1R6VA

Crystal structure of fervidolysin from fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
671
structure length
671
Chain Sequence
SKAKDLASLPEIKSQGYHILFGELRDGEYTEGKILVGYNDRSEVDKIVKAVNGKVVLELPQIKVVSIKLNGMTVKQAYDKIKALALKGIRYVEPSYKRELIKPTVVKPNPDMYKIRKPGLNSTARDYGEELSNELWGLEAIGVTQQLWEEASGTNIIVAVVDTGVDGTHPDLEGQVIAGYRPAFDEELPAGTDSSYGGSAGTHVAGTIAAKKDGKGIVGVAPGAKIMPIVIFDDPALVGGNGYVGDDYVAAGIIWATDHGAKVMNHSWGGWGYSYTMKEAFDYAMEHGVVMVVSAGNNTSDSHHQYPAGYPGVIQVAALDYYGGTFRVAGFSSRSDGVSVGAPGVTILSTVPGEDSIGYEGHNENVPATNGGTYDYYQGTSMAAPHVTGVVAVLLQKFPNAKPWQIRKLLENTAFDFNGNGWDHDTGYGLVKLDAALQGPLPTQGGVEEFQVVVTDAKGNFGVPTVFVSMMRDNGSCYYAKTGPDGIARFPHIDSGTYDIFVGGPDHWDRALAPYDGESIPGGYAIALRMAEERQASFVGFGVSPDATQLNVNFNSTLQVKFSTNLSTLKDPQFVVVDPLLRGVYGRVAYARNQTYDLSLLSGQISFGIQTLLPAATDITIQGTVTLNGEDIPVYGVLKAGTTWTIIDDFGGLNLGTDSQPIYVWWTIFGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of fervidolysin from Fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin.
pubmed doi rcsb
source organism Fervidobacterium pennivorans
molecule tags Hydrolase
molecule keywords subtilisin-like serine protease
total genus 183
structure length 671
sequence length 671
ec nomenclature
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1r6vA04
2.60.40.1800 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1r6vA01
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 1r6vA02
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1r6vA03
1I8MA 5GGVL 1I1AD 1KJMA 3DUUA 5JPNB 5BZDA 1IM9A 2P8LB 4NQXB 4XP1L 1BIHA 2X4TB 4FS0A 3V0AC 2R4RH 4U3CA 3BPLB 4JPIA 1G6RA 1Y6MR 1CQKA 4RFEA 4OZFH 3BT2L 5DVKA 3VA6A 3MBEA 3VGEA 4G3YH 2CKBB 5HD8D 4Y5YA 4M7JL 3QDJE 1FFOA 4RAVA 4AM0B 5FYLH 1N3NA 1N4XH 1YJDC 3OQ3B 2DBJA 4GBXB 4G80B 4LIQH 4AY0A 1MI5A 1PKOA 1CLYH 4NT6A 4HKBA 4BUHA 2DI8A 1TO1E 2EE9A 4L8CA 4TULH 3TBWB 3RWEB 1O7VA 3QIBB 4FP8H 1QLFB 2FECI 1AD9A 4HS8H 4MD5A 3LS4L 5C0DA 2DM2A 2IQAB 3ZKNC 5IM7A 5AAMA 1L9NA 1K3ZA 2CMRL 4P23B 4PBWD 4QRSB 3RWFB 4Q58C 4JFEA 3KNBA 1Y4DE 4P49A 2AQ3A 5D70L 1YEKH 5E2WL 5LJYH 4Q74A 5IW6A 5EU3B 4KWUA 3JWNC 3AREC 1IAMA 2NX5D 1JIBA 2PTVA 3MNZB 4PB0L 1KCRL 5CAYB 3FFCB 1KJVB 2BSSB 2V2WA 4R7NB 3KXFD 3RGVB 1G6RH 2XWTA 3NBNA 2E9IA 3BE1L 2YXMA 5ENWB 5IT2L 1AIFB 5LVEA 1ST3A 1HOCB 4MNQD 3ZDYE 4GRWF 5DJ2B 1QEWA 2ADIA 2OR9L 3F7VA 3PG2A 2PXYA 2FSEB 3D5OF 1JV5B 1MJUL 1YECH 2VSCA 2EC9T 2ATKB 2JB6B 3HAEA 3QBTB 1D6EA 4U6XA 4XCNA 2XRAL 4U6YB 1KJ2B 4KK5C 4Z5RA 5HDLA 4ONHB 2GJ6D 1QVOB 4F33A 4QRQB 4DW2L 1OAQL 4R96B 2MTPA 1ZHKB 3RI5K 1U8KB 4UIMA 1QR4A 1JUFA 2M8XA 3LPCA 3VRLE 2XWJB 4OCRH 3WDHA 4YWGL 5DJXA 4PJXF 1OSPL 1MCKA 4YBQC 2NY0B 4B5LA 1OWWA 5T3ZH 4PJEB 1BEYH 1SBBA 2A74B 4JZJC 2OXHA 1IBGH 1I3UA 3QO0B 4YUEH 4XBEH 5ADPL 3VGAB 1NCBL 1MJJA 3FN3A 4FG6D 1FJ1A 5TDOA 5CSBA 1MCOH 1T5XB 3QQ4B 1IM9B 1QFOA 4GRWH 3MV9A 3LN9A 5DUBA 4QHUB 3VWKC 5JXHA 3O11B 3TYFB 1VPOH 1Z2KA 2O5ZL 2CRIA 4G6AC 4NQEA 1MCBA 1WWBX 5EOQL 4LSSH 5DTFB 3E2HC 4KTYA 4YNYB 4H6XA 1ZT4B 1VGEH 2OL3A 3IDYB 5BS0B 1CFNA 3KG5A 1B0RA 2FGWH 3AS1A 1TVHA 3LCYA 4PRBA 2EZ0C 4EI5A 5I16A 4JG1H 4UI2A 4TUOB 4K3EH 3X11B 2XQBL 1IQWL 2WBWB 1AKJB 3MA7A 5DMIL 3V0WL 1HT3A 1G9NL 1VENA 3AU1B 5F9OL 4LVOC 4OZIA 3SDAC 2Q8AL 1LNUB 4XNXL 3OKMA 3N1GC 1A6UL 5FUZH 4N8CL 5DHYB 3IFNH 1OB1A 3OPZH 3V4PH 5C09A 3KYKL 1YMMB 2KUTA 1NMCB 4NQSA 3KNBB 3HMWH 2CDGB 3UAJD 1A7QL 4FQXC 4J6RH 4PJHA 4NQED 3U4EB 4X5WB 1XR8B 1LO5B 3L3JA 1UJTA 1S5HA 4IM8A 4UDTA 4M6MH 4NZTL 1EJOL 3TCLA 3L3GA 5KTEL 4GOSA 3UPRA 4RISH 1TENA 5J7CC 1KXTB 1XH3A 4BFIA 3P11H 2I26N 4Z7OE 1CG9A 1UJ3B 5J11C 1RIHL 3WLBB 1PJ9A 3AM8A 2X4QA 4RSVA 4RFEB 4AKSA 3QCUH 5C0JB 4XNYL 4UILH 4I2XA 3ZT5A 3D18A 3B5GA 4F7EB 3KYAA 5JOFA 4LKXA 3AUVA 1U9KA 3ARSA 5GIRA 1X6LA 5HVHC 4WIQA 1XT5A 4NKMA 2X89D 1WICA 3TEUA 3QUML 5F3HA 3CLFH 5HYQA 2P8PA 1Y6KR 3AAZA 3B9VA 5AYUH 5DDHA 3RWHB 5DT1L 6CGTA 1C5CL 4X99B 1BQLH 2Y07H 1IM9D 2H2SC 1NJ9B 2VJXA 1NC4B 5TDNB 2H1PH 3ZKSD 3UJTL 2WSKA 4DFHA 3EW3B 3MRQA 1A02N 3BZDA 3MRLA 3VDAA 1TQBB 2XTJD 3CH1A 3PP3K 1BE8A 2VISB 1ZHNA 3WLWC 1KJ3H 1MWAL 1XZ0A 3FONB 4UILL 2ICWI 1T5XA 4Y5XA 1RY7B 1SJEA 3BQUC 5C0GB 1KPVA 4MXQD 5FKAA 1P7WA 1DBML 3M45A 1NLBH 1NAMB 2HJFB 2XWTB 4WRLA 4KZDH 4GAFB 3RUGB 3VD3A 5D7JA 3DTXA 1GCFA 4J2XA 2OI9B 3OTTA 4XPBL 1E4KA 2PXYB 5SWZA 4X6EB 1BBDL 4HKXA 3WKNA 2LU4A 4I2XE 5FYKU 5ILTH 4XBEL 4OZIB 3S36X 5E8EA 3T2QA 1J1PH 2DJUA 4IIQA 1E4XL 5DGRA 1CFBA 1HXMA 1IC1A 1MFNA 3UJJL 1YMMD 1J0JA 1NAKH 4XHJD 4F7PB 3RGVD 1HXYB 1F02I 2I9TA 2AK4B 3RA7H 3SBWC 4PJHB 5EO0B 3G5YB 2NY4D 5TQ2L 4QT5B 4M93C 3KPSA 4G6MH 2YD1A 4OZ4B 3CDGA 1J0IA 5FFLA 1JGDA 4JO1L 3PV6B 3T77B 1BZ7B 3FT2B 4KQ3H 4XMPL 5MEQA 5DK2A 4YHLL 3JTTB 5HHNB 43CAA 4GMTL 5HI4D 3CFJB 4HUXB 2AJSH 3QUMH 1MF2H 5C92A 5MHSD 4X4YA 1T3FA 1NL0L 1MHPL 1T0NB 4MDIB 1RUAH 1Q94A 4GQ9H 4K71B 2EXYD 4NQDB 4XCCL 4LHJB 3BKYH 4ZUWB 3LKRB 5JXEA 1A6WL 1BE6A 5C86A 3MREB 4WY7L 3NCMA 3PWVA 1MIEH 3KYOA 4ERSL 5FOBA 3B9KB 2R15A 1P4IL 5HGGS 2G5BA 3L1KA 3RZCD 3GGWA 4XH2B 5HVFB 4ZXBD 4NQUA 1YMHB 3QNYA 2W2PP 4GAGH 2H3NB 4MCYB 1NGPH 2J8UF 4WWKA 5FM8A 3W39A 4AQ1B 4NMXA 2V8BA 4OKDA 2FHFA 3OKDB 4PJ7A 1OB1B 5IF0B 1VCAA 3MRRA 4AL8H 1UH4A 3QWOA 1N7ML 3MRLB 4ZFGL 1F4WL 3TT3H 4U6VH 5H37G 1G7IA 1S7UA 5LGJB 2AJ3B 4HK3J 3RBGA 3U4EA 1XF5B 1IGIH 4TTDC 4ZTPL 5ID1B 5ISZE 1BHGA 1KPUA 1FE8L 4W6XB 1W72H 1DL7H 5BZWA 2XN9B 4TVPL 1JGUL 2IANB 4OLWH 4PTTA 4AJ0A 3T2NH 4U7MA 4NRXA 1QRNE 3WO4B 2ZCHL 4Z8FH 4JRYA 2LTQB 1IL1B 4DJMA 5FKAB 5D7SH 3E2HB 3D9QX 4BK5A 1FQ9C 3RPKA 4ZFOL 1URLA 1G7LA 5GRVL 5LWYH 1R3IL 4M48H 3QIUC 3O2DA 1NFDA 3PHOA 3RWCA 2QQNL 2XZAL 4X6DB 4KK9D 5I71C 4JZOA 1MJJB 3VXPA 4LLUA 4LLQB 3KR3H 1AE6H 4G6KL 5C8JA 5IVZB 1DLFL 2NTFA 3OAYK 3NN8B 4CVXB 1HSBB 4U3HA 3B2VH 3GUTB 3UO1L 4H0IA 4PYGA 3LIZH 4I3RL 2C5DC 2I9TB 2PW1A 2IC2A 4LU5H 3BP5B 4HUNB 5JO5A 5DYOA 1RUAL 2IADB 1AQDA 5HI5C 1CICB 5ESQA 3QQ9D 4QTIL 3B8SA 4ZUTB 3ESUF 1H9VA 2DWDB 1RUKH 3T65A 4TNVF 5D8JL 1N64L 3U7WL 4NN5B 4NCDA 2AJUL 3QDGD 3CFJA 3DVRX 2QSCH 5GGTH 5DRZA 2HFFB 4XCEA 4BELD 5HGHA 2YD5A 4OZFB 3FQUB 1WJ3A 2YA0A 4NQDA 3ZDXF 4F57L 4JM2D 2BJML 4Y4FB 3EDYA 4XMKH 3QP3A 1TZIA 4PRNB 2DQDL 5ESAA 1T20A 4ZS7L 4HKXB 4U1HA 1MRFH 1IC5H 1U3HD 2ZUUA 3KPTA 1SUBA 3O6ML 1SMOA 5IT2H 3CFEA 2BVPB 4NQCA 1ZT7B 1FGVH 1KV3A 3FB7B 1J18A 5J1AA 1UKTA 1CFSB 4GMSL 4OD1H 4GMTH 4EDWH 1YY9D 5MENB 5KN5B 4BH8B 2R9HC 3LKSA 5D1ZB 4YHIA 3KLSA 5I74C 1YECL 2WP3T 3GFUA 1HK6A 3GBLA 3JUZA 4XI5C 5IIEB 3ZKXC 1RZGA 2CD0A 4N5ED 3MCLH 1UGNA 4Q6IA 5B8CB 1A7NL 2VAJA 2AEQH 3QEGL 3EYQD 3L9RB 4YH6A 3BAEL 5CKAA 3HTLX 3O9WD 2FEDC 1R5WA 2PF6A 4KJYA 4KKBC 3V4UL 4O5LH 3HS0A 2N7BA 3EO0B 3A3NA 4MJ2A 5D2NA 5SWSB 4YHKH 2GK0A 3UBXG 4GG6A 5FUZL 1LEIB 3O2VL 2BHUA 1CGSH 1GPOL 2BSTB 3C08L 3MRJA 5K9QI 3ZSSA 4JG0H 2BCKB 4NOBA 3N1QC 4X9BA 3V5HA 5E00B 1UWGH 4WU5A 3RWGA 3UZEA 5IGXH 4ZUWA 2YN3A 3R0MA 1BAFH 1A6AB 5D1XC 1HQ4B 1OAYH 1YYML 5CP7A 3PWVB 4OIIH 1A7RL 4FFVD 4YDJA 3RL1A 1KPVB 1ZAGA 4C54A 5EZJA 5GGUA 3FB6B 3DE5X 1M7DB 1ORSB 3CSBA 4P23D 3VXOB 4PGEB 1YN7B 3H9SB 3O4OB 3VFTB 1UXWB 2HN7A 4XP5L 4YFEA 4TSCH 1GA4A 2WBJC 1WT5C 1A3RL 3QNXB 3P9MB 4RWHA 3O2VH 3RVVC 3QWRA 5IP4A 1BP3B 1XF2B 1T83A 5IF0A 4WWKC 4UB0L 1LP9E 4K94L 4PJAB 3UYRL 2W2MA 3BT2H 3LEXA 5CD3A 1WFTA 1UWGL 4PRHB 4CJ1A 2B4CC 2Y23A 3NFSL 5EC2A 5JLZA 1Q1JH 4K8RH 4M6AA 1I8IB 5FDWB 3UX9B 5C08D 4HKJB 2GTWB 3RVXD 4AMKL 4HK3N 2DJ4A 4UUJA 5I66A 3F58H 2R1YA 2F8XC 2HAZA 3HB3D 5EIIB 4UT6L 2Z4QB 3PWPA 5IMOA 1DBIA 2NLJA 1TZIB 3L5XH 3CXHK 5I8CA 4GS7C 5D5MB 2O5YL 1AHWC 2H6PB 2JK5A 3UP1A 1U36A 2Q7NA 2EDHA 3NAAL 3TJEH 5T33L 4PJFB 3EO9H 3N85H 4Z95L 1ND0B 5DK2B 2DBLH 1OARL 1QOKA 1I8KB 3TO4D 4RA0C 4D0BA 1N59A 4F2MA 4XTRD 3K1DA 4NQXA 4FXLA 1X5ZA 2QQLL 2A9ML 1BX2A 2QHLA 3KPSE 5A16A 5D1ZA 1TJIH 5AZ2L 3JV0A 1CFTA 4XAWL 1ZXQA 5DFTA 1DQDH 3MV7E 4NNPL 3KLDA 4MD0A 4OT1H 5GRJH 1BBJA 2F54D 3H7BB 1MNUL 3SO5A 1KXQE 1A6PA 5CIPA 1LHZA 5E6IC 3D25A 5E70A 5D2NB 5SWSA 2EIEA 3L3KA 5IWLA 2CDFA 5EZOL 5F89B 5J6HB 1BQLL 3GSOA 4JHAH 2D31B 1YYLH 3N9GL 1DP0A 2NYYC 3NZHH 1J9CT 4XVJH 4QRSA 1IC7H 3RWFA 4NKQB 4OD2A 3VH8B 3SGEH 2IFFH 5MP6H 4A6YB 4PJBA 1PDKA 2ZUSA 3J7HA 4JZNB 5BZWB 4MQ7A 1LD9B 2I07B 1SMAA 3CLEH 4L3CB 1MFCL 2YWZA 3ZKMD 1D9KD 2ICEA 4NQCD 4W81A 5EUKB 5GS0C 2O61A 3ARBD 3QFDA 3GDBA 3W9EB 4L8SC 3HKFA 3ZYIA 4YHZL 3ZYOA 4P48A 1JTTA 3WN5B 4WUUE 5IB2A 1XGUA 2VH5L 1R64A 4R26L 4M3JA 5ACLA 1S8DB 2DWEB 4JG0L 5MENA 3V7AG 1KNOB 3WXWH 4KI1A 1NBVH 2CQVA 5D7IA 3DLQR 1SIOA 1I9IH 3TA3D 1IC7L 3C5SA 1K2DB 1TO2E 2JCCE 3L9RA 4PRPB 1SHMA 5FKPA 1JPFB 3QDGA 5HHME 2NY6B 2VXTH 4XP9H 1YUHB 3P4MB 3SPVB 1MREL 3ILQD 2SEBA 1HSBA 4Y2OA 2MHAA 1JVKA 3SJVE 4APQA 1ORQB 4QCIA 1RIUL 4JLRA 1TETL 4IOIB 3VD7A 2E7LA 4Z7VF 3H0TA 3ZZ1A 3QDMB 3O2DL 2CH8A 1J1OL 2FZ3A 2HVKB 2PW1B 4KDTC 4EN3A 1F5WA 4OCRL 3AFLA 4XMLH 1IGIL 1KDYA 5GRUH 3U30C 4NUJA 3P4OA 1BREA 1JTOA 4GBXA 1OVZA 1HINL 4G80A 4LSUH 3V6ZA 2VLMD 5T3ZD 3W0WE 1MUJA 1TECE 4Z7NE 4DKFH 1GZQB 2VZVA 4CW1B 3UBXB 2XNAB 5F88A 1ZGLA 3D3VE 3MLSL 3LMJL 3ULVE 2XKSA 1T1ZA 4OCLC 3TPUA 2FBJL 3GMQA 3IU3B 3SE4C 5IJVB 2IANE 2XN9E 3OAZK 3QCUL 4NO3B 1T83C 5EU3A 1SYSA 2GY7B 5DF0A 3EYSH 2CDFB 2FLRT 4WTXA 5EU6A 3VFVA 1JI2A 3QA3B 1BIIB 5D5MF 4I3RH 3LKNA 4UUJB 1HKFA 4ENEC 1IEBB 4YX2L 5I66B 3QFJD 4NHUA 3MRDB 4JO2H 5DJ2A 1NCWL 3QUXA 3F7VB 5DMJB 3HE6A 5IMOB 1ZVHA 5F7NC 1WEJH 5TFSH 2H1PL 2OXGA 3WS6C 3VRIB 1T2QL 2AK1L 4K8RB 5E6ZA 1BVLB 1CQYA 1GGIH 2GT9A 1FORH 2ADFL 2VXTL 3CPLB 3CX2A 2IPTL 4U1NB 5T1MB 2Z93B 3MV11 2V2TB 1XGUB 4QRPD 5F97E 1BX2B 4OCSL 4XCFL 4KTEH 2V9TA 3IXTB 5CJXC 3RWGB 1SBCA 3HJRA 1IFHH 1NMBL 2IAMD 2Y6SD 3KPPA 1YEFL 2ZPKH 4EBQH 4IJ3C 1VFUA 4LRIA 5K9OB 3B6SB 3C6LC 4P2QB 3P9WB 1FDLH 4PJ5B 2ZOLA 1HKLL 5CIPB 3GBMH 4OI8A 3GSVA 3DURB 3VXOA 4OFVA 3QQ4A 3HI1A 5F7LB 1MCEA 2VDLL 4QXTA 1NDMA 2FX7H 3OWEA 5I30L 4GG8B 4JFQB 2QQKH 1NQBA 4FFWD 3WFBH 4JEGB 5SV3A 3RL2A 2NY1D 1EUUA 4NBZB 3L3DA 4NUJB 4JFZH 3G6DL 4E41B 3QUKA 2AP2A 4HUVB 3RIAK 4XBPB 3PABA 3QUYB 1YJDL 1CD1B 2C3HA 3LV3B 2X4SB 3FONA 4LVNC 1RJLB 3MOAL 4QNPF 4HQQH 4N5UA 3NVQA 1LD9A 1FHGA 3L5WB 5CIPH 1HHKA 4P5MB 4G6ML 4QYOA 1T7WA 2HFGH 5M7QA 1GZQA 1MJ7L 1IEAB 1XIWC 1F4XH 3OXSB 3CO0S 5F96H 1RZIB 5B1EA 1G7HB 3AJ8A 3G5ZA 4P2OA 5DMYA 3D0VA 5EORL 4ZYKB 3T0AA 5J3HD 4XRCA 2HTLD 4JQIL 2X7LB 3S4SB 5F1NB 1G84A 1T7VA 4XMLL 5D7IB 4JANB 1QQDB 3QNZB 4PJFA 4JFYB 5FYKL 5BV7C 2YXFA 4ZUVA 1S5HB 2W38A 3S34L 4L9LC 3EHBD 4Q7DA 1ZLSH 5T5NG 4EJ1C 3BW9A 1TTFA 2VUYA 3O6LL 5D2NE 1MIEL 1ZHLA 4D0DB 1AGDB 3MJ7A 2CO6B 4HS6B 4I0PA 2HJKA 5DJ0A 2IPTH 1IGJA 4NYLB 4EXKA 1INQB 3C5ZA 5CD5D 5L8LB 2GJJA 1A64A 5KVDL 2YEZA 1KTDB 3QRGH 3LRSA 4DOHE 4NCC1 1J5OL 1ADQH 3D39A 1QACA 2P5EE 3MV01 1KCRH 3KWWB 3GJFK 4UIKH 3OX8B 1GHFL 5B3JF 4Y1AB 4UT9H 3RKDD 1F6AB 3DWEX 5DJDB 4FQQB 2APTA 2X89A 4OUUB 5F3HB 3IVKB 3QXDB 5KSBF 2WUCL 1AVTA 4R4FL 3BPSA 4D9RD 3QMPA 1ZLSL 3MV8B 4B7LA 1OOAA 3UYOD 5DR5H 2ZUQB 4JFFE 3DVFA 1WZ1H 1NJ9A 3MV9D 1ZA6B 1A4KA 3HZYA 2EDKA 2X9XA 3NH7H 4WEUD 3VTAA 1T1EA 4JFFA 2VITA 2BOCB 5K9OA 2VISA 4PJ9D 5HVGB 4QNPE 1QYGL 4PJ5A 1GTG1 4Z78A 1MELA 3C6LD 4P4KA 3H7LA 5FYKD 3RY4A 1PD6A 5HHOE 2JJSA 4HEME 5A1AA 2Y6SC 4ZUUA 2H26A 3U48A 3O45B 2J8OA 3HMXL 1AO7B 4JQVC 1IGCH 4GH7B 1JK8A 3MRRB 1S5IL 2IXTA 4QOKB 3MRDA 4FTVA 4YIQA 2Z56A 1NUNB 3C5SB 2BHZA 3GZKA 1P4LB 2DD8L 3UJIL 5DJ6B 2EDNA 5SWZB 3NFNB 2QV2A 4PB9L 3LV3A 2R2CA 3UCRA 2QQQA 4WTZG 2SEBB 1LP9A 3C87A 5BRZD 1UWEL 3TH3T 3RNKA 2YRPA 3PL6B 4QHLB 5TH2B 5T1KB 4POZC 3QUZC 4ZXBB 4EI5D 4I0PD 1WWAX 1YC7A 4NQCE 1UCTA 3QDAA 3Q5TA 2AEPH 1RJZA 5GJTL 3NMEA 4ENED 5DS8B 1OGAE 3WMSA 2GJ6B 3GSUB 3QCVL 3QFJB 1I1FA 1L7TL 1U3ZA 3CFKA 1ZVJA 3ULUC 2F74B 1YNTA 3HUJB 4GFTB 4PJDB 5EU7C 2I24N 4OGXL 1QFHA 2A6JA 1EEZB 5IB4A 1SUPA 2J88L 1X5LA 4JZJB 3V79C 1DLHA 2VXSL 2DAVA 4YHZH 3QYCA 1G1CA 5IVZA 3FO2B 2NTFB 3FO9A 4JKPL 4EXPX 4R26H 3PWLB 2OK0H 4Y5VC 3OR6B 5JHLH 1DQDL 2V7HB 1KB5B 4HGWA 4XP6H 3X13A 1PFCA 1W8NA 3BGOP 3SKOA 4A2MA 1QSZA 3E8UH 3ZTJG 4K3GA 5DEGA 4WENB 1C5DB 2CJUL 1NUFA 3GIZL 2V6HA 3BPOB 1GL4B 1FIGH 3FFDA 1P6FA 4PGBA 2PO6C 5CEZL 2MKWA 4JHAL 3JV4B 5I8KL 1CR9H 3X3GL 1X7QB 3I02A 4S11A 5AG8A 3RRQA 3E3QE 1S9XB 1IEBA 3JWOL 4ZSOE 3JSSA 3TN0D 1UYWH 5DD1H 4MCYA 3VXRA 4OB5L 2PXYD 1F58H 3P77B 1OPGL 2BX5A 2VABA 5CMAB 3RY6A 3IF1B 3OMZA 4DAGL 5DJ8B 1CTNA 2BNQB 4O58H 1N6QH 5D7LA 1FZJA 5T5FL 3MRKA 2RCSH 3P30L 5MEOA 3KXFA 5FB8A 1PZ5B 1XF4B 4XVUD 5FYLE 4OAWB 1SUAA 3WIFB 3TA3C 4G8EB 3PNWB 1U95A 1MPAH 3BW9B 3IJHA 3C2AH 4X6CA 4PJHF 1OP3K 4C56E 4XP4H 5J12C 4P4RA 2CK0H 2V17H 3P40A 1U8LA 3FQXB 2FX8H 4RQQB 3GM8A 3WYRA 2OSLB 3O81A 4O2CA 4LAJH 4GW5B 2CKBL 5HJ3A 3FO0H 2ZUXA 5GSRA 5T3ZL 2RR3A 3DRQB 4L4TE 4DAGH 4U05A 1JE6A 2BNUA 1OAXL 2BSED 3RNQB 5E2UH 4EIGB 2W1NA 3IAPA 3PDGA 4MJ6A 2BMKA 5AMXA 5ANMB 3MV8A 1A0QL 1WBZA 3P73A 1WITA 4WU7A 5FYJL 2WLZA 1JPGA 5D6DA 3L3DB 1TQCC 2VWEC 1HH6B 5JUEH 2X4SA 4ZUSA 3LS5L 3TBVA 4HXAL 3BD3A 1SY6A 3RZCB 1E4XH 2F54B 1MHCA 1VGKB 1NFDE 4NPYA 5D7KD 5HTSA 1P5UA 2A6DB 4P4KB 1MFEL 2AQ2A 3MGAA 3EIFA 2NY6D 3SN6N 2W0PA 3V5KA 4KTEL 1AGEB 4D8PA 4ZNCD 4LDOB 2JF1A 5CJ8A 2EYSA 5BOZG 5IHUL 2X7LA 3S4SA 4MS8C 4H6VA 2XQYK 3IAGC 2Y5TB 4Z7UE 4U1LB 1UKSA 2BDNH 1BEYL 3UTTB 2EH8L 2D9CA 1KUMA 4YHPB 1N0XL 5GRZA 4UTAH 4DOHB 2ZWOA 1AP2A 4JY5H 3QDGE 4KKAD 1MCIA 2HJKB 2ITCB 3QQ3B 4LVOA 5I9SA 4JDZB 2VDML 2DN7A 5LWYL 1EMTH 4WW2B 5IMMB 1GOHA 2A73A 2HTKC 4FQLL 2YSSA 5LQBL 4JFHE 5TGBB 1DE4A 4XVJL 4LFHD 5D2LB 4LIQE 1EHAA 3OR7A 5IB3A 3EUUA 5TE7H 2APVA 4NN5C 2PO6D 1CFVL 4I3GA 3WO3B 4WEBH 1I8KA 5LKNA 1DBBL 1DN0B 1YC8A 4NRZB 2LAAA 3S9DB 4ZDHA 3LEYH 3OJDB 2BSTA 1JGEA 4PGDB 1FFRA 1T80A 3GMLB 4OBRA 4L8CB 3UTPE 4G43B 4PREB 1E4JA 1A7OL 2WBJD 1ZA6A 1RURL 2DQJH 4DJ5X 3AB0C 5GPRA 1VERA 4LCIL 1RZJH 1JYNA 1FDLL 1BBJB 4OV6A 5DQDL 3WDJA 3X17A 1JGUH 1HEZB 4OLWL 4C55A 5J13B 4AENB 4OT1L 4TNVK 3RP1A 5F3BB 2A6KB 1C12B 3L3KB 1QSFE 1U8IB 3AS2A 2X4UA 1I1RA 2XACC 5GGUB 4AIXA 2Y4SA 1Z3GH 3ULUD 4HWEL 1H3WM 4PRAB 1YN7A 4PP2B 1A6WH 4GLRH 3A3OB 3W82A 1D5ZB 4WNQA 3ARFC 4L5FL 4ZOCA 5KVGH 1RIHH 3QUZD 4PFEA 4POZD 3SOBH 4ZQKA 2H41A 3GCWA 1GHFH 3FOLB 1CZ8H 1NC2A 2NY5L 1V05A 1D6EB 4L4JA 4EQ3A 5DC4B 2ZUVA 1JWUA 1VGKA 2A9NH 1T1WA 2HA1A 5EFIA 3MBXL 5J06A 4QRQA 3EYQC 4JO3H 4X7DC 5T1KA 3DX7A 3S3PA 4NQTA 3FB8B 2Q8BH 1KN4L 4R4NC 3WO4C 4DGVH 1V5JA 2GCYA 1KLGA 5IG7A 1EEZA 4MQTB 4HF5L 1DZBA 3QO0A 5BV7L 3I3DA 4PRPA 2YBRB 3QDGB 1U3HC 2LV4A 2ARJB 2N4IA 3FJTA 4M9PA 4RGNE 1KCUL 4BFEA 4PJ9C 4F9PA 4ORGA 4NE9C 2LAGB 3PWPD 2PMWB 2J1KA 1SCDA 3HRPA 1H15B 4K8RD 3MJ9A 2VLJD 2VDOH 4LOUC 3MBXH 1R24B 2XV6B 2FIKA 1XGRA 1EFQA 3IFLH 2PRKA 4NQEB 1OP9A 3BRDA 3RWJA 2W91A 5DTFA 4M6NH 4YNYA 2JE8A 3DV6B 1ZT4A 3S35L 3PF2A 1DE4B 5IFHH 5K59E 2AJSL 1KULA 3FMGH 4TUOA 4HV8A 4XNZC 1UA6L 5ID0B 3TBVB 4PJCF 3TNNB 1EO7A 1JWSA 4ODWA 5JW4N 3KS0H 3NZ8A 4LPUA 5EOCL 1CDCA 5HI5D 3V5DA 3ME0A 5L2KD 1LNUA 3ZE2F 4CW1A 4Z7OF 4ODHH 3VFSA 3UTSB 4Y0GA 3Q48A 3VXRB 1WFUA 2J6EL 4JY5L 3I30X 1CU4H 4HWEH 3LB6D 4MB5A 4DN4L 4DEPB 4P23A 1B9ZA 1NMAH 2FJHA 5ALCL 3G5VB 3VFNA 2XICA 3EOTH 4PJ8A 4M9OA 1KLFA 4FQ2H 2VO5A 4U1GB 5IW6B 3S35H 1KEGL 3EHBC 2DLTA 4G8EA 1CLZL 5HPMB 5GISH 3FFCA 1TNMA 3VFPA 4D9RE 4LCYA 4N8PA 4GRLC 1H3PL 3HPLB 4KUZL 5ICZA 2IPUK 5J56B 5J3HC 2ST1A 4HVLA 2ED8A 1INEH 2DWEA 3CZFA 1AIFA 3QIWA 4AEIL 1OLZA 3LN4A 3SE4A 3TZVD 4PV9B 3DWTA 3TO2A 1ZA3B 2CXGA 5DZOA 5IBUG 2ID4A 4TSAL 4JDVA 2X44D 2DQGH 1GA1A 4L9LB 1CU4L 4M6OH 3NPSB 3H42H 2PYZA 1U8OA 2ATKA 2CKNA 1A2YB 3I85A 3VRIA 4LKCB 3P4MA 2CLVB 3ZXXA 4G7VL 4TTDD 1Y3FE 4HS8L 1WIOA 1GGBL 2Z93A 4CG0A 1M05A 4JRXD 2V2TA 3C09C 5I1GH 4H20H 1FFPB 1FORL 2YKLL 3L95A 1W0VB 2A1WH 3IDGA 3ZKQD 1DEEB 1E4WL 3ZSTA 4LSRL 2VLJA 3T1FB 1MHEA 3WJJA 2RQ8A 5CEZE 4Y19B 5KVGL 2DI9A 2GJ6E 5CZXC 2GTZA 5FECB 1INEL 1MNUH 2VXVL 2YOCA 3H3PL 3O2WH 4XPFH 1Q9WB 2AXGA 5ERWA 1G6VK 1C8PA 3HPJB 5I8EB 3ALPA 3WUWB 3BMWA 4HJJH 4KAQH 2PMWA 4PJXA 4POUB 2IAMB 1BFOA 3MV9B 1UH3A 4X4ZA 2IAMC 5EBLB 4JFDA 5D93B 1LO2L 5DEZA 1AI1L 3FKUS 2CRZA 1FP5A 5D93C 2VR5A 3KPRE 1YNKL 3SY0A 3GMQB 3QUKB 2UVEA 5EZIH 1Q72L 1UEMA 1FN4A 5J4MA 1BFSA 1AJ7H 3FOLA 1C1EL 4TVPD 2C26A 3V5DB 1JCKA 3KPQB 4FRWA 4MA8H 3AGVA 1G9NC 4MWFA 2VLRD 3HUJF 4PJDF 4DVBB 2IJ0C 2JCCF 5JPMB 4MHHI 3O9WA 4GAJH 5GISL 1M7IB 2VIRB 2DQKA 1WF5A 3HMWL 3RGVC 2FJHB 2DKSA 1AGCB 4D9LL 1YU6A 3SE8H 4JREB 5IV2B 2OJZL 1K6QL 3G5YA 4PJ8B 3NIDF 4NKOB 4OFPA 3T77A 3TCLB 3MLRL 2G9HB 3WKML 4JFEE 5KSBE 2MJWA 5DD6B 4S0SD 4WW1B 1XR9A 4HMCA 4K07A 2HT4D 5GQBA 5JA9A 3UTSD 1LE9A 2AW2A 3MJ9L 5GRUL 1S7XA 4MXQC 5FGBA 2BDNL 3EO9L 3TO4B 1IARB 3WS3B 4BZYA 1NGZA 2EE6A 4LFHG 2DLGA 1I3GH 1ZLVK 1WCQA 3STZA 5I76A 3LH2L 2XI9A 1E27A 3WIUA 1NEUA 4GW4A 4NNXB 2QTWA 2NY1B 2DICA 4HC1A 2HFEA 5DQ9A 3DE0X 4C4KO 3V8CA 4XC3H 3EOAA 4QXTB 3MLXH 3IFPB 1CS6A 1D5ZA 2DB8A 5I73B 2BFVL 2H2SD 2P5ED 4NJAL 2HT2C 3QJFB 4X99A 4RAUA 4ZQKB 3K80A 2C3GA 4L1DA 1BD2A 5DWUH 3RL2B 1NC4A 4JGUA 5TF1H 4MNQB 1EBPA 1J0KA 1JTPA 4YPGA 3LSOA 5C0IA 4U6HA 3PQYB 3O0RL 3VFNB 1FV1A 3MGTA 3PV7A 1RJLA 3OL2A 2V5RA 4DGIL 2DDQH 4XWOC 4AKTA 3NZHL 1IZJA 1TETH 2HH0L 4F15C 3OXSA 1HSAB 3MTRA 2CIIA 3RTQA 1JHKH 1GA6A 2Z57A 1FYTB 3Q5OA 4E41E 5FYJU 1UWXH 2FECL 1BECA 4FTVE 4PRID 3C6LB 3GIVA 1JF1B 2WBJA 3UDWC 4XBGB 4WFFE 3MX0A 4ZUVB 5E7BA 3ZKMC 2OTUA 4RFNC 5F6HJ 1Q5PA 3D39E 3FB5A 3KPQA 4M8QA 4NM4L 1N5AA 4HUWA 4S1QH 4U2YA 5E8EB 4GKNA 2QTEA 1HZHH 4Z0XA 4XC1L 4FQXD 1UWEH 4PJCE 5EBWA 1AGBA 1FFPA 1FL6A 1HHGB 1OAQH 3CXDL 1TVBB 4XGZA 1AR2A 4ISVA 2A9MH 3G9VA 4WVRA 4EBQL 5K59F 4LEOA 4IRSB 3QEUB 1VFBB 5GJSH 1JZ3A 4XAWH 5ID0A 2F53A 3EE6A 4JY4B 5LBSH 1H0DA 4K94H 1SJHB 2GSIA 2YD3A 3Q3GA 3HPJA 3OF6A 4UV4L 4XXCA 3CMOH 1QNZL 1KENL 3AS0A 3VXQA 2DQJL 5I30H 1AD0B 5F6HI 4AMKH 2AJYL 1J1XH 4LDEB 5EBLA 4KTDH 4OZFA 4NCC2 1NH6A 3BYTA 3NPSC 3TV3H 1NGZB 4HLJA 3SDXB 3OKNA 5AEAA 2EDQA 1MJ8L 5ISZA 1NFKA 2B4CL 2CXKA 5JW3L 3JV4A 1MFBL 4J3XA 1JPTH 2Y7QA 4GKOA 1CIUA 4LCYB 4XWGL 5BVJA 2YR3A 4DGIH 1S7TA 4P2QE 1EPFA 3WFZA 5TF0A 3HC3H 1OP3H 3ARGB 4BFBD 1XCTB 2VDNL 5L9DL 1S7VA 2HFTA 2VABB 5IIEA 1RZFL 3GSXA 3EAKA 4YPGB 1R0AH 2IH3B 2IALA 5DGQA 3D3VB 3ZE1E 1FYTD 1NBZB 4N0UA 4RMVA 5L2JB 2NY2B 1TTGA 1I3GL 4KJYB 2IGFL 4ALAL 1QKZH 1KTLA 4QY8A 5JOEA 1QPXA 5D7SL 5KS9E 4HXAH 3V95A 4ODBD 3MJ8B 1MFBH 4RBPK 3OAUH 3RAJH 4J3OC 2A83B 1MHEB 5FUOL 4Y19A 2HKFH 1R5VB 1FL3A 2OZ4H 2Q76B 3MMEA 4P23C 3EZ8A 2Q20A 1S7XB 2VC2L 3MCKB 3F49S 5GXBB 3S3SA 2AI0H 2VB5A 4XNUH 3VDBA 3TWCL 4JAMB 3DRQA 4NGHH 1MCRA 2BNUB 3PQYD 3K1KC 4R2GB 1KJ2A 1BFOB 1NGQH 4H6WA 1HIMH 1WBXA 1M4KA 2ADGB 2J4WH 4PGEA 1NDQA 1FNLA 2IGFH 3OKEB 5FYJD 5ETUA 1KYOK 3QPXH 5D7LD 4IMKA 5C0CB 3X13B 4M1ZA 3K2UL 2Z35B 3DUSA 2ICES 4HWUA 4LNRB 4XVSL 5FO9B 1AK9A 3KAAA 1DL7L 2OL3H 3C2SA 4PJEA 5CD3B 1LO0L 5DXWA 1UH2A 5FEBA 5CUSL 4L8BB 1CGUA 4FABH 1ZGLP 5JPMA 2UWEB 4C57C 3I02B 2YPLB 5H94B 4NC2B 5HD8C 4HFUH 1YQVH 3ARFB 4RBPH 1KFAH 4TUKL 2ZSVA 1L6XA 1BZ9B 1EGJH 1PQZB 5HYJA 3LY6A 1PLGL 1DQLL 5EIIA 3DSFH 5F8QC 1QRNB 3NOIA 2HT4C 1NGWA 1N4XL 4RGOL 5HHPA 1BOYA 1BLNA 5ISZB 2J8UB 1U6AH 5I1CL 2KQNA 2DTSA 3VXMB 3G6JB 4KKLC 2EDDA 3IU4H 1YEIL 3UDWA 1Z5LA 4OJFH 1F4HA 3DVIA 1KJMB 2X4NB 2X4TA 2AK1H 4NM8L 1QBAA 2EDLA 2LU7A 3L7FA 4FNLL 3VWKB 3VWJA 2ADFH 3T0ED 4P3CL 4N68A 3MV7B 5D1QA 3HN3A 4W4NA 5K9KA 1J0ZA 3VXUB 1KSRA 4FA8A 1S7WB 1X5HA 4GW5A 4G7VH 3HHRB 4XT1C 2D2OA 2X70B 1LO5A 5F1IA 4U7KA 1QLRB 1H0DB 4XP1H 2AAVA 5DURB 3RX7A 1HH9B 4OCWL 5DJCB 4X6DF 2VUOA 2FX9L 3VV2B 2CUHA 1QLEH 3Q5GA 2X1XR 4XP6L 3BP6A 1P7QB 3DUHA 4JFXB 1LO3L 2D7OA 4HLZG 2X1PA 5CZVH 5I75C 5EOTB 2B0SH 3BRFA 3T0EA 3K2UH 1RZKC 3PQYA 4PBXA 4MLSA 1FNSH 2X4OB 4GG6F 1FVEA 4XVTH 5I1LA 2FIRT 3U6RB 3MRHA 1FGVL 1XFPA 3ZT7A 4ZFZA 1XGQB 4PJHE 3SJVA 4HIXL 4N0CC 2D7NA 2VN4A 4BKLB 4JFED 5EUOE 2VQTA 3SDYL 4FQ1H 3QIUD 1AGEA 5F1KC 4YWGH 3VFTA 2H45A 5CZXD 3AVEA 5A2KH 3BO8B 1QFUL 4MQXC 3P9MA 3UC0H 4J8RB 4OZIE 2HKFL 5FHBL 1I75A 4Z7WA 4XCFH 5JXJA 5TDNA 5EA0H 4K2UL 2SNIE 2G60L 1WC7B 5EWIL 1CF8L 2E9JA 1D5MB 1JWUB 4RMTA 3ULSA 3DETD 1ZHNB 2CGRH 1U92A 4OLZL 1G6RL 1I8IA 4TOYH 4HKJA 5CSGA 4G9FA 3CX5K 4NSKB 5DUPH 2GKOA 1JF5A 5EBWB 5HGAB 4N0UE 3QQ3A 1FL6B 1HHGA 4PY8I 2DUJA 2PR4L 2XWJA 3ET9F 1ACYH 2FX7L 3WFHA 1BFTA 4MQXD 5CJBA 3QUZB 4ZXBC 3IRZA 1A1OA 2YMXL 3RZCC 1BLNB 4B0MM 1RZKL 4K3EL 5IOPA 2VZTA 4GRLD 4G6FB 4NUGH 3U36A 4K3JL 1FFQA 4DQOH 2R23A 2VL5A 4WWID 4JO4H 5I1JL 4OQ1A 4KHXH 2IG2L 3QHTC 2EXYC 2G75A 4QHKI 1ED3B 3A6OA 5KSVA 4L4VA 5FYJH 3VMPA 2XQYG 1CVRA 3NTCL 1F4XL 3PP4L 3LB6C 1XGTA 2Z0BA 4M1DH 2EIZB 1KG0A 3OF6D 4H8WH 4ELKB 1LO4H 1WZLA 1TVHB 3WSQH 1IC4H 5IFHL 3GKWL 1DUIA 1MAML 3FOMA 1NLDL 5F9JA 4P57B 3VSBA 1TMGE 4TVPH 2XKNA 4Y4HB 5E94A 1JNNH 3ZO0A 3PWUB 3I3EA 3WEXB 3T0EC 3GIZH 5IW1A 4X98A 4FQXA 3CFIC 1HWGB 1OW0A 1QSEE 3QULA 1VEMA 3CDYA 2X4OA 3HC4L 3MREA 2JTDA 2J8UA 3TN0B 1K3IA 3MNWA 5I1KL 2F15A 3NACH 2XZAH 4LGPB 1A5FH 5BO1H 1CD0A 4HJGA 5LAXA 1HQRB 5FXCH 5L88H 4BSVA 3UBXI 4YDKL 1H3PH 1LK3H 3LEVL 1P84K 2KH2B 3MQIA 4R4ND 4KUCD 3O3DB 2B0SL 4M6ML 3L7EA 3BQUD 1GRWA 1CFVH 5E8NA 4G8IA 4D94A 1SPBP 4GI3A 2OS7A 3WLWD 3MROB 4M4PA 3EO1A 4P46D 5JXAH 1H15A 3FQNB 4JO4L 3OKEA 2WV3A 1ONQA 3CUPA 4M62L 4IOSD 4C83A 1NDMB 4ZNEA 4HMDA 2IG2H 2W0FA 3V6BR 3FL7A 2DL9A 2PKCA 4PR5A 5C0CD 1G9MH 3C60A 3CC5A 3AMLA 4D2NA 5IMKA 1S5IH 4QO1A 4HV8B 1VESA 2Z8VC 4M7JH 3BEVB 5E8DL 2CDEA 4LRNL 3K0WA 4GG6E 2ICWA 4OLZH 5E6IB 2XG4A 2IEPA 1P6AB 3UTSA 2G75B 4KJWC 4IDJL 3VH8G 5F88B 1ZGLB 5DHVA 1YEJH 3C9NA 3M17A 1LEGA 4M7ZB 3V6FB 2YRZA 3Q0HA 1T1ZB 2UZIL 3QG7H 4HWBH 3JBG7 3G9AB 4H5SB 4HT1H 4R4BA 4M43H 4JJ5A 4JPKH 1DQJA 4OIBA 3ZHDA 4IRSD 1OF2A 5I8OL 4BSWA 3MRCB 4P2RE 3T65B 3ARYA 1NLBL 3GJEA 4QOKE 3UAJC 2HRPL 1HXMB 2DQCH 3QAZC 1B4JH 4KY1L 3LKNB 4XPTL 4X7TA 1MCOL 4L8SB 5EBMA 4CNIB 1G7MB 2WUWE 2YPVH 1Z9SA 4TQEH 3MLXL 3VYVA 2OL3L 4ELMF 2P8MB 4OM0H 2EDRA 4OD3L 2AK4A 2B39A 2Z92B 4FXKA 1NANH 1Q9KA 2BRRH 2P44B 1CFQB 4PTUB 1UENA 2FYYA 4LSSL 5IMLA 2NY5C 3WJLC 4QT5A 2ENYA 5JQ6L 8CGTA 4F7CB 3ARUA 5TPWH 3MNVB 4OUUA 1BFVH 2BNRD 2LVCA 3DX6B 3E6HB 4EIZC 4QHNB 2XWBB 4P9MH 1DCLA 4GKSB 1GZPB 1U3JA 2BSRB 3BEWB 3EKCA 3F5WB 4N0YL 3TA3A 5DRXA 4OQTL 4L3EA 3OKOA 4X5XB 1VSCA 2ITDB 2XN9D 1RZGB 4NWTL 2ZP0T 2VZ1A 4JO1H 3X12B 4B41A 1IM3B 3MOQA 3H42B 1NKOA 5FOBB 4FFZH 1N6QL 3O4LB 1E4KC 3MV7D 3DX8A 4KUCF 5CCKL 3L5IA 1DFBH 4NT6B 3U82B 2HPZA 3OHXB 4WTZA 1AFVH 1IGFL 1P8JA 3EGSA 3MLZL 4K7PX 5I74B 5KAQG 1YMHA 3GT3A 4RISL 1S7RB 3PL6C 3CC5B 2BY2A 3QPQC 1LDPL 4MNGB 4JQVA 4V1DE 3VXNB 1DQMH 4NFBA 4U0QB 5E2VL 3I3BA 3N06B 4XBPA 3ZLQC 2AEIT 4KK5D 2W2OP 1QG3A 2RFXB 3BQUB 4Z7VB 4NSKA 1QSEA 3M1BB 1IQWH 4AYFA 2NW2B 4IOFD 3V0WH 2HWZH 1HSAA 3UO1H 2EH8H 3QIWD 5DK0A 3RY6C 4JHWH 4ZMAT 3X14B 1UXWA 1NFIA 1K4CB 2QQLH 3EDDA 3T41A 3JUYA 3VE0B 3STBA 4RAHA 2WZPD 4RNRB 4QF1A 1XF1A 3H42L 2YUVA 4QWWC 4HH9B 5LCVH 3DXAA 5E8PB 5IB4B 5HSFA 5FCUH 1J8HB 1U8HA 2X5PA 3ARED 4QRUB 4AZ8A 4CADB 3FB5B 4M8QB 4Z18A 3AU1A 4XWOD 4XVUC 3DYBA 5EC2B 5HDOA 1MCDA 2QSVA 4KHTL 4OSUL 5EUOA 3P4LA 3OKMB 4LSQL 5GZOC 3BJLA 3GO1L 1MCSA 3RX5A 1E6OL 4KQ4H 2BNQD 2D9QB 4NYLA 2Y72A 3RIFF 4LPCA 5F7WC 2W59A 1ZVKA 2HT2D 1CF8H 3GBNH 1EIBA 3RHWK 3PWPB 3TN0C 5JIHA 1J1OH 2NLJB 2RHEA 4ODVL 1ZK9A 3TC9A 3TVMB 1SJHA 5EU4B 3RJDA 1MJ7H 2Y1VA 1TPXC 1KBGL 3R06A 2XKNB 3GK8L 4GW4B 1CL7I 4Z9KB 4KG7A 2BERA 3IDXH 3MLYL 1FNGB 3OKYA 4ZFOB 1VA9A 3QXDA 4YR6A 1X6NA 4N90E 5DUBB 1T5WB 5F93C 4TVSa 3I6LE 5GGSB 2NXYC 5ITFA 5EDXA 4G8FB 3BI9X 4G7YL 4AEHH 4LSQH 2GHWB 2E7LC 2YPLE 4LF3B 1NCCL 5GGQH 1EGQA 1MLBB 2UWEF 3X12A 3GMNA 2BNQA 4KQ4L 5MI0C 5C0IB 1MOEA 3LMJH 2NY3C 1I9IL 4EI5B 1LQSR 3VXUE 4KPHH 2E27H 1PZ5A 1XF4A 1QTYT 4RMWA 2NY3B 1DSFH 4OV5B 1WFNA 4OAWA 3MA7B 1QPPA 5I1GL 5TQ2H 3V6OC 5KS9F 4BA8A 4LPWA 3CDCA 1IAIH 2F19H 1ZT7A 3ZTNL 3JV5A 2BC4A 2C7UB 2FEEI 1MFAH 3V6OE 1JYVA 4BH8A 4X7TB 1T89A 2YWYA 5CSZB 5DK3A 1PGRB 5GGRY 4CNIA 3L7EB 5ESVB 5T1LB 4I0PC 1JF1A 1P4LA 1YEEH 2FSEA 4PTUA 1KTRL 2C9AA 4EUPB 4HFWA 1TQCB 3L3JB 4R4FH 3DROB 5DC9B 4UDTB 4W4OA 2NY4B 3BDYH 1X5YA 3OKKB 3RU8H 1L9MA 3VJ6A 3BP4A 3MNVA 4ALAH 4GG6B 8FABB 4OGAD 1MCPH 2W0LA 5ILTL 3QSKB 4MCZB 1XMWA 2EDFA 4PJAF 2OTWB 1EBAA 4MAUL 3MLZH 4G9FE 5AUMA 3I37X 4M7LT 4JM2F 2D3VA 2E8ZA 5DJXB 2WBKA 4OGXH 2Y06H 5ICXA 4TUKH 2C4FU 3GI8H 5AG9A 1C1EH 1NGPL 2XTJE 3MLVL 3DE7X 2F74A 5B22A 1WIPA 4QRRE 5GRXG 5E8PA 2AJVH 2VDKH 1HQ4A 2DIJA 5DVLA 4MLIA 2HRLA 3WIHA 4AL8L 4YXHL 1CNMA 3REWB 4JZJA 1GGCH 4AG4L 4D9QE 4JKPH 4I3SH 1JN6A 3SHSA 4HGMA 5DD3H 3HMXH 5HHQA 4Y89A 3G04B 4M4RA 4D8PB 4WI8A 4PRPD 1LEGB 3VI4F 5TQ0H 3KLHC 3GI9H 3QDJA 4YE4H 5AWNL 2Q8BL 4X83A 4KI5E 4MVBD 2P46B 4PJFF 1WIUA 4S1SL 3J8F7 3BGMB 5DEGB 3SQOL 3LPFA 3JV6A 1UFUA 3WFBL 4FZEH 3NIDE 4PRPE 1OF2B 3MUY1 4M02A 2DBLL 3ISWA 4W6WB 2W2NA 3RKDC 2PW2A 2BNRA 3MRPA 1AXTL 5DJAB 2YPLA 3CFCH 5IEHB 1MUJB 1KDZA 2FJFB 1D9KB 1F4YL 1KCLA 2ZSVB 5EN2A 1PY4A 1NC2D 1VB9A 5B39G 1P7VA 1Q72H 1P9MC 3WE6B 3TZVC 2RJMA 4R8WH 5CD5C 5I1KH 1K8DB 4PLNC 2AKRB 3GSQA 4MZ2A 4HEPG 5L2JA 3GNML 4ONGL 5JXGA 1CK0L 2EH7H 3GSNA 3D9AH 1T0PB 1L7IL 1JEAA 4K23H 4QY8B 4E9LA 1F42A 1QRND 3L3GB 3GGWB 4QXGL 5HXMA 1L4IA 3EYFA 1F3RB 3G6JF 3LDBB 2HTLC 2DKUA 2XY2A 4F7PA 1Q0XL 3VFRB 5H2BB 1HXYA 4NP4H 3MXWH 1T2JA 3F62A 3DIFA 5T1LA 2Q76A 1FNEA 2HD4A 2EECA 1SCNE 2AJ3A 4EQ2A 1OAZL 1CVSC 1JWMB 2DDQL 4WDIA 1CR9L 3QRGL 4X4XA 1G9NH 5F3BA 4UINH 2YD2A 2RBLA 3HZMB 2DM7A 5CGYD 4O2EA 3JWOH 3BPSP 2D0GA 3L5JA 3GMPB 5GS2D 4ONGH 4PRAA 1JYXA 3CPLA 4H26A 4YR6B 2NY1C 4X4YB 4P5TB 1BD2E 4CFZA 2MQ0A 4LLVA 2NW3A 3PDDA 5E08L 2RIKA 2KPNA 4LF3A 4LOUD 3RWCB 4K8RC 3ROOB 3P4NB 3GCXP 1EEYB 5SWZD 2ZNWA 2EEBA 1DANU 2ICEB 1CXEA 4IDJH 4JRWA 5C08B 1Y3DE 5EZLA 3V0VA 2XZCL 3D2UA 1MCPL 2BC4B 2FJGA 4TTGA 2XZQL 4XNYH 2AEWA 1WZMA 4WWKB 1GGUA 1QD0A 2GCYB 2IFGA 2GAZB 2W07A 4GAJL 1EXUB 3IETB 2F8VA 3QDMD 3RUGA 1JF6A 2P42B 5D7JB 4N8VA 5D71H 2NNAB 3FHAA 4GKZA 4LSUL 4OF3A 1G0XA 2VDKL 2ARJA 1JPFA 3INUL 5IUSA 3DROA 1YEGL 5EUOB 3T3ME 1GGCL 1KGCD 4JRXE 3HZVB 5J57B 4P2RD 4JFPA 4E0RA 5IHBA 3FHQA 3AROA 3VGBA 4MCZA 1JMZA 4JCLA 3AS3A 4PG9B 3SCMA 3ARFD 4NFCA 3F7YA 2WM0A 3ARZA 2AKRA 3VFMB 4S1SH 3H9ZA 1A3RH 5KSUB 4ZSOA 1BGXL 1OW0C 4LBEA 3B9AA 1X5IA 5DJYB 4WFGD 3QUYC 1FNGA 5DA0B 2L7JA 4KMQA 3ECBB 1A6VH 1S9VA 1IMHC 1ED3A 4YQXL 1CE6B 1RK0A 3QQNA 1DQTA 5BVPL 4P3WA 4JRXB 4I0PB 1OSZB 3EYVA 3LKPA 1XF3B 1KG0B 4X6FB 2BFVH 3Q1SH 5E2TL 1Y1KE 1RUQH 2JELH 1DBAL 2F5AL 4LSPL 1WFOA 5JIKA 1MAJA 4WFED 5F9JB 1KN2H 3CJJA 2DWDA 1NAKL 1E28B 2H32B 3NAAH 3TJEL 5C70A 1I1YA 1N8ZA 4M7ZC 1FPTL 1WWWX 3PWUA 43C9B 2P47B 4GUPB 2YC1A 3HG1A 5CSZA 3L3OB 2HFFA 1IT9H 2A77L 4OM1L 2HTKD 1A6VL 2ZUWA 5GRWA 5E5MA 4XNXH 4GRMB 5C0FA 4P59H 9CGTA 4I1NB 1RI8A 4WHTA 5IFJA 4KKAC 1G9ML 4GW1A 5T3XH 1P9MA 3MO1B 2LABA 4LSDA 3ILQC 3IDNB 5CGTA 5I1AB 5C0EA 3NFSH 2H32H 5T1MA 3H9YA 4LPXA 1JHTA 3FB8A 1KCKA 2HN7B 5MEPB 3QJHA 2FO1A 5J1AB 1RIVL 1CFSA 3CGTA 4MS8D 3QH3A 4PV8B 1F3DH 1HZHL 3BIBX 4P5KA 1ZLWH 2GAZA 4JPVH 1IKNA 4MYWB 3VFRA 2IY9A 2ZUQC 3BH9A 4YHML 3WL9A 4WW2C 2BY0A 2NY6C 3C8DA 1LGVA 4P2YA 3SKMB 5GGRA 3B6SA 5JLZB 3MLTB 4JFFD 3WXVL 5GS0D 1D9KC 3RBSA 5SWQB 1QLEL 3R0NA 4FQHA 5JXIA 2C4FT 5EU5B 5C6WH 1AH2A 5HYJD 3ULUE 5DHXB 1PX3A 4RGMC 1V3MA 5DRWB 1WGOA 3C60B 5H8DA 2VH5H 5I8CB 3JV6B 3V4PL 5JHDD 5HHXL 1QFWL 2FDBP 3PGCB 4LBEB 3QUYA 5CBAA 4RFOH 3WCYA 2ESVE 5DJAA 1OTUC 5A2JH 3SGDH 1YN6A 5E2JA 2EKJA 3P30H 2J5LC 4DVBA 2HYMA 3K81A 5B1DA 3CCHA 5C07E 4DCQA 3C5ZD 3HG1D 2QL1A 1CXLA 1RPQA 2Y36H 1WAAA 2YS4A 3TFKC 5B8CC 3LKPB 1TZHB 3D0VB 4ZYKA 1XF3A 3HAEG 3SKOB 3QG7L 4HWBL 3UNXA 1KCUH 3QDME 5MP6L 4XTRC 1QHPA 3PWNB 3TO4C 2MSPA 5CEYA 1DLFH 5LGHH 3U0WL 2XQBH 2G9HA 2R56L 1CT8B 1VEOA 3BVNB 3GJEB 3LD8C 1CYGA 2PTUA 4KXZH 4UV4H 1I8MB 1JBJA 4YO0A 5KJRH 3LD8B 4Z0BL 3S37X 2Q87A 1FGNH 4ORZC 4X8XA 4JPIB 1EHXA 2X40A 3HB3C 2P8MA 3BKCL 2PXYC 4G5ZH 5FBZA 3PXJA 1U8PB 3U83A 2XT1B 4X4XB 3L6FB 1UT9A 3N1FC 4MQ7B 3RVXC 2DKMA 2NMSA 4Z8FL 5D72H 3U7WH 2EO9A 2VYRE 5BW7C 5C0EB 5BRZE 2GI7A 3WFEH 1GZPA 1N59B 4F2MB 1PG7L 1U95B 2W2OA 3VV3A 1CICD 3TECE 2V7NA 1W0VA 3LHPL 2MCG1 4XX1E 1OY3B 2FWOB 3CO0P 1TM4E 4ODTH 3W81A 1C08B 2IQ9H 4GXVH 3FQXA 5C6PB 4MNQA 5IVXA 1OT5A 3RDTB 1Z9MA 5I1EL 3SPVA 1KJ2H 4Y16D 4YC2B 1SY6H 35C8L 4XX1G 4MJIE 4NNYB 4UT7H 5F7YC 4FQHB 2FH8A 3NIGE 4EUPG 2NX5A 2IAMA 3ZYJA 1ORQA 7FABL 3DRTB 1FL5B 1QSVA 4ERSH 4FABL 2H26B 1TCMA 3N0PB 2GQHA 4G6FD 1I7TB 1RZKH 3PUCA 3ZDXE 5IB5B 4U7SA 1X44A 2KZ1B 3BKML 4Z76A 4EI5C 1EVUA 2BVYA 2G2RB 3S35X 1WBYA 1RUKL 2OR7A 2QHRL 3PGCA 2BHYA 4WW2F 1YEFH 2OTUB 2AJUH 4JZNA 3DOSA 1CZ8L 5CEXB 1RK1A 2EE2A 4KKBD 2FEDD 4RWYL 3O9WC 4MWFB 4WEBL 4U1JB 3IDNA 5L88L 1ZOXA 3IB4A 3W9EA 5ITBL 5C2UB 4CN1A 3ULUF 4N5EC 2R1YB 4D3CH 1RJZB 3FT4A 5EWIH 5FGSA 4D9QD 3WSQL 4Z0BH 4YBLB 1KNOA 1YY9C 5FYKE 5ELIA 3SCMD 3DW1X 2R2EA 3HUJA 1YQ2A 4PJDA 4NO3A 5D2NC 3WJJC 5DJYA 5HHXH 4LMQE 4CMMA 2ZCKH 3EDEA 4IIQB 3SGDI 2GITA 4MHHG 2W2PA 3MUHL 4TSCL 3NFPB 2Z30A 1F58L 3O11A 3IXAA 2VTFA 2F19L 3ABZA 1SVNA 5JIPA 1F11B 4ZAKC 1A22B 2JIXD 4DVRL 4I2XB 1EAPB 3MRMB 3L6FA 3SDXA 3B4NA 3WIIL 1TIUA 3DSFL 4OZFG 3LN5A 3KPSB 4JJHA 4OZ4A 5E8DH 3D2UD 2Z58A 4OF5A 1FNFA 3STZB 5I76B 4JQIH 3CSYB 1GPOH 3EYOA 5CBAB 3T4YA 3BRGC 3QQ9C 5DQJB 1N8ZB 4MMXC 3MSPA 3S34H 43CAB 1KJ2L 4XP4L 4ZOBA 4YDKH 1WT5A 5HYJE 2EICA 2GEEA 2V5TA 5EOCH 4JB9H 3L3OA 5GGSA 1T22A 3MRBA 4HULB 1EZVX 1BD2B 2KZWA 3MRQB 4NQSB 1UC6A 2AJXH 1CXKA 3A67H 4A6YA 1YPZB 3I6GA 3KS0J 4OZGA 1LE5A 3MFGB 3IDMA 4JFZL 1DJSA 2I25N 3GSVB 3G6AA 5T3XD 4Y5XB 3VGHA 4OZHF 5DD1L 2KDGA 1H3XA 1ZSDA 4Q6YA 3TH2T 1CLZH 25C8L 4Z7NF 2W65A 1UJ3A 5DD0L 1P7HL 3V7MA 3LHPH 2PKDA 4WNQB 3VXUD 5IFAL 4J6RL 4Z76B 3QB7C 3ARWA 3O4LE 5J13C 1PKQB 1G7IB 1S7UB 5LGJA 4MNHA 3GIVB 1WAAE 1WZ1L 1XIWD 2KBGA 2P49B 1UM5L 1EVTC 3U4BH 1AV7A 2EE3A 5EB9A 3TYGH 5FGBC 3W2DL 2I9LB 1RK1B 5FO7B 4WFHD 4Q0XL 1BVLA 1S01A 1R3HB 2H2PC 4LK4A 2ESVA 3FCTA 4B53A 5M95B 2QBWA 3PGDB 2B6NA 3HE7B 1MRCH 1SIBE 3G5ZB 4FFWC 1DBJL 4UDUB 5KG9A 4PUBH 4ZPVB 1IRAY 1R3JA 5EO0A 1NFDB 5SX5K 1H8OA 4EN3D 4LSRH 3PHOB 3EOBB 3U46B 2IBBA 3BUTA 5IFAH 4CMMB 4LLQA 2WIIA 3RQ3A 1IZKA 2F54A 2Y25A 2GSIB 5SWSE 3GNMH 3SDDD 4ORGB 5H94A 3DURA 3MCG1 2OTPA 4N9GB 3P5BA 1MWAA 6FABH 1AD0A 3WD5H 1D5IH 5DUPL 1INQA 3C5ZB 1NPUA 3M8OH 4GSDH 2X1WL 3VFWA 4GG8A 4JFQA 2H9GB 2JELL 1I7TA 1EAPA 3BPOC 3MRMA 2PYEB 5JO5B 3TPUB 3RKPA 4M5ZL 4DN3H 4C56A 3G6JA 2ZJSL 3CSYA 4LARH 3W11C 1FYHB 1S7QB 3TNNA 3LEYL 3RVTD 4MZ3A 3ARBA 3BPCA 4DTGL 1HHKB 4LHUD 3OAYH 3QEHA 5D8JH 1D9KA 4WV1B 1I85A 4OQTH 1GTJ1 3T3PE 4XCEB 4Q9RL 3CFCL 4OTXL 4Z7WF 4EZMA 4LL9A 3VWKA 1G7HA 4PJ7B 1MAKA 4Y4FA 2YSSB 7CGTA 1HHIB 5GGVY 1HINH 3U0PA 5ESAB 3MZTA 4NC0B 3MUZ1 3W5NA 3NA9L 2AGJH 2VKWA 1FC2D 2BY1A 3OAZH 3R8BB 4YEEA 4KY1H 5ICYA 1PSKH 2CJUH 5LG1A 1MSPA 4IMLB 3D9AL 5F6IB 1ZHBA 5J12B 3NCEB 5SWSD 3LVEA 3CU1A 2V2XA 3KHOA 3EYFB 5FK9A 5KZCD 3EDKA 3VFPB 5EC1B 1ZVSA 3MLRH 5KN5A 2FWOA 4RGNC 1FNHA 3FTGA 4D0CB 3DIFB 1OCWL 4Q97A 2Z56B 1FL3B 5IESL 4Y2DA 2DQUL 1UYWL 1ZA3A 2X8JA 1A6ZA 1P7KB 3REVB 3LQMA 5ACZA 4U1GC 4NP4L 2C3VA 4X6DA 4R90L 2AABL 4WUUD 3VXPB 1AH1A 3OG4B 2FHBA 3QO1A 3KYOB 4PJIB 2CK2A 2PETA 5C8JB 3IDJB 3NN8A 2NXZC 1WBXB 3T0VA 2JJUA 2XTJC 4KRPB 4CVXA 5MERA 1E6JH 4JO2L 5E7FA 4H0GA 4WCYH 3KDMA 4JN2A 5J1TC 1HCFX 4LNRA 2Z31D 2OP4H 5BV7B 1A4KB 3HZYB 5FCUL 1EO8L 4FQCL 1WC7A 1AQDB 4B5EA 2P43B 1YPZE 1DLHB 1AQNA 2XOTA 5ID1A 1L6ZA 3UJJH 1BFUA 5I6XC 2DS4A 1OQXA 2NY7H 4KPGA 3DX7B 5AVJA 5SICE 3V0VB 3DO7B 2V7HA 1B4RA 1NMBH 3QUXC 5CHNA 1D3CA 1II4E 5L8JB 3MR9A 1FVDB 5AYQA 1FZOA 4LHUA 2FEEL 1K8DA 3ULVH 3GMMA 1OL0A 1U3HA 2ORBL 5ALBL 4OI9A 1RAMA 3T2NL 4OD3H 4H8WC 2ENSA 4P46B 1WQVT 3ARBC 3K46A 5GRJL 2MCPL 4O51A 1NBVL 4OLXL 2GITB 1J86A 3D87B 5JPNA 1R3HA 1AKJD 1V3KA 1D5BA 4L3ED 3PL6A 4WOBA 1PZUB 4L4VB 3BXNB 2P24A 2V5MA 4WTWA 5C9JB 3O6FB 1ULVA 4YDLB 5IK3B 1RIUH 3O4OC 2NYYD 5HY9B 1U8QA 1ZANL 2FD6H 4YBHA 4WDIB 3DW3X 3LQZB 3O2DH 3GJFA 3F7QA 3THMH 5KVEH 4KI5D 3QEQA 5E6ID 1E6OH 3F12B 1G7QA 4NN6B 3ARPA 1NCUA 1LO3H 4OBSA 1L0QA 2EZ0D 3FN0H 4M6NL 1ZE3C 3C60C 2W9DH 3OR6A 4KVCH 1MHHB 3BIKB 4OTXH 1B4JL 2ESVD 1AFVL 1IGFH 1PW3A 3SO3C 2OSLA 3SQOH 3IFNL 5T1DH 1CGTA 4MD0B 3DX9A 3RIFK 4U6TA 3VG0H 1EHNA 4WI4A 3VWKD 2XTJP 1UZ8A 2W60A 2BOCA 2DYPB 5LQBH 2VDLH 1XIWA 4HS3B 5DEFB 4FG6C 3DVGB 2XRMA 3LDBC 1QSFB 1KJVA 2BNRE 2V2WB 1RHFA 3KJ4C 1R3LB 2D31A 5EZLB 1BQUA 2N1KA 3D2UB 4FQJL 3AM8C 3IDUA 4WUKL 3LN4B 5F9AC 1T21B 3QJFA 1S9WB 1DANT 1PKQA 4LGRB 3EJJX 4M61B 1EXUA 3IETA 3QZWB 1SQ2N 2UY7A 4NQDD 3D48R 1A7OH 4PLJD 4AT6B 4HK0A 3U0PB 3TT1H 4ODUA 2LFGA 3U9PH 4CMHC 3TPKA 3ULVL 1CDJA 3OB0K 1NLUA 3DI2B 1PBYA 3VG0L 5BJTB 4K55A 3HS0B 1T04A 2Q6WA 1SPBS 5I19H 4ELMA 1V7NL 5CCKH 4WWKD 1CGYA 4EVNA 4PJIF 4JCMA 5DUMH 4ZXBA 3RVVD 4I77H 2UVFA 2WQ8A 3HFML 4TPRH 1NEZB 4WI7A 5BRZB 2WW8A 4FQJH 3QUZA 1SM3L 1U91B 1GYAA 5GGRB 2C3VB 1FZKA 1IGYB 4U1SA 4X8JA 4NZRH 4OMCA 1A6AA 2BVQA 4Q2ZA 5E1HB 4FFVC 5GGTL 5SWQA 3ZE0E 1MLCB 1UZ6F 4PLOB 5EU6E 4R0LA 2Z91B 4OLVH 1QFUH 4QCIB 5D1XD 5EZJB 4L4TB 1QO3A 2D7TH 4MDJA 4Z0XB 5EG6C 2DQIL 4R8WL 4D9LH 1RFDH 2BVEA 1RMFH 1SBIA 1CFTB 1AGBB 5I1IL 4H1LH 4IJ3B 5KVFL 3P5BP 3NCYS 3ZKND 5HY9A 2IPUG 1V7NH 4X6FA 1NDGA 1MJUH 1MRFL 4O02L 5IB3B 4ELKA 3DYOA 3H7BA 1RZFH 4P0DA 1JPSL 1DQJB 4Y4KB 2ORBH 3BKYL 3QEQB 4S1DC 5E5UB 5J8OA 4J3SA 3G6DH 3Q5YA 5FDWA 4Y16B 4OLUH 1JGEB 4PGDA 2QSQA 3LS4H 4HIEB 1I9EA 3DO7A 3DNKA 2C1OA 4L3AA 1YMMA 4XI5D 2R9HD 1ROWA 5C0FB 2Z92A 3X3FH 3HI5H 4CU6A 1DUYB 3CSGA 3NIFE 3KYNA 1YY8A 4WGVB 1RZ7H 4Z7WE 4P46A 2ID5A 1JZ5A 4WHCA 4O51B 1QSFA 5FUCC 4ETYA 1ZV5A 4MJIA 1TJGH 2XWBA 4LCWB 5HVHB 2BSRA 2QLVB 1AP2B 2Q86B 4IS6B 4KV5F 2YZ1A 4X6CB 4UT6H 4JM2C 4DGYH 4NHUB 1BAFL 1T6WA 2BOBA 3WFCH 1PKQE 5K9QG 4HJ0C 3W2DH 3GSXB 5F72S 4IRJD 3CVHH 1M6OB 5I6XB 3BKMH 1FO0B 1WEJL 3T0EE 3C6SB 1CBVH 3CK0L 1EK3A 4QRRA 4S2SB 4U1NA 5IEKA 1R5IA 4JN1H 3CUPB 3GMRA 5EU7E 4U2ZA 4MJ6B 4OZGF 5JDSB 3H6JA 5JORB 3ARDA 4PJEE 5FM5M 2A83A 1T1YB 1NGXA 3QWQB 4KUZH 1RMFL 4WU7B 3RVWC 5BOPA 4JKLA 3VW3H 4JKKA 4N1EA 2VDRH 1I9JL 1FRGL 4I9WD 4KB5A 3MCKA 4WJ5A 5D1QC 3VRLF 1D6VH 3HR5A 3TT3L 5CLTA 1KIPA 1SYVB 2DYPA 5EZOH 1BM3L 5JZ7D 1MHCB 4KK9C 1S78C 3Q6FB 4K7FB 3MJGX 1ZVYA 1MCFA 3QIBC 4MDJB 1CWVA 2OJEA 5B21A 4RX4A 4ZPTB 1JZ6A 5ETUB 1S9KC 1FZOB 4LHUB 1UB5B 5IB5A 4HT1L 2J6EH 1KCVH 1I7ZB 1SUEA 3TJHC 2QADB 4N1CA 1MFCH 3WNLA 1EV2E 5CEXA 1R6VA 3FQTB 3IKCA 4HWZA 3UTTA 3OKLA 5C71A 2VXQL 4RWYH 3KYKH 4WFEE 1IAOB 2MHAB 2YD7A 2DM3A 2WNGA 3MRFA 3O6FA 5IBTH 4UNTA 1A7QH 1TVBA 4FQIL 4G9DB 4QEGA 4BQCA 5DA4A 1EX0A 2J6EA 3GI9L 4M5YH 4DGYL 2EYRA 3D0LA 1NCDH 3SICE 4XP9L 1YEHL 1AI1H 3CDGB 3MXWL 5J9PA 3MV8E 4ZARA 3GHBL 5MI0B 2NY7L 1FPTH 1AHWB 3EJZD 2MQ3A 4V1DD 2FL5A 4FTVD 4PRIE 1WCBA 4DQOL 3JTTA 1Q9OB 1A3LL 3B9KC 2Z30B 3VXQB 2GK2A 5GRYA 2BVOB 3QIWB 4YXKH 3UBXA 2WQRA 2FIKB 1P1ZA 3PGFH 4TUJA 2BOBB 3I75A 3JVGA 4XNQB 2NQCA 4BYHA 5EO9B 4CU7A 2W2NP 3D39B 3W9DB 5IBTL 4WO4A 5HI4C 3RDTA 2FBOJ 4NO5A 4OKVB 3SE8L 1ADQL 2Z58B 4M5YL 3C6SA 5DJDA 2HT3C 5GS1A 1PTKA 4X80H 1D6VL 3NZ8B 1MCWM 1SEBA 1DN2A 3VGAC 3HI1B 5L6YL 2HVJA 4OIIL 3OHXA 2NY4C 4MA3A 4HUMB 4OM0L 4HIEA 1DEEA 3QUMB 3UTPD 5HYSB 2CR3A 2GUOA 2FBJH 4X7EC 2Q7YA 1CGXA 4LPYA 3CIQA 2AV1B 5D6CA 1P5VA 4XHJC 4JFFB 1PEWA 2EC8A 5GGSY 5FCSH 4O4YL 3T4AA 3IDYC 4N0UB 1DUYA 1NSNH 3P0VH 5I1LB 2AJXL 4Z78B 1B6DA 2W2QP 4JFHD 5C3TA 3UYRH 4F15B 2E9WA 4QYOB 1QFWI 1SBHA 1YPZF 1NUDA 4TYUA 3O45A 5KVMC 4X80L 3MYJB 4XXCC 1MHPH 5ICZB 4HAFA 4YJZL 2W2MP 4W6YB 5AUMB 3QISA 1CGVA 1R5VA 1JGVH 3WD5L 2AQ1A 3BGFC 4J8RA 3UTTD 5D6DC 3I6KB 4G42A 3S8WA 4L9LA 1QQDA 1UM4H 4HH9A 3PTLA 1EA7A 3CLFL 2OR9H 2UUDH 1LO4L 1LP9B 3NPZB 1VEPA 1Z9LA 3FQWA 5C3LD 3UROR 1NLDH 4HPOH 1ERNA 1FIGL 1ZHLB 4D0DA 3OV6A 5BMFL 4HBCL 3LAFA 4H25A 4P2OD 4Y19D 4PY8J 5IVOA 3G6JE 3X3GH 5I8KH 3VXME 4EOWL 4PIRF 1MCHA 4C4KT 2HH0H 2YEZB 2I5YH 2UY6A 3WFHB 4MSWB 1UVQB 2D7PA 2CMRH 3BH8A 4P3DA 3PGFL 4HGKC 1A0QH 1WAAF 1T4KA 5KOMC 5JXEC 5D70H 3DE3X 2FRGP 5BQ7A 5I17B 5DJZA 5FYJE 3EYOB 2R23B 2VL5B 4ETQB 1F8TH 3H9HB 4N0FB 2UWEA 3IVKA 3MBED 5DO2C 3OBAA 2V5YA 4BM7A 3SDXF 4JQXA 1P1ZB 1T0MB 3D39D 4P2RA 3NCJL 4JFDB 4ONFH 5K33A 3OXRB 4HF5H 3LKOA 1Z0NA 3VG9B 4WO4B 4LLDA 2NR6C 1KB9J 1T20B 5F1NA 5IHUH 3UTOA 2GW5A 1FN4B 1M71A 4E41D 3CAFA 1NCNA 4HKZA 4QHMB 3FOMB 1SCJA 3G6AB 2NZIA 4MJIB 1XGPA 3V52L 3CFEB 3U1SH 1IVLA 3QEHB 3VD5A 1FH5H 2AERT 1IAKA 3RA7L 1SVZA 1IQDB 3HG1E 2DMCA 1HYRC 3GBNL 4I5BA 3LKSB 1JZ4A 2ZWLT 1FZMB 1G7JB 2FCBA 4NFDA 4YQXH 4QXWA 1TJIL 5AZ2H 1OPGH 4FFYH 3T4AB 4Z2AA 4JDVB 4EEEA 1IGTA 4JFDE 2Y07L 4Y1AD 3MRKB 5JW4Q 2DJSA 3SDAD 2I9LA 5ADOH 2ZCHH 3UJTH 4LKCA 3MGOB 5HYEA 3PNWA 1HH9A 2NCMA 1GIGL 3ARDC 2DYPD 3OB8A 5F71A 1MQKH 1SBSL 5TE7L 4R7NA 4F3FB 4H26B 1FG2A 2P45B 3WDIA 1JHLH 1NCCH 5GGQL 5IR1A 3ARRA 1P7QA 4JFXA 3U1SL 3VXRE 2EYTA 3FRUB 2YK1H 2CK0L 4J3VA 3OGOE 4K2UH 4G6AD 2NW3B 2GYSA 3O41A 2R0ZH 4N0YH 1QA9A 3I6KA 2D0HA 2R2BA 3EOBA 5EO9A 4NDMB 1YNLH 3W9DA 1BF2A 3WIHH 5CP7B 1IC5L 5C0BE 4NO5B 2CRMA 4PJIA 2VRAA 4ZFZB 3SJVB 5I8EA 5ALBH 3RNQA 1EFXA 4BKLA 3MROA 3NGBB 4NBYB 4KV5E 3MJ6A 1MWAB 4MAYA 1K4DB 3EFDH 1V5IA 1WBZB 4ZUUB 4YBQD 4JN2B 1S02A 2IBZX 2JJSC 4RAUB 1PG7X 4F7TA 1G9MC 3BGMA 2KQMA 4OZHB 1T4KB 3SY0B 2IF7A 4X6DE 3O6LH 1G0YR 3CZJA 2XPGB 3IS1X 5F8RC 2E3VA 3CDFA 1OM3H 1WVZA 4XNUL 1CIDA 3S3JA 3KLAA 1IAOA 3SEPA 4E0RB 4HIIB 3GRWH 4QHUA 3SE3C 1B90A 1KB5H 4GAYA 3O9WB 3T3PF 2VIRA 5DHVB 4LHQB 2YPLD 1YDPB 5DJ8A 3GSUA 3QFJA 4HHAB 3BWAA 1HHJA 1N2RA 4G42B 5CINH 3U9UA 4WI3A 1KPRA 3KPRA 5ICYB 3WHXB 4U1MB 5KSAB 5ADOL 4BSWB 3D85A 2BVOA 4ZD3L 4KZEL 3C5JB 2JKXA 1A6TA 4TSBL 2WIMA 2UYLB 3BZFA 1FBIL 4L4VE 1ZS8B 4HCRL 4L8SA 5JHDB 3FO1B 4PRIA 3HC4H 3AY4A 4XXDA 1KIUA 1S9YA 1NBZA 4WUKH 1I4FB 4LEOB 1CFQA 1F3JA 3VGFA 2FD6L 2HLAA 1Q1JL 2YUZA 1GSMA 3JZ7A 5GS1B 1FLTX 1KTLB 3D25B 1YNLL 4UV7L 4NKIL 4P57A 5IQ7H 4U6VL 4NQDE 4OF0A 5EBGA 3QXTA 1L0XA 3O3EA 4K9EL 5JMOA 1BJ1J 3DX6A 3E6HA 1MFDL 1Y18A 3T1WA 3MRIB 2EDJA 1XH3B 4BZ2H 1NMCC 5BW7A 2BMKB 5D9SA 5I75B 3AMKA 1FRGH 4O2FB 5BXFB 3FT3B 4GRMA 1KGCE 1QA9B 2VLRA 1BVKB 2GJZA 4JQXC 4TSBH 4KGLA 1HEZA 4X6CF 3RI5F 3IF1A 3DE6X 1A14L 1I1AC 4JGJA 3TBTA 5F6IC 3ZYZA 3G5XA 5DMGC 1U8IA 1JNNL 3MGTB 4PD4J 4WY7H 5I18L 2Y7QB 2VQUA 3BMVA 2JB5L 4NZRL 3TIEB 1HYSD 3A3PB 3PDOA 3WN5A 3HNVH 4U4BA 3SDCA 1V5IB 2COQA 3WFEL 5BS0D 3EZJB 5E2WH 4U31A 1LK2A 3F65A 5F9DC 1UACL 1UBNA 2Z2ZA 1IFHL 3VXNA 2R0ZL 4KRNA 2IH3A 2R29H 1PSKL 1TXKA 4JR9H 3WFDH 1YUHA 4E5XB 4CVWA 5IQ9A 2X4PA 5E56A 3IU4L 3T08A 1NGYA 1XGYL 5SX4H 4JLRB 3RU8L 5L8KB 4GAYB 1BQHG 3DXAE 3LKQA 4OJFL 3EFDL 2J3SA 5JMRA 1NAMA 4ZOQI 2DQUH 4NM8H 2PWAA 1TQBC 1KLGB 4XGZB 4AEHL 1J0HA 2PUQT 2AABH 4AIOA 2CPCA 1JFQL 4J12A 1E4WH 3A6BH 4NC1E 5I17A 5KSUA 4CRPA 1KPRB 5HDQL 4WI2A 5L0QC 3Q6GH 5C07A 3QCTH 2TECE 2Q8AH 4N0FA 2G60H 2YD8A 4P99A 5FAAA 4UNUA 2R29L 4ZO6A 1TZGH 1DBJH 2Z31A 2X4NA 2HMIC 2CGRL 2YHGA 4NKIH 3GMLA 3MJ9H 1AE6L 3TIDA 3U2SB 2UV3A 4KGJA 2HFGL 4MAYB 3SGJC 4UB0H 1MHHA 2X10A 3BIKA 3JWDH 3O8XA 1NKRA 4MA7H 4DKEH 1MFAL 4KJQD 3MLPA 3VXSA 4MAYC 1HILB 5B38G 4UNVA 4XXDB 4KMTL 4P5TC 5HYSG 4A2LA 5C0BD 3ZTJH 5TPWL 4KJPC 1X5FA 2R39A 4HZLA 4M00A 4PJ8D 1FNSL 1C3LA 5BMFH 1YYLL 3BAEH 3FT2A 4Y2DD 1AJ7L 2H32A 4LHUG 1WVMA 5JR1L 3O6FC 5FV1L 2PCPB 1AXTH 4HBQA 4M5ZH 4DN3L 3BYYA 4X0KB 4JHZA 2R4RL 1YEDB 3DV4B 1O7SA 4LARL 5IMMA 4R2GD 1GGTA 3MXVL 4JKWA 3JWDL 4AT6A 4XPHL 5JNYA 3MO1A 1UACH 2VLKD 2L0DA 1XGQA 4CJ0A 1PY9A 3NGBC 4KKCC 1ZLWK 2DQCL 4YGVA 5IB1A 3TIEA 5E03A 1YA5A 3A3PA 2Q6WB 4UT9L 3SQOP 4LVNA 1D7FA 4LIQL 2ZG1A 4IS6A 3T8XB 3OJDA 3D6GA 3P0YH 3K4ZA 1FC1A 1MCLA 1EO8H 4FQCH 5FA4B 1BFKA 3OKOB 4K3DH 4XHQA 3BZFB 4ZTOL 1UM4L 3KPPB 1T7YA 1IEHA 1JNHB 3G08A 5ARBA 1TVDA 1IM3A 2YBRA 1ZEAL 5E8OB 2X70A 5F1IB 2AXHA 1B0WA 1T1XB 3P2TA 2W9LA 3PHSA 3O6KL 1NGYB 1OCWH 3HMXA 3AREA 3VV2A 4IRJB 5GGVH 4JN1L 5C0BA 5INCB 1S7RA 1CGSL 3C08H 5DHVH 2XTJB 1JP5A 4KRPC 3RTQC 1OAUL 5T1KD 1RULH 1E0OB 2A0LC 4MGXA 4OZHA 4PP1C 1UXSA 2G2RA 2XZZA 3NCBB 1KCSL 3PABB 3IT8D 1OTTD 1QFPA 5I0ZA 3WUWA 1K6QH 5KSAC 2VE6A 3UTSE 4JZOB 3MRHB 5AYUL 4ZFFB 1NCDL 1C16A 4XPGL 1SBSH 1F6LL 1RZ8A 5B4MD 1J1XL 3QT2A 1GAFH 2Z31B 3LPGA 3WJLA 2FR4A 4IHOA 15C8L 4G8GE 1TITA 4OCYH 3VXSB 12E8H 1K4CA 2JJTC 1HILA 5D7KE 5HYJB 5KS9A 4F37F 2AEPL 4Y4FD 3BWAB 3NCFB 1FAIH 2ZUYA 2OCFD 2DM4A 4DZBA 5DRNB 5HHPB 1DBBH 1IAVA 5EZIL 3WHXA 4TN9A 4U0RC 1D5MA 1CN4A 4NNPH 1FVCB 1AGDA 2APFA 3BX7C 2BNRB 3MRPB 4YX2H 4FXGB 3C5JA 5IEHA 1A5FL 2E1PA 4YHKL 2ZSWB 4DGVL 5DRZB 1R24A 2DLFL 4YZFE 2EDEA 6FABL 4TVPE 3U4AA 3L7FB 2Y9RT 1S9YB 1LO0H 3MC0A 1I4FA 5B38A 1A2QA 3GM0A 1ZWIB 3KPRD 5IJKA 4HQQL 3I2YX 3RWDB 2DLIA 2P5WB 1OHQA 4G8GA 2VL4A 3ULUH 1BMGA 3SDDA 1KELH 2ZJSH 1Q9OA 2VDOL 3S36H 1HQRA 4JM4L 3MLWL 3IJSB 4L5FH 3N1MC 5BZDB 5HDBF 2V7NB 2VLJB 3T1FA 3BP6B 2ZKHH 2EDYA 3B5TA 2MNUA 3S37H 3O8XB 2HRPH 1SJXA 5DURD 5DSCA 4OI7A 1AR1D 3LPDA 1REIA 3OJVC 3O8XC 4I4WA 2K9UA 2VITB 2Z8RA 4LAQL 1MEXL 4OKVA 2EO1A 2VR9A 35C8H 4XPHH 4ONHA 2P4AB 3SDCC 5AZEH 3EO1B 3LS5H 4KVCL 4NNYA 3FQNA 2HVJB 2OMBA 1AO7E 3QI9D 1KIQB 4FNLH 2WWMD 1BPVA 1V8HA 4LDLB 5D1ZC 4ESKA 4ZPTA 2C3WA 2PCPA 1A9EA 1AO7A 3O3AA 5EUOF 4WO4C 4NJAH 3WEXA 1KXVC 1LW6E 1HDMA 1KC5H 3ARVA 4B50A 1HN1A 1KF9B 3HC3L 3S88L 5C7XH 4QTHB 1P4BL 1MH5B 1CLOL 3BFOA 5E4IA 1U93B 2F53E 4OF6A 5IQ9B 3DYMA 5GJSL 4DKDC 2ICWB 2FX9H 1EHLH 2EDBA 2HKHH 3OKKA 1PYWA 3VJ6B 2FO4B 1RFDL 2R2HB 5F9OH 2D0FA 3RGVA 4PRHD 2OTWA 3TVMD 5I1DA 1H5BC 3PJSA 4Y5VB 1CFNB 4LVEA 1JPSH 1BZQK 5ICXB 2NY2C 1YNTB 1C5CH 4XBGA 5DD5H 1SUCA 4YHOH 3LEXB 4HIXH 5FECA 3HC0A 1MY5A 5I19L 2WIIB 2JB5H 4Y4HC 1U41A 1T1XA 2NZ9C 5D7JD 4N9GA 2R69L 3ETBF 1XR9B 3T2PA 3K3QA 4NGHL 1S7SB 5KSVB 1T2XA 1HIML 3EOTL 1TDQA 4LCCA 3BH8B 4OM1H 1N0LA 4M93B 4OMDA 3QPXL 4OCMC 1XGTB 2JJVA 1KE1A 4JR9L 1UXSB 2WP3O 3ZE2E 4HZLB 4QGTA 4RAVB 1N3NB 3L3HB 1S7QA 2ERJC 4TNWF 1ZT1A 5I15L 1RZ8B 4D0BB 4WV1A 3IFPA 1QKZL 1N0XH 2RB8A 1NCTA 4LASL 4MMZC 3TA3B 5D2LE 1CE6A 1RK0B 4KHTH 5DFVD 3WFCL 5E24E 4X9FA 3M17B 4JVPA 1JFQH 3AXLB 1MIML 4G6JH 5IBLD 5IW1B 3E3QC 3CNQP 5KS9B 2I60L 5HDQH 3MV8D 5JOFB 4CBPA 1JNJA 1KC5L 4PJ7E 3MOBL 2BVUA 1HI6A 4HKZB 5F9WB 4OZHE 4OLYH 3MNWB 5A2FA 5BVJB 4LVNB 2EIBA 4R3SA 3U7YL 5KVEL 3KPNA 5KVDH 3FAXA 5F89A 4Q9CA 5J6HA 5EC1A 4I5BB 1IQDA 3RTQB 2ZZUT