1R6VA

Crystal structure of fervidolysin from fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
671
structure length
671
Chain Sequence
SKAKDLASLPEIKSQGYHILFGELRDGEYTEGKILVGYNDRSEVDKIVKAVNGKVVLELPQIKVVSIKLNGMTVKQAYDKIKALALKGIRYVEPSYKRELIKPTVVKPNPDMYKIRKPGLNSTARDYGEELSNELWGLEAIGVTQQLWEEASGTNIIVAVVDTGVDGTHPDLEGQVIAGYRPAFDEELPAGTDSSYGGSAGTHVAGTIAAKKDGKGIVGVAPGAKIMPIVIFDDPALVGGNGYVGDDYVAAGIIWATDHGAKVMNHSWGGWGYSYTMKEAFDYAMEHGVVMVVSAGNNTSDSHHQYPAGYPGVIQVAALDYYGGTFRVAGFSSRSDGVSVGAPGVTILSTVPGEDSIGYEGHNENVPATNGGTYDYYQGTSMAAPHVTGVVAVLLQKFPNAKPWQIRKLLENTAFDFNGNGWDHDTGYGLVKLDAALQGPLPTQGGVEEFQVVVTDAKGNFGVPTVFVSMMRDNGSCYYAKTGPDGIARFPHIDSGTYDIFVGGPDHWDRALAPYDGESIPGGYAIALRMAEERQASFVGFGVSPDATQLNVNFNSTLQVKFSTNLSTLKDPQFVVVDPLLRGVYGRVAYARNQTYDLSLLSGQISFGIQTLLPAATDITIQGTVTLNGEDIPVYGVLKAGTTWTIIDDFGGLNLGTDSQPIYVWWTIFGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords subtilisin-like serine protease
publication title Crystal structure of fervidolysin from Fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin.
pubmed doi rcsb
source organism Fervidobacterium pennivorans
molecule tags Hydrolase
total genus 183
structure length 671
sequence length 671
ec nomenclature
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r6vA04
2.60.40.1800 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1r6vA01
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 1r6vA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1r6vA03
3PHOA 3I84A 4OLUH 1RPQA 1P5VA 1YMHB 5DEZA 1WICA 1EBPA 2EYRB 2A77L 2VQ1A 3WFHA 4PS4H 4MX7B 3C2AH 4OFKA 1YZZA 4KQ4L 3U2SB 1RIUH 4B50A 1DLHA 4DJMA 3RWEB 3VU2A 3AY4A 4FS0A 2P5WA 1PW3A 3GSXA 3CSYB 3Q1SH 1PKQA 3PG2A 2P5EA 1YYML 3QUXD 1U8LA 5CSBA 3SDXA 3JWOL 3SOBL 5ADPH 4M1DH 1IGJB 1T20B 4LF3B 2GCYB 5CD5D 4R9HA 3ILQD 4XP6L 3UO1L 4BSWB 3D9AH 3ZSSA 4F2MA 4M4PA 4ZPTA 2ZUQC 2UZIH 4N0RA 2HFGL 5E8NA 1AV7A 1E27B 5AQEA 1QFWI 3BH8A 1U3HA 3T0XA 1QSED 1I1AA 4L5FH 1K4CB 5I8CA 5IWLC 2EE6A 3HNVH 4Q6YA 2UWEE 4YLQT 5GSVA 1G6RA 3HNSH 1JRHL 5D7IE 3VFPB 4HWNA 1TQBB 4AK1A 2SBTA 3D0VB 2R4RH 5I66B 4Q9QL 1D5XB 5FM4A 3VI4E 3GI8H 3O3DB 4QYOB 2APWA 5D1ZB 5FUOL 5I76A 3Q6FA 3O3AA 3C5JB 3IDNB 3RVTC 2AJVL 4Z7WE 3ROLA 1U8JA 3QDMB 4CADB 1ZLVK 3I75B 1MFBL 5EORL 1JWSB 3MJ7A 1BQLH 5GGSY 4UU9B 4K23H 5E9DB 4YHYC 4PLNC 1A7PL 1ED3A 3BH9A 1BVKA 3O2DL 5CGYC 4QHKJ 3FTGB 3GHBH 5A2LH 2VSDA 4QXGL 2LV4A 3B9DA 5CWSB 3I02B 4OFYD 2W9EL 4LSVL 4KK9C 4LNRA 3TWCH 4HWZB 4YGAB 2VZVA 4W68A 2A9ML 1OD9A 1KLGB 3BMVA 3I50H 4HGKC 3QHTC 2ORBH 1CI5A 1FRGL 5JXAH 5J3HC 3U9UA 3SBWC 1RZKL 3ME0A 4PP1D 3ZXXA 3T65B 2F54E 1LO3L 3FRPG 4Y4FC 1UA6L 3T4AB 4OFIA 1S78C 4NM8L 1IQDB 2AJ3B 3RTQC 4U1LB 1IC1A 3I6KA 3BYYA 4WFED 5L88L 1NKOA 3SDCD 1KTRL 1LK2A 1D7FA 3ZTJH 2AABL 1TFHA 5GHWL 5HHXH 5DJXA 4NRXB 1LO4H 3T3PF 1FO0L 1H5BC 3FQRB 1TETH 3P9LB 5IR1A 4OT1L 3SE4A 1DEEA 4JKWA 1DTUA 1OF2A 1CLCA 1FC2D 1ZWIB 4UDUB 1UJ3C 2APFA 1C1EL 1FQ9C 2X1QA 4DOHE 5I19L 3FRUB 4XMPL 4PJBA 2DF3A 1EZVY 1FNGA 1EVUA 3D39E 4D2NA 2PWAA 5GGUA 3QEUB 1XZ0A 2RJMA 3ZYZA 9CGTA 5KSVA 3EDDA 4TSBL 2BOCB 1GRWA 1BBDH 3P5BP 5SWQB 4JFEE 1DBML 3SJVA 4WO4A 5DTFA 3V52H 2ZG3A 1SUCA 3ARDC 1IILE 2D7OA 2P5WD 3H3BC 3PIQB 4I0WB 3C6LA 2P47B 2CLVA 2P5ED 4ODSL 4J3UA 5DJ2A 2ITDB 1EA7A 1XGTB 3CVIL 4JPKL 4GRWH 1C16B 3PWUA 2XTJA 4G42B 4ZFGH 4GG6A 4OI7A 3QRGL 3P9MB 5CEZD 2AK4B 2H3NA 4J2XA 4RGOH 3G9VA 4HC1L 1PX4A 3TJHD 1GGUA 4PJ7E 1U3HD 4MAYB 3KNBB 4LLQA 4M5ZH 1I1AD 1BLNB 3MJ8B 5LVEA 3BN9C 3QB7C 1CXIA 3Q6GH 4I18B 2CIIB 1IEHA 2Y1VA 1DFBL 3DURA 5E8EA 2VL5A 4D0BA 2ID5A 5JHDE 2PYFA 3N85H 1A2YB 4CL7A 1A6ZA 1YUHB 2WM0A 4EUPB 2EIDA 4X8JB 4H0IA 2P24A 2C4XA 2YSSB 5K9OA 1QLFB 3NZHL 4LDLB 1U3ZA 3TECE 1A6VL 1QYGH 3TNNB 4UQ2A 1RUQH 4JN2B 2XZAH 2AI0H 3AXLA 4M93C 3C5SA 2IANE 5HJ3A 1R5VA 2W0PA 5JPNA 3LN9A 3G6AA 1FNEB 1EIBA 2H6PA 1L6XA 2XN9B 3P4MA 4HF5L 1FBIH 5IVXB 1AO7A 1U3JA 5D6DA 5HYEA 5HI4D 2PWBA 4H8WH 1NH6A 1Q9WA 5C0EB 4JO2L 1LDPL 3JUYA 2VDPH 5C3TA 4PRPA 4U6HB 1VA9A 2WBWB 5L0QC 2X05A 1GXEA 3FO1B 1J10A 1UQSA 3UPRA 3QZWG 5IOPA 5BO1L 4JFDA 3MRBA 4L29A 2V2WB 2YBRB 2NY0C 3TZVA 4JY5H 3S5LA 1YPZF 2RAMA 2B1HL 4K7PX 4UOW1 1TZGL 5F9OL 4LKXA 2FYYA 3NCFB 3IDIB 3GBML 3QXAB 3RQ3A 4LQFL 2AS5M 5HHME 2ZJSL 4ORZC 2XQBL 4HXBL 1U58B 4PRHB 2V17H 4OV5A 1VACA 4AEHH 3VSBA 5EOTA 3RIAF 4KXZI 3GFUA 5HVGB 2WWKT 1YY9D 4CVWA 1QSFE 5K9KB 1EXUA 1SBIA 4MS8D 3IVKA 3RVVC 3CFIC 3HZVA 1HQ4B 3MRDB 4AEFA 4G8FA 1KJ2H 4OGAD 1QSVA 2QKIB 3I9GH 1XCTB 5IB1A 1NDGA 5I8KL 4CW1B 1FFPB 5MEPB 1A3LH 3O4LE 3VXQB 1R3HA 3SE8L 4M6OH 5CS7A 1I3GL 2A6JB 4HKJB 5ECJE 1FYTB 1RV6X 1BZ9A 4YDLC 3V6OC 4R7DA 2VISB 3V5DA 1EO8L 5DUPL 2HT4D 3SJVD 3OMZA 4WO4D 3WHIA 2ICCA 3KPSE 4BUHA 5KW9H 1NGPL 3C6LD 3BX7C 2XPGB 3KR3H 4MA3A 5T1KB 3MRJA 2MQ3A 1IAOB 4KPHH 3MLTB 3REWB 3S8WA 4TPRH 3MV8A 1I7ZA 2XTJD 3RY4A 4JJ5A 4P9HC 2L0DA 3EE6A 4KQ3H 5EULV 1TM7E 3NFSH 4QT5A 2ZKHH 3OKNB 3P40A 3GRWL 5JIIA 4L4VB 5DK3A 1VEOA 4YHKL 2VAAA 3QTLA 2NZ9C 4G6ML 5CBAA 1EVTC 4NM4L 1RULH 3QEHA 4W6YB 3GSNH 3GJFA 4R2GC 3ULSA 1JVKA 1E28A 4HIJA 3BPOC 4Y2DD 3RUGE 4O2FB 4OZFH 4IRJC 1YNTA 5CCKH 3BJ91 2XY1A 1T1YB 5DI8A 5CP3H 5HHNA 2VUOA 5KVEH 1QSEE 1A8JH 2F9BT 4G5ZL 1ACZA 1Q5PA 4NQXA 1MNUH 2V7NA 2VN7A 4YH6A 4AT6B 1D9KB 2V5TA 3E8UH 5CHNB 5KSUB 5D7KD 5IWLA 2GI7A 3IETA 3BEVB 3WXWL 1WWWX 1A3RL 4R26H 1QO3A 1N7ML 4PJXB 4D0DB 1RZIB 1AO7D 2P45B 4HLJA 2C1OA 4NN6C 3VXTB 5I1KH 5IBLC 3X14A 3MRRB 1JK8B 4PRPD 5KVDL 5D7JA 1DANU 2I60H 2VLKA 1PYWA 2EICA 3U83A 5FXCH 5E4IA 3CO0S 3MXWL 1QFUH 1CG9A 4AQOA 3W39A 3LH2L 4JFDD 4OIBA 4L8SC 4KY1L 7FABL 5LQBH 1KCUH 2DLFL 5AAWA 4AM0A 4QHKI 4F9LA 4KZDH 1WZKA 4LEOB 3DXAB 4UBDD 3O8XC 3S3JA 1IBGL 1GVIA 2A77H 4PR5B 1E4XL 1NC2A 3IXTB 1FGNL 4MAUL 4KQ4H 2JJVA 1CXFA 3CXHK 5LCVL 4OKVB 4NHUB 5B1DA 2R39A 1ZANL 2R2BB 3JTTA 2I9LA 1YYMH 5DJAA 1JGVL 3SBWA 3JWOH 3SOBH 1BD2B 3WV0A 4WFEE 1ADQA 1G0YR 4XP6H 3UO1H 1LE5B 1XF5B 4ACPA 4UUJB 1ZT1B 4G8EB 1ZLSH 3ESVF 1QFWM 2HJLA 3X13A 2HFGH 5FO8A 3BP6A 4ELKA 4EIGB 4UQ3A 4HK0A 3MUZ1 3LXUX 2HKHH 2KL6A 1SCDA 1JRHH 4G7YL 4H0GA 5BQ7A 1T1WA 4Q9QH 1YNKL 1YC7A 3IJSB 3T8XB 1G9EA 5DQDL 1FVEB 4PJ8B 1Y1KE 3BPLC 5GSRB 5FUOH 1UJ3A 5CSZB 1N0XL 2YMXL 3QP3A 3ARYA 2AJVH 3MV8D 2NNAB 3KPOB 3VJ6B 4MJ6B 5EBLA 5EORH 5EU7C 1RZJL 3UTSA 2GSIA 3IGAA 1JPST 3LKSB 3DI2B 4WY7L 3UTPD 1QHOA 5DMIL 3STZB 1A7PH 2X4SA 1F6LL 2P5WE 2ID4A 2BVTA 3OGCB 4KTDL 4X6CE 3TN0B 1PKQE 2P5EE 3SDXE 4PJDA 5CIPA 3ARDA 5D7LB 4M61B 5F9JB 1EHAA 5EPMA 2W9EH 4LSVH 1A1OA 1CLZL 1V5IB 5ISZB 1KDZA 3G5XA 5CEZE 3CPLB 2A9MH 4Z7UA 4QHLA 1QBMH 1YC8A 5INCA 1E6JL 1ZLUH 1FRGH 3S9DB 1JMXA 4KH2A 1MCEA 2ZNWA 3V8CA 3B9KA 1I1RA 2XWJB 1AFVL 1RZKH 1KT2B 2DI9A 2X4NB 4OFPA 1FNFA 4WUKL 4YX2H 3H3KA 1UA6H 1OLZA 1S7SA 3BHBA 4YO0B 1JPGA 4LLUA 4NM8H 5T1DL 1SIUA 4X9HA 5L88H 1HKLL 3KWWB 4HV8B 1IM9A 2W2MA 2AABH 5C0AB 5GHWH 4KDTC 2JK5A 5DRXA 1FO0H 5D7JD 4JP8A 3E3QE 3C09C 5SX5K 5CLWA 5EIQA 5C0RL 2R2CA 3CX2A 4Y5VA 3RVTD 4MD0A 3ISWA 4OT1H 2EXYC 2OQJA 1F11B 1N8ZB 1RUAL 2X4TB 3QXDA 3VXOA 5EA0L 5C0NC 4YK4C 1C1EH 5I19H 5HPMB 4QRRA 1SHMA 4XMPH 2JCCB 3AUVA 4KRNA 5HI5D 4QTHB 4OCMC 4MA1B 1PY4A 5CGYD 4YPGA 1HHKB 3P73A 1UXWA 4GW5B 3DX9A 5F1SA 2RIKA 4TSBH 1NEUA 3VXUB 2FATL 4P5MB 1D6VL 2X1OA 1WBZB 3VH8G 2ZWLT 4XHJC 1NPUA 3EJZC 4KK9D 1DBMH 2R15A 3KJ4B 4FQIL 3WIFB 4E9LA 1ZK9A 2ICES 5I75C 5LGJB 3CSPA 2JJTC 2X4RB 1ZGLA 1FPTL 4CFYA 4ODSH 1DDHB 2VIRA 4AY0A 5I1JL 3IXAB 3CVIH 4JPKH 5DD1L 5JW4Q 1NJ9A 4Y4FD 3EAKA 4HG4K 1CFQA 2O5ZL 3QRGH 1S78D 3RL1A 2R2EA 3F7PC 4EVNA 4K71C 3QIUC 4HC1H 5CD3B 3DARA 4EN3C 3BQUC 2GUOA 5F1OB 4WV1C 5D70L 3BGOP 4JFYA 2PO6C 3UYRL 3QIWA 2FECL 1E0OB 5GIRB 3FB8B 5AUMA 1AGCB 4HKXA 5DO2D 3AMLA 4J23A 4JY6A 4LDOB 3DX8B 5F3HB 2EECA 3O81A 3L3DA 2AXGB 1EDQA 3K7UA 3Q0HA 3L1KA 3NZHH 5BZDA 4LOUC 4PJBE 4NQUA 1SBTA 5DD6A 2W9LA 1A6VH 2V2TA 3S34L 3WLWC 4LGRB 5IVXF 1OW0C 5HYFA 4JCLA 3MUGB 3BZFB 1AC0A 4A6YB 3KAAA 4Z76B 1UCBH 3UTSD 5JDJA 4UI2A 1Y6KR 4P4KC 3PUCA 2PRKA 3G08A 3SJVE 1A7RL 3N9GL 1DN0A 5I18L 4HF5H 5JW3L 3NN8A 3QFHA 1LP9A 4U1NA 1DE4A 4Z78A 2BMKB 4JO2H 4O2EB 1LDPH 4FQCL 2BY2A 1KUMA 4MB4A 3VFMA 3T2NL 1NCBL 3ARDD 3PWLA 4X4ME 4CN4A 4OCRL 3VXUE 2XTJE 3PL6C 4BQBA 4GG6E 1BZQK 5F9WC 5BS0B 4P2RA 5BO1H 1BE8A 2F53B 4AENA 2C9AA 1T80A 3STLB 1CFBA 4JM2A 3TYFA 4S1QL 3NIDF 1W2KT 1TM1E 5JQHC 3Q5GA 4JFOB 5HHQB 4CN6A 4X7SH 2ZWPA 3AJ9A 4YN3A 1S9YA 4X4YA 1UWXK 1CGVA 2Z30B 2B1HH 3SE3C 3DRQB 1TZGH 3QH3A 5F9OH 2VDRL 4UT7L 4XAKD 3BN9D 3GBMH 3WNPA 2JTDA 2CDFA 4PREB 4LQFH 3ARBA 4QHNB 4UNTA 2ZJSH 5EBWB 1AGBA 2CKBA 2XQBH 4HXBH 3LRSA 1G0XA 3G5VA 1QEWB 3B6SA 4IRJA 4LCIH 1P7QA 4YDJB 3OAUL 3ARGA 1AJ7L 1GPOL 4KRPC 4ZD3L 3D3VA 2BSRA 4XNQB 3RNKA 5IJVA 1JL8A 3TH4T 4Z0BL 1TK2A 3S4SB 2H32H 5D7KE 5KG9A 3BUYB 4RBPH 4ODXA 3D87B 3QXTA 4OCYL 4Q9RH 2JF1A 5I8KH 2E9IA 4QRRD 4CU8A 1AO7E 5IV2B 1NMAL 5M95B 3BZEB 4PRPE 3SE8H 5I1LB 5IMKA 1HCFX 1RSFA 4ZUSA 1I3GH 3WUZA 2IMNA 3S96A 2IH1B 4RQQB 3O6LL 3DROA 2H1PL 5L7XL 4H0HB 5DJ0B 3ELAT 4JFDE 1EO8H 2R2HA 3V6BR 5E6ZA 1KLUB 2GQHA 1CR9L 1CXEA 2XA8L 1NGPH 3NZ8A 5EBMA 5KZCD 3FQXA 1AY1L 4MNGB 1X6LA 2NY0D 3L5WA 4OF0A 3ORJA 2D31A 2KZ1B 5KAQF 2X4OB 3V9FA 1CFVL 3O8XA 4P5TA 3GJEB 2FL5A 1MFNA 5D7SH 2Z92B 5CMAB 3GRWH 1SUDA 4YHKH 3KS0H 1U8HA 3HG1D 3WN5A 1UFUA 4G6MH 1WQVT 3CNKA 4NM4H 5TF0A 2MKLC 4NKDA 2WINA 3T0BA 5C0CA 3BXNA 2EE9A 1JGDB 1MCPH 4W6WB 2BJMH 4PJIA 1HQRB 4D8PA 1TMGE 4TN9A 4PJXF 5IM7A 2BSSA 2CDGA 5DA0B 4G5ZH 1SCNE 2HN7A 3LVEA 5E94B 5KOVC 3N50A 4HUUA 3V5KA 4IOFC 2YWZA 1JFQH 1A64A 1LK3H 4Z7VA 3QEGL 5SICE 3WS3B 5DK2A 2QQLL 3WXWH 1FZKB 1A3RH 3WUWA 3A3PB 5DC0A 1G6RL 2OJZL 4WHTB 1N7MH 2I5YL 1G9NL 3GSVA 1VEPA 4Y88A 1EZVX 3KPRA 4U1IA 3GT3A 3TO2A 4YHYB 4WU7B 4F7MB 1TCMA 1QP1A 3GMNB 3MV8E 2R1YA 1UENA 1K2DB 2LU3A 4DUXA 2XWBA 3MXWH 4LSUL 4HWBL 4RZCB 2NY6B 2Q3ZA 3KXFB 4P2RD 2A73A 3TA3C 3FO9A 4JM2D 3UTPE 4KY1H 1S9WB 5D5MB 7FABH 2G75A 2DLFH 4OF5A 2FR4B 3LMJL 1VFBB 4U1HB 5BW7A 4U0QB 3HLAA 2K3TA 4CVZA 3HE6C 3STBA 3K4AA 1RIHL 2NZ9D 1MFCL 2LQRA 5LXGL 2ZRQA 2FIKB 3LDBC 4P2CG 4FOMA 3ARBD 1E4XH 2BSTA 1FGNH 3QDJA 4MAUH 4I0CC 5EU5A 3RTQB 3FQTA 5E8OA 4P99A 5DVMA 4IRJD 5LCVH 3W11C 4OZGA 5DJCB 4F80A 2W2NP 4F7TB 2P48B 1ZANH 4ELME 5F89A 5CUSL 5T3XD 1JGVH 3FKUS 3HI1A 3D3VD 4Y2OA 4DN4L 4BQ8A 2HJFB 5LAXB 3UBXA 4QF1B 2E7MA 1H5BB 35C8L 1QZ1A 3DRTB 3EDEA 2HTLC 2MPAL 4OD1L 4ZPVA 3ALPA 4FQPA 4NQSB 3A6CL 4LAQL 2HT2C 3GDBA 3ES6A 3OHXA 4L3CA 4NO3B 5IQ9B 1PAMA 4Y19B 5IBLD 1HE7A 1K8DB 4WI9A 2F5BL 2QSTA 3BPSP 4G7YH 3NIFF 1YNKH 1WF5A 3FCTA 4DVRL 4LCYB 2XWTA 3DE2X 3D18B 1XCQB 5LBSL 4J6RL 1N0XH 1GHFL 2YMXH 3SDAC 5DHXB 1UADC 3G6JA 4LCWB 3SQOL 4JZJB 2NW2B 3QZWB 4ERSL 3BWUC 2DMBA 2QL1A 1YY8B 2C4FT 3O8XD 3OKOB 4P5TD 1RZJH 3KDMA 4PJFB 3L3HA 3D0LA 1U8PA 1KCLA 2VOTA 4G80A 4WY7H 5FYKD 4X83A 3VA2C 1KB5B 3FQWB 5DMIH 4AIOA 5B39A 4NP4H 5B3JE 1M7DA 2X4UB 3FB7A 1RIVH 4PLOB 1PZUB 3TIEB 2HLFC 2HVJA 4H20L 5C0CD 2ICWB 4MGXA 5L2JA 4QRSB 4G6FB 1MWAB 2BOBA 2ARJB 4MJ2A 1TVBB 4OUUB 5DYOB 2VLLA 4RNRA 5E56A 1AFVH 3QIUA 1A9EA 2B0SL 2FO4B 5BV7H 2ENSA 4WUKH 4EN3A 1JZ5A 3SE9H 1WC7B 5T1DH 4KVCL 3QUKA 2WWMD 3HC3L 1FVDA 4KMQA 1HKLH 1AQDA 2MMXA 1FNLA 3KPMA 4KV5E 1HINL 3VMOA 4ETYA 4MLSA 2AXJA 3KPRD 5C2BL 3MRMB 1MCWW 1CL7I 4ORGB 2JCCF 1P8JA 4HULB 2XTLA 5C0RH 1INEL 5IKCA 1F4HA 4X4XA 1OW0A 3UTSE 1RUAH 5ID0A 2BC4B 3CFCL 4NKIL 5EA0H 4H25B 4MNHA 3FT4B 1WMEA 3KPQB 3BESR 3DJ9A 4DWHA 3K81A 4P4KA 4EUPH 4LLMB 3RWDA 5DQJB 4BFEA 4MCZA 3QG7L 2Z2YB 1X5ZA 3L1OL 4YJZL 2JB6B 4PJDE 3LPCA 2YUWA 2Q7YB 2OL3A 2YD8A 1QPPA 2FATH 1D6VH 5EZOL 2CGRL 1AHWB 3HCVA 4Z7UE 3QDJD 4A6YL 3MV9B 1CWVA 2RR3A 5C09A 4PP2B 4FQIH 4P57B 5T5FL 3GCXA 2B4CC 4ZS7L 4YNYB 1MY7A 1FPTH 4J8RA 5FKPB 5I1JH 1I8MA 4HKZB 1MI5B 4XAKE 3ZMRA 3TBVA 2O5ZH 3FT2B 3SE3A 3IDMA 5ENWB 3GGWB 1ZHNA 2UZYB 1N6VA 4DKFL 2J4WH 5D70H 3SKOA 1G0DA 5DLML 2V2XA 2XICA 2DJ4A 2YPVL 2YD4A 2UYLB 2Z93B 43C9A 2DL2A 1R6VA 4U4BA 1F3JA 1XH3A 2AEIT 3VFWB 1F5WA 2X70B 4QRRE 5C0ND 4Z6AT 3S34H 3SGKC 1A4JA 3ULUD 3GSQA 4MSWB 2V8BA 4H26A 1SBCA 1TO1E 2E7CA 1SEBA 4J3XA 1J1PL 3U48A 2EYTA 3B9AA 3NFNA 4XCYA 1HN1A 1Y3DE 2AW2A 5I6XB 3IJHB 2ZUTA 1PLGL 1S7XA 3B5TA 2YRPA 1A7RH 3N9GH 5I18H 4DFIA 5JW3H 5DJDB 4XHJD 4FXLA 4KI1A 1T5XB 4FQCH 3S5LG 3T04D 2CRMA 4KFZC 4U1GC 1NCBH 1WTLA 1FVCB 3DIFA 4N8VA 4F37F 3QNYB 2AKRB 2EDXA 1Y18B 4NFBA 5DR5L 5GXBB 3VTAA 1RZGA 4R2GB 2CLRA 1CD8A 1CD9B 3H9SB 4LCCB 4S1QH 4WI5A 3HZYA 4JFXA 1ZHLB 3QIUD 1T7XA 4BKLA 3HG1E 3OJVC 4EN3D 3PWJA 1DL7L 3OZ9L 2GK2A 5IW3A 4HSQA 2HFFB 5L2KA 2PO6D 2VDRH 3QO1B 4UT7H 3LN4A 5HDQL 1F6FB 4ZUVA 3UJJL 2JB5L 1FIGL 4PRIA 1I8IB 1UXSB 2HFEA 5SX4H 3GMMB 4KAQL 3KYNA 4AIXA 2J3SA 1HHJB 4LOUD 1EAPA 1JUFB 1GPOH 3HUJB 1T04A 4OCNC 2IGFL 1TNNA 4ZD3H 3WLWD 5ITBL 1UB5B 4Z0BH 3SKNA 1VEMA 1IAIL 4OCYH 5BVJA 3B2UC 5HVFB 3GMLA 4YDVA 3HI5L 4OCXL 5DURB 1RJYA 1LP9E 4P4KD 1QSZA 3HRZB 5D6CB 5E2VL 3E0GA 3WFZA 2EO9A 1SCBA 3VG0L 4YEEA 3O6LH 4D3CL 2H1PH 4PGCB 2IH3A 2FJHA 5C09D 3W9EB 4YIQB 5CJQL 4WVRA 5LGKA 2N7BA 3QO0A 1CR9H 3B5HA 2XA8H 2WANA 3QRFM 4M7LL 1VFMA 1ZA3A 4AJ0A 4ZS6C 3PGDB 3EOYG 2R0KL 3HI6L 3ZT7A 4YHPB 1OB1B 1CFVH 4JB9L 5EN2A 2PXYC 3HE6A 1P6FA 5DFVD 3O11A 3WNMA 1AKJB 1BH6A 5FUCC 4GBXB 1T21B 2JELH 2OS7A 3C60C 1MCOL 3JSSA 1CICC 1AI1L 2IF7A 2ZNXA 5T3XE 5I71C 3D3VE 1S7WB 4JEGB 4KMLB 1JN6B 2UVFA 5EO1B 4JFFA 1QR1B 4KRPD 2HMIC 4DGIL 3MMEB 1RJZB 3DE0X 5TDNB 5D1XC 2J7LA 3HMXL 1IGFL 1EGJA 1MHEA 5DK0A 5J6HA 4NN5C 5F6HJ 3BWAA 2XQYK 1H8SA 4PJ9B 1J8HB 3W5MA 3VCLA 3PWVA 2B7DT 3IJYB 1X3DA 3QEGH 5K59F 4G9DA 2QQLH 4NO2B 2PTVA 4GAYA 3HKFA 1G6RH 2OJZH 4PGBB 4FTVB 5EUOA 2I5YH 1P7VA 1G9NH 5TDPA 5JZ7D 4PJEB 3VXRA 4LPUA 4F33A 3DUSB 1KCSL 1HXMA 2DQFB 2R4SL 5D5MF 4TVPD 2LTQB 5BOPA 4K7FA 3VH8B 4M43L 5IMMB 5HGAB 3SDAA 4LSUH 4HWBH 1IGTA 3MV7B 4XPHL 3TH3T 4ZO6A 5ACZA 3MRIB 4FZ8L 4XP4L 2ICWJ 5ANMB 4F8QA 4M5YL 5FYKE 5J06A 1WVZA 4RDQG 4Z9KB 2JLLA 1HYSC 4WWKC 4NQDB 1CGUA 3LMJH 4NZJA 5T3ZD 2D4DA 2KQMA 1YEFL 3FHAA 3Q40A 4AQ1B 2CK2A 5J9PB 3LZFL 1RIHH 5C0CE 1V7NH 1MFCH 1O7VA 4LIQE 5LXGH 4LVNA 3JWDC 4PJIE 3TESA 3L3JA 5AEAA 4PRID 2VTFA 1X5FA 2BNQA 1V6CA 3AU1A 5C08A 3PWPB 5KJRL 4OI8A 4Y5XB 3GSOA 1KB5L 1EEQA 4RRPA 5CUSH 2OJEB 4X5XB 3RWGA 2JIXB 4XT1C 4XNYL 3BDXA 2RFXA 5TFSH 2E3VA 3CH8A 1CFTB 4IOFD 4JVPA 3C09B 4PJHA 4G43A 3UTTD 2PN5A 35C8H 3PDOB 1SIOA 4S1SL 4HVLA 2DP4E 1WGOA 2MPAH 2RCSH 3IDUA 4OD1H 3SDDB 3DVRX 1FZJB 4XCFL 3KPRE 1AGFB 4Y16C 1HSAB 3A6CH 4LAQH 1MWAL 4IMLA 5I1DA 1U8MB 4WW2B 4Q74A 1NEZG 2VL4A 4AL8L 3IYLW 5DJ6A 4XC3L 2F5BH 2X4QB 4GFTB 2GT9B 4HWUA 1CGYA 2EH8L 4DVRH 3OWEA 5FYJU 4X6DA 5JXJA 5EU7E 1U95A 1E4WL 4S2SB 3QI9C 4X9IA 5ARBA 5LBSH 1MH5A 4J6RH 1GHFH 3H0TA 1CDUA 3ZO0A 3CLFL 1RUPH 3SQOH 3QEQB 4ERSH 4NRZB 4M6AA 4OCLC 1G7HB 1IGYA 3V95A 3MJ6A 2AEQL 1BFSA 1KG0A 3HE6D 4IHOA 4GJTB 1SY6A 1Q9LA 1MJ7L 4ODWA 1FFQA 3QDJE 1WZLA 4BM7A 4U6YB 1JHTA 3TPUB 4ZTOH 1S9VA 1YN6B 4PRNA 3KPNB 5JORA 1T83C 3MRNA 2NY5H 4J12A 2YC1B 4TUKL 2ATKB 4HDIA 5C92A 2AV1A 3BQUB 4WV1B 1S02A 4H20H 4X6FA 2NY2C 3VFUB 2QQKL 3NA9L 3DVSX 1KPVB 2E6JA 2A74B 1K3IA 4EEEA 1D6EB 3LV3B 5F21B 3A3OA 2G9HA 3TBSB 5IF0A 2HTLD 2B0SH 4X99B 3DYMA 1Y4DE 4HIHA 4L9LB 2HT2D 3RRQA 4FZEL 3RVXC 3WEXB 4CDHA 1VFAA 3EYVA 1HEZB 1NAMA 3FAXA 1OSZB 2X1XR 2JJUA 1S8DA 3HC3H 2ZP0T 2CJUL 4LASL 4CMHC 4ZMAT 4HS6B 1A14L 5I1AA 1HINH 3KYOB 4P2OB 3WBDA 1SBHA 2ED7A 2IXTA 2R8SL 1YNLL 5C2BH 4TRPL 3KHQA 3BVNA 5I2IA 3G6JE 1BPVA 2J88L 5JOEA 1CCZA 5HYIA 2CXGA 3ULUE 4IIQB 1ZLWH 3OG6B 3SDAD 3OKLB 5E8PA 2Q86B 1Z5LA 1DZBA 5IT2L 4NKIH 5J11C 3OKEB 3VRJA 4UV7L 3BD3A 5HGDB 3PL6B 1X5LA 1YYLL 2GJ6B 3VGGA 4NQVA 4KI5C 3NIGF 5CFHA 3QG7H 4U2YA 3SY0B 3P77A 3L1OH 1INDL 4ODTL 5ID1A 1QVOA 2VE6A 2VRAA 2YPKB 4FQJL 3O6FB 4N90D 2D7TL 1IAII 5EZOH 5GRVL 2HLFD 2Y7QA 1EEUA 4HAGA 5IBTH 1W8NA 4A6YH 1DQLL 5HY9B 3O4OC 2BNQD 4XNMB 4JO3L 4GS7B 1S7VA 5C08D 5SV4A 5IEHB 4ZS7H 1V05A 4WJ5A 1GCFA 5ITFA 1Y3BE 1DUZB 1WIUA 4PFEA 3W0WB 2C5DC 4AZ8A 5FGRA 2P42B 3L95B 1Q0XL 3FOLB 4ODUA 4L4TA 4LHUA 1RVFH 5GGRA 3GSUB 4PY8J 3MBEB 2Z56B 5BRZB 3BGMA 5DLMH 1S9KC 3U7AA 2YPVH 5EO0B 1TPXC 3MOBL 1M6OB 3SO5A 5T33H 2QQQA 4P23A 1FN4A 2KZWA 4QXWA 1LW6E 2XZCL 1LEKA 3WFHB 4NKQB 1R24B 5AYUL 4WDIB 5IMOB 15C8L 1NL0H 1J1PH 1DLHB 1FFOA 3GSXB 4I0KA 1XR8A 4ZUUA 4AH2A 1PLGH 1R3JA 1DBJL 3CC5B 5C09E 3BP7A 3MNWB 1TO2E 3IF1A 5IFJA 1P2CB 3P11L 2QHLA 4PTUB 3E2HC 4F2MB 3EOTL 4B41A 1G7LA 1KEGL 3RPIB 3OSKA 2FX7L 5I17A 2IQAA 1OARL 5DR5H 5FKAA 2BY3A 3DWTA 5CEXA 5E8DH 3NFPA 4TUOB 3CDGA 5E1HB 3ZYJA 1F90H 4GXUM 1MRDL 2BXYA 2IPKB 1DQQA 2X4PB 4K2UH 4V2BA 5F7WC 3O0RL 5AZ2L 3O6ML 3CSGA 1ZT7B 1DL7H 3OZ9H 2B8OT 3VFTA 4M02A 3VXPA 2ADFL 5DWUL 5IVNA 5HDQH 4WIQA 5I76B 1H15A 2Y4SA 3HUJF 4I48B 3HE7B 3ULVC 3QJFA 3QUYA 3TFKC 2JB5H 1QLEH 3VXMA 4RFEA 2BERA 2ARJQ 4ONOA 4KAQH 4QOKB 4X6EA 5F6HI 5JMOC 2E6PA 4OZIA 2G5BA 5EZLA 5D1XA 3RBSA 2IGFH 5I9QC 5C07B 3LEXA 3BH9B 4XMLH 5ITBH 4JKLA 1UKSA 2DWDA 3UNXA 1IAIH 5GS1B 3BRFA 4Y5YC 3HI5H 4OCXH 1WV7T 2O5XL 3QPXL 4YEFA 3TA3B 2VXVL 2NX5D 5ACMA 5E2VH 4TVPE 4LLWA 4W81A 4JJHA 1J0KA 3HAEH 3GI9L 4R8WL 4Q2ZB 4D3CH 1I75A 1XGPB 3MLZL 4U3XA 3H6JA 2ICWI 3PXJA 5CJQH 4YXLL 3SDYH 4JM4L 2B5IC 3S7GA 3MRCB 5DJYB 4M7LH 1YMMA 4UILL 4GRLB 5T3ZE 1Q8MA 5DRNA 1VESA 2NLJB 3LQAC 4WWKA 5TF1L 1A5FL 2D9QB 2L7JA 2R0KH 4DAGL 3HI6H 4GLRI 4EQ3A 1INQA 4JB9H 2BRRL 1JBJA 1JWUA 3BW9A 5IB2A 4L4TD 1WLHA 2NQCA 4LHUD 2TECE 4I0PB 1D5MA 4P2QB 4PRIE 4FFVC 4JG1H 1W0VB 4KROC 5CINL 1DEEB 1MCOH 1AI1H 2R9HC 3L3IB 4HIEA 1FZOA 2QTWA 2F58L 3D2UD 1BVLA 2BVYA 1X5IA 1FNGB 2DTSA 4P23D 3UTTE 3MFGB 2J8UB 6FABL 2A6IA 4U1SA 1FZMA 4KK8D 1ADQH 3HMXH 1S9XB 1IGFH 1T0MA 3B2UD 4PJEF 4P3DA 1U41A 3L3GB 1NDMA 4Q9CA 1U92A 4F7EB 4FQXC 4K8RB 3GZKA 1TLKA 5B8CB 1Y6MR 3RKDC 1IZJA 4OLVL 4K3DL 1T7ZA 2J8OA 4BH7A 4GSDL 1VGEL 3UC0L 3GSRB 4N0CC 3UP1A 5TE7L 1YU6A 2R4SH 3QDGA 3QI9A 4YR6B 4Q6IB 3K4DA 3DVQX 2PNDA 1Y3CE 3RGVB 3FB6A 4XPHH 4ZS6D 1GOGA 5L8JB 5C0FA 2HRPL 4FZ8H 4XP4H 5INDA 4FABH 2QSCL 4WI6A 4M5YH 3MRHB 5DSCA 4G9FA 3QG6A 4ZYKA 2PXYD 4JREC 3R06B 4H88L 4ETQA 3ZTNL 2PYFB 2RHEA 4HPOL 1KNOA 4PY7B 3RWCB 4ZDHB 3C5ZB 3D69B 1CICD 3QULA 3K1DA 5FO9B 5CIPH 3REVB 3BT2L 3AXLB 3VXMD 2HMID 1WWAX 5FK9A 3WHE0 1PKOA 4PJGA 5GGVY 4DTGL 5KJRH 3Q2CA 5D1XD 5E6IB 3WIHL 1S7UA 4I3SL 1CFSB 1DP0A 5I15L 4WW2F 2ICEB 4EI6B 4U1JB 5C3LD 2D0GA 1W72B 3MCKB 4HH8A 3LEYH 4RA0C 4S1SH 1F4XL 3Q3GA 4YFDB 4XCFH 1CDYA 4F9PC 4KUCF 3I6LE 2GKOA 1MIML 1ZVSB 4LPVA 1UZ8B 5J1AA 3MJGX 2XNAB 3IFPA 4AL8H 3OKMA 4L29B 4XC3H 4I2XA 3RNQA 4GLRH 3TZVB 2I07A 1N5AB 4QTIL 2EH8H 2EDHA 2P44B 3WFBL 1EFXD 1JPFB 1U2CA 1DBBH 5B39G 4J4PA 4I4WA 2BDNL 1TZHA 5EU6B 1A9BA 2ZUUA 3CLFH 1HNFA 1HYSD 4WWKD 2Y25A 4N90E 2AEQH 4NT6B 4OV5B 5IMLB 4P46C 5ESQB 4XP5L 3EYQC 1MJ7H 3DTXB 4QRQA 4RYDA 1CN4A 1ORSB 2RBLA 4LLDB 5DQ9A 5JXGA 2DWEA 2DRUA 2BNQE 1LWRA 4QXUL 1LD9A 5D2NA 5C08E 2C7UA 4JANA 4ZSOB 2C3HA 3BX1A 1T22B 5KSAC 3ZE1F 3U36A 2ZG1A 3N1FC 4JPIB 1WITA 2E6QA 3MOQA 3NA9H 4KB5A 4YZFE 5EZJA 1X4YA 1UVQA 5IW1B 1R3HB 4PJ5A 1BQSA 1IARB 2PW2A 5I73B 5I8EA 4NN7C 3JV6A 4PY8I 2CDEA 4XH2B 1NAKL 2DIBA 4YHML 1BZ9B 4C3UA 4HZAA 4R7DB 5D93B 2BSED 4JN1L 4ZQKB 5JXEC 4Y16D 4FZEH 1NBYA 3OKKA 1YJAA 4HEME 3MRJB 2CJUH 4LASH 3HR5A 1A14H 1BIIA 2EO1A 5FO7A 4Z5RB 4X6DE 5KSBA 4YFLI 4PB0L 2R8SH 1YNLH 1FAIL 4JJ5B 4TRPH 4M9OA 3QDGD 2J88H 4LKCA 3QI9D 4E5XB 5IHLB 3QQ3B 4G8GD 3LKQB 1C5BH 4NQEA 3TBYA 5IT2H 2UUDK 5EO9A 4G9FD 3H42B 1YYLH 3O45B 4MJID 2ESVA 5DMKA 1E28B 3WLBB 4HIJB 3IDJB 2R0ZH 2WUBH 4ODTH 1INDH 1WFOA 2VH5H 4L3EB 1KJ2A 2AJUL 2DS4A 4DEPC 1IAIM 1VGKB 2OX5A 4FQJH 1PEKE 5C6TL 2D7TH 4KG7A 2NY1B 4ZUWA 4ZG1A 1TM5E 2NY4B 2NY2D 1A6TA 2PYEB 4NQXB 5C86A 1V3LA 1MELA 1BM3L 4JO3H 3HB3D 3QR2A 3LKOB 3O2VL 2P7TA 3TCLA 5FF6A 1TVHB 1HHIB 2CR3A 3GSWB 4QHUB 3VE0B 3V6OA 4XPGL 1KJMB 1SYSB 4S1DC 1FORL 4PYHA 1BIHA 1Q0XH 3X14B 4XAWL 3G5YA 3TBWA 1KELL 2VLKB 1P7WA 2VDML 1HXYB 3GHEL 1N0LA 2LU7A 2OZ4A 1MIEL 1ZS8B 2X89A 4C3VA 4IRSC 3W39B 1FFNA 2CKBH 5DRZA 3TV3L 1HZHH 4XGZB 3VA6A 1KE2A 1ES0B 1I1FA 2YN5A 3MLSH 5DMGD 1T1GA 1BQHA 2C3VB 5JMOA 4WI3A 5T3XH 1ZE3C 4ESKA 4YPJA 4J4PD 3EGSA 1WMFA 3EO0A 1KBGL 2FNBA 3BJLA 3L7EA 3GSNA 1HOCA 2XZCH 4OLWH 2NX5E 4CGTA 3VXNB 4Y5YA 4N8VG 1NC2B 5AYUH 15C8H 2Y06L 3DUUB 5HDBE 3D25A 4TQEL 4MDJB 4KI5D 4WEUD 2BZDA 4PRBA 5E99L 3GO1L 2I9LB 1DBJH 5CP3A 1GGYA 2DMCA 4IDJH 2FX8H 1JYWA 4UTAL 3UZEA 1ZT4A 4GKZA 4OZHA 5A16B 4CKVX 3SGEI 4N0FB 2ITCB 5IIEB 1NGZB 4NNYB 3U46A 1KEGH 2W60B 3C60B 1UH2A 2Q6WB 5D9SB 5JO5A 3RL2B 1SMAA 1OARH 1M71A 2FWOA 2JJWA 4HK0B 3L3OB 4L4TE 4PJ5D 4U3HA 4OD2B 4QHMB 3F7VA 1MRDH 2EZ0C 5HHPA 2DBLL 2CIKA 3O0RH 1T0NA 5H94B 1BECA 2AV7B 2ADFH 5DWUH 1P4BL 2DM3A 4FQLL 5I1EH 4FN0A 4F7CB 2FZ3B 4OV6B 2IBBA 3ARTA 3MA7B 2OXGA 2EDNA 1RD6A 1NCDL 3MRPA 5MI0B 3UTZB 1F4AA 3IKKA 3GMPA 1NEZB 1DBKL 5EBLB 1CBVL 1MJUL 4EXPX 5ALBL 2OR8A 3IGAB 4NWTL 4RAHA 1L9MA 3DHMA 4TTDC 3F5WB 3LN5B 2FJFB 2X4SB 3N1PC 4NQED 2AJZA 2ID8A 3IFNL 2KUTA 1X6NA 4XX1E 1W0WA 4M1CC 1QBLH 4FQXA 4J3TA 3T08A 1SYVA 1VENA 5JW5B 1M4KA 1A2QA 4JHBA 1XGUA 2O5XH 2VR9A 2ESVD 3C6SA 2VXVH 4GAGL 2W38A 4R3SA 3L7FA 3OKDB 4UAOB 2DQUL 3AREB 3BIKA 1ZVYA 3ZE2F 2ATPA 2D7PA 5DT1L 2Z58A 3DVGA 3LD8B 3GI9H 3ZKMC 4KDWA 3B9KB 1QACA 3QDHA 3MLZH 3U4EA 5B38B 4S10A 4NBXB 3WJLC 2R0WL 4NQCB 1N2RB 4YXLH 4YHZH 2PW1B 4LP4A 5E5MB 4JM4H 5J89A 3UPAA 3DGCR 4GG8A 3MXVL 2GAZA 5SWSB 1MPTA 4UILH 1QPXA 5EIIB 1YN7A 1IM9B 5TF1H 1B6UA 4QKXB 4HIIB 5GRUL 1DQJA 4FFYL 2BRRH 4YHOL 1S7RA 4EKXA 2ZSVA 4LGPB 3CO0P 4MQXD 2FLRT 2VITB 1UJTA 2VKXA 2OBGA 1BBJA 4OLYL 3T77A 3VXME 3ULVD 3QIBB 3ZT6A 2J8UF 5CINH 3U9PL 2CUIA 3TFKD 4NZTH 2CRZA 2G2RB 4XC1L 1TQBC 1P9MC 3FQNB 1EMTL 3ABZA 2XOTA 3PV6B 2COQA 2Y5TA 3PQYB 5D1ZC 2YUVA 3O2DA 3B9EA 3EYUL 4WUUB 1CSEE 3OX8B 6FABH 1J1OL 1KPRA 3QXVA 4X6BA 4OIIL 3A3NB 1UC6A 3EZ8A 2X6MA 3LEVL 4XWGL 3LKPA 4GW1A 3EOBB 1GTL1 3CVHA 4GW4A 1OWWA 1KJ3L 1XFPA 3DVNA 2DQGH 2XKUA 4GSDH 1A0QL 1QFOA 1T89A 4M7KL 1XMWA 3UC0H 1C08A 4QWWC 1JPTL 1W72L 2R23A 5TE7H 4UT9H 3K8LA 1AD9B 3MRLA 1G7MB 4XP1H 4OZ4B 3UXFA 5KANG 4JDZB 3TI7A 1UWGL 3TP4A 4JFYB 4NMXA 2HRPH 1XF1A 2QSCH 3QIWB 5JQ6H 1MCBA 5IVZB 4LU5L 4NDMA 1FO0A 1MOEA 4JY6B 1F6AB 4P46A 3U0PB 5AD0A 4H88H 4V1DA 3QHZL 4DGVL 1AXIB 4RRPG 5I16B 4HJGA 2X8JB 3L3DB 4FFVD 4HPOH 3VGAB 4KROD 5GPRA 1VFUA 8FABB 4OB5H 3GIVA 3VV2B 1T66C 5KSAA 2R9HD 4J3WA 3TNMA 2V2TB 1A7OL 3QFDB 2YUXA 3BT2H 4KK5C 4LNVA 4U1MA 5MEQA 5CSGA 1RZJC 2IFGA 3QAZB 1IAKB 3HZMA 4RMRA 4DTGH 1ZV5A 2IALA 3QFJB 3WIHH 1K3ZA 4I3SH 1HWGB 5FGCE 3ZKQD 4BQ6A 5I15H 4O51A 1ODAA 3MTRA 1MLCB 4FQXD 4HQQL 1BQUA 5FM5M 1Q94B 2KH2B 3RKDD 4HHAA 1NCWL 1CXKA 5ACLA 1VKXB 3AS0A 2OTWA 2WBJB 1I1YA 2DYPA 3QDGE 3VFOA 4JLRA 4GXVL 1MIMH 5FIEA 1XGRB 4N0CD 3MO1A 1JGLL 2Y72A 1HNGA 4G8GE 4DCQA 1D5IL 4NO5B 4HC1A 3MNVA 4U6VL 4NGHL 1HHHB 1MY5A 1XF4B 2XKNA 4DZBA 4OLXL 1MVFA 4QTIH 5F6IB 3VFVA 1H3VA 1J1XL 5DDHA 3WFBH 4G9FE 4HMCA 4MQSB 4P48A 3MCLL 3QH3B 3F6LA 4MJIE 2BDNH 3MR9B 4PV9A 4O00A 3V0VB 1K4DB 1RHFA 4DVBA 5EOCJ 4PB9L 1YEEL 1G1CA 1RURL 1ZVHA 1P7QB 3WSQL 4XP5H 1KIPA 1KV3A 4S0TD 4MAYC 1Q72H 3ARGB 3MACL 4Z2AA 3TCXA 1JIBA 1Q9KA 2ED8A 4MWFB 1KYOK 3ECBB 2BSRB 4I18C 3U79A 2HT3D 4PJGE 3PNWB 4QXUH 1YPZA 5GGSB 3JBG7 1ST3A 3FFDB 5TE4L 3RP1A 5ESAB 4WU5B 1RK0A 4NC1C 5F7UA 5BJTA 4FQ2L 3VG9B 3QQNA 3V4PH 3PABA 1F58L 5D2LB 1Z3GH 5FA3B 3SKMA 1I1CA 3EYFA 4HUXB 4DZ8B 3S96B 2P4EA 4GRWE 1NAKH 4QY8A 2YXFA 2ARWA 4YHMH 2CLZA 5HYQA 2VC2L 1I7UA 3GKZA 4JN1H 5IG7A 1WWCA 2R2HB 4OBSA 5EG6C 3ZDXE 4I2XE 1FP5A 3P4OB 4IRSA 2HTKC 3D1MC 3WNNA 2BNRB 3BE1L 4HUWA 4KKAD 4KJQC 3QA3A 1WSDA 5KBNC 4PB0H 3WHXB 1FAIH 3NCEB 3BO8B 4KJPC 1MUJA 3DSNA 2V7HA 3JZ7A 2DJSA 4NO0B 4U6XA 3O3EB 4E41A 2X42A 4HFUL 4KI5E 1GZQA 4XPFL 2FBJH 1U8HB 3O3UN 4F15B 2J6EL 3WN5B 4P46D 3EO1A 2ADIA 3EYQD 3P4NB 4HKBB 4M6NL 2AEPL 5D2NE 3RKPA 3CX5J 4JRWA 1U8OB 4CNIB 4GXUN 4IRZL 5EU4A 1VADA 3G9AB 2H32A 1IE5A 3VFSB 2AJXL 5IESL 4GUPB 1MJJB 5KSAD 5C6TH 2BSSB 3V6FA 1OGTB 1Z2KA 4PJ5E 5H2BA 3AC0A 1JTTA 2X2YA 1FSKC 4JO1L 5JHLL 3MGOB 1YEJL 2O61B 1KIQB 4DKAA 1QRND 3LB6C 3O2VH 4MJ5A 1YEIL 3M1BB 4WHYG 1DJSA 4KJYB 3H3PL 1CK0L 3LKRB 5ABDE 1AGEB 4XPGH 4Z7NE 5JXED 1NGXA 5AMXA 2NXYD 4XAWH 3NACL 4YQXL 5KSBE 1J0ZA 1F97A 3WHE1 3KPTA 3RWJA 2VDMH 3GHEH 5SWZA 2DYPD 4RMTA 3RJQB 1CE6B 3CFDB 5EIVA 3FO9B 4CJ1A 1EGQA 4Z7WA 4I9WD 4NQEE 3GRWA 5IW6A 1WCBA 1VPOL 5IB3A 5F44A 3MGTA 4ALAL 1LO5B 2ESVE 1KBGH 3TBTA 3HMWL 3BPCA 4MHHG 2PCPB 2YEZA 3FN0L 1FL5B 4Y1AA 1R5WB 1FL6B 2Y06H 4BSVA 4TQEH 5EU5B 3FQTB 3TO4A 1YMHA 3H9ZA 3DYOA 3KLSA 4OZGB 2EYRA 5E99H 3RZCB 4MX7A 1NCCL 4H5SA 1M1SA 4HZLB 4BZ2L 3U2SA 4UTAH 3DETC 1U6AL 2CK0L 3WJLA 3X12B 1C12B 4RA3A 4XPBL 4TOYH 3CSYA 4BH8B 3HZKB 4PLJC 3V6OE 4Y8AA 4K3HA 1ZVJA 4YGVB 2VLRB 1IGJA 1T20A 2GCYA 1ETZB 5F1IB 2PYZA 4S1DD 4OV6F 1WWBX 4L3AA 3ULVE 2VNCA 1E27A 2FGZA 3RA7L 1G7JB 3FMGL 2WUCL 2MOVA 1U93B 4JQIL 3FCTB 1K4CA 2XWTB 1U91B 3JWDL 3WIVA 4IRSD 1P4BH 5E03A 4C83B 4FQLH 2DQCH 2EYSB 3TYGH 12E8L 1BFVL 3VFPA 1P9MA 2FB4L 2WQ8A 3D0VA 5I1GL 1U9KA 5EZIL 5I66A 4KGLA 2Z4QB 1NCDH 2DTML 4HFWB 1YQVL 5HVWA 1PSKL 3O3DA 1DBKH 4EBQH 4N1EA 5D1ZA 1CBVH 3EDFA 4WTWA 1MJUH 3C5JA 4P59L 3IDNA 3L3HB 1TJGL 2BVUA 4Y4HB 4LSSL 4E41D 3HC4H 3QDMA 1YJBA 4CADA 1JF1B 3I75A 3IFNH 2D7NA 5E5UB 4X0KB 3RX8A 4NNXB 1SJEB 4UU9A 5E9DA 4NZRH 3AMKA 3Q5YA 4OZHE 4ZOEA 5FA4A 1CQYA 3FN3A 2G4VA 1EO7A 4GAGH 3ZKXB 1A22B 5B3NA 4J3OC 4X7TB 5IGXH 2BOBB 2DQUH 5DT1H 2C3GA 3I02A 4B5EA 1F3DJ 3UAJC 5I1CL 3TT3L 2R0WH 1MCKA 3EHBC 1KLGA 3QCUL 3MXVH 1AQDB 3T65A 1P4LB 2NR6C 3KPMB 3MUJA 2EDLA 5BZWA 3T4AA 1D5ZA 2H45A 2FHCA 1Y48E 1IQDA 2AJ3A 4U1LA 2F8VA 5GRUH 4FFYH 1JGEB 4YHOH 2VB5A 2WQRA 3DHJA 4JY4B 3VWJB 2D3VA 5F7EL 4U0RB 1IAVA 1BZ7B 4OLYH 5SWZD 4NRXA 5E2TL 5LWYH 3MV11 1MQKL 4MVBC 4XC1H 1EERB 2VLJB 3SQBA 5GS0C 4KGJA 1EMTH 5HYJB 5FYKU 4PJ8C 4TTDD 2IANA 4TSCL 5C7XL 2FSEB 3MLWH 4MMZC 1ZWIA 4UDUA 4YHIA 3EYUH 2SECE 3BDYL 1J1OH 5ERWA 5E5RB 3FRUA 2P49B 3EW3B 4HIXL 5A1AA 4MCYB 4OIIH 4Y1AD 3WXVL 2Z31B 3LEVH 4XWGH 2DQKA 3X3GL 3QEUA 5HBBA 4M62L 5IK3B 4IS6B 3GMOB 3WDJA 3ZTJG 2BOCA 1KJ3H 3G5ZB 1A6AB 5H37H 1A0QH 3ZKMD 2EC9T 4MZ3A 5SWQA 3TN0C 4M7KH 5DVOA 3PIQA 3MNZA 1HDMA 3IDMB 2ITDA 1JYNA 1XGTA 1QTYT 4BK5A 1C16A 3SKJL 1UWGH 4G42A 2C1PB 3N1MC 3P9MA 2ILLA 4K3EL 2AK4A 1KIRB 2V2XB 3VRLF 4LU5H 1KCRL 3PGFL 5F7YC 1SY6H 2X10A 3QHZH 4DGVH 1MAML 3KNBA 3BPNB 4NUGH 5E4EB 1BLNA 3MJ8A 4YHLL 4R4BB 1GNVA 4I18A 2CIIA 3OXSB 2ZPKL 3Q48A 1A2YA 1A7OH 1YUHA 2NTSP 4EUPA 4X8JA 2B39A 4H26B 2B4CH 2YSSA 5D1ZD 1QLFA 3T3PE 2UVEA 1XF2B 4XCYB 3VI3F 1HHGB 1S7XB 3QDMD 4JN2A 1YDPB 3DPBA 4QXTB 2EDFA 2PTUA 5FUZL 1AH1A 2IBZY 1FNEA 2XQYG 4XPAL 2XN9A 3L6FB 5E9DD 2R1WB 4LRIC 4R7NB 2YZ8A 1NCWH 3GT4A 3GJFK 1J86A 1N4XL 4UT6L 3MRQB 5IVXA 2SICE 1SJVA 4JFZH 3U82B 3SKUD 4GXVH 3IU3B 5JXHA 3VFNB 4PJCB 4QWWD 1JGLH 5IBUG 4U6HA 3NTCL 1D5IH 4S11A 3QCTL 4U6VH 4NGHH 3HZYB 4JFXB 1CDHA 3ARQA 3KJ4C 1L6ZA 1NGWB 1J1XH 3OAYK 2WUWE 5L2KB 3LPAA 4FONA 3LN4B 2V2WA 1MFEL 2VWEC 3C8HA 1CXHA 4WCYL 4GKOA 3CZFB 1ZSDB 4PB9H 1YEEH 2PMWB 1RURH 3W9DB 4OM1H 3IDIA 3QXAA 5IROC 3WSQH 1X5JA 4KTYA 5GS3A 3MACH 2XRMA 1T66D 2E5EA 5GGTL 1DQDH 5C8JB 5D2LF 1U58A 4B7IA 5C9JB 1C8PA 3SKNB 3OJDB 4KK5D 3RVUC 1QRNE 5TE4H 1ZA6B 3A6OA 5K9KA 1RJYB 4FQ2H 1HQ4A 1V7ML 3R8BB 1F58H 2QKIA 3L5XL 4M6ML 3FOMB 3CU7A 2GSGB 2NXZB 4LQ1A 4LPCA 4CW1A 1FFPA 5F96L 4HD9A 5MEPA 3ROOB 1X5HA 2NYYC 2VC2H 3VXQA 1WTGT 4B5LA 1C3LA 4H6WA 2H2SC 3ULVL 4I9WE 3P30L 4HW6A 4HKJA 1FYTA 3BE1H 1XF3B 3CCHB 4NE9A 2VISA 1Q0YL 4AIZB 1TVDA 1R0RE 3ZZ1A 3CH1A 4R97B 5T1KA 5EN2B 1B2WL 1IAOA 3MLTA 3REWA 1HIML 5JOPD 3D43A 4XPFH 4PBWD 3CK0L 4DK3A 4YBQC 3U7YL 2AK4D 2CO7B 5F7MC 3MRGB 2ZCHL 5CZKA 3OKNA 4M6NH 4L4VA 5FYLL 4MAYD 1UZ6F 4JFFB 1KF9B 1N59B 4XVUC 5FM8A 2XKSA 4IRZH 3VGFA 3OF6A 2H2PC 1CU4H 43CAB 2W2NA 3TVMB 5B1EA 5KN5A 5IESH 4MDIA 1JNHB 1IC4L 2VXQL 4O2FA 2PTTB 4FFWC 1I3VA 2EDYA 4JO1H 5JHLH 5L6YL 5FEBA 1YEJH 1G7QA 1CXLA 3LQAL 4JFHD 2ADJB 4V2CB 4YAQA 5EUOB 3H3PH 1CK0H 1PFCA 4JRYB 4I5BB 4Q7DA 4AT6A 3VXRB 1D9KA 5CHNA 2EDJA 2GFBB 4PD4K 5BMFL 5KSUA 2XN9D 1I7TB 3NACH 4YQXH 3BEVA 2HTKD 3EJYC 4PJXA 3M45A 4D0DA 3BPSA 1RZIA 4KJQD 3IKCB 2DB8A 1JHLH 5ACZB 3MRRA 5E24E 4OZFG 4E41E 1UWEL 4KJPD 5MENB 3TEUA 1OPGH 5JOFB 4EI5C 1VPOH 1QRKA 4OZGF 4IMKC 4ALAH 1QG3A 1PVHA 3HMWH 5C0GB 4NFDA 5I0ZA 1QA9B 4ENEC 3CXHJ 3K1KC 3NABH 4LEOA 5ILTL 2QHRL 3DXAA 4X6CA 3WE6B 3CMGA 3ARRA 3FHQA 3RY5A 2PUQT 4PR5A 3JVGC 3MODL 5EC1B 5KTEL 1NCCH 3IXTA 4K9EL 4BZ2H 1U36A 3ZSTA 1U6AH 4PRHD 2RFXB 4OUOA 4OKVA 5EWIH 4NHUA 4XPBH 4PJHB 2R2BA 4Z95L 3RIFK 4P2YA 3LB6D 2BVPB 1BD2A 5JR1L 1B4RA 3X11B 1LE5A 1FH5L 3NH7H 2H9GB 2VDQL 4UUJA 1ZT1A 4G8EA 1EHLL 1JZ4A 5I9SA 4TVSa 5SWZE 3RA7H 3FMGH 4PLKC 3EOAA 4P49A 3ETBF 1R3IL 2VXUL 4HWBA 1WZ1L 4JQIH 2VR4A 3FONA 1WT5C 1X4XA 3JWDH 5DZOA 1ND0B 4TNWK 1FYTD 12E8H 1BFVH 2FB4H 5I1GH 4U7SA 3T8XA 1BFKA 1FVEA 1J0JA 1YJDL 1YQVH 2DTMH 3O6KH 4PJ8A 5D1QB 4RAUB 3RDTB 4JQXA 5T1KD 5CSZA 4P59H 4P5KB 2V6HA 1TJGH 2P8LB 2NY3B 4ODWB 4I77L 4Y1AE 2NY6C 1TTGA 4LSSH 3OB0K 4C58B 1JHTB 5FCSH 2NNAA 2HYMA 3KPOA 1QKZL 3VJ6A 4MJ6A 4F58L 1Y0LB 1Z9LA 1UM5L 4LGSB 1SJHB 3S36L 3LKSA 2AV1B 1FJ1A 2EDEA 1UYWL 3CVHL 4L4VD 3STZA 1L9NA 2BVOB 1TJIL 1S2NA 3OGCA 3IT8D 1JEAA 4KHXL 3TN0A 3DETD 1KACB 1A4KB 5GRZA 2X7LA 3OF6D 3PHSA 4N8CL 1N5YH 5D7LA 3RX7A 4M61A 4GRMB 4WGWB 3AJ8A 3A3OB 4PLJD 1NMCB 3WJJC 3MSPA 3DBXB 4Z7OE 3EFDH 3C8KB 5I1CH 1V5IA 5ISZA 3TT3H 3E6HB 3CPLA 1OP9A 1K6QL 1OTUC 4D94A 3OR6B 4PV8B 1U0QA 3F7QA 1F4WL 3QSKB 2HG5B 1E4KC 2XWJA 3WKNA 5EFIB 2EDRA 2X4NA 1MFDH 1RY7B 5F93C 3QUZB 5TQ2L 2GY7B 1FIEA 1ZHKB 1D9KD 4YO0A 2DQTH 1IL1A 5JPMB 3QBTB 2OR9L 3KWWA 4HV8A 5F7EH 3RGHA 1JP5A 3SQOA 1IEBB 2H26B 5C0AA 5E2TH 1MQKH 3K4ZA 4WI8A 3QDME 3G04B 1IKFL 4TULL 5A40E 4TSCH 5C7XH 1F11A 1N8ZA 2X4TA 3QJHA 3MBXL 1VB9A 5E9DE 2VE6B 3BDYH 5DGRA 5HPMA 3EYOB 2V9QA 4JZJC 3U1SL 2JCCA 1T2XA 1QFWH 4QTHA 3DXAD 5DS8B 3WXVH 2IEPA 3X3GH 1FL3A 4G8IB 1HHKA 4HX1B 4M62H 4WHDA 4X4MA 4GW5A 4HBQA 1S7VB 4R4FH 3IRZA 3VXUA 4P5MA 1DR9A 1WBZA 1MVUB 4E0RA 3S97C 1NKRA 4NFCA 4MNQB 4HG4J 3WIFA 2DIJA 3EHBD 4KTEL 5LGJA 1CIUA 2Z8WC 4OTXL 2BHUA 1MCFA 2X4RA 2E1PA 3O2WL 3VW3L 4ODUB 5K9JL 4XNZB 1DDHA 3K80A 2SEBB 4HUMB 3IXAA 1BD2D 2DD8L 2NR6D 4F3FB 4GT7A 4K3EH 5DVLA 4Y2DA 1RJLB 1KCRH 3T0EB 4UDTB 5B4MC 3T2PA 5IROA 2I9TB 1MAMH 3ZDZF 5GIRA 3FB8A 1AGCA 4DZTA 3PF2A 4MVBD 2ZPKH 4OJFL 4YXHH 3T41A 1GYAA 4M8QA 3DX8A 2OM5A 5F3HA 5GS0D 3MLPA 1NBQA 4PJ8D 2OMBA 5K9QG 1DVFB 4NKOB 1ZTXL 1SM3L 4AH2B 1H3XA 3I2CL 4PTTA 2Z35B 4OSUL 3MUGA 4A6YA 4Z76A 4PJCF 4WFFD 1NFDB 1SUBA 5FUZH 5D72H 5GISL 5DEGB 4LRNL 4XPAH 3BAEH 1H8OA 4YBLB 5EDXA 1N4XH 4UT6H 5MHSD 1KCVL 3TN0D 4CN1A 2BMKA 4O2EA 1KN2H 5CEXB 4EDWH 5D7LD 5DD0L 3CDGB 1OM3L 1AHWC 3NTCH 3GCXP 4AKTA 5JOPE 2F19L 4WENB 5E2UL 5ISZD 1T5WB 5IQ7L 4RIRB 2AK4E 5BS0A 1MCRA 1BJ8A 2Q8AL 2F53A 1X5YA 3STLA 1MAJA 1NFIA 1SUAA 2GTWB 2A83B 4PG9B 1H15B 1MFEH 32C2B 2WIIB 2Y36L 4JFOA 5DJ8B 4RFOH 5ICZB 3KYMB 1FSKB 3BEWA 2G5RA 3QJFB 1R3KB 3QUYB 2Z30A 3DRQA 4AG4H 4UIMB 3MYZA 4NSKA 5E70A 5D4QA 3ZHDA 5KVGL 4PREA 4NC1E 4AMKL 4QHNA 4OF8A 4OZIB 1TIUA 5GGTH 5EBWA 5EZLB 5KVFL 5C0AD 3LEXB 3O9WB 4HS8L 1CT8B 3O41B 4JFHE 4YDJA 1S01A 4N5UA 1DSFL 1ZOXA 3QQ9C 4ZO8A 4XNQA 2E7HA 1AR1C 3S4SA 2XN9E 3BUYA 1Q9OB 3DVFA 5JW4R 4CUCA 1GAFL 5IVXE 5CJOL 5F96H 5IV2A 3V7AE 5HXMA 4MA7L 2FCBA 3BZEA 3CFEB 4L9DA 5I1LA 2YA1A 5C0JB 5I6XC 3ULVH 2OZ4H 3P30H 4IJ3B 3VXUD 1FNHA 4RQQA 1YMMB 2MTPA 3R8QA 2Z8VC 5F7HA 2MFNA 3LSOB 5DJ0A 1Q0YH 2BHZA 1OAUL 1KLUA 1RMFL 1S7TB 1INQB 4IMKA 4X9FA 1SN7A 2YD1A 1HIMH 1D5MB 4MNGA 2HVKB 4JKMA 1BFTA 3DW3X 2X4OA 3CK0H 4JRXD 4KKBC 4KJWC 4LCCC 2Z57A 3NIDE 3GJEA 3B4NA 2MCPL 2XT1B 4FMKA 2ZCHH 4HIEB 4S0SD 5CMAA 5LG1A 3JV4B 5FYLH 4LMQI 4PRHE 3TJEL 3JVGA 2I26N 3FN9A 1CFNB 1G7PB 4RGMC 1TZIB 4ELMA 1G7IB 3U7WL 1NFKA 3RVUD 3E1F1 1FZMB 1HCVA 3T2QA 1UB6B 5EUOF 3DMMC 3MLRH 4L8BB 1IC4H 1JGDA 2VXQH 3RVWC 4APQB 1GZPA 4C56B 4YFEA 4LVHB 1M05B 1HQRA 1I7RA 5L6YH 3QWOB 4LVOB 3MUY1 3FT3B 3LQAH 4NBZB 1T3FA 3HAEA 4JDVB 1NDUA 3I6GB 2LAGB 5D96B 5E94A 3PP3K 2NYYD 3DI3B 1FYTE 2CR6A 1CDBA 1WT5A 4WTXA 1FZKA 4WHTA 3NCYS 1A7BA 1J0IA 4D0CB 4GAFB 5F7LB 4HJ0C 4WU7A 4F7MA 3OJMB 1GA6A 4ZOCA 3LRGA 1UWEH 3GMNA 4U1KB 4KXZH 1WK0A 4XNXL 1K2DA 4Q97A 1UEYA 4HS3B 4ETQB 4RZCA 4C55A 5BS0D 5FECA 2F53D 4KRMB 3QMPA 3T3MF 2WBKA 2BXZA 2ZCKL 4Z7OF 3NPZB 2YPLB 4YBQD 5MP6L 1S9WA 4L4VE 5D5MA 2FR4A 1VFBA 2ST1A 4U1HA 5ILTH 5FOBB 3OL2A 2QHRH 3W2DL 4OQ1A 2CRIA 4PJHF 4XVUD 3L9RB 4O02L 5FK9B 1N26A 2FIKA 2H2PD 3BKYL 2EEDA 4Y4FA 1N3NB 3TM6A 3MODH 3HMXA 2WV3A 4GBXC 4X7CC 5KTEH 1GOFA 3WJJA 3DV4B 1YA5A 1OAQL 3RTQA 1AF4A 3VXSB 4FFWD 3FFCB 4PGJA 2M1KA 5DJCA 5CILL 4TNVK 4F7TA 2AXFA 4Z95H 1FFRA 4CU6A 2N4IA 1U8QB 1OTTC 4ODHL 2KBGA 2HJFA 5LAXA 1YQ2A 25C8L 1FH5H 1H5BA 5CJBA 3DW1X 1EHLH 3DRTA 4PJXE 1IC5L 4HH9B 2X09A 3F62A 3V0AC 4PJ9C 4NQSA 2Z91B 4XMKL 4YC2B 3MRFB 3EJYD 1R3IH 2VXUH 4LLVB 1WZ1H 5B22A 3SCMB 2X44D 5CP7B 3GMQA 4DKEL 4NO3A 5IQ9A 4LSDA 4Y19A 4PGEB 2IBZX 1K8DA 1A9BB 1MFBH 5AG8A 3DO7B 5HSFA 4LCYA 4ZAKB 1YJDH 1A1MB 2LTQC 4DQOL 4EI5D 1TQCB 5IBUB 4HK3J 3WCYA 3D18A 5DC9B 1XCQA 1A6UL 3O2DH 3DXAE 4I77H 3DX6B 2W1NA 4LCWA 4N0YL 1KB9K 2DWEB 2NW2A 3QZWA 4JZJA 3KLAA 1Y4AE 1ONQA 4ENED 1QKZH 4QXGH 3NGBB 4ISVB 2GITA 4JANB 3B8SA 1UM5H 1A7NL 2Q7NA 3S36H 2A6KB 1UYWH 3CVHH 1KB5A 3FQWA 4A2LA 4ZUTB 1TJIH 2X4UA 3LY6A 5ICYA 4KHXH 1IT9L 1LO3H 4N8CH 2PW2B 1B4JL 5I8EB 4NKMB 1TJHL 3TIEA 1BD2E 1AE6L 4H1LB 2ICWA 3UTQB 4MYWB 5T1LB 1QOKA 1K6QH 1MWAA 1SBSL 3K8MA 2ARJA 4FXGB 4Y5XC 4DKDC 1TVBA 4OUUA 1F4WH 2BFVL 5DYOA 4NJAL 1GSMA 5TQ2H 5FAAA 4PLKD 1EJOL 1WC7A 3ZHKA 1HH9B 3I3BA 1R5IB 4HGWB 5HYSA 4JFPB 1DQML 3SDDC 4QRPB 4LKCB 2OR9H 2QJDA 5J7CC 4UIKL 1ACYL 4X7EC 1CVSC 2L7UA 4WW2C 1PBYA 3WNKA 1OGAB 3MRMA 4O2CB 3BKCL 1FGVL 5F8RC 4ORGA 2MNUA 1S5IL 3QT2A 1IKFH 4G7VL 3NIFE 4TULH 3K2MC 2NY6D 4WFFE 4HBCL 5DVKA 3KXFD 3MBXH 2P43B 1CTOA 5FM5O 1C5DB 3FT4A 3KPQA 3U1SH 3CNQS 5DHVB 5MHSE 2CUMA 4LLMA 5DQJA 2H8PB 2EIZB 2Z2YA 1VDGA 2VDNL 3GMRB 4UB0L 5D7LE 5J3HD 2Q7YA 5ADOL 3QUMB 4JGMA 2GY5A 3U6RA 5ISZE 1NUNB 5SX5H 4JRXB 1AHWA 2EDBA 2P1YA 3IS0X 3MV9A 3RTQD 3EBAA 3V79C 1NCAL 2XFXB 4KTEH 1B0RB 4P57A 3RBGA 4YNYA 1OTUD 5DFTA 3VW3H 3HG1A 5FKPA 4HKZA 1MI5A 2DD8H 1DFBH 3GM8A 3HPLB 4MQ7B 3MROB 3F8UB 3FT2A 4EUPG 4L8DB 3MZGB 4YUEL 4KRLB 3GB7B 1YJCA 1I9EA 3GGWA 3ET9F 5C0AE 1DUIA 1I1FB 3HS0B 4L9LC 4JAMB 4BQCA 3HN3A 2XXCB 1WIOA 4XB7A 5DUBB 4Y19D 3EO0B 4L1DA 4OJFH 4P2OC 4JZOB 2UYLA 1Z0MA 5CEYB 2Z93A 5EBGA 2W65B 1K9TA 1NFDF 3VFWA 3GKWL 4OZFB 2X70A 1AD0A 2EH7L 1OY3B 2JCCE 1R0AL 3U0TB 4IIQC 3RX5A 4WNQB 1BJRE 1ZTXH 1SM3H 3V7AG 4IOIB 4LCWD 1YEKL 3PE9A 5HHVL 2WSKA 4OSUH 4MSWA 1BVZA 1RZ7L 1UKQA 3HRPA 4C54A 5KANI 2GK0B 2WMPA 3HC0B 2F74B 2QQNL 5GISH 3CLEL 4LRNH 3IJHA 1NANI 3Q1SL 4ODVL 4R6UA 1OT1A 2OLDA 4M1DL 5DJDA 5CZVL 1U8IA 1KCVH 4GKSA 2VMFA 2V5RA 5JO5B 3O6FC 4XTRC 1CL7L 5EOQL 3F12B 5DD0H 1OM3H 1D5BB 3FB5B 2VWEE 1IKNC 2F19H 4LBEB 2AKRA 5E2UH 2CIKB 5FGBC 2N7AA 4JRXE 5IQ7H 5IP4A 2Y07L 1Y18A 4R96B 5FHAL 4G6FD 4GS7C 2CSPA 2Q8AH 2OK0L 5MEOB 5FOJA 1TCRA 3H9SA 1FG2B 3HNSL 4OZIF 3AM8C 4LVEA 1B3JA 1ZHLA 4XBPB 5B4MD 1FV1B 1MCLA 2Y36H 2D0HA 1SQ2N 3MRPB 1U8KB 2HFFA 4WEMB 3QO1A 1HSBB 2WWTA 5KVGH 3MBEC 4RGNB 1RHHA 2X1PA 1P7HL 5KVFH 3JV5A 4HS8H 2Q20A 1UXSA 3GMMA 3UJIL 2XXMB 4N5EC 5H8DA 1BQLL 1HHJA 2LVEA 1JUFA 5BVPL 2GIYA 1DSFH 3HUJA 1BAFL 3MFFA 1XGUB 3NCJL 5A2JH 1UB5A 4JHAL 4DK6A 1UWXH 3LRHA 3L7FB 3EFFB 5DUPH 1MHPL 1GAFH 4HUVB 5CJOH 4EI5B 4HCRL 4FQHB 3TWCL 3M17B 4L8SA 3AY4C 4MA7H 3PHQB 4KMTL 2ORBL 3GIZL 5JXAL 3MLVL 4BFBD 1NCNA 4GG8B 4QRTB 2DQDL 4PGCA 2APXA 5BS0E 2MHAA 3MV9D 1YN7B 2F53E 1I8LC 3W9EA 4YIQA 1MQ8A 1OAUH 1HT3A 4BZYA 1S5HB 3IRPX 1RMFH 1TDQA 2JJSC 4NBYB 1I9JL 1CS6A 3BZ4B 4Z0XB 5KAQG 5CBEA 3KPPB 1MI5D 1OCWL 3PGDA 2Y23A 4YHPA 4RMQA 1OB1A 4XHQA 2IFFL 2YOCA 1B0WA 1CDIA 3ARWA 4NOBA 1YEGL 3RVVD 2MCPH 1AKJA 1TETL 2FHFA 2Y5TB 5T5NG 4GBXA 1T21A 5DZLA 5C6PB 1WBYB 2YA2A 3V6ZB 2JE8A 3HE7C 4XCEB 3U7WH 1S7WA 2ZUYA 5F72S 1JN6A 4N0UB 1YEDB 3H2WA 1NBZB 3QQ9D 2HJKB 3MMEA 4QGYA 4D9LL 1AR1D 4BWGA 1P1ZB 4I3RL 5TDNA 1P6AB 2BCKB 1HI6A 4LLYA 5IHZB 3DVNB 3MZTA 1PG7W 4PJ9A 5KVDH 5KS9B 1J8HA 3FO0L 1PY9A 4OAWA 3VD3A 3IJYA 5GS1C 4FXKB 2XG4A 1SCJB 1MHHB 3LH2H 4PGBA 1OSPL 4FTVA 3PJSA 1QBAA 4PJEA 5GS0L 2DQFA 1LE9B 4MZDA 5DRWA 1OL0A 2IADA 4MNGE 3VH8A 4NDMB 4FQQB 5IMMA 5HGAA 4MXVF 4FNLL 4XNXH 5F7FA 5AD0B 1IBGH 4V1DB 1SIBE 1G9MC 1AP2B 3MV7A 5FYJD 3MRIA 2UY7A 5JNYB 2OTPA 4R2GD 5ANMA 2ZCKH 1JZ6A 4GRLC 4KKBD 3GIVB 2GJZA 3H9SD 4KJWD 1JYVA 3T4YB 4NQDA 2HLAB 2MWCA 2IWGA 4J1UB 1I4FB 3K0WA 5EUKB 2YZ1A 3W2DH 3MC0A 5J9PA 2K7PA 3T1FB 4O02H 4I0PC 3SO3B 5ICXB 1JNNL 2EIEA 5IB5B 1T6WA 4ZNCD 2J5LB 1OAQH 1ITBB 1RU9L 3RVWD 4OGAC 3QPQC 4O51B 3IFOB 1CNMA 3ARVA 1OTSC 5CILH 4ZARA 1J05B 3F65A 3PWPA 1EH9A 4Y5XA 3C87A 4XBGB 2OJEA 3VWKB 5DC4B 3LIZL 3HFML 2ZOLB 4X5XA 4KDTA 4ODHH 2JIXA 3U4BL 3VFOB 1CFTA 3EO9L 25C8H 1FDLL 3D85B 3DX7B 3DE3X 3PDOA 3MO1B 3P0YL 4M1ZA 4XRCB 1IC5H 5DQDH 3VRIB 4CMMB 5DURD 5HHOB 4MHHI 3SDDA 1FZJA 4H6XA 4XMKH 1RZ8A 2GEEA 3JXAA 1HSAA 4K8RC 4QNPF 1Q38A 5B8CC 1U8MA 5K59E 1LEIA 3I3EA 1UM4L 4DKEH 2OTUB 4HJ0D 1FG9C 2X4QA 3KXFE 3BGFB 2DKMA 4JY5L 3JTSB 4DVBB 3VD9A 2Y5EA 3BGAA 1AXTL 5D5ME 4BFGA 4DQOH 5C0DB 3GCWP 4S2SA 1A6UH 4Q6IC 4KTDH 3RGVC 1DUYB 4N0YH 1X5KA 4Z7QF 1KJVB 3QEQA 5F8QC 3TIDA 1G7HA 5C0BB 2JJTA 2BNUB 1WEJL 1CLZH 5BXFB 1I3UA 4AEHL 1A7NH 3GUTB 1CD1B 1A21A 4XXDA 1AKJD 4U6YA 3TPUA 1P84K 4QEGA 1AR2A 1E6JH 1YN6A 3WIHA 1CYGA 3KPNA 4GBXD 3PGCA 1XR9B 3L5HA 2YC1A 1BREA 3PABB 3C5ZC 5HGGS 1IT9H 3N1QC 3BQUA 2ZUXA 3BD5A 1TJHH 4WV1A 1AE6H 3MYJB 3BP5B 1NGYB 2PO6A 5E1AB 2A9NL 4ZXBB 3VFUA 4CVXA 2W0FB 1KPVA 1OTTD 4MQTB 4OF6A 2A74A 1SBSH 3QUML 4LL9A 1D6EA 3ZE0F 5E6IC 2BFVH 2I25N 4RX4D 3D9QX 3TBSA 4WWID 4DW2L 1J0YA 1NLDL 4NJAH 1IGCL 4PJ9D 1J8HD 4X99A 2FJGB 4PJAB 1EJOH 3FO2B 4L9LA 4L8CA 4Y19E 4XP9L 3WEXA 2CKNA 1HEZA 2MCG1 1OSZA 3K74B 1DQMH 5E00B 4HS6A 4KPHL 4UIKH 1ACYH 4U6XB 4FTVD 4P2OA 2K1MA 4PRAB 4K3JL 4UOJA 4N9GB 3OV6A 5AYQA 3BKCH 3LKNB 4PGDA 4LCWE 4R0LB 1S5IH 2ED9A 3TZVC 3OKYA 1NCTA 4IIQA 4BZ1L 1LEGB 3KPLA 4G7VH 3OKLA 2OI9B 2Q86A 2VYRE 3MV7D 4HBCH 4PJFE 4GKNB 3OKEA 3F7RA 3LS4L 5HGDA 3PL6A 5E6YA 2GJ6A 4NQDD 2W2PA 3S36X 4POUB 1RFDL 3VFGL 2XIDA 3SY0A 4Y4KB 2VDNH 4UB0H 2BVEA 5H2BB 2YPKA 4UINL 4G6KL 5ADOH 1KULA 1CE1L 3O6FA 5DD1H 1T6VN 1T1ZB 3D48R 4YXKL 4N1HB 2BHYA 5HY9A 1NCAH 2EKJA 5IHBA 1IEAB 5FGBA 4XNMA 3RHWK 2UWEB 4N8PA 1PZ5B 1OOAA 3PWPD 1WBXA 5IEHA 5D7IB 3DNKA 5JMRA 3OB8A 2DQEL 3UYRH 5ETUB 2UY6A 4JFQA 1RK1B 3DWEX 2JIXD 3LPFA 5I73C 1I3RB 2ZOKB 3W0WA 4R4NC 5IJKC 3QXWA 5I1KL 3ILPB 4YUEH 1IM3B 1X9QA 4Z7WB 2DLHA 3SDDD 2EXYD 2QR0B 3P4LA 1IC6A 1QLRB 5D93C 1ST2A 2QADC 3MBEA 3RWFB 2SNIE 3S3PA 1GGIL 3DV6B 1NGQL 1PG7L 1AIFB 1P4IL 1ROWA 5BRZA 5DJZB 4MXWL 1MRFL 3MGTB 5EO0A 3ALWA 5LQBL 1KCUL 1M6OA 2AJSL 3DOSA 3ZKNC 4PBVC 5EU3A 4BSVB 3GKWH 1QNZL 4JKPL 4KUCD 3TO4B 2EH7H 2QBWA 2NW3A 1KPUB 1R0AH 2P8PA 3H9HB 3EJZD 1MHCB 3F7YB 1M7XA 1YEKH 2APBA 3QEQD 5HHVH 1R24A 3PXHA 4H5SB 4WDIA 2MKWA 5IMOA 3T2NH 4DGYL 1CDJA 1RZ7H 3ARFB 5IHUL 4OCRH 4IDLA 2QQNH 4YHNB 3CLEH 4DUWA 5J13B 1O5DT 3MV9E 3CC5A 4ODVH 4F7PB 2F54B 2IAMB 3NIGE 3MNWA 4NNPL 2XRAL 2M26A 1P2CA 5CZVH 1I8LA 4PTUA 1HK6A 1XIWB 1JMZA 1ZLSL 3BQUD 1CL7H 5EOQH 2YXMA 2JJSA 5TH2B 2GYSA 2NY1C 3RPIA 1MI5E 2K7QA 2NY4C 3CDCA 5ALCL 3F7MA 1BX2B 5TGBB 3VGBA 1X7QB 2Y07H 4RGMB 5FHAH 4QCIA 3WS6C 2OK0H 4FMFA 4TUOA 2HKHL 1V3KA 3DMMB 3QYCA 2IPKA 2X4PA 3OXRA 1VFOA 4UZGA 1M7IA 3VD5A 1J7VR 2CRYA 1ZT7A 2EDOA 1V5JA 3OAUH 2IPTL 1AJ7H 5D7JC 4DOHB 3S4SG 4Z8FL 4I48A 1UACL 3HE7A 2E7LC 1KGCD 4PRDA 4P2OD 4M7ZC 3UTTA 3D39B 1JHKL 2GTZB 3WIUA 2VKWA 3OR7A 3UJIH 4Q9BA 4QOKA 3EJJX 1NMAH 1H3WM 5BVPH 1DBAL 4F9LC 5CJ8A 5HI5C 1BAFH 3NCJH 5C07A 4JFEB 5FA4B 3WQBA 5F88B 4JHAH 5DHYB 4BA8A 3UEZA 3V5HA 1PD6A 5L7XH 2OSLB 3L5IA 3RI5K 3PL6D 5GS1A 1MHPH 3R4DA 2GJ6D 1OD7A 4HCRH 5HGHB 2V5YA 3TA3A 3EIFA 3RPKA 3LAFA 5CAYB 3S35X 4QRUB 1AY1H 1IGML 1QBML 3O6FD 1NC4B 4KMTH 5C6WH 3GIZH 3MLVH 4KWUA 4PJ7B 4XTRD 4RCAA 2B6NA 2A6DB 4Q2ZA 2PKDA 1X5XA 2DQDH 5FYJE 1XGPA 5AZEL 1QFPA 4UNVA 5BZWB 4YX2L 4NE7A 1D5ZB 3H9SE 3OPZL 3SPVB 3MX0A 3S37X 3WD5L 1JZ8A 3MRCA 1UH3A 5DJYA 3BP4B 1I9JH 1J12A 4GRLA 5JHDB 5HGBB 1WISA 2NLJA 1OCWH 3W0WD 2IFFH 5DO2C 3EUUA 3WL9B 4KKNA 1YEGH 4LSRL 2F5AL 4I0PA 6CGTA 1OYOA 3MBED 4P2QA 1W0VA 2IANB 3HAEG 4RISL 5JIHA 4MMXC 3MLXL 4XCNB 5BRZD 4YHIB 3HUJE 1GC1C 3L3IA 5ERWB 4WEBL 1BFUA 4N5ED 5HVHB 5MI0C 4RAVA 1G1YA 4U31A 5KS9F 1ORQB 4NRYA 3BSZL 1BWWA 2J8UA 4D9LH 2R0LL 4I3RH 3BD4A 1BEYL 1KLFA 1KTLB 4WGVB 1P7KB 1S9XA 2W0KA 1N64L 3L3GA 2YD3A 1B0GB 1K8IA 3FO0H 4QO1A 3FQUB 4F7EA 5BV7B 4XVSL 4K8RA 2YD6A 2ZSWA 5B8CA 5EC2B 5F7DB 4WW1B 1B90A 1MFAL 3RAJL 2AP2A 1K5NB 3MNZB 3F49S 1HDMB 1OSPH 3VFRA 1SJXA 4XVJL 5I30L 2CH8A 1AXSB 3GSRA 4UAOC 3AREC 3H7BB 5GS0H 3BMWA 3LD8C 3ZDYF 1HH6A 2EKSB 3B9KC 4YR6A 2DKSA 4Q6IA 3MJ9L 5HHMB 5JDSA 4FNLH 1EEYB 3IDGA 3RGVA 1XGQB 1PFGA 1S3KL 2VR5A 3MRHA 4JO4L 2V9RA 5FCUL 1QSFB 3R06A 3RWIB 3DYPA 1EEZA 5ESVB 4BFIB 3PWNA 1CGXA 5C71A 4HMDA 4PY7A 3RWCA 1L4IA 4TUJB 4DN4H 4EOWL 4ZDHA 3C5ZA 3D69A 3HE7D 5FO9A 3VD4A 4Y5VC 5GJSL 1JNNH 3QIBC 3CFBB 2BY0A 5FDWB 3REVA 2WNGA 3O4LB 1H0DB 2R1XB 1I9IL 2N1KA 3GK8L 1RU9H 5GRXG 1UCBL 3C9NB 3SICE 4Z77B 4QOKD 4AEIL 1BOGB 1RUML 1OP5H 4EQ2A 1J8HE 5E6IA 3LIZH 3HFMH 5C07D 1CFSA 3U4BH 2ICEA 4EI6A 3KPSB 1AQKL 4U1JA 4POZC 3EO9H 3MCKA 1W72A 1FDLH 1AVTA 3QQ4B 1E4JA 4FTVE 3P0YH 4H1LH 5D8JL 8CGTA 4X7FC 4PJFF 4PJEE 4NQTA 1RZFL 3TA3D 3VGDA 1KXQE 1ZVSA 1UZ8A 1UM4H 2XNAA 2Q76A 3HPJA 3MV7E 5FB8B 1WAAF 1N5AA 4X7SL 5ANME 4XBEL 1JPFA 5TPWL 1AXTH 3B3IB 3QNZB 4MD4B 1SUPA 3QUXB 4NQDE 5EU6A 4GRLD 3RUGB 1O0VA 3W11D 3DE4X 3CIQA 3QIWC 4N1CA 5JTWA 3DUHA 4LCIL 1WEJH 4NT6A 4HLZH 5IMLA 3DGGB 5ESQA 3DTXA 3QXUA 1ORSA 1QSEB 1T4KB 4LLDA 4I0PD 3JUZA 2BVQB 3QNXA 4P2QD 3VGAC 4NUJB 3PWPE 5FFNA 1LNUB 4ZSOA 1T22A 3QPQD 4JPIA 1JWMA 5DHVH 1OTSD 4Q9RL 1AGDB 3KS0J 4NYLB 5HYSG 1LVEA 1A6PA 4PJAF 2A9NH 4P4RB 1BFOB 4KVCH 2AQ1A 3QAZC 5IW1A 1DEDA 4EIZC 3QUMH 2QV2A 1BE6A 4Q58C 5IJKA 5TDOB 4A2MA 1BHGA 4LPXA 4XH2A 4CBPA 1PJ8A 3LQZB 4ZODA 4DW2H 4EDXB 1NLDH