5JPMB 2GAZA 4HIEA 3S3PA 4KQ4L 3D0LA 4LVEA 3OSKA 2DL9A 3VFMB 4HFUH 1VFBA 5I74C 3VXUB 2Y9RT 4NO0D 2HFEB 5HHPA 5B21A 3P5BP 3BQUC 4XBPB 4PRDA 1OAKL 4MB4A 4HF5H 4KDTA 4K9EC 5DVMA 5KSAC 3VRLF 3OKYA 4J7RA 4XBGB 1SBHA 2LE9A 4AM0A 1ORSA 4DKFH 5IJVB 2X4UA 3WIVA 1QSZA 3GM0A 1A7PH 3GSRB 3K4AA 4NQUA 1FIGL 1KPUB 3S7GA 5IEKA 1GGIL 1ZHNA 3SQOL 4UNTA 4BK4A 3G9VA 1AY1L 2FHCA 3HE6D 2JE8A 4XB8A 4ETQB 2Z8WC 4DK6A 3BPLC 5LWYH 1OGAD 4F7EA 3BXNB 2PTTA 5IW1A 2OYPA 3L1OH 1CFTB 3P9LA 1YEKH 2WBJC 5T3XH 1EGQA 4M48L 4F3FB 5DRZA 1RHHA 2HTLC 2AEPL 3AY4C 3K8MA 1OPGL 3B2UC 4Y4FA 3P11H 3K4ZA 5F72S 1NGZB 3X3GL 2GQHA 4N90E 5TE6L 1N2RA 2X1WL 4W4NA 1BVZA 1R5VB 3EE6A 3QXUA 4ODBD 3OHXB 4NE9C 4LSRH 2IWGA 3GSOA 2VAAA 4PS4H 5IIEB 2VB5A 5F9OH 4OM1H 5I8CB 3CX5K 5HI3D 3L3OA 1QYGL 1MOEA 2DD8L 1Z9OA 1PFGA 4ODWB 4M7ZB 3KDMB 1UA6H 2SEBA 1L7IL 1VERA 1XIWD 3MBED 3PIQA 5IF0B 3W39B 5FOBB 3U30B 4FQCL 4CADB 5IG7B 3CIQA 3EW3B 4CJ0A 1WVMA 3E0GA 3KPRB 5DI8B 3HN3A 2MQCA 5FYLL 1ZS8A 3DVQX 5FDYA 3RNQA 3RVTC 1WBYA 4CN4A 5KSUB 4AQOA 3QI9B 4XPBL 1AGEB 4ODSL 5CFHA 2VZ3A 3TT1H 4PGEA 4XNQB 5I1IL 3EFFA 2YXMA 3STLA 3V0WH 4OUUB 4JHWH 3T0XA 2C4FT 3MX0A 2FO4A 3OKOB 4WV1A 5I2IB 4GLRI 3SKNA 4Y5XB 1TVHB 3OZ9L 3P4OB 5F7LB 2CJUH 4PB9H 4YWGL 2V5RA 3H7BB 2I25N 5EG6C 4KK5D 3TCLA 4NN7B 4L8DA 4YGAB 4IMLA 1VFMA 4NT6A 4CW1B 2DM7A 2WUBL 2ATKA 1J1XH 4YDIH 5ID0A 5ILTH 3HC3L 1LVEA 4NO5B 1TTUA 3PWLA 3F49S 5KJRL 3DURB 1BFTA 3RHWK 4F9LA 4XBEL 4HCRH 3MRFA 4M61A 5D7IB 1C9MA 2BHYA 2A77H 3DX9A 1FVEB 3FQNA 3OKEB 1V05A 3KPMA 1N26A 1UM5L 1YNKL 3UEZA 5ALCH 3SDCA 2C3HA 2F54D 5D1QC 4PJEF 1DSFH 3KLHD 4JZNB 4LF3B 3QO1A 3X11A 4F15C 1MPTA 3L1KA 4R90L 4H8WH 3ECBB 3BUYB 5DJ6A 3VXUD 3GM8A 4N0UA 5JOPD 3G6AB 1LO2L 1TETH 5KVGH 2G60H 4NKDA 3MLPA 4KK6D 1EEQA 2BNUA 2L7JA 4TULH 2VDNH 1WZMA 1OGAE 1EV2E 1MEXH 1CGWA 1F6FB 5DD3L 5C92A 2IANA 1AK9A 3WS6C 3DBXB 1G7LA 3QB7C 3GSNA 1J88A 1ZKAA 5F1OB 4PJAF 3HMXA 3S36X 3MLTB 4X6FB 1T20B 4IDJL 5CZKA 3DE7X 35C8H 3CXDL 3WHE0 2B4CL 1RZFH 2GI7A 5C08A 3RA7H 1SEQL 2J8UB 1Q0YL 1CD1B 2BVTA 4OLZH 2GT9B 4P0DA 4KGJA 4I1NB 1U91B 4NIKB 4RMUA 1LEGB 3LB6C 2F15A 1MRCL 1JL8A 3N1MC 4LHQB 4R0LA 4FQXA 1V3KA 2GKIA 1E28B 4OKVB 2Z31B 4GS7C 1JV5B 2WUVA 3GGWA 3MLZL 3HR5B 1FFPA 5LXGL 4LSQH 4P9HC 1X5HA 4N8PA 3T09A 4M5YH 3IYLW 5HPOA 3QUML 5ADOH 4HT1L 4O9HL 4RAUA 4APQA 2EIZA 1ZVSB 3MRCA 4PD4K 2ZNXA 1HI6B 5ADPH 4P2YA 4EN3C 5I19H 4TUJB 4WI3A 2D3VA 1W0VB 3OMZA 3WIIL 1EK3A 4X9GA 2UV3A 4YHPA 3KYAA 4AEHL 2B0SH 4EDXA 5CGYD 4WW2B 4XCEA 2BMKB 4QRRE 1TK2A 3VI3E 2XQBL 4TNVK 4JO4L 2XWBB 1BFOB 3V79C 4HUKB 1YMMA 3VA6A 2A0LC 4F33A 1PTKA 1S7XB 4XPFH 1E27A 3MUJA 1VACB 3WFBL 2AERT 5E8NB 1PY9A 2N7BA 4Q0XH 4D0BB 5J3HC 3INUH 1T1ZA 1KT2A 2H6PA 2OJEB 4B5LA 1YN7B 4X6DB 4M5ZH 4JFDA 1MCOH 2ZG3A 3NFPB 4IEFB 5C07B 3U7WL 4UT9H 4KQ4H 3LKPB 5EOTB 5FHBL 3QTLA 5E6IA 5D5MA 1U9KA 4N0FB 25C8L 3EJJX 4UU9A 1AGCA 1T6WA 1IGTB 2F54E 2P49B 2PTVA 1OAKH 1QOKA 3U46A 4MDJB 4HZAA 3GMQB 3VFWA 4R4FL 2ERJC 4H25A 5JOPE 1AC6A 5B4MC 5INDA 3T1FA 1FIGH 5IHUL 5B1DA 1GGIH 3SQOH 1CG9A 4NQEA 4NKMA 5B8CA 1R3JB 4MQ7A 5GISL 3ZHLA 4CU6A 2X1XR 4E42A 4HV8B 2RAMA 5J6GA 3CAFA 3G6JE 1NUGA 1WCQA 5D1ZD 5TDNA 1T1YA 4M48H 5EU4A 3MXVL 3N06B 3HG1A 4H5SB 3IS1X 4F2MA 2AEPH 3A0OA 1P8JA 3QUYB 3U1SL 1OPGH 3UJIL 4W6WB 4OFVA 3ROOB 5F7DB 3X3GH 1YEIH 5TE6H 3T4YB 3B5TA 2FBJL 3U36B 1TIUA 5GSRB 1BVLA 1U8IA 2W0KA 2EYRB 4X9HA 2HPZA 3QFJB 2EXWC 4IJ3B 3DMMD 1ZMYA 5CP7B 1GZQB 1ZA3A 1HK6A 4QRTA 4OCMC 1RIUL 1QYGH 2DD8H 5JZ7C 4JY4A 3W11D 2GYSA 3C5SB 1B0RB 4JPVL 3SJVD 1L7IH 3LD8C 3VI3F 3SN6N 1ZLWK 4CVXA 4FQCH 3CZFA 3SGDH 4MJ2A 3PJSA 5EN2B 5C0GB 1D9KB 1JYXA 4PG9A 3UJJL 5FYLH 3OKNA 5CBAB 2Z31D 1A6AA 4NSKB 1OOAA 4CFYA 2YA1A 5GGVY 4GXUN 2V7NA 3L5XL 4PFEA 2W60B 1FZKA 3PDDA 4XPBH 4ODSH 4I48A 3RDTD 1HILB 4RGND 1MLCA 5I1IH 1N4XL 4OV5A 3M45A 2R9HD 1OLLA 1ZLVH 3WLWD 3IS0X 4OZFA 1I4FB 4PJ7E 3FTGA 5I66A 1NAMB 4PLKC 3TIDB 5CMAA 4ZG1A 3LPDA 3OZ9H 1KB5A 1U8OA 4YWGH 2R4SL 4Y16A 3FFCA 4EQ2A 2DI7A 5HHQA 3QRGH 3IGAA 3CH8A 2DIJA 3ZE1E 3I30X 3MUGB 2VRAA 3CO0S 2WUBH 1XR9B 4OCNC 3HC3H 1G6VK 5DD1H 5IHBA 3ZYZA 1MFCL 5KJRH 3K2UL 4XBEH 1QSFD 3O3BA 3G04B 3QAZB 2X4NB 1QSVA 3MRBB 1YA5A 3FONB 2F58L 1YYLL 5IBTL 5TDOB 1JWSB 5DGRA 2FLBT 3UNXA 1P6AB 3P0GB 3O6FB 1UM5H 1YNKH 1KDVA 2YR3A 3OSZA 1UXWB 5E6YA 1ACYL 2AXFA 3RY5A 5KN5A 1HHGB 4E9LA 5FDWB 4R90H 3T77A 1QRND 5MEOB 4G6AD 1X3DA 1A1NB 1KJMA 3EFDL 1ULVA 1LO2H 5GGVL 5TE4L 3QJFA 3EDDA 4BZYA 2QR0A 4JRYD 5E2TL 3WHXB 3NABL 3TEUA 5MHSD 2AK4A 2EDOA 1U3HC 4U49A 1K8DA 1ZGLB 3D39E 3TH4T 3UC0L 3LKNB 1TJGL 2QEJA 2NX5B 2CGRL 5DD3H 4HHAB 4RZCA 2OL3A 1LK2A 4Z7UA 4ZO9A 5DC0A 2BNRB 2CLZB 4LCWB 3AC0A 1T7XA 4OKDA 3I2CL 2IPUG 2CDFA 4IDJH 5C0CA 1LEKB 3PDGA 3DJ9A 1OD9A 2HN7A 3CXDH 1T80A 2B4CH 3FB6B 5AMXA 4YO0A 2XYCA 5F89A 1SEQH 2UVEA 1Q0YH 3P2TA 4P5TC 3LH2L 3C08L 4ZAKB 3T2QA 4BSWB 4V2BA 2RB8A 1IQDA 2ARJA 1UH3A 1MRCH 5I73C 5FO9A 3QUMB 5JXED 3QUYD 3D85D 3CFEA 3RAJL 3QEHA 3DX8A 1HHJB 4PJGE 1JGEA 3QEUA 4QT5B 3MLZH 3SJVE 1NMCB 5LXGH 4OTXL 4TOYL 3NFNB 4LNRA 1PG7W 5D7KD 4PJHB 4Y5YA 3QUMH 4PJ7F 4HT1H 3MFGB 4O9HH 4JFEB 3BKYL 4KH2A 3ZKNC 3WIHA 4DVBB 3LEVL 1IAII 3PQYB 1S5IL 3WIIH 4JO3L 3A6BL 3EIFA 2GJZA 1NGXA 3UDWC 3ZE1F 4AEHH 2EDNA 4RGNE 5FYLD 1AHWC 4Z5RB 4N9OB 1NDGA 3QEGL 3DE4X 3TN0A 1KTDB 4NWTL 3VXOA 1FN4B 1OGTA 4U1SA 2XQBH 1B2WL 2Y36L 4JO4H 4DJ5X 2F5AL 1G7QA 4D0CB 1T3FA 5F9WC 1BZ7A 1F02I 1Z9LA 5D70L 3TIEB 3VFUB 1WWWX 4PTUB 5EU6A 1MFNA 2C4FU 2XACC 3CSYB 3WFBH 1HQ4B 4K2UL 1X5LA 3FCTB 3M1BB 2GSGB 3L9RB 2NYYD 1RK1B 3WKML 5EC1B 5IVNA 4Z7WE 4DGYL 3BWAA 4R9HA 3ARBB 5IB4A 5D7IF 2F74B 4K7PY 3AXLA 3U7WH 1QSFE 1MFBL 1E4XL 4BFBD 3FAWA 4Z78A 5FHBH 1P7HL 1R5WB 2KKQA 5BV7L 2Y6SC 1UH4A 1AIFB 3D2UA 1GTG1 25C8H 3ROLB 5CEXB 1M05A 2YEZB 2FB4L 3DV6A 2WUCL 4TN9A 1G9NC 1X5ZA 3SCMC 1Z5LB 4JM2C 2P47B 1QRNE 2WQRA 3BP4B 4PGDB 4XVSL 3V5DA 4R4FH 5C9JA 2PYEB 4OLWL 2IPKA 3F6LA 2XTJD 5IHUH 1XGQA 4JRYE 4KI1A 2DQIL 3B9AA 3VFNA 3SDXE 5MHSE 4R6UA 5GISH 5DVKA 5CLTA 3GMNA 1D5MB 3HZYB 3KPQA 1BP3B 1EAPB 2UYLA 1CFNB 3DTXA 5C09A 1Q38A 5J7CC 3SOBL 4X0KB 2VDKH 4L9LB 1NC4A 3RWDB 3K7UA 1MHHA 3MXVH 4RMQA 3U1SH 1X5IA 1LNUA 4PJGF 2H26A 2FBJH 3I3EA 1QHOA 1CK0L 3FN9A 1JZ7A 5EBGA 4J6RL 5F9JB 2FECL 4ZFFA 1SIOA 4K7PL 4Z77A 1Z2KA 4PJEA 2BNRD 1NFDA 3PWUB 3PGDA 3FRPA 1RIUH 4PRPA 3G5YB 2IQAA 3FQXB 2YZ1A 4JVPA 5KVDL 3VMOA 1LEIA 4DZTA 3MRQA 5D7KE 3H3PL 4JPVH 3PL6A 1NC2D 4JQXC 2BXZA 2FRGP 1KOAA 4X80L 5J6HA 2DIAA 1EA9C 3PABA 4AG4L 3Q6FB 4HLZH 3C9NB 5DT1L 3WHE1 3RBSA 1AD0B 3UJJH 4E5XB 4PBWD 4P46A 1J05A 2ICES 4MVBD 4GXVL 3SPVA 3L5XH 2JKXA 5FYLE 4KGLA 4KI5C 4PJAA 4YHNB 3IDJB 4EVNB 3BW9B 1GA4A 3CSBA 1N4XH 2EKSA 5IK3A 4JFED 1R24B 2YBRA 1BAFL 2UUDK 5HTSA 4F7TB 2Q20A 2JIXB 3EYVA 1VPOL 1EZVX 5D9SB 4LLVB 2R4SH 1FV1B 2Q8AL 5ID1B 1YJDC 3IXTA 2WMPA 3V52L 3CSPA 2E27L 4JKMA 4WWKA 8FABB 1VKXA 2WAHA 4UNUA 2ITCA 1INDL 4P49A 4AK1A 1MFCH 3K2UH 4QGTA 2PKDA 5DEFA 5JHDA 2F58H 1YYLH 5IBTH 3QG6B 4UIMB 1VHPA 4XNMA 3GJEA 1QD0A 1FZJA 3CC5A 1OAYL 3RTQA 1EA7A 2P8LB 4U7SA 1ED3B 1Q94A 3ARBD 1ACYH 4Q58C 2E8ZA 1TM5E 2I9TA 4PRHA 1SUDA 3BI9X 1ZLWH 4XCCL 1NLBL 2BHZA 3V5KA 4UQ3A 4YH6A 2XTJE 3EFDH 43CAB 5GGVH 2DLGA 5TE4H 3DIFB 3OR7B 3QIWC 2NR6C 3QDHA 3HPLA 5KSBA 4X9BA 5E2TH 3NABH 4NQVA 3C6LB 1CFVL 1BLNA 4S2SA 1MCHA 1LGVA 3UC0H 1TJGH 2KL6A 5HYSA 2FIKA 2CGRH 5FYJL 3SDAA 3ZSSA 2Q7YA 1N59A 2PYED 4H0IA 2DLTA 2YPLD 3S37L 4L3EB 3I2CH 1VADB 4Z9KB 3NGBB 4CBPA 4JEGB 3ARGD 2WBWB 4UNVA 5I76A 3ULVL 3HB3D 5D7JA 2PW1B 4I4WA 3Q0HA 2BCKA 4PRIA 2C5DC 3C5ZD 4J4PD 4NGHL 4P4RA 4QHUA 3LH2H 3C08H 2BNRE 5B38B 4B53A 4LAQL 2BSRA 5DS8A 5D93B 4MNQA 4UI2A 1NCBL 3F6IA 2HT4D 3CVHL 3L3HA 3RAJH 1JNNL 1NCCL 3FB8B 4LCYA 3U0TB 3W81A 4OTXH 4TOYH 5CIPB 5EBLB 4YDLB 2WUWE 4GG8B 1CZ8L 3BKYH 4LKCA 3LEVH 4JPWL 4MAUL 1YC7A 3P3YA 4F7MB 1S5IH 5HI5C 3S9DB 4PJ5B 1NFIA 5DHYA 1Y18A 4JO3H 3U83A 5CIPH 4YPGA 3A6BH 5HDOA 1G0YR 1QKZL 4U6HB 3DRQA 4DUWA 1X6LA 5GJSL 2Z56A 4EUPA 3QEGH 1ITBB 4KXZI 4NWTH 1QA9B 4JFEE 3BDYL 1I1FA 2ZJSL 1T66D 4W6XB 1B2WH 3R0NA 2Y36H 3A3OA 2F5AH 4NOBA 4O2EA 5D70H 3A3PA 3SDYL 4M8QA 5I1LB 1J11A 1GZPB 3BEVB 4ZPTA 4K2UH 3TBWB 1T22A 3CPLB 5JA8B 1O7SA 4HMEA 5DQDL 4X6CA 1SBNE 2GW5A 3WKMH 5BV7B 4FMFA 1S7WA 1YY8A 4DGYH 4YJZL 3WXVL 3IXAB 2NZIA 3VD9A 1MFBH 2JIXD 3W0WB 1GPOL 1D5IL 5MI0B 1AGDB 1A6TA 4XI5D 5BV7H 2A6JB 1P84K 4U1MA 5IB3B 4EI5C 1X5GA 3VFGL 2R8SL 5EFIB 3QDJA 3DSNA 2CRMA 2FB4H 5FGBC 2WUCH 4U05A 1Y1KE 2EE2A 4G8IB 4LSDA 4LGPB 1NEZA 1MPAL 2WWMC 1CFQA 4XVSH 3I6GB 2PYFA 1F6AA 5DJ0A 3LDBB 4OLWH 4J3WA 2D0GA 3RNKA 2G75B 2HLFC 2YC1A 1RJZA 2R1YB 2VERN 4X7EC 3LKQA 3G5ZB 2HRPH 2DQIH 4FQ2L 1WZKA 1YUHB 4JN2B 2NTSP 2COQA 3L3DA 4R8WL 3TZVC 1WBXA 3QNXA 5DQJA 5GGRB 4GUPA 1ZLSL 3M17A 3KPNA 4TVSa 3VXTA 3IB4A 3SOBH 4F7PA 2PYEE 5JPMA 2YPLE 2PO6B 4ZSOB 1BMGA 1DEEB 2NXYB 5K7SA 2ILLA 5KS9B 2QKIB 1MEEA 3CCHB 3TJHD 3VFMA 5I1AB 5TJWK 3VXUA 3GI8L 4Y2DA 1Z0MA 1IC7L 1M4KA 1MHCB 3C6LD 2VQ1B 2FJHB 2OS7A 1CK0H 4J6RH 4YIQA 4K7PH 4M6OL 4YBHA 4XBGA 4XC3L 2E3VA 4JZJC 5DJDB 4BH8A 5IJVA 1U58B 1NPUA 2VUOA 2KQNA 2UWEE 3GSRA 1TCMA 3KPSB 1UJTA 2A9NL 3VXQB 5KVDH 1KPUA 4FTVA 4U1GC 4YE4L 1CTNA 4PJHF 3H3PH 4WI9A 4LSUL 2FDBP 1ODAA 4OF6A 4X80H 2O26U 4ETQA 4AG4H 2FH8A 2NXZC 4BK5A 5DT1H 1CFBA 3BXNA 4ZNEE 3ALWA 1S78D 2V7HB 1AJ7L 2WSKA 3CXHK 4F3FA 5F6IB 3HZKB 1RZJC 4BQ6A 4JQIL 5HGHB 2Q6WB 2Y7QB 4A2LA 4GXVH 3BGAA 4CDHA 4KKNA 3IFLL 3VH8G 3MUZ1 3O3EB 1GC1L 1FC2D 4MLIA 1P7VA 1A9BB 4HWUA 3MLRL 1R5VA 5BW7A 1A6WL 3OHXA 5DRNA 1BAFH 4LVHB 3BPNC 5IIEA 3MROB 3CFBA 1I8KB 1VPOH 1HH6B 4NN6B 5D96B 3RL2B 4L8SC 2ZSVB 4PJ9D 5SX5K 5I8CA 1JNHB 3VCLB 2Q8AH 2ZUQC 2E7LC 5C0BE 2YD9A 4QNPE 4JP8A 3V52H 4X9FA 2E27H 1JZ3A 3KDMA 4OFIA 1DVFC 3PE9A 1TVBB 4F37K 1CXFA 3W39A 3W9EB 5D6DC 2HD4A 1INDH 5FOBA 4CVZB 1MAML 4BA8A 1RK0B 5IG7A 4CU7A 2ZCKL 1CNMA 3KPRA 4XC1L 4XPGL 3J8F7 1O0VA 2YD4A 2HH0L 4ZOQI 4N8VB 2PNDA 3MGAA 4XAKD 4L8CB 3F7YA 3WFDL 5J89A 4MQTB 5SWZB 5KSUA 3QI9A 3VMNA 4HVLA 2DB8A 1AGEA 3TI7A 1E4WL 1OAYH 1T89C 4OZGE 4XNQA 5T5FL 2C3XA 2AXJA 4KK8C 4OUUA 5DMKB 1XF4A 2HJLB 4HIJA 5CJOL 2X44D 2YK1L 3OKOA 5I2IA 4XCCH 1NLBH 3I75B 4Y5XA 4B41A 1TVHA 3VDCA 1QFWM 2Q8BL 3P4OA 5ECJE 2DWEA 4NRYB 4FQHB 1MFAH 3H7BA 3DVRX 1RD6A 4HCRA 2P5EB 3FOMB 4Q9RL 1CFVH 4K8RC 4CW1A 3L3GA 1FDLL 4MJ6B 1N5AB 5FYJH 3BN9C 4XVJL 4MAYC 3HE7B 4HUMB 5E9DB 1CTOA 4NO5A 1AF4A 4J2XA 3NCBB 4OI8A 3DURA 2UUDH 3RVXC 3S37H 3T0AA 4KTEL 4H26B 5D7IA 3BPOB 2UWEF 4YN3B 5DK0A 1RJYB 2FJFB 3OKEA 3ULVH 3GSQB 1ZXQA 3WDHA 3DI2B 3T04D 2GEEA 3Q5OA 3CVHB 3TNNB 4NGHH 4GKZB 2ICCA 4JZNA 4LF3A 2V6HA 2IADA 2PO6D 1T4KA 1MCPL 1MQ8A 2NXYD 3BP7B 4GMSL 4ESKA 4LAQH 3ECBA 3BUYA 1SJVA 4HBCL 1NCBH 4M7LL 3G6AA 1IGYB 3CVHH 3QYCA 3LN9A 1JNNH 1NCCH 2OBGA 2IG2L 5MENB 3QIBB 5IVZB 5B38G 3ZDZE 1CZ8H 4XNZC 2AS5M 2HKFL 1HYSD 4JPWH 4MAUH 3DBXA 1N64L 4XMLL 4TSCL 3H3BC 2AQ3A 3KPSD 3ULSB 3HE6C 2WLZA 1QKZH 3MLTA 4X6FA 4QNPF 4OF0A 3CMGA 1S7QB 1PD6A 4D8PB 5FECA 4WUUD 3BDYH 1PG7X 5F8RC 2ZJSH 1LO0L 1XAUA 2VLKD 2J8UA 5SWSD 5EWIL 1WK0A 2GT9A 4P5KB 3X14B 4M7KL 1LO5B 3SDYH 1J0KA 1LEGA 4JJ5B 2R2BB 4Y4HB 5DUBB 3X12B 5IHZB 4MB3A 1E28A 1JV5A 3TWCL 3IAGC 2AV1B 2ADIB 4HWBA 5DQDH 1PVHA 2IQ9L 3S35X 4LCIL 1IM3A 2OP4L 3CFIC 3HR5A 4OZGF 4Y19E 3V6ZA 1BGXL 1UFUA 1PYWA 3WXVH 1ZVSA 4PY7B 1QUNA 2WLYA 1HI6A 1GPOH 2EYTB 1IMHC 3SE4A 1D5IH 1KPVB 1JBJA 2XZAL 3FB5A 4KRLB 3KPPB 4TUJA 1W0VA 1YNLL 1AKJD 1HSBB 1FYHB 3MBEC 3VFGH 1XIWC 2R8SH 2XWTA 2A1WL 1GOGA 4WW2A 2XFXB 4X6BB 1XZ0B 2BMKA 3T0EB 4D9RD 1MPAH 2XWBA 5H94B 1YNTB 4HIIB 1QPPA 1UWGL 1OF2A 1S7XA 5T1LB 2CRIA 3IKKA 5E8NA 1K8IB 5SWZD 4FQ2H 3LXUX 4D0BA 1U3JA 4W4OC 5JW5B 4R8WH 2OJEA 1YN7A 4X6DA 1H5BB 3FQUB 4KVCL 1T0MB 2C3WA 3GSUB 5C07A 2DMBA 1X5YA 1ZLSH 1OTSC 5LQBL 1I8LA 3C09B 3HAEB 2P8PB 4JAMB 4XGZB 3LKPA 5EOTA 3HJRA 3RWJB 2V9TA 4TVPL 2R23B 5JPNB 5TPWL 1IC7H 4N0FA 5GRVK 2E7MA 4QTHB 3T2OA 3RIFK 1SY6L 1IGTA 5K33A 3HAEH 1SELA 1X5FA 3ZDZF 1T2XA 3FT4B 3SQOA 4M6OH 3O4OC 3HE7D 4MDJA 4HJ0C 2R29L 4XC3H 4EKXA 4WHCA 3ARFB 3WEXB 4IRSB 1ZSDB 1UWEL 1Q9OB 2EDBA 4KV5E 2A9NH 3U7YL 5IROA 3QIUA 4MWFB 4YE4H 2CO6B 3KLHC 5EO9A 1P5VA 1R3JA 4Y7MA 4LSUH 1SQ2N 3RVWC 2LAAA 2BRQA 3LKRB 5J12C 4U33A 1AJ7H 5EU5B 4IMKA 4QOKB 4PV8A 1DBIA 4H5SA 4JQIH 2NTFB 3NN8B 3QUYA 1T83C 5ERWB 3IFLH 5F7DA 2VABB 2SICE 1N8ZA 2VYRE 4UDTB 1GC1H 4NQDB 4WUUE 3T4YA 3U36A 2VLKE 5GSRA 1DCLA 3AREB 3MLRH 1A6WH 5SWSE 2EYRA 4GAGL 3QFJA 2R2CA 4X4ZA 2BZDA 5CP7A 1KE2A 4ZMAT 1GCFA 2AJXL 3EUUA 1RUQH 2OM5A 5AD0B 1Y3DE 4WUKH 1JZ8A 3DXAB 4KROB 1AH1A 5GRVL 4BQBA 4LSPL 3SGEH 3C5SA 2AV7B 2VL4A 1B0RA 5I1DB 1CI5A 3QPQD 2DBLL 5ARCA 1T7ZA 1MCWM 1S7VB 4ZXBA 1SJHB 2W9LA 1MAMH 1KG0A 1OSZB 2ZCKH 4MHHI 4HWNA 3I6KB 5EN2A 3I37X 1M1SA 1UJ3A 3B5GA 4XC1H 1D9KA 2JJSA 4XPGH 4EBQL 1U3YA 2HH0H 2QADB 4P4KD 3R8BB 5DHVA 5CBAA 4NSKA 5GZND 3WFDH 4I18B 4EIZC 5IQ9B 3FFDB 4S11A 2FHBA 3MV9A 3TA3C 1IKFL 1E4WH 1HILA 1U95B 1TJHL 1XH3B 5T5FH 3SDDB 2KUTA 1GCIA 5CJOH 1EHAA 1F4XL 2YK1H 3NOIA 3QFHA 4P2CG 1I4FA 5FCUL 3QUXB 4QRPB 1IT9L 4YFDB 4Y5VB 1Q9KB 3TIDA 4L4TB 3ZKXB 2Q8BH 3KHQA 1PKOA 1IVLA 3LAFA 5CGYC 3CFKB 3J7HA 4R7NB 5SWZE 4HS6B 4EEEA 3WLBB 5FV2A 4Q9RH 2G5RA 5SWQA 3H7LA 1CDYA 3LV3B 3MUGA 3K4DA 4UOW0 1FDLH 1P7QB 1XR9A 4OZHE 4UAOB 5L0QB 3SGJC 1SIUA 5F96L 5CEYB 5C0FA 4XVJH 2J88L 4E41B 4GQPH 1MF2L 1RZKC 3MLYL 5DQ9B 2ZNWA 4YXKL 4KTEH 3G04A 4JVWA 4OF3A 3WQBA 2X4NA 4KV5F 3MRBA 4HGWB 3FONA 1NLUA 5SX5H 5TDOA 1JWSA 2M8XA 4X6CE 3O6FA 4XPTL 3B8YA 1UXWA 4KMLB 2APBA 5GGUB 1CDHA 2J6EL 4LPWA 4Q6IB 3WO4B 2UZIL 1HHGA 1MCPH 5FDWA 1VSCA 2FLRT 2VJXA 4GMSH 4P23C 3CFDA 5K9QG 5MEOA 4HBCH 4XPHL 1A1NA 4M7LH 1AU9A 1TTGA 5BOZG 3SBWA 3H9SA 4Y0GA 1R3KB 4PTTB 3FKUS 3QCVL 1HEZB 2IG2H 3WHXA 4Z0XB 5B1EA 1OW0A 1ZGLA 2Y1VA 4Z7VE 3MGOB 2NX5A 4URTB 3OJMB 5L88L 4HHAA 2HKFH 3DSFL 5F7WC 1G7PA 3QWOB 4XMLH 1GSMA 4HX1B 4LCWA 4TSCH 3RPIA 3HUJE 5CZVL 1FL6B 5KTEL 3RGVB 1KIUA 4JGMA 4WHYH 1LEKA 4NUGL 2ENSA 1J7VR 5D1ZC 1FYTB 1ZT1B 1LO0H 2YXFA 4XMKL 2EDEA 5EWIH 4RGMC 4ZAKA 4LFHD 4M7KH 5BZWB 3JV4B 5FEBA 1ZK9A 3DYOA 1QVOA 1G1YA 2GJ6B 3QUMA 5DJXB 1KE1A 5F3HB 5BVPL 3TWCH 2N7AA 2VR4A 1BJ1J 4G7YL 3VWJC 2IQ9H 5EUOA 1HHJA 4QT5A 4LCIH 4NQDD 2OP4H 3KXFA 1A4KB 2BY0A 3DMMC 3MJ7A 3ARED 3NFNA 1BGXH 5CWSB 1IARB 4CU8A 5E4EB 4CMHC 3U48A 4PLNC 5KG9A 3HCVB 2FEEI 1HQRB 3BJLA 5JO5B 4L29B 4O58L 1VA9A 4R2GC 4DVBA 5CJXA 1X5AA 1PKQB 2XZAH 3PQYA 2PXYB 3W11C 5J11C 1YNLH 4JANA 3WUWG 1G6RL 4FTVE 4KROD 3DV4B 4KQ3L 4OI7A 4MA3B 2A1WH 3NVQA 3D5OF 1CYGA 4XMPL 3H42L 4OZHF 3UZEA 3VXRB 3IDNB 4C4KO 1FN4A 4MHHG 4OFKA 5FM4A 4ELMA 4D0CA 5F3BA 2XIDA 3VFUA 2QADD 1UWGH 5KAQG 4GRLB 3RDTC 3KR3L 1PX3A 3I9GL 4RGNC 1WBZB 2R9HC 5ICYB 5IVXA 2W2MP 3M1BA 3L9RA 1KIRB 1GTL1 1HDMA 2PCPB 1RK1A 3SDDD 4KVCH 4H1LB 1V3MA 3CU1A 1TO1E 5LQBH 4QRPD 2F74A 3U2SB 5FKPB 1IEAB 1G1CA 4L4TD 4Y4FC 1RI8A 2MCPL 3O8XB 1R5WA 4TVPH 1AIFA 5TPWH 1D5ZB 4CN1A 4WENB 3ROLA 3D18A 4H1LH 4JDTL 2PRKA 1SY6H 3HC0B 5ESQB 2YEZA 5FGSA 1P7QD 4Z7VF 4LRIC 4N5UA 1Z5LA 2JCCE 1XFPA 2R29H 4D3CL 3BP4A 4PGDA 4KY1L 1UWEH 3HUJF 3Q3GA 2Y07L 4OLXL 5FBZA 2RHEA 5DEGB 4WHDA 4RMSA 4Y2OA 3U7YH 4JRXB 1I1YB 1BJ8A 1D5MA 3HZYA 3K74B 3B3IB 4PYGA 2X7LB 4PGBB 1EAPA 4AKTA 5DK2A 5C0EB 2WBKA 4I2XB 4RMWA 2J4WL 2ZUVA 4P9HL 4X0KA 1KTRL 4L9LA 5IKCA 3RWDA 3FO9B 5C0ND 3UTTB 1GGYA 3QXVA 4N8CL 2E7BA 2R0WL 1MCEA 2BP3A 1VGKB 5HHOD 4AEIL 3CK0L 1EXUB 3JUYA 4YXHL 3RZCB 5IM7B 2CIIB 5F9JA 4LFHG 4GAGH 3OJ2C 3MRMB 2CUHA 5HVGB 3PWUA 2J5LB 2AJXH 1Y6NR 3S5LB 3EOTL 2D0FA 3KNBB 5DMJB 2ENYA 3G5YA 3FQXA 1QEWB 3C6SB 4NQDE 4LSPH 2VLRB 3V6OE 5H37G 2X4OB 1E4KC 2DBLH 4YX2L 4BKLB 4PGCA 4S1SL 2NY4B 3U0PB 2B5IC 4F9LC 3Q6FA 5I74B 3DO7B 5C6WH 4ODXB 1JP5A 1AD0A 3BQUB 4EBQH 1ZHBB 4E5XA 5I71C 5H8DA 1SBIA 1F45A 3GFUA 4NCC1 5KSAB 4KG7A 1A6PA 1IKFH 3RVVD 3UYRL 3IDJA 2QV2A 4V1DE 3BW9A 4EVNA 4U4BA 1ZVHA 1R3LB 1TJHH 3PWJA 4U2ZA 5D71L 1F4XH 1GOHA 1R24A 2R0ZL 1JN6B 3CDYA 1IT9H 2ORBL 4F7TA 1I7ZB 1NUNB 5IWLC 4OGXL 1TZHB 3E3QE 1T1XB 3OR6B 5CEZE 1A14L 5IMKB 5D9SA 3CFJB 3RI5F 1FV1A 3BPLB 1PX4A 3OV6A 3BMVA 4LARL 2CLRB 2VZTA 5IB2A 3ARUA 1MLBA 2WBJB 2JCCF 1W2KT 3HLAB 8FABA 5F96H 4J3SA 2J88H 1EBAA 1AGFB 1MF2H 3MLYH 4YXKH 3JZ7A 4JZOB 3F8UB 4GRLD 3QG6A 2YWZA 2EXYD 4DCQB 3QDMB 3NPSC 4OJFL 4PRAB 4XPTH 2DS4A 4U3CA 4WTZA 5IEHA 1JJUA 2X5PA 2P8LA 1KJ2L 3QDAA 4JY6B 5J4MA 2J6EH 2UZIH 4FQXC 4WGWB 2NY5L 4G5ZL 3NH7L 4NFCA 3O8XD 4XPHH 2YMXL 1DLHB 43CAA 1JWUA 4Z7QE 4YFLF 3DIFA 5J1TC 2XZQL 3OR7A 1IGFL 1IC1A 2VH5L 3QCVH 5JXJA 4APQC 1P4IL 4P57B 3QDGB 5AYQA 2X10A 5JOEA 5L88H 1IE5A 3TPUB 2VR5A 1Z6JT 4NFBA 1FC1A 2QL1A 3QNYA 4L3EA 1MY7A 5CZVH 1VADA 5TDPB 5KTEH 4PJIB 4R97C 2W2NA 5HHOE 2PW1A 2XOTA 3EO0A 3L5IA 4NUGH 1CGYA 5IFJA 1REIA 4DOHE 4ZUUA 2EE9A 4XMKH 4UINL 4ONFH 4OIAA 2RIKA 1P7KB 3CLFL 5C0JB 3WSQL 5BVPH 4OF5A 4G7YH 4KRPC 4NDMB 5DDHA 3U0TA 4X7FC 5CIPA 5A3IC 1G6RB 1FH5L 1LO4L 4GG8A 3SGKC 5E2UL 1Y4DE 4O58H 3H42B 2Z91B 1NH6A 1RZIB 5INCB 4F7MA 1X7QB 4PJ5A 5JW3L 1UB5B 3L5JA 1G6RH 3O11B 4DGIL 4RFOL 5D1QB 1TLKA 4U6HA 4KQ3H 5B3JE 4XMPH 4F15B 3H42H 2DWDB 3VU2A 4K3EL 1D6EB 2W2PP 4JPKL 4DGVL 4J3XA 1J12A 4MVBC 3BQUD 5I1LA 1GZPA 3KR3H 5FUZL 3I9GH 5B8CC 3EYOB 3L7FB 4ODUA 3CPLA 3F7VB 3O6ML 3MV7D 5KSAD 3SO3C 1I85A 3PV6B 1Y6MR 3DW3X 4N5EC 4JDVA 3QHFL 5JW4R 4IOIA 5EZOL 1KJVB 1K6QL 2LQRA 4JO2L 3P5BA 5E5UB 1IM9B 5LVEA 3W0WA 4F37F 1AGDA 5FB8B 2MCPH 1F2XK 3WJLC 3VFRA 2ZZUT 3QJHB 4JDTH 4ORZC 5BMFL 5EFIA 4NZRL 5E03A 4Z2AA 2D03L 1FNAA 2WBJD 2ZOKA 5F1IB 4QHKI 3BYYA 3CUPB 4G8IA 2HTLD 1TZIB 3B2UD 4D3CH 3PWVB 5F7FA 4KY1H 4GS7B 3QH3B 3I6GA 3V0VA 1BD2B 2Y07H 4OLXH 1CDJA 1G0DA 4R4NC 4PJBE 4NUJA 2IY9A 2R1YA 1DE4B 1H8SA 4I77L 2Z57B 5GGRA 1DBBL 3O45B 3RUGE 5CSGA 2J4WH 1ZE3C 4P9HH 1TECE 4ZSOA 4QF1A 1DEEA 3T08A 5KS9A 2QKIA 3A3NB 4WOCA 3CCHA 4N8CH 5I1AA 1ACZA 2R0WH 2AI0L 4AEIH 3CK0H 2VQ1A 4XRCB 2V5MA 4YXHH 2BVPB 2DQFB 2BNQD 3VE0B 2XN9D 5FCSH 2DTSA 2VLLA 4HGKC 5DJDA 3OAYK 1AP2B 1YJAA 1U58A 3EOTH 1V3JA 4HMDA 1LP9B 2IH3B 5EO0A 3VXQA 1IAIM 3TCXA 3C5ZC 2VDOL 4ZYKB 5B3JF 4Z7NE 1RSFA 3X3FL 2EIDA 2J3SA 4YX2H 4S1SH 1II4E 3P4LA 1FNGB 3GT4A 3MCG1 1OYOA 2P44B 2V7HA 5IJKA 3HZKA 1RMFL 5HGHA 2Q6WA 3CLEL 4KC3B 2D7OA 4YK4C 5AVKA 4OGAC 1MCCA 2JB5L 4OFPA 3QHTC 3UYRH 3O3EA 4UV4L 1T1WB 2ERJB 5D71H 2FH6A 1U6AL 2R0ZH 3SE3C 5EIVA 1FO0L 1XGYL 3MROA 1I8KA 4OGXH 1HH6A 2AKRB 3MMEB 3T4AB 2ZSVA 4Q9BA 5D1QD 1JNHA 3MV7E 3OJDB 3D9AL 3VCLA 3ZHKA 5D7SL 2HA1A 5BZDB 2ADJB 4G6FD 4NQSB 4LARH 3MV8B 3DROA 1K5NB 2Q86B 2X6MA 3FN0L 2ICWI 2YPKA 5DMGD 1TVBA 5LBSL 3W9EA 1F3JB 5AUMB 4AIZA 4CVZA 1KJ2B 3L3IB 2AEQL 4PJBF 4WEUD 5CHNB 4N8VA 3EDYA 3LQZA 1G7JB 3QG7L 4OJFH 2EDQA 2A6DB 1BHGA 3FZUC 3W9DB 1CFSB 5B3NA 4ACPA 1KJ2H 3RUGF 5DMKA 2VOTA 2HJLA 1IM9D 5DR5L 1OQOA 2CPCA 2NY5H 4G5ZH 2AJZB 4W70A 5GRJL 3NH7H 1DQMH 3K81A 3MO1B 4PV9B 3I75A 3LQAC 1Z0NA 2Z93A 1FL5B 2YMXH 1AO7B 3UO1L 4NRYA 4FQHA 1K3IA 4NM8L 4HUVB 2MMXA 4HMCA 2XZQH 4LLQA 1IGFH 2VH5H 5HDLA 1HSAB 1A1MB 2P5EA 3FOMA 1R3IL 5AQEA 1P4IH 3WIUA 3LPGA 3REVB 1H3XA 4MJ6A 1HZHL 5F93C 1N5AA 3EJYC 4ODVL 4WTWA 5E9DA 1IILE 5IMOA 5EUKB 4H26A 2B39A 3PNWA 1GRWA 1XCTA 2FJFA 1TM4E 4K7FB 3GSQA 3WNPA 2Y5TB 4HWEL 2HLAB 4EN3D 4WFFD 2BNQE 1S9YB 3CVHA 4M62L 2XN9E 3TNNA 5J8OA 1A6UL 4GKZA 4DUVA 3C5JA 4UINH 1ORQA 3BP7A 5C0AD 2Z8VC 1D3CA 1DBKL 3CLFH 4S1RL 3WSQH 3IVKB 1IGYA 5IB5A 1I1RA 1MNUL 3IFNL 5GRXG 1S7SB 5MENA 4KAQL 3I02B 3QIBA 2A0LD 5IVZA 3LPCA 1FH5H 1YJDL 1AQNA 2MSPA 1LO4H 4NP4L 5AAMA 1ST2A 5E2UH 3EYSL 1UVQB 1KFAH 3BFOA 3V0AC 4GG6E 3TT3L 5J3HD 5IBUG 5HY9B 2DDQL 2VIRA 5JW3H 4KDWA 3ULSA 3VV2B 3DUHA 4DGIH 3ETBF 4RFOH 1V5IB 4KRMB 4O2FB 4ONGL 4X8JB 4JCLA 1S7QA 1ZLUK 2HJKB 4D8PA 1S78C 3CZJA 1WF5A 4K3EH 3EYQD 4LL9A 1DQQB 4JPKH 4DGVH 1IQWL 1S8DB 2YN5A 4P5KA 2JLLA 1LO5A 3E6FB 3TESA 2XRMA 2E5EA 4JJ5A 4Y4HA 2GITA 5FUZH 3X12A 3MUY1 1U3HB 3O6MH 2AV1A 2PW2B 5HVFB 1HYRC 3QQ3A 2I24N 5EZOH 1K6QH 4JO2H 5ISZB 1ETZB 4PY7A 1C08B 1SVCP 4K71C 1FFOB 1GL4B 1KPVA 4K3HA 3KPPA 1YYML 4WFEE 2PWBA 2MHAB 1HSBA 1SPBP 3DGCR 5BMFH 3AM8A 3MV8D 4NZRH 4P5TB 3KS0J 3ULUD 2D03H 3HPJA 1XCQB 1W8OA 5CUSL 1KDYA 1U2HA 1FJ1B 5EDXA 2XFXA 4X6BA 1XZ0A 4NQCB 5I73B 3VWKC 3T0EA 3O9WD 5H94A 1XF3A 1YNTA 4HIIA 4H0HB 4GRWB 2NY0B 5T1LA 5ALBL 1BOYA 3PL6C 1K8IA 1BECA 1VEOA 2EXWD 4Z95L 5E56A 5JW5A 4UTAL 5DMYA 1H5BA 2BXYA 3FQUA 1DBBH 1QFWL 3GSUA 4MGXA 4LLWB 2CO7B 1P4BL 3HAEA 5JZ7D 2P8PA 2RFXB 3WMSA 5TQ0L 4ONOA 4Z76B 4JAMA 1HHKB 2UY6A 4AL8L 3RWJA 2NY3C 5A43C 3QUZA 1N3NA 2R23A 4F8QA 5JPNA 2AI0H 3O4LB 3WN5C 3AAZA 4WFFE 4O4YL 5HHNB 5F9WB 4LPYA 3DE3X 2FSEB 1J8KA 3FT4A 1I1AD 3TP4A 4RQQB 5I16B 4GG6F 3ARFA 3WEXA 5C0AE 4IRSA 1ZSDA 2NY2C 3B9KB 4R7DB 1Q9OA 1QRKA 4MJ4A 4PJCE 2YSSB 3VA2C 1QQDB 2VDOH 1EH9A 5C86A 2OZ4A 3X3FH 4MZDA 1FG9C 1F8TL 4PLKD 5C1MB 4HLJA 3RGHA 2IBZX 5BS0B 1CICA 4C4KT 4HWZB 2X89A 1WUNT 5EU5A 3ALPA 3BIBX 4QOKA 4UQ2B 1LP9E 4PJXB 5I8EB 4YNYB 4C56D 1RMFH 1FO0B 2NTFA 4GO6B 3CLEH 3RTQC 1LHZA 2JB5H 5ERWA 4WHTB 3SCMB 1AGBB 3VFTB 2VABA 4JM2B 1T04B 1S9XB 4UV4H 4UDTA 4A6YL 2RCSL 3BEWB 1WIPA 4LP5A 3AREA 5ICXB 1BBDL 5KZCD 1U6AH 1FO0H 4B0MM 1XGYH 4HC1L 4Y4KD 4LIQL 3E2HC 3GHBL 4UV7L 3T3PF 3D9AH 5AD0A 5D7SH 3AS3A 3FRUB 2NQCA 3DXAA 1UADC 3OWEA 1XR8B 5HHMB 2AV7A 2FEDC 4PJFB 3FN0H 5I1DA 4Q74A 4TNWF 3SDAC 3O6KL 5LBSH 4FFVC 2GY7B 1SJHA 1JWMB 3F7PC 1E6OL 4RNRB 3QZWA 1C7TA 1OSZA 1G0XA 3BZFB 4U6XB 2AEQH 1Y9ZA 3OAYH 3QT2A 1U3HD 2ARJQ 5D7JC 4YZFE 2D7TL 2E7CA 3MV8E 3ULUE 4I18A 3QG7H 4GMTH 3FFDA 5IQ9A 3VXMB 5J13C 2IAMC 1U95A 1AR1C 1XH3A 1J86A 3MA7B 1YPZE 3D3VD 5DR5H 43C9B 1UYWL 1OLZA 1U8LB 5GRJH 3QUXA 4QRPA 5FAAA 4Y5VA 1KCRL 1Q9KA 2DLFL 4ZPVA 1QFHA 1C5DA 4L4TA 5D7LB 1U92A 3VD7A 3UO1H 1Y33E 3CFKA 4NM8H 4R7NA 4HS6A 4RWYL 1ZVJA 3WLBA 2EC9T 3S34L 1C12B 4C3VA 2A6IB 4AMKL 1R3IH 5GQBA 3LV3A 1N6UA 3PRKE 1QBAA 4BSJA 1G9MH 1HZHH 4ODVH 2FL5A 4JHAL 5CEYA 1SUBA 3MJ8B 3VRJB 1BQUA 4YC2C 4E41A 2V5YA 5F1KC 2ADGB 1MCDA 5DQ9A 5L2KB 4PJCF 2CUIA 1FRGL 4S0SD 1NDMB 1CS6A 1RZJL 4JPIB 3DOSA 3ZKND 1EEYB 3C8DA 4HWEH 1A7BA 1JPFB 2X4SB 1BBJB 1A5FL 4M62H 3NCEB 1JRHL 1F3RB 4NO3B 1A6UH 2M2DA 1FVCA 4Q6IA 4YBLC 1JYWA 4XVTL 4JKKA 1IBGL 1LP9F 3T8XB 1DBKH 2LTQB 5ARDA 4S1RH 2ZPKL 1R3KA 4PTTA 1MNUH 2A2QT 3BESR 2ZKHL 4QRQB 1BZ9B 4Z0XA 2EEDA 1FZOB 4XHQA 1YJDH 1MCWW 4NP4H 4OZIB 3PHSA 1P1ZB 1NCDL 3MGOA 1FG2B 3EYSH 1QP1A 3T0BA 5F7MC 1FPTL 2W1NA 3TT3H 5DYOB 2DDQH 4C56E 2ATPA 1AC0A 3D6GA 3PWPA 3RGVA 4O2CB 1ZV5A 1WMEA 5BVJB 2ZP0T 4ONGH 1GGCL 3ARVA 4D2NA 2VZOA 1QG3A 3D0VB 1FYTA 1JEAA 2Y6SD 5BS0D 2N1KA 5FHAL 1IQWH 3MLUL 5BZWA 5HYEA 2DMKA 5HYJB 2OLDA 1JPST 1UXSA 4YZFF 4G8GB 2GJ6A 3EBAA 3ULUF 1U36A 5F3HA 3U0WL 2VLJD 3SCMD 2GCYB 3B43A 3RWCB 4JM2D 3UYOD 1C1EL 1OM3L 1A4KA 3H6JA 3LVEA 4BWGA 3SEPA 2ESVB 1A7RL 5CWSA 1IEBA 2CMRL 4OLYL 4K8RL 3HCVA 1HQRA 5JO5A 2VXVL 4L29A 4Y2DC 2HT3C 2ZG2A 5I1KL 4K3GA 2PXYA 2Z30B 3A6CL 2D7QA 3DNKA 3TH3T 3UTPE 5GXBB 2O5ZL 3O2WL 4QHLA 4M1ZA 4RA3A 5CUSH 3ZT7A 4DFHA 5FF6A 3D3VE 2VMFA 3VXRA 3IDNA 4I8DA 4I3GA 5GZNC 4KB5A 5ESVA 2F53B 2APFA 5JDJA 5EU3A 5ALBH 1S7RA 1GGTA 1WBZA 1RULL 3DVIA 3JWNC 4Q6YA 4Z95H 5ICYA 3D1MC 1KIRA 2PCPA 3MLXL 4UTAH 4HZLB 1ZLUH 1QFWH 4H1LA 1OL0A 1WGOA 3TFKC 4IS6B 5F9AC 5HBBA 3WUZA 4GRWE 4LLUB 1P4BH 1XMWA 5FKPA 3U2SA 5TQ0H 4AL8H 4XVUD 2IH1B 3PDOA 3O8XA 1D5ZA 3ARDA 1DQDL 2AJUL 5BW7C 4O4YH 5IBLC 4JFXB 4AT6A 4GW5B 4DK3A 3BISA 2V8BA 3DYMA 2EE3A 5BRZB 3GMPB 3OKKA 2GK2A 3B83A 1EPFA 4KI5D 4HX2A 2P42B 5DEGA 4ZUSA 4WGVB 3R1GL 4JRXA 5FYKD 1AQDB 1KUMA 5AG8A 1I1YA 5DJAA 1F8TH 1R64A 3B3IA 2X7LA 2DI8A 4PGBA 3FQRB 3VGDA 4U1NB 5I18L 4I2XA 4A6YB 4EI5B 1KTLB 3T3ME 3QUKB 3UXFA 3FO9A 3UTTA 4NC1C 1SIBE 4G80B 3QI9C 1J0IA 1AR2A 3GRWL 3MTRA 4NKQB