The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
183
|
sequence length |
671
|
structure length |
671
|
Chain Sequence |
SKAKDLASLPEIKSQGYHILFGELRDGEYTEGKILVGYNDRSEVDKIVKAVNGKVVLELPQIKVVSIKLNGMTVKQAYDKIKALALKGIRYVEPSYKRELIKPTVVKPNPDMYKIRKPGLNSTARDYGEELSNELWGLEAIGVTQQLWEEASGTNIIVAVVDTGVDGTHPDLEGQVIAGYRPAFDEELPAGTDSSYGGSAGTHVAGTIAAKKDGKGIVGVAPGAKIMPIVIFDDPALVGGNGYVGDDYVAAGIIWATDHGAKVMNHSWGGWGYSYTMKEAFDYAMEHGVVMVVSAGNNTSDSHHQYPAGYPGVIQVAALDYYGGTFRVAGFSSRSDGVSVGAPGVTILSTVPGEDSIGYEGHNENVPATNGGTYDYYQGTSMAAPHVTGVVAVLLQKFPNAKPWQIRKLLENTAFDFNGNGWDHDTGYGLVKLDAALQGPLPTQGGVEEFQVVVTDAKGNFGVPTVFVSMMRDNGSCYYAKTGPDGIARFPHIDSGTYDIFVGGPDHWDRALAPYDGESIPGGYAIALRMAEERQASFVGFGVSPDATQLNVNFNSTLQVKFSTNLSTLKDPQFVVVDPLLRGVYGRVAYARNQTYDLSLLSGQISFGIQTLLPAATDITIQGTVTLNGEDIPVYGVLKAGTTWTIIDDFGGLNLGTDSQPIYVWWTIFGQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of fervidolysin from Fervidobacterium pennivorans, a keratinolytic enzyme related to subtilisin.
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Fervidobacterium pennivorans
|
molecule keywords |
subtilisin-like serine protease
|
total genus |
183
|
structure length |
671
|
sequence length |
671
|
ec nomenclature | |
pdb deposition date | 2003-10-17 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00082 | Peptidase_S8 | Subtilase family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like | ||
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Peptidase S8 propeptide/proteinase inhibitor I9 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Peptidase S8/S53 domain |