1R76A

Structure of a pectate lyase from azospirillum irakense
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
408
structure length
384
Chain Sequence
AVIGMNEAASALTPSRVSSLPDTQRAAWQEYLARSEAQLSRDKASLAAELAPGQPLPPPPAEGKGADTMPLDKPAAWYTSKAARHVADVIVSFQTPAGGWGKNQPRDGALRLPGQHYTGENVAKVKRDRDWHYVGTIDNDATVTEIRFLAQVVSQLAPEEAAPYRDAALKGIEYLLASQFPNGGWPQVWPLEGGYHDAITYNDDALVHVAELLSDIAAGRDGFGFVPPAIRTRALEATNAAIHCIVETQVVQDGKRLGWGQQHDALTLRPTSARNFEPAALSSTESARILLFLMEIEAPSDAVKQAIRGGVAWLNTSVIRDQGAKPLWSRFYSLDGNKPVFGDRDKTIHDDVMGISQERRTGYAWYTTSPQKALSAFTKWEKRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pectate lyase
publication title Azospirillum irakense pectate lyase displays a toroidal fold.
pubmed doi rcsb
source organism Azospirillum irakense
molecule tags Lyase
total genus 119
structure length 384
sequence length 408
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2003-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09492 Pec_lyase Pectic acid lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1r76A00
1H3BA 2F0YB 1TNZB 3Q75B 2V8KA 4YDOB 4D4BA 4M76A 2WINB 1S64B 1GXNA 1D8EB 1KZOB 1GSZA 2IEJB 1O79A 1JCSB 3DRAB 3E37B 2G02A 2PN5A 1H36A 3DSXB 3DSUB 1C3DA 3HXCB 1TNYB 5FO8B 1X81B 3Q7AB 1DCEB 1O1SB 3Q7FB 4ZRPA 2H6IB 1MZCB 2V8JA 5FOBB 3G6JB 3HXDB 1QQFA 4D4DA 2GOXA 2H6GB 2G0DA 2XWBB 4BOJA 1GXMA 4V1RA 1H37A 1FPPB 3RJ3A 1GXOA 1QBQB 3SQCA 5JPMB 1W6KA 4EHMB 1O1TB 2NOJA 1LD7B 4YDEB 1N4PB 1TN8B 5JPNB 3KSQB 3KSLB 4KKIA 2H6HB 3EU5B 2SQCA 3D5RA 1N4RB 3HXBB 3OEDA 4MBGB 3PZ1B 1N9AB 2BB6A 3D5SA 1JCQB 1SA5B 1KZPB 4GTSB 1O6RA 2XWJB 2ZISB 1GHQA 4ZH1A 1N4SB 1TNUB 1O5MB 4GTVB 3E34B 3SFXB 2BEDB 4GTPB 2V8IA 3DSTB 5FO9B 4LNGB 3E33B 1NI1B 2V3NA 1LD8B 2BBCA 2WY8A 3OXUA 3Q73B 4FXGB 4C1SA 1FT2B 1H35A 1N94B 1TNOB 4D4AA 3KQ4A 4GTRB 4GTMB 1R76A 3KLSA 4LNVA 2ZIRB 2H6FB 4GTQB 1SQCA 3DSWB 3HXFB 1O6HA 4GTTB 4LNBB 2BB5A 1O6QA 4FXKB 2WIIB 1TNBB 1N4QB 3PZ3B 4L9PB 1NL4B 2B39A 3DSSB 1H3AA 1JCRB 3C72B 3K7XA 3DPYB 3CU7A 3EUVB 1TN6B 3Q78B 1SA4B 3Q79B 2A73B 1LTXB 1D8DB 1S63B 1QSJA 4D4CA 1H39A 4KKJA 3HXEB 4MU9A 1FT1B 3PZ2B 3PZ4B 2XQWA 2R2LB 4ONTA 3E30B 4ZRQA 2WY7A 1H3CA 2I07B 1UMPA 2PMVA 2V3PA 1W6JA 3DSVB 1O1RB 4BOKA 4V1SA 5AGDA 5FO7B 3SFYB 3E32B 4GTOB 4D94A 1TN7B 1N95B 1HZFA
chains in the Genus database with same CATH superfamily
3Q75B 1WU5A 1S64B 1GXNA 3CIHA 1LXMA 3GLYA 4MMIA 3DRAB 2RI8A 1G6IA 1LOHA 3A3VA 1C3DA 3TF4A 1TNYB 3H2WA 1FCEA 1JS4A 2ZBLA 1X81B 3Q7AB 1J0NA 1O1SB 3Q7FB 3SDVA 1CEMA 1HMWA 5EATA 1WU4A 5IKAA 5GW7A 4Z4LA 4FJQA 4D4DA 2G0DA 2XWBB 2FUZA 3WIQA 1H37A 1XWTA 4XUVA 3QT3A 1GXOA 5IK0A 1OJPA 1HN0A 3M7EA 2NVPA 3SDRA 3N0GA 3WKHA 1W6KA 1O1TB 2ONHA 4WVCA 3QSPA 1GAHA 3S4CA 5JPNB 1N7RA 1EGUA 3KSLB 3VXDA 5IL3A 3EU5B 3EU8A 1I8QA 3PZ1B 1HXAA 2D8LA 3D5SA 5KKBA 3P2CA 1GLMA 1G87A 3ON6A 2ZISB 1GHQA 1N4SB 1FBWA 4GTVB 3SFXB 2OKXA 3SAEA 4GTPB 2BRPA 5FO9B 3W5MA 1AYXA 2ZZRA 2BBCA 2Z07A 1H35A 1TNOB 1F9GA 3W7XA 1OJMA 2CQTA 3QT9A 2GZ6A 4GTTB 2D5JA 1ULVA 4FXKB 1TNBB 2RGKA 3PZ3B 4DOEA 3ANKA 2QNOA 1QAZA 3CU7A 1TN6B 1SA4B 2FBAA 2E22A 4F10A 2VN7A 1HV6A 4D4CA 3G4FA 1H12A 1DL2A 3HXEB 3PZ2B 3E30B 2DROA 2I07B 2EACA 1KSDA 1KS8A 2PMVA 3LZ9A 1N22A 3M7CA 3DSVB 4BOKA 5M7IA 5FO7B 3E32B 5DHIA 1NC5A 3S4DA 1FO3A 1N95B 1AGMA 4YDEB 3W5NA 3E7JA 1TNZB 2V8KA 4YDOB 2WINB 1KZOB 5JMDA 5DHKA 1RQ5A 2JG0A 3DSXB 2EADA 1KKTA 1KFGA 1X1HA 1RW9A 3P5PA 2E24A 4E1YA 1N1BA 5IM1A 4ZRPA 1MZCB 2V8JA 3E6UA 5FOBB 3RENA 2GOXA 2XFGA 1GXMA 2YIKA 4V1RA 5ILKA 1G9GA 4WU0A 5ILJA 2AHGA 1QBQB 3SQCA 5JPMB 4EL8A 3EQAA 2FV0A 5ILIA 4AYQA 3WKFA 1K72A 5CZLA 3AFJA 3WKGA 2NOJA 3GT5A 4DODA 3W7SA 1TN8B 3S4BA 3KSQB 1VD5A 1RWFA 4TF4A 1N9AB 3M73A 1SA5B 4OK2A 1RWHA 4GTSB 3QFZA 3GZKA 1O6RA 2XWJB 1F9OA 4GAXA 3VSNA 4NEIA 1WU6A 2B4FA 4F13A 2BEDB 3DSTB 3VW5A 4WVAA 1LD8B 2WY8A 3OXUA 4GL3A 1FT2B 5IKHA 1N94B 5DGRA 4L6XA 3S9VA 4D4AA 4GTRB 5C05A 1N7PA 4LNVA 1V5DA 1KRFA 1RWAA 2H6FB 3SDTA 1V7VA 4GTQB 3W7TA 3DSWB 3M76A 3WC3A 2AHFA 5CD2A 3P5RA 1KWFA 2ONGA 1IA6A 3M77A 3ANJA 5EASA 4TXTA 3WIRA 1H3AA 1CB8A 3WIWA 1HCUA 2BRVX 3M75A 1N1ZA 3M72A 1N24A 1V7WA 3PZ4B 1X9DA 1W6JA 1OJOA 1FAEA 1GA2A 1HXCA 1H14A 1TF4A 1LXKA 1UT9A 1TN7B 1HZFA 1H3BA 2F0YB 4J5TA 1V7XA 5M7YA 1D8EB 1FP3A 3W7WA 1O79A 1HX9A 1H36A 3N0FA 3HXCB 3M02A 3H3KA 1RWCA 1DCEB 1N23A 2JF4A 1FBOA 1LF6A 2H6IB 2X03A 1W3YA 2FUTA 3HXDB 4LIXA 4BOJA 1FPPB 1IA7A 1N7OA 3M74A 5ILYA 1RWGA 4AYRA 3E80A 3QXQA 4FNVA 3NFVA 3QG0A 4MMHA 4EHMB 1L1YA 3WUXA 1N4PB 2RI9A 4KKIA 3D5RA 3PYAA 1N21A 3ACSA 3OEDA 4MBGB 2BB6A 5EAUA 2FUQA 1XWQA 3X17A 5MEHA 4JJJA 2BRWA 4KTPA 2EABA 3A0OA 4OZWA 1TNUB 1O5MB 5IK6A 3QFYA 4Z4JA 1N7NA 1N7QA 3S4AA 1F1SA 5CA3A 4LNGB 3E33B 1NI1B 2V3NA 4FXGB 4AYOA 4Q2BA 1R76A 3KLSA 1IS9A 2ZIRB 3PYBA 1J0MA 1SQCA 3HXFB 1O6HA 4LNBB 2BB5A 5ILDA 2DRSA 5JMFA 2WIIB 3EZ8A 1HMUA 1CLCA 1NL4B 1V5CA 1FMIA 2EAEA 3C72B 1OJNA 3D3IA 3K11A 4AYPA 2FV1A 3EUVB 3Q78B 3Q79B 3E73A 2VN4A 2A73B 5DGQA 1WZZA 3QRYA 1N20A 1HXGA 1F9DA 1X1JA 3ACTA 5ILZA 4OK4A 1FT1B 1HM2A 4L0GA 4OJZA 4ONTA 5ILHA 3QPFA 2WY7A 1H3CA 1UMPA 2GH4A 1NXCA 2WCOA 1FO2A 1O1RB 1H54A 4V1SA 3SFYB 2WYNA 2DRRA 4GTOB 3M7BA 4YCRA 1H13A 4D4BA 4M76A 3RX5A 3W7UA 3VSMA 3M71A 1L2AA 1GSZA 2IEJB 3M7LA 2JJBA 1JCSB 3E37B 2G02A 2PN5A 4WVBA 3DSUB 5FO8B 4CJ1A 3G4DA 4QT9A 1XW2A 3G6JB 5GZKA 1QQFA 2H6GB 3M78A 3RJ3A 3ANIA 3QWTA 5GY3A 1GAIA 1G9JA 3QDEA 1KREA 2F6DA 3H7LA 2CQSA 1LD7B 3SDQA 4Q88A 5IL8A 3AFLA 2H6HB 3M00A 2SQCA 1N4RB 3HXBB 2A8ZA 1JCQB 2J5CA 3RRSA 4ZH5A 5E2JA 1KZPB 2Q1FA 4ZH1A 1C82A 3E34B 4RNQA 2V8IA 3T33A 3Q73B 3QXFA 4C1SA 2P0VA 5IK9A 1UG9A 2AFAA 3KQ4A 4GTMB 4FUSA 1O6QA 3RX8A 1N4QB 2DRQA 4L9PB 2B39A 3DSSB 4CE7A 1JCRB 3K7XA 4CJ0A 3DPYB 3PMMA 4KTRA 4DI5A 3NNBA 1LTXB 1HM3A 1LF9A 1D8DB 1S63B 1QSJA 3SDUA 1H39A 4KKJA 3M01A 4MU9A 4ZRQA 2XQWA 2R2LB 3RSYA 4ZG8A 1DOGA 1X1IA 1KSCA 2V3PA 3WKIA 5AGDA 3RX7A 4D94A 4OZVA 2WDAA
chains in the Genus database with same CATH topology
3Q75B 1WU5A 1S64B 1GXNA 3CIHA 3GLYA 3DRAB 2RI8A 1G6IA 3A3VA 1C3DA 3TF4A 1TNYB 3H2WA 1FCEA 1JS4A 2ZBLA 1X81B 3Q7AB 1O1SB 3Q7FB 3SDVA 1CEMA 1WU4A 5GW7A 4Z4LA 4D4DA 2G0DA 2XWBB 2FUZA 3WIQA 1H37A 1XWTA 4XUVA 3QT3A 1GXOA 3M7EA 2NVPA 3SDRA 3WKHA 1W6KA 1O1TB 4WVCA 3QSPA 1GAHA 3S4CA 5JPNB 3KSLB 3VXDA 3EU5B 3EU8A 3PZ1B 2D8LA 3D5SA 5KKBA 3P2CA 1GLMA 1G87A 3ON6A 2ZISB 1GHQA 1N4SB 1FBWA 4GTVB 3SFXB 2OKXA 3SAEA 4GTPB 3W5MA 5FO9B 1AYXA 2ZZRA 2BBCA 2Z07A 1H35A 1TNOB 3W7XA 2CQTA 3QT9A 2GZ6A 4GTTB 2D5JA 1ULVA 4FXKB 1TNBB 2RGKA 3PZ3B 4DOEA 3ANKA 2QNOA 3CU7A 1TN6B 1SA4B 2FBAA 2VN7A 4D4CA 1H12A 1DL2A 3HXEB 3PZ2B 3E30B 2DROA 2I07B 2EACA 1KSDA 1KS8A 2PMVA 3M7CA 3DSVB 4BOKA 5M7IA 5FO7B 3E32B 1NC5A 3S4DA 1FO3A 1N95B 1AGMA 4YDEB 3W5NA 1TNZB 2V8KA 4YDOB 2WINB 1KZOB 1RQ5A 2JG0A 3DSXB 2EADA 1KKTA 1KFGA 3P5PA 4ZRPA 1MZCB 2V8JA 3E6UA 5FOBB 3RENA 2GOXA 2XFGA 1GXMA 2YIKA 4V1RA 1G9GA 4WU0A 2AHGA 1QBQB 3SQCA 5JPMB 4EL8A 3EQAA 2FV0A 4AYQA 3WKFA 1K72A 5CZLA 3AFJA 3WKGA 2NOJA 3GT5A 4DODA 3W7SA 1TN8B 3S4BA 3KSQB 1VD5A 4TF4A 1N9AB 3M73A 1SA5B 4GTSB 3QFZA 3GZKA 1O6RA 2XWJB 1F9OA 1WU6A 2B4FA 2BEDB 3DSTB 3VW5A 4WVAA 1LD8B 2WY8A 4GL3A 3OXUA 1FT2B 1N94B 5DGRA 4L6XA 3S9VA 4D4AA 4GTRB 4LNVA 1V5DA 1KRFA 2H6FB 3SDTA 1V7VA 4GTQB 3W7TA 3DSWB 3M76A 3WC3A 2AHFA 5CD2A 3P5RA 1KWFA 1IA6A 3M77A 3ANJA 4TXTA 3WIRA 1H3AA 3WIWA 1HCUA 3M75A 3M72A 1V7WA 3PZ4B 1X9DA 1W6JA 1FAEA 1GA2A 1H14A 1TF4A 1UT9A 1TN7B 1HZFA 1H3BA 2F0YB 4J5TA 1V7XA 5M7YA 1D8EB 1FP3A 3W7WA 1O79A 1H36A 3HXCB 3H3KA 1DCEB 2JF4A 1FBOA 1LF6A 2H6IB 3HXDB 4LIXA 4BOJA 1FPPB 1IA7A 3M74A 4AYRA 3QXQA 3QG0A 4EHMB 1L1YA 3WUXA 1N4PB 2RI9A 4KKIA 3D5RA 3PYAA 3ACSA 3OEDA 4MBGB 2BB6A 1XWQA 3X17A 5MEHA 4JJJA 4KTPA 2EABA 1TNUB 1O5MB 3QFYA 4Z4JA 3S4AA 5CA3A 4LNGB 3E33B 1NI1B 2V3NA 4FXGB 4AYOA 4Q2BA 1R76A 3KLSA 1IS9A 2ZIRB 3PYBA 1SQCA 3HXFB 1O6HA 4LNBB 2BB5A 2DRSA 2WIIB 3EZ8A 1CLCA 1NL4B 1V5CA 1FMIA 2EAEA 3C72B 3D3IA 3K11A 4AYPA 2FV1A 3EUVB 3Q78B 3Q79B 3E73A 2VN4A 2A73B 5DGQA 1WZZA 3QRYA 1F9DA 3ACTA 1FT1B 4L0GA 4ONTA 3QPFA 2WY7A 1H3CA 1UMPA 2GH4A 1NXCA 1FO2A 1O1RB 1H54A 4V1SA 3SFYB 2WYNA 2DRRA 4GTOB 3M7BA 4YCRA 1H13A 4D4BA 4M76A 3RX5A 3W7UA 3M71A 1L2AA 1GSZA 2IEJB 3M7LA 2JJBA 1JCSB 3E37B 2G02A 2PN5A 4WVBA 3DSUB 5FO8B 4CJ1A 4QT9A 1XW2A 3G6JB 5GZKA 1QQFA 2H6GB 3M78A 3RJ3A 3ANIA 3QWTA 5GY3A 1GAIA 1G9JA 3QDEA 1KREA 2F6DA 3H7LA 2CQSA 1LD7B 3SDQA 4Q88A 2H6HB 2SQCA 1N4RB 3HXBB 2A8ZA 1JCQB 3RRSA 4ZH5A 5E2JA 1KZPB 4ZH1A 3E34B 2V8IA 3T33A 3Q73B 3QXFA 4C1SA 2P0VA 1UG9A 2AFAA 3KQ4A 4GTMB 4FUSA 1O6QA 3RX8A 1N4QB 2DRQA 4L9PB 2B39A 3DSSB 4CE7A 3K7XA 1JCRB 4CJ0A 3DPYB 3PMMA 4KTRA 1LTXB 1LF9A 1D8DB 1S63B 1QSJA 3SDUA 1H39A 4KKJA 4MU9A 4ZRQA 2XQWA 2R2LB 3RSYA 4ZG8A 1DOGA 1KSCA 2V3PA 3WKIA 5AGDA 3RX7A 4D94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H3B A;  2F0Y B;  1TNZ B;  3Q75 B;  2V8K A;  4YDO B;  4D4B A;  4M76 A;  2WIN B;  1S64 B;  1GXN A;  1D8E B;  1KZO B;  1GSZ A;  2IEJ B;  1O79 A;  1JCS B;  3DRA B;  3E37 B;  2G02 A;  2PN5 A;  1H36 A;  3DSX B;  3DSU B;  1C3D A;  3HXC B;  1TNY B;  5FO8 B;  1X81 B;  3Q7A B;  1DCE B;  1O1S B;  3Q7F B;  4ZRP A;  2H6I B;  1MZC B;  2V8J A;  5FOB B;  3G6J B;  3HXD B;  1QQF A;  4D4D A;  2GOX A;  2H6G B;  2G0D A;  2XWB B;  4BOJ A;  1GXM A;  4V1R A;  1H37 A;  1FPP B;  3RJ3 A;  1GXO A;  1QBQ B;  3SQC A;  5JPM B;  1W6K A;  4EHM B;  1O1T B;  2NOJ A;  1LD7 B;  4YDE B;  1N4P B;  1TN8 B;  5JPN B;  3KSQ B;  3KSL B;  4KKI A;  2H6H B;  3EU5 B;  2SQC A;  3D5R A;  1N4R B;  3HXB B;  3OED A;  4MBG B;  3PZ1 B;  1N9A B;  2BB6 A;  3D5S A;  1JCQ B;  1SA5 B;  1KZP B;  4GTS B;  1O6R A;  2XWJ B;  2ZIS B;  1GHQ A;  4ZH1 A;  1N4S B;  1TNU B;  1O5M B;  4GTV B;  3E34 B;  3SFX B;  2BED B;  4GTP B;  2V8I A;  3DST B;  5FO9 B;  4LNG B;  3E33 B;  1NI1 B;  2V3N A;  1LD8 B;  2BBC A;  2WY8 A;  3OXU A;  3Q73 B;  4FXG B;  4C1S A;  1FT2 B;  1H35 A;  1N94 B;  1TNO B;  4D4A A;  3KQ4 A;  4GTR B;  4GTM B;  1R76 A;  3KLS A;  4LNV A;  2ZIR B;  2H6F B;  4GTQ B;  1SQC A;  3DSW B;  3HXF B;  1O6H A;  4GTT B;  4LNB B;  2BB5 A;  1O6Q A;  4FXK B;  2WII B;  1TNB B;  1N4Q B;  3PZ3 B;  4L9P B;  1NL4 B;  2B39 A;  3DSS B;  1H3A A;  1JCR B;  3C72 B;  3K7X A;  3DPY B;  3CU7 A;  3EUV B;  1TN6 B;  3Q78 B;  1SA4 B;  3Q79 B;  2A73 B;  1LTX B;  1D8D B;  1S63 B;  1QSJ A;  4D4C A;  1H39 A;  4KKJ A;  3HXE B;  4MU9 A;  1FT1 B;  3PZ2 B;  3PZ4 B;  2XQW A;  2R2L B;  4ONT A;  3E30 B;  4ZRQ A;  2WY7 A;  1H3C A;  2I07 B;  1UMP A;  2PMV A;  2V3P A;  1W6J A;  3DSV B;  1O1R B;  4BOK A;  4V1S A;  5AGD A;  5FO7 B;  3SFY B;  3E32 B;  4GTO B;  4D94 A;  1TN7 B;  1N95 B;  1HZF A; 
#chains in the Genus database with same CATH topology
 3Q75 B;  1WU5 A;  1S64 B;  1GXN A;  3CIH A;  1LXM A;  3GLY A;  4MMI A;  3DRA B;  2RI8 A;  1G6I A;  1LOH A;  3A3V A;  1C3D A;  3TF4 A;  1TNY B;  3H2W A;  1FCE A;  1JS4 A;  2ZBL A;  1X81 B;  3Q7A B;  1J0N A;  1O1S B;  3Q7F B;  3SDV A;  1CEM A;  1HMW A;  5EAT A;  1WU4 A;  5IKA A;  5GW7 A;  4Z4L A;  4FJQ A;  4D4D A;  2G0D A;  2XWB B;  2FUZ A;  3WIQ A;  1H37 A;  1XWT A;  4XUV A;  3QT3 A;  1GXO A;  5IK0 A;  1OJP A;  1HN0 A;  3M7E A;  2NVP A;  3SDR A;  3N0G A;  3WKH A;  1W6K A;  1O1T B;  2ONH A;  4WVC A;  3QSP A;  1GAH A;  3S4C A;  5JPN B;  1N7R A;  1EGU A;  3KSL B;  3VXD A;  5IL3 A;  3EU5 B;  3EU8 A;  1I8Q A;  3PZ1 B;  1HXA A;  2D8L A;  3D5S A;  5KKB A;  3P2C A;  1GLM A;  1G87 A;  3ON6 A;  2ZIS B;  1GHQ A;  1N4S B;  1FBW A;  4GTV B;  3SFX B;  2OKX A;  3SAE A;  4GTP B;  2BRP A;  5FO9 B;  3W5M A;  1AYX A;  2ZZR A;  2BBC A;  2Z07 A;  1H35 A;  1TNO B;  1F9G A;  3W7X A;  1OJM A;  2CQT A;  3QT9 A;  2GZ6 A;  4GTT B;  2D5J A;  1ULV A;  4FXK B;  1TNB B;  2RGK A;  3PZ3 B;  4DOE A;  3ANK A;  2QNO A;  1QAZ A;  3CU7 A;  1TN6 B;  1SA4 B;  2FBA A;  2E22 A;  4F10 A;  2VN7 A;  1HV6 A;  4D4C A;  3G4F A;  1H12 A;  1DL2 A;  3HXE B;  3PZ2 B;  3E30 B;  2DRO A;  2I07 B;  2EAC A;  1KSD A;  1KS8 A;  2PMV A;  3LZ9 A;  1N22 A;  3M7C A;  3DSV B;  4BOK A;  5M7I A;  5FO7 B;  3E32 B;  5DHI A;  1NC5 A;  3S4D A;  1FO3 A;  1N95 B;  1AGM A;  4YDE B;  3W5N A;  3E7J A;  1TNZ B;  2V8K A;  4YDO B;  2WIN B;  1KZO B;  5JMD A;  5DHK A;  1RQ5 A;  2JG0 A;  3DSX B;  2EAD A;  1KKT A;  1KFG A;  1X1H A;  1RW9 A;  3P5P A;  2E24 A;  4E1Y A;  1N1B A;  5IM1 A;  4ZRP A;  1MZC B;  2V8J A;  3E6U A;  5FOB B;  3REN A;  2GOX A;  2XFG A;  1GXM A;  2YIK A;  4V1R A;  5ILK A;  1G9G A;  4WU0 A;  5ILJ A;  2AHG A;  1QBQ B;  3SQC A;  5JPM B;  4EL8 A;  3EQA A;  2FV0 A;  5ILI A;  4AYQ A;  3WKF A;  1K72 A;  5CZL A;  3AFJ A;  3WKG A;  2NOJ A;  3GT5 A;  4DOD A;  3W7S A;  1TN8 B;  3S4B A;  3KSQ B;  1VD5 A;  1RWF A;  4TF4 A;  1N9A B;  3M73 A;  1SA5 B;  4OK2 A;  1RWH A;  4GTS B;  3QFZ A;  3GZK A;  1O6R A;  2XWJ B;  1F9O A;  4GAX A;  3VSN A;  4NEI A;  1WU6 A;  2B4F A;  4F13 A;  2BED B;  3DST B;  3VW5 A;  4WVA A;  1LD8 B;  2WY8 A;  3OXU A;  4GL3 A;  1FT2 B;  5IKH A;  1N94 B;  5DGR A;  4L6X A;  3S9V A;  4D4A A;  4GTR B;  5C05 A;  1N7P A;  4LNV A;  1V5D A;  1KRF A;  1RWA A;  2H6F B;  3SDT A;  1V7V A;  4GTQ B;  3W7T A;  3DSW B;  3M76 A;  3WC3 A;  2AHF A;  5CD2 A;  3P5R A;  1KWF A;  2ONG A;  1IA6 A;  3M77 A;  3ANJ A;  5EAS A;  4TXT A;  3WIR A;  1H3A A;  1CB8 A;  3WIW A;  1HCU A;  2BRV X;  3M75 A;  1N1Z A;  3M72 A;  1N24 A;  1V7W A;  3PZ4 B;  1X9D A;  1W6J A;  1OJO A;  1FAE A;  1GA2 A;  1HXC A;  1H14 A;  1TF4 A;  1LXK A;  1UT9 A;  1TN7 B;  1HZF A;  1H3B A;  2F0Y B;  4J5T A;  1V7X A;  5M7Y A;  1D8E B;  1FP3 A;  3W7W A;  1O79 A;  1HX9 A;  1H36 A;  3N0F A;  3HXC B;  3M02 A;  3H3K A;  1RWC A;  1DCE B;  1N23 A;  2JF4 A;  1FBO A;  1LF6 A;  2H6I B;  2X03 A;  1W3Y A;  2FUT A;  3HXD B;  4LIX A;  4BOJ A;  1FPP B;  1IA7 A;  1N7O A;  3M74 A;  5ILY A;  1RWG A;  4AYR A;  3E80 A;  3QXQ A;  4FNV A;  3NFV A;  3QG0 A;  4MMH A;  4EHM B;  1L1Y A;  3WUX A;  1N4P B;  2RI9 A;  4KKI A;  3D5R A;  3PYA A;  1N21 A;  3ACS A;  3OED A;  4MBG B;  2BB6 A;  5EAU A;  2FUQ A;  1XWQ A;  3X17 A;  5MEH A;  4JJJ A;  2BRW A;  4KTP A;  2EAB A;  3A0O A;  4OZW A;  1TNU B;  1O5M B;  5IK6 A;  3QFY A;  4Z4J A;  1N7N A;  1N7Q A;  3S4A A;  1F1S A;  5CA3 A;  4LNG B;  3E33 B;  1NI1 B;  2V3N A;  4FXG B;  4AYO A;  4Q2B A;  1R76 A;  3KLS A;  1IS9 A;  2ZIR B;  3PYB A;  1J0M A;  1SQC A;  3HXF B;  1O6H A;  4LNB B;  2BB5 A;  5ILD A;  2DRS A;  5JMF A;  2WII B;  3EZ8 A;  1HMU A;  1CLC A;  1NL4 B;  1V5C A;  1FMI A;  2EAE A;  3C72 B;  1OJN A;  3D3I A;  3K11 A;  4AYP A;  2FV1 A;  3EUV B;  3Q78 B;  3Q79 B;  3E73 A;  2VN4 A;  2A73 B;  5DGQ A;  1WZZ A;  3QRY A;  1N20 A;  1HXG A;  1F9D A;  1X1J A;  3ACT A;  5ILZ A;  4OK4 A;  1FT1 B;  1HM2 A;  4L0G A;  4OJZ A;  4ONT A;  5ILH A;  3QPF A;  2WY7 A;  1H3C A;  1UMP A;  2GH4 A;  1NXC A;  2WCO A;  1FO2 A;  1O1R B;  1H54 A;  4V1S A;  3SFY B;  2WYN A;  2DRR A;  4GTO B;  3M7B A;  4YCR A;  1H13 A;  4D4B A;  4M76 A;  3RX5 A;  3W7U A;  3VSM A;  3M71 A;  1L2A A;  1GSZ A;  2IEJ B;  3M7L A;  2JJB A;  1JCS B;  3E37 B;  2G02 A;  2PN5 A;  4WVB A;  3DSU B;  5FO8 B;  4CJ1 A;  3G4D A;  4QT9 A;  1XW2 A;  3G6J B;  5GZK A;  1QQF A;  2H6G B;  3M78 A;  3RJ3 A;  3ANI A;  3QWT A;  5GY3 A;  1GAI A;  1G9J A;  3QDE A;  1KRE A;  2F6D A;  3H7L A;  2CQS A;  1LD7 B;  3SDQ A;  4Q88 A;  5IL8 A;  3AFL A;  2H6H B;  3M00 A;  2SQC A;  1N4R B;  3HXB B;  2A8Z A;  1JCQ B;  2J5C A;  3RRS A;  4ZH5 A;  5E2J A;  1KZP B;  2Q1F A;  4ZH1 A;  1C82 A;  3E34 B;  4RNQ A;  2V8I A;  3T33 A;  3Q73 B;  3QXF A;  4C1S A;  2P0V A;  5IK9 A;  1UG9 A;  2AFA A;  3KQ4 A;  4GTM B;  4FUS A;  1O6Q A;  3RX8 A;  1N4Q B;  2DRQ A;  4L9P B;  2B39 A;  3DSS B;  4CE7 A;  1JCR B;  3K7X A;  4CJ0 A;  3DPY B;  3PMM A;  4KTR A;  4DI5 A;  3NNB A;  1LTX B;  1HM3 A;  1LF9 A;  1D8D B;  1S63 B;  1QSJ A;  3SDU A;  1H39 A;  4KKJ A;  3M01 A;  4MU9 A;  4ZRQ A;  2XQW A;  2R2L B;  3RSY A;  4ZG8 A;  1DOG A;  1X1I A;  1KSC A;  2V3P A;  3WKI A;  5AGD A;  3RX7 A;  4D94 A;  4OZV A;  2WDA A; 
#chains in the Genus database with same CATH homology
 3Q75 B;  1WU5 A;  1S64 B;  1GXN A;  3CIH A;  3GLY A;  3DRA B;  2RI8 A;  1G6I A;  3A3V A;  1C3D A;  3TF4 A;  1TNY B;  3H2W A;  1FCE A;  1JS4 A;  2ZBL A;  1X81 B;  3Q7A B;  1O1S B;  3Q7F B;  3SDV A;  1CEM A;  1WU4 A;  5GW7 A;  4Z4L A;  4D4D A;  2G0D A;  2XWB B;  2FUZ A;  3WIQ A;  1H37 A;  1XWT A;  4XUV A;  3QT3 A;  1GXO A;  3M7E A;  2NVP A;  3SDR A;  3WKH A;  1W6K A;  1O1T B;  4WVC A;  3QSP A;  1GAH A;  3S4C A;  5JPN B;  3KSL B;  3VXD A;  3EU5 B;  3EU8 A;  3PZ1 B;  2D8L A;  3D5S A;  5KKB A;  3P2C A;  1GLM A;  1G87 A;  3ON6 A;  2ZIS B;  1GHQ A;  1N4S B;  1FBW A;  4GTV B;  3SFX B;  2OKX A;  3SAE A;  4GTP B;  3W5M A;  5FO9 B;  1AYX A;  2ZZR A;  2BBC A;  2Z07 A;  1H35 A;  1TNO B;  3W7X A;  2CQT A;  3QT9 A;  2GZ6 A;  4GTT B;  2D5J A;  1ULV A;  4FXK B;  1TNB B;  2RGK A;  3PZ3 B;  4DOE A;  3ANK A;  2QNO A;  3CU7 A;  1TN6 B;  1SA4 B;  2FBA A;  2VN7 A;  4D4C A;  1H12 A;  1DL2 A;  3HXE B;  3PZ2 B;  3E30 B;  2DRO A;  2I07 B;  2EAC A;  1KSD A;  1KS8 A;  2PMV A;  3M7C A;  3DSV B;  4BOK A;  5M7I A;  5FO7 B;  3E32 B;  1NC5 A;  3S4D A;  1FO3 A;  1N95 B;  1AGM A;  4YDE B;  3W5N A;  1TNZ B;  2V8K A;  4YDO B;  2WIN B;  1KZO B;  1RQ5 A;  2JG0 A;  3DSX B;  2EAD A;  1KKT A;  1KFG A;  3P5P A;  4ZRP A;  1MZC B;  2V8J A;  3E6U A;  5FOB B;  3REN A;  2GOX A;  2XFG A;  1GXM A;  2YIK A;  4V1R A;  1G9G A;  4WU0 A;  2AHG A;  1QBQ B;  3SQC A;  5JPM B;  4EL8 A;  3EQA A;  2FV0 A;  4AYQ A;  3WKF A;  1K72 A;  5CZL A;  3AFJ A;  3WKG A;  2NOJ A;  3GT5 A;  4DOD A;  3W7S A;  1TN8 B;  3S4B A;  3KSQ B;  1VD5 A;  4TF4 A;  1N9A B;  3M73 A;  1SA5 B;  4GTS B;  3QFZ A;  3GZK A;  1O6R A;  2XWJ B;  1F9O A;  1WU6 A;  2B4F A;  2BED B;  3DST B;  3VW5 A;  4WVA A;  1LD8 B;  2WY8 A;  4GL3 A;  3OXU A;  1FT2 B;  1N94 B;  5DGR A;  4L6X A;  3S9V A;  4D4A A;  4GTR B;  4LNV A;  1V5D A;  1KRF A;  2H6F B;  3SDT A;  1V7V A;  4GTQ B;  3W7T A;  3DSW B;  3M76 A;  3WC3 A;  2AHF A;  5CD2 A;  3P5R A;  1KWF A;  1IA6 A;  3M77 A;  3ANJ A;  4TXT A;  3WIR A;  1H3A A;  3WIW A;  1HCU A;  3M75 A;  3M72 A;  1V7W A;  3PZ4 B;  1X9D A;  1W6J A;  1FAE A;  1GA2 A;  1H14 A;  1TF4 A;  1UT9 A;  1TN7 B;  1HZF A;  1H3B A;  2F0Y B;  4J5T A;  1V7X A;  5M7Y A;  1D8E B;  1FP3 A;  3W7W A;  1O79 A;  1H36 A;  3HXC B;  3H3K A;  1DCE B;  2JF4 A;  1FBO A;  1LF6 A;  2H6I B;  3HXD B;  4LIX A;  4BOJ A;  1FPP B;  1IA7 A;  3M74 A;  4AYR A;  3QXQ A;  3QG0 A;  4EHM B;  1L1Y A;  3WUX A;  1N4P B;  2RI9 A;  4KKI A;  3D5R A;  3PYA A;  3ACS A;  3OED A;  4MBG B;  2BB6 A;  1XWQ A;  3X17 A;  5MEH A;  4JJJ A;  4KTP A;  2EAB A;  1TNU B;  1O5M B;  3QFY A;  4Z4J A;  3S4A A;  5CA3 A;  4LNG B;  3E33 B;  1NI1 B;  2V3N A;  4FXG B;  4AYO A;  4Q2B A;  1R76 A;  3KLS A;  1IS9 A;  2ZIR B;  3PYB A;  1SQC A;  3HXF B;  1O6H A;  4LNB B;  2BB5 A;  2DRS A;  2WII B;  3EZ8 A;  1CLC A;  1NL4 B;  1V5C A;  1FMI A;  2EAE A;  3C72 B;  3D3I A;  3K11 A;  4AYP A;  2FV1 A;  3EUV B;  3Q78 B;  3Q79 B;  3E73 A;  2VN4 A;  2A73 B;  5DGQ A;  1WZZ A;  3QRY A;  1F9D A;  3ACT A;  1FT1 B;  4L0G A;  4ONT A;  3QPF A;  2WY7 A;  1H3C A;  1UMP A;  2GH4 A;  1NXC A;  1FO2 A;  1O1R B;  1H54 A;  4V1S A;  3SFY B;  2WYN A;  2DRR A;  4GTO B;  3M7B A;  4YCR A;  1H13 A;  4D4B A;  4M76 A;  3RX5 A;  3W7U A;  3M71 A;  1L2A A;  1GSZ A;  2IEJ B;  3M7L A;  2JJB A;  1JCS B;  3E37 B;  2G02 A;  2PN5 A;  4WVB A;  3DSU B;  5FO8 B;  4CJ1 A;  4QT9 A;  1XW2 A;  3G6J B;  5GZK A;  1QQF A;  2H6G B;  3M78 A;  3RJ3 A;  3ANI A;  3QWT A;  5GY3 A;  1GAI A;  1G9J A;  3QDE A;  1KRE A;  2F6D A;  3H7L A;  2CQS A;  1LD7 B;  3SDQ A;  4Q88 A;  2H6H B;  2SQC A;  1N4R B;  3HXB B;  2A8Z A;  1JCQ B;  3RRS A;  4ZH5 A;  5E2J A;  1KZP B;  4ZH1 A;  3E34 B;  2V8I A;  3T33 A;  3Q73 B;  3QXF A;  4C1S A;  2P0V A;  1UG9 A;  2AFA A;  3KQ4 A;  4GTM B;  4FUS A;  1O6Q A;  3RX8 A;  1N4Q B;  2DRQ A;  4L9P B;  2B39 A;  3DSS B;  4CE7 A;  3K7X A;  1JCR B;  4CJ0 A;  3DPY B;  3PMM A;  4KTR A;  1LTX B;  1LF9 A;  1D8D B;  1S63 B;  1QSJ A;  3SDU A;  1H39 A;  4KKJ A;  4MU9 A;  4ZRQ A;  2XQW A;  2R2L B;  3RSY A;  4ZG8 A;  1DOG A;  1KSC A;  2V3P A;  3WKI A;  5AGD A;  3RX7 A;  4D94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...