1R8EA

Crystal structure of bmrr bound to dna at 2.4a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*AP*CP*CP*CP*TP*CP*CP*CP*CP*TP*TP*AP*GP*GP*GP*GP*AP*
publication title The structural mechanism for transcription activation by MerR family member multidrug transporter activation, N terminus.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
total genus 84
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2003-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 1r8eA02
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1r8eA03
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 1r8eA01
3E0HA 3T97B 5KAWA 2J5UA 3D6YA 3QAOA 2VZ4A 1Q09A 4AYZA 2JMLA 3Q1MA 2HVAA 4WLSA 5E01A 4R22B 1Q07A 3D6ZA 3GP4A 5I44A 1EXIA 5KATA 5KCBA 3Q5PA 3IAOA 1EXJA 3Q5RA 1R8DA 5I41B 5D8CA 3B49A 5D90A 3Q5SA 3R8JA 3GPVA 4A1MA 4R4MA 1DIPA 4R4LA 1JYHA 4B0YA 1Q05A 3D70A 1D5YA 1Q06A 5KAVA 4WLWA 3GK6A 4AYZB 2BOWA 3UCSA 1Q0AA 2KCUA 2ZHGA 1JBGA 5KAXA 2ZHHA 2OQQA 5KAUA 3HH0A 1R8EA 5GQQA 3Q3DA 1BOWA 2GOVA 4J2NA 3D71A 3LURA 4R24B 3G9RA 4R4EA 2DG6A 3Q2YA 3R8KA 1Q08A
chains in the Genus database with same CATH superfamily
1CW5A 3H1JE 1FZCC 4NPEA 3HE4B 1ZXGA 3H1KG 1IFDA 4IL6H 2P10A 1OMIA 1JCDA 1SQBE 5KKZB 2YNYA 4EDFA 2AXCA 5AW1B 2Y9YA 2J5UA 4KJMA 4LHFA 4K35A 1VQ9P 1IK7A 4M3LA 1NYHA 2HG5D 1MKMA 1SS1A 1OW6A 1KFNA 1LT9B 2WSSH 2YKOA 3O6QB 1S9KD 3VOPA 2QRXA 2E75C 1M90Q 1VL2A 1HF9A 2IFNA 4BRYB 2Q9IA 2D2CB 1LTGC 3R8KA 3MZWB 2W83C 1Q90D 2KI7B 2BASA 5B5EH 4RO0A 1YIJP 4RKUJ 3OA7A 4OWFA 3NXSA 1VF5C 4I2LC 4W7ZA 2WPVB 1GL2B 1JY3O 3R4YA 1N7SB 2JMLA 1W2EA 2CPBA 1L0NJ 2E76D 3VMYA 5KCBA 1LX8A 3EZ7A 2WSFH 3Q5SA 1BCCJ 4ZKPA 2WSFJ 4H0LD 1L2PA 1ZOYC 2R3SA 2ZYAA 4GT1A 5E79H 1P84H 1L0NG 4QMAA 3V2QA 1H8AA 1SP4A 3B4SA 3CCEP 1BCCG 1G2CB 2Q1KA 2BOWA 1KV4A 1L4AC 4U3FJ 5APUA 3L74D 5KLIC 5KLVD 4PV1C 1KQGB 1N86A 2RN0A 5APXA 1SQVK 4EYYQ 2KZIA 1FJPA 5EFWB 3RL0D 2OYIB 1KQLA 3I56P 1S5LH 2AEFA 3L71E 1NTKE 3CCMP 2YKPA 2M3BA 2ZHHA 4U3FG 1FDOA 1RH5B 1L0LJ 1JY2N 4WY4C 2P1JA 1JEKA 1RE4A 3CCLP 2E75B 1YHQP 4GODA 2I1KA 2I1JA 2Y0DA 3MUDA 1SQXE 1HWTC 1URQB 4D6TJ 1SFCC 1L0LG 2AXTH 1KILA 3VYIA 3L73J 1K04A 2M5AB 2K88A 4EI2A 1A02F 3TK1A 2YO3A 3H1HD 4WBAA 2YMKA 2OYHC 1R8EA 4D6TG 4GDOA 3GMAA 1EZVG 2W6JH 2KLVA 2A06D 3A2AA 4Y28J 4O9BA 4JYCA 3L73G 3JCUH 3LIDA 1KYOD 2HYNA 1SQPD 3P8MC 3KQGA 3CL3D 1BGYJ 3CX5I 5KAXA 1JO5A 1ZP0C 2O3JA 1N73A 2OARA 1OX3A 2E42A 3EFGA 1YQ4C 1EXIA 1PL5A 5KAIH 1GZLA 3M9BA 2KSEA 1BGYG 1N7LA 3B8EB 1GL2D 3AECC 1N7SD 5GQQA 2OTKE 4R4EA 1NU1K 4DCZA 1Q09A 4PV1B 2R44A 4AYCA 2N9YB 3B5NB 2B88A 3WUVA 1M1JB 2B9BA 5APWA 1LWUA 2E74C 1QVFO 2IEFA 2QIWA 3PHLA 3FX0A 1M8OB 5CCHD 3CCUP 2WSCH 3TGUJ 4WY4B 4R22B 2WSCJ 4EIJA 3A0BE 5TISH 1HTLC 1JMBA 5KJ7C 2QM7A 2QM8A 2C9LY 3TGUG 3GHGC 2ZT9C 5APSA 5KTBA 3D6ZA 3VMXA 1Y47A 3L70J 2RH0A 3TNUA 1KILE 1SQQE 5AW6B 3TF5A 1Q81Q 4XA4A 1J1EC 2KIKA 1ZLLA 2KNCB 3IFMA 2YO2A 3AEFC 3BCCE 3CCJP 2DG6A 1T2KD 3QAOA 2ZFCA 4H0LC 2E75D 1PFIA 5APYA 1TU3F 4OH8B 1LP1B 3HTKB 3AE2C 3VP8A 3M0AA 2H88C 2B87B 1URQD 1LTJA 3G6EP 1ZRTE 3CC2P 1M57D 1CI6B 2FYUK 5KLVK 1H0TA 3D71A 3Q2YA 2N1TB 2XKMA 4H44C 3GG2A 4HH2A 1SQVE 3EZFA 2IYPA 4HKZH 1E79H 4JF7A 1K73Q 2XNXA 3W67A 2FFDC 1K9MQ 3N7NA 1KB9D 2ZAEB 1Q2NA 1LTBC 1L0ND 2KS1B 3RL0C 1PP9E 3EZ6A 1FC2C 1G1JA 1FS0E 2Y0CA 1BCCD 5AVXB 1RF1B 3KPEA 1ZV8A 3Q5RA 1YJ9P 3T97A 1Y8AA 5KKZC 4AYZB 3CMEP 2OGUA 2E74B 3I5CA 4Z1MH 5APTA 2IX7C 3L72J 3G4SP 3JSVC 1BE3E 4MN4C 5KAFE 1J2JB 2NPSA 4U3FD 3GLMA 4WWIA 5AW4B 1USDA 3D70A 2WWWA 4C7NB 2BEQD 4PV1D 1GU5A 3L72G 3B5ND 3GHGB 2ZT9B 3SWKA 1NTMJ 3ZDMA 4U7JA 1FZEA 4JYBA 2O01N 1SQPK 4PD4E 1L0LD 4NPDA 1KC8Q 1YQ3C 2D2CC 2BCCD 4R24B 4WY4D 3FWNA 3M0DA 1NTZK 2NZ2A 3Q5PA 4D6TD 4XE5B 1Q06A 3M91A 1S3JA 3S1KA 1SFCD 2WT7B 3L73D 3S4RA 1GL2C 1S9KE 2Z5HA 1NU1E 3L71J 1NTKJ 1T8ZA 4H44B 5K5GB 4W80A 1J1DB 2Q7CA 1RQUA 2IPPA 5DJUB 1P84I 5AVSB 3GK6A 1X8YA 1X79B 2LR2A 3PJSK 3A7OA 2QA4P 3SWFA 4LGDE 3L71G 4GOFA 1NTKG 3HD7A 5CCHC 1M1KQ 2IBZI 4PJ0E 1KN7A 5AW2B 1BGYD 1LT9A 4ZKUA 1VQPP 5D90A 2AEJA 1AQ5A 3G71P 5KAVA 1OFCX 1QX8A 1OVVA 1EDLA 1X22A 2N1TD 1U7MA 2VRSA 1LT1A 1W5CE 3KYQA 1KQSO 1FOSE 3Q1MA 1JUNA 1T6AA 2P58A 3CCQP 3G3ZA 5CJ4A 2OYIC 1NWQA 2Y9ZA 2OTJP 3GF3A 4OGQC 1EZVI 1MV8A 1T2KC 1PGJA 5L8RJ 2SPZA 3GF7A 1N7SA 4K3AA 2E74D 4L73A 1URQC 3L74E 1N8RQ 2KSJA 4J2NA 2WPQA 1D5YA 2FYUE 5KLVE 5AVVB 1NH4A 2VZ4A 4UB8E 1YITP 3WUUA 1VQ8P 1AQTA 2IDBA 1IFPA 2C9NY 1FZCA 1L0NK 1OIPA 1RF0A 2GM4A 5KJ7D 3L70D 1JTHA 1G2CA 2ZT9D 3ABVC 1VQ4P 1FAVA 1BDDA 1FZFA 1EDJA 3GP4A 2O01H 4DJGA 4NPFX 3A0BH 2O01J 2WQYC 3N4XA 1RE4C 1LTSC 1MFTA 3VN0A 4PD4I 3G9RA 5KAWA 3KDPB 5AVQB 3MUDC 3EZ9A 5KATA 1AV1A 3F5HA 1Y6UA 3TSIA 2HODA 1PGPA 1NJIQ 3H1HE 3AE8C 5AVUB 1LTAC 3M9QA 1SQQJ 4YPCA 3LURA 5CCGC 4H44D 3CX5D 3RK3E 3B5NC 2P7JA 1KYOE 2LXCB 5AVRB 2P67A 3PRJA 4RESB 1M1JC 3VTPC 1SQPE 1CZQA 1OW8A 1U7JA 2K37A 1SQQG 5H2FE 4JBZA 4L75A 2QJKC 2JP3A 3E0HA 2IBZG 4OGQB 2WZ7A 4WLSA 2O1KA 2Q5UA 1FJKA 1NTZE 2Q3EA 3L72D 3H1LJ 1QLED 3CXHH 1PP9J 2XZRA 1IFMA 3AE3C 2MJZA 4AQRD 3SFEC 4KHXA 1NTMD 2O1JA 5BU8B 1RQVA 3AEEC 1AA0A 3H1LG 3CCVP 4BXLA 1Q08A 2KXPB 1G1IA 2PRRA 2E43A 1PP9G 1L4AA 1YBKA 5KAFH 3BASA 5AW0B 2K3RA 3P8CD 3HE5B 3RBZA 1FZBA 1BE3J 2D2CD 1KMIZ 1Q0AA 1WT6A 2ZYGA 1JNMA 2N1TC 1HVVA 1EDIA 2Z5IA 3E1RA 2HFED 5DJTB 3R8JA 1PGOA 2HPCA 4PD4H 4WY4A 2FXMA 1S4XA 1BE3G 3L71D 1NTKD 1X0TA 3NFQA 2QEXP 3GW6A 3H1KD 1JM0A 2JDIH 1RF1C 2WITA 1NAYA 1SFCA 1HGVA 3A3YB 1W2BO 1YYCA 1Q05A 2PAJA 1LGHB 3WMM0 2YXRB 1M56D 3AE5C 2QJKB 3KXDA 1HH0A 1NGMB 3LIEA 2OYHA 1YI2P 4I7ZB 5B66E 1N73B 1T3UA 2R32A 4C46A 1NU1J 1KB9E 3F89A 2H43A 3AE9C 1LP1A 2DW3A 1FDMA 1FBMA 1BCCE 1IFJA 2WSEH 1NKZB 5AW8B 3SSUA 4PJ0H 3LW5H 1OXZA 3AEGC 2WMMA 1S1CX 3IF4A 1PPJE 1NU1G 4N78D 3H1JJ 4DZOA 1QL2A 3LW5J 3V4WA 4HB1A 3BRTB 2GOVA 4OGQD 1XTGB 3H1IE 3IR9A 3RL0g 1SQBJ 1MZ9A 2JWDA 2KS1A 3H6PA 1Y9BA 3C8VA 4KT0J 2A45H 1RH6A 1FZAA 3IAOA 1Q7YQ 3B49A 3CWBE 3H1JG 1PIXA 3AE4C 1U57A 2NPSC 1N2DC 1PM6A 1BOWA 1SQBG 3WUTA 3MTUE 2ITAA 1J1DC 2M3EA 3HRNA 3WU2E 4IFDK 3L4FA 1EXJA 3V6IA 5AVZB 2WPRA 3HUSA 1NKNA 4ASWA 2BCCE 3TNUB 3VP9A 1RE3C 3D6YA 1JY2O 3A0HE 3CXHE 1VDFA 4UB8H 3L74J 3O8ZA 3SWYA 3P7KA 5KJ7A 2W6AA 2FYUJ 1S2EA 2FYNC 1KFMA 3IN6A 1AVYA 2G8YA 3AE1C 2Q6QA 1QL1A 1VPCA 1P84D 1IFNA 4OVNF 5E01A 2YXQB 1LNQA 1LTJB 3L74G 1EQ7A 1OVRA 2P2UA 5BU5A 1SQQD 2FYUG 2YIUC 1H0TB 1CSBA 2PP6A 3E7KA 3L75E 1NTMK 5AW9B 2IBZD 5CHXA 5BVZA 1NAFA 5KAUA 5CCGD 1X9VA 3PTZA 3PH0A 1BGYE 3H32A 2K9JB 4IOIH 4HYTB 3BVHA 4R4LA 1YJWP 4IFFA 3HD7C 1ZRTD 3MD0A 5GTHE 2L91A 2FFDA 3T97B 3JC22 5AVWB 2PGDA 1Q07A 1GW3A 1KYOH 3H1LD 5APVA 1JYHA 1EZVD 1GU4A 4I1LA 3HE4A 3AE6C 2NPSB 3QWOC 1GK4A 5H2FH 1UIIA 3V2NA 1ZW0A 3AEAC 4CPGA 1MFZA 5GTIE 4LLHA 1H89A 2JO1A 1Z56A 2XDJA 2W8ZA 2HR3A 1GD2E 2E5TA 3PLNA 1NTZJ 2KLUA 3AEBC 1KTMA 1BE3D 4YXWH 2OG0A 2W27A 1SQXJ 2J59M 3V4QA 1DIPA 1DEBA 3O6QA 2FYNB 1HUCA 1NTZG 2R3CA 3L70E 2PFXA 1DD4A 1K8AQ 4BRYA 1VQNP 1FU1A 4DCKA 1SVFA 1RF0C 4LC1A 1SQXG 3S9OA 5M1BA 1JMMA 4PD4D 4YXDC 1FDIA 2YIUB 5AVYB 1NHLA 4UB6E 2LKMA 1LJ2A 2KCUA 4Y99B 2OQQA 2IFMA 2QVAA 3M9HA 2UWJE 3EWKA 1GL2A 2FXPA 2IZ1A 2FBWC 4R4MA 3TGUD 3CXHI 3HD7B 4BWNA 1OW7A 3KHUA 1VQ6P 2W90A 1PGQA 1EDKA 3C1LA 1NU1D 1E5WA 1IC2A 3CX5E 2JJLA 2V4HA 1GMJA 3KZIE 2OYOA 3RK3B 2LXBA 2POHA 5CCHA 3FWLA 1IJDB 2RMZA 2FY8A 2WPSA 1IFIA 3H1JD 1H88A 4HJGH 5I44A 3H25A 3TDKA 2QJPC 5B66H 2G3AA 3L72E 1SQBD 1KB9H 1NO4A 2QJYC 2QG4A 2XNDH 4I6MC 3CC7P 2OYIA 1JY3P 3E1IA 4H13C 1D7MA 2M8RA 1S72P 1SQQK 2KB7P 1QEXA 2CK3H 1KILC 4A7PA 1Q86Q 1JB0J 2NPSD 1NTME 1R5SA 2B89A 3TYYA 4L74A 4N3YB 1VQ7P 1OZHA 2OTLP 2CPSA 1K05A 1FZCB 2A06E 3L37A 2JR8A 4IFMA 2XU6A 1URQA 5APQA 3BCCJ 1JTHB 3H1IJ 1L0LK 2KYVA 3P8CE 3GPVA 2K9YA 1DX7A 3CC4P 3VMAA 1JCCA 2M5AA 2C0WA 2FXOA 1YTZI 1QVGO 3CWBJ 1HGZA 2FYUD 1PPJG 3RK2C 4ASVA 4W7YA 3C9IA 3B71A 4TT3H 4ZNCA 4I7ZC 1FE6A 2W6BA 3CLQA 3BCCG 3WU2H 3H1IG 1N73C 1OVUA 5C39A 2RKLA 2Z4EA 3MHVA 1ZMEC 3EFFK 1DH3A 1SQVJ 3P32A 3HE5A 3H1KE 3CWBG 2K1AA 2H89C 2Q3IA 1HBWA 2HODB 3A0HH 2BCCJ 2IZ0A 4B86A 1DEEG 4WB4A 3AEDC 1HJBA 1VQKP 4WLWA 5AW3B 4AUWA 2A45I 1SQVG 3MP7B 3FGAD 1LWUC 3CPWO 2BCCG 4IL6E 5I41B 1Q82Q 2ZXXA 3RBXA 5CCGA 2QJPB 1XTCC 3HD7D 1VF5B 4TLFA 5AVTB 3UCSA 3B5NA 2H7HA 2ZHGA 2QJYB 1DD3A 2XV5A 2BEZF 1M1JA 3L75J 1IZNB 4JPZB 3PP5A 3OAKA 4H13B 1SLQA 3RK3D 1EC5A 1JOCA 1UIXA 2QE7H 2QSIA 4N78E 1KILB 4WVZA 2R5BA 3FXDA 1ZR2A 3V2RA 1NOHA 1VQ5P 4ZMDA 2KOGA 3L75G 1M7LA 1YTZT 5GTHH 1YJNP 2M0BA 3A5TA 1NTZD 5AW5B 2ZJSE 2KP8A 3CCSP 1MUUA 1GTWA 1SQXD 1L4AB 3MGNA 1BSHA 1FZGA 1A02J 5KLIB 4GIFA 3RK2B 1FOSF 2GUSA 2ZXEB 5B5EE 1WMKA 1LTJC 2KNCA 2L5GB 5GTIH 2NRGA 3VMZA 4A1MA 1ZN5A 1VQOP 5AW7B 3L35A 1L0NE 2IYOA 3HTKA 2B87A 2HPCB 2MKVA 4JQ0D 1RHZB 2HVAA 3HUSC 3BRVB 1KD1Q 1CI6A 3FXEA 2C0XA 4IL6X 1SQBK 2JEEA 2N1TA 2WSEJ 3SFDC 1GK6A 2HLOA 1KYOI 1SFCB 5E79E 3OW2O 1P84E 4YTPC 1LWUB 3CMAP 4EOTA 2E76C 4U3FE 1AFOA 2IBZE 4UB6H 3K5BA 1RF1A 2OYHB 3V2PA 1ZR4A 3II6A 2H8PD 4AYZA 3L70G 3I55P 1VQLP 1L0LE 1S5LE 2ZYDA 1LTTC 4DT0A 2A45G 1QGKB 3QH9A 2N9BA 1RY3A 4XFJA 4C7NA 2YKQA 3BATA 1AJYA 2I8DA 1IK9A 3CX5H 2E5YA 3U1CA 4D6TE 1R5LA 5KLVJ 1VF5D 3H1LE 3KZIH 1EZVE 4C7RA 3GHGA 5CBOA 4L76A 2K9JA 3M0DC 1BSNA 2GA1A 3ITKA 2AXTE 3L73E 1JY3N 4H13D 2FKWB 1JY2P 3CI9A 3CD6P 1KILD 5D8CA 5KLVG 4RJTA 1PPJD 2ZVNB 3U59A 2WTYA 3AE7C 4Y99C 3UIAA 3EZ2A 3BCCD 3H1ID 2KK7A 3L36A 1KZUB 2Y0EA 1GW4A 3MIWA 3USSA 5TJHA 3JCUE 3HUSB 1AVOA 2WT7A 3NTNA 1HJ0A 2V7QH 1VQMP 3CWBD 2ZVOB 1L4AD 1PV3A 3EQ2A 1USEA 2V7QJ 3RK2D 3Q3DA 1LT9C 2KVVA 3H1HJ 5KAIE 1SQVD 1GDTA 1T3JA 2JWAA 3RK3C 2E76B 3M06A 1RE3A 4B0YA 1S5LX 1J1EB 1NTKK 2AEMA 2FYZA 2WVRA 1JBGA 1PP9D 3U1AA 2J58A 1SQPJ 1KQFB 4H0LB 3H1HG 3CXHD 1NTMG 1KB9I 1OWAA 5CJ0A 1BDCA 4GKGA 3NMDA 3CCRP 2GUVA 1PZQA 2A06G 3R2PA 3TGUE 1NVOA 1SQXK 2R5DA 3OJAB 3HH0A 3H32B 2KUBA 3W68A 5CMZA 2YMYA 1SQPG 1N7SC 1KORA 4GOEA 3V5BA 1IO4A 2KZJA 3H1KJ 4N6JA 5TISE 1R8DA 3L75D 2FFDB 1WRGA 1LTIC 4DOJA 2JKVA 3RL0B 5CBNA 3RGUA
chains in the Genus database with same CATH topology
3E0HA 3T97B 3R4YA 4YTPC 2VZ4A 1K05A 4OGQB 2JMLA 4WLSA 4H13B 4R22B 1Q07A 4H44B 2E76D 1K04A 2WSCJ 5KCBA 1HJ0A 2E76C 1LX8A 1RQUA 1EXJA 1UIXA 3EWKA 3EZ7A 3Q5RA 2FXPA 2IDBA 3Q5SA 2P10A 1OMIA 3GPVA 2FBWC 2QSIA 4R4MA 1JYHA 1Q05A 2K9YA 5KKZC 1PV3A 3GK6A 4AYZB 2V7QJ 2WSFJ 2YMKA 2E74B 4Z1MH 3AE6C 1R8EA 3AE5C 3Q3DA 3GMAA 4GDOA 4H0LD 2ZT9D 2KVVA 1OW7A 3ABVC 1ZOYC 2J5UA 3D6YA 2ZT9C 4AYZA 4LHFA 3AEAC 4Y28J 1NGMB 3D6ZA 3GP4A 3B71A 4TT3H 4I7ZB 4I7ZC 1KILE 2JO1A 1GMJA 3GLMA 2E76B 5D90A 2FYNC 3AE3C 4B0YA 3D70A 1IK7A 2O01J 1S5LX 3SFEC 5KAVA 2WQYC 3IN6A 1ZMEC 3AE9C 1NYHA 2BEQD 2BOWA 2G8YA 5KAXA 1JBGA 3AE1C 1MKMA 3AEBC 4XFJA 1ZP0C 1RQVA 1OW6A 3AEEC 3AEFC 4PV1D 5KLIC 3G9RA 2DG6A 1Q08A 2H89C 5KAWA 4PV1C 1KQGB 3QAOA 1KQFB 1KTMA 4H0LB 4H0LC 3Q1MA 2OG0A 5E01A 1WMKA 2E75D 2ZT9B 1AJYA 4U7JA 1TU3F 1YQ4C 5I44A 3EZ9A 1EXIA 1PL5A 2E75C 5KATA 1VL2A 3H25A 1HF9A 3AEGC 2YIUC 2QJPC 1S1CX 1Y6UA 1VF5D 3AE2C 2G3AA 4A1MA 1DIPA 3AEDC 2H88C 3O6QA 2D2CD 1YQ3C 4WLWA 3LW5J 3AE8C 1KMIZ 1ZRTE 1Q0AA 2D2CB 2D2CC 3AECC 2ZHHA 2QJYC 5KAUA 1DD4A 1FDOA 3HH0A 5GQQA 2GOVA 3D71A 4OGQD 3LURA 4R24B 4R4EA 3GF3A 3Q2YA 4H13D 3R8KA 3RL0g 4H44D 3FGAD 4OGQC 2MKVA 1KORA 4DCZA 1Q09A 1Q90D 4H13C 4PV1B 4H44C 2HVAA 1Y9BA 3C8VA 3RK3E 4KT0J 1RH6A 3S9OA 5L8RJ 2NZ2A 5M1BA 3EZFA 3Q5PA 2E75B 3GF7A 3IAOA 4YXDC 1R8DA 5I41B 5D8CA 3B49A 1FDIA 4IL6X 3R8JA 4R4LA 4RKUJ 2E74D 2WSEJ 1Q06A 1JB0J 1PIXA 3AE4C 1OW8A 1VF5C 1VF5B 3SFDC 2E74C 3UCSA 1U57A 2KCUA 2ZHGA 3AE7C 2OQQA 2IEFA 2QIWA 3EZ6A 1DD3A 2QJKC 2BEZF 4J2NA 3EZ2A 2WPVB 1PM6A 1BOWA 1D5YA 2JP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E0H A;  3T97 B;  5KAW A;  2J5U A;  3D6Y A;  3QAO A;  2VZ4 A;  1Q09 A;  4AYZ A;  2JML A;  3Q1M A;  2HVA A;  4WLS A;  5E01 A;  4R22 B;  1Q07 A;  3D6Z A;  3GP4 A;  5I44 A;  1EXI A;  5KAT A;  5KCB A;  3Q5P A;  3IAO A;  1EXJ A;  3Q5R A;  1R8D A;  5I41 B;  5D8C A;  3B49 A;  5D90 A;  3Q5S A;  3R8J A;  3GPV A;  4A1M A;  4R4M A;  1DIP A;  4R4L A;  1JYH A;  4B0Y A;  1Q05 A;  3D70 A;  1D5Y A;  1Q06 A;  5KAV A;  4WLW A;  3GK6 A;  4AYZ B;  2BOW A;  3UCS A;  1Q0A A;  2KCU A;  2ZHG A;  1JBG A;  5KAX A;  2ZHH A;  2OQQ A;  5KAU A;  3HH0 A;  1R8E A;  5GQQ A;  3Q3D A;  1BOW A;  2GOV A;  4J2N A;  3D71 A;  3LUR A;  4R24 B;  3G9R A;  4R4E A;  2DG6 A;  3Q2Y A;  3R8K A;  1Q08 A; 
#chains in the Genus database with same CATH topology
 1CW5 A;  3H1J E;  1FZC C;  4NPE A;  3HE4 B;  1ZXG A;  3H1K G;  1IFD A;  4IL6 H;  2P10 A;  1OMI A;  1JCD A;  1SQB E;  5KKZ B;  2YNY A;  4EDF A;  2AXC A;  5AW1 B;  2Y9Y A;  2J5U A;  4KJM A;  4LHF A;  4K35 A;  1VQ9 P;  1IK7 A;  4M3L A;  1NYH A;  2HG5 D;  1MKM A;  1SS1 A;  1OW6 A;  1KFN A;  1LT9 B;  2WSS H;  2YKO A;  3O6Q B;  1S9K D;  3VOP A;  2QRX A;  2E75 C;  1M90 Q;  1VL2 A;  1HF9 A;  2IFN A;  4BRY B;  2Q9I A;  2D2C B;  1LTG C;  3R8K A;  3MZW B;  2W83 C;  1Q90 D;  2KI7 B;  2BAS A;  5B5E H;  4RO0 A;  1YIJ P;  4RKU J;  3OA7 A;  4OWF A;  3NXS A;  1VF5 C;  4I2L C;  4W7Z A;  2WPV B;  1GL2 B;  1JY3 O;  3R4Y A;  1N7S B;  2JML A;  1W2E A;  2CPB A;  1L0N J;  2E76 D;  3VMY A;  5KCB A;  1LX8 A;  3EZ7 A;  2WSF H;  3Q5S A;  1BCC J;  4ZKP A;  2WSF J;  4H0L D;  1L2P A;  1ZOY C;  2R3S A;  2ZYA A;  4GT1 A;  5E79 H;  1P84 H;  1L0N G;  4QMA A;  3V2Q A;  1H8A A;  1SP4 A;  3B4S A;  3CCE P;  1BCC G;  1G2C B;  2Q1K A;  2BOW A;  1KV4 A;  1L4A C;  4U3F J;  5APU A;  3L74 D;  5KLI C;  5KLV D;  4PV1 C;  1KQG B;  1N86 A;  2RN0 A;  5APX A;  1SQV K;  4EYY Q;  2KZI A;  1FJP A;  5EFW B;  3RL0 D;  2OYI B;  1KQL A;  3I56 P;  1S5L H;  2AEF A;  3L71 E;  1NTK E;  3CCM P;  2YKP A;  2M3B A;  2ZHH A;  4U3F G;  1FDO A;  1RH5 B;  1L0L J;  1JY2 N;  4WY4 C;  2P1J A;  1JEK A;  1RE4 A;  3CCL P;  2E75 B;  1YHQ P;  4GOD A;  2I1K A;  2I1J A;  2Y0D A;  3MUD A;  1SQX E;  1HWT C;  1URQ B;  4D6T J;  1SFC C;  1L0L G;  2AXT H;  1KIL A;  3VYI A;  3L73 J;  1K04 A;  2M5A B;  2K88 A;  4EI2 A;  1A02 F;  3TK1 A;  2YO3 A;  3H1H D;  4WBA A;  2YMK A;  2OYH C;  1R8E A;  4D6T G;  4GDO A;  3GMA A;  1EZV G;  2W6J H;  2KLV A;  2A06 D;  3A2A A;  4Y28 J;  4O9B A;  4JYC A;  3L73 G;  3JCU H;  3LID A;  1KYO D;  2HYN A;  1SQP D;  3P8M C;  3KQG A;  3CL3 D;  1BGY J;  3CX5 I;  5KAX A;  1JO5 A;  1ZP0 C;  2O3J A;  1N73 A;  2OAR A;  1OX3 A;  2E42 A;  3EFG A;  1YQ4 C;  1EXI A;  1PL5 A;  5KAI H;  1GZL A;  3M9B A;  2KSE A;  1BGY G;  1N7L A;  3B8E B;  1GL2 D;  3AEC C;  1N7S D;  5GQQ A;  2OTK E;  4R4E A;  1NU1 K;  4DCZ A;  1Q09 A;  4PV1 B;  2R44 A;  4AYC A;  2N9Y B;  3B5N B;  2B88 A;  3WUV A;  1M1J B;  2B9B A;  5APW A;  1LWU A;  2E74 C;  1QVF O;  2IEF A;  2QIW A;  3PHL A;  3FX0 A;  1M8O B;  5CCH D;  3CCU P;  2WSC H;  3TGU J;  4WY4 B;  4R22 B;  2WSC J;  4EIJ A;  3A0B E;  5TIS H;  1HTL C;  1JMB A;  5KJ7 C;  2QM7 A;  2QM8 A;  2C9L Y;  3TGU G;  3GHG C;  2ZT9 C;  5APS A;  5KTB A;  3D6Z A;  3VMX A;  1Y47 A;  3L70 J;  2RH0 A;  3TNU A;  1KIL E;  1SQQ E;  5AW6 B;  3TF5 A;  1Q81 Q;  4XA4 A;  1J1E C;  2KIK A;  1ZLL A;  2KNC B;  3IFM A;  2YO2 A;  3AEF C;  3BCC E;  3CCJ P;  2DG6 A;  1T2K D;  3QAO A;  2ZFC A;  4H0L C;  2E75 D;  1PFI A;  5APY A;  1TU3 F;  4OH8 B;  1LP1 B;  3HTK B;  3AE2 C;  3VP8 A;  3M0A A;  2H88 C;  2B87 B;  1URQ D;  1LTJ A;  3G6E P;  1ZRT E;  3CC2 P;  1M57 D;  1CI6 B;  2FYU K;  5KLV K;  1H0T A;  3D71 A;  3Q2Y A;  2N1T B;  2XKM A;  4H44 C;  3GG2 A;  4HH2 A;  1SQV E;  3EZF A;  2IYP A;  4HKZ H;  1E79 H;  4JF7 A;  1K73 Q;  2XNX A;  3W67 A;  2FFD C;  1K9M Q;  3N7N A;  1KB9 D;  2ZAE B;  1Q2N A;  1LTB C;  1L0N D;  2KS1 B;  3RL0 C;  1PP9 E;  3EZ6 A;  1FC2 C;  1G1J A;  1FS0 E;  2Y0C A;  1BCC D;  5AVX B;  1RF1 B;  3KPE A;  1ZV8 A;  3Q5R A;  1YJ9 P;  3T97 A;  1Y8A A;  5KKZ C;  4AYZ B;  3CME P;  2OGU A;  2E74 B;  3I5C A;  4Z1M H;  5APT A;  2IX7 C;  3L72 J;  3G4S P;  3JSV C;  1BE3 E;  4MN4 C;  5KAF E;  1J2J B;  2NPS A;  4U3F D;  3GLM A;  4WWI A;  5AW4 B;  1USD A;  3D70 A;  2WWW A;  4C7N B;  2BEQ D;  4PV1 D;  1GU5 A;  3L72 G;  3B5N D;  3GHG B;  2ZT9 B;  3SWK A;  1NTM J;  3ZDM A;  4U7J A;  1FZE A;  4JYB A;  2O01 N;  1SQP K;  4PD4 E;  1L0L D;  4NPD A;  1KC8 Q;  1YQ3 C;  2D2C C;  2BCC D;  4R24 B;  4WY4 D;  3FWN A;  3M0D A;  1NTZ K;  2NZ2 A;  3Q5P A;  4D6T D;  4XE5 B;  1Q06 A;  3M91 A;  1S3J A;  3S1K A;  1SFC D;  2WT7 B;  3L73 D;  3S4R A;  1GL2 C;  1S9K E;  2Z5H A;  1NU1 E;  3L71 J;  1NTK J;  1T8Z A;  4H44 B;  5K5G B;  4W80 A;  1J1D B;  2Q7C A;  1RQU A;  2IPP A;  5DJU B;  1P84 I;  5AVS B;  3GK6 A;  1X8Y A;  1X79 B;  2LR2 A;  3PJS K;  3A7O A;  2QA4 P;  3SWF A;  4LGD E;  3L71 G;  4GOF A;  1NTK G;  3HD7 A;  5CCH C;  1M1K Q;  2IBZ I;  4PJ0 E;  1KN7 A;  5AW2 B;  1BGY D;  1LT9 A;  4ZKU A;  1VQP P;  5D90 A;  2AEJ A;  1AQ5 A;  3G71 P;  5KAV A;  1OFC X;  1QX8 A;  1OVV A;  1EDL A;  1X22 A;  2N1T D;  1U7M A;  2VRS A;  1LT1 A;  1W5C E;  3KYQ A;  1KQS O;  1FOS E;  3Q1M A;  1JUN A;  1T6A A;  2P58 A;  3CCQ P;  3G3Z A;  5CJ4 A;  2OYI C;  1NWQ A;  2Y9Z A;  2OTJ P;  3GF3 A;  4OGQ C;  1EZV I;  1MV8 A;  1T2K C;  1PGJ A;  5L8R J;  2SPZ A;  3GF7 A;  1N7S A;  4K3A A;  2E74 D;  4L73 A;  1URQ C;  3L74 E;  1N8R Q;  2KSJ A;  4J2N A;  2WPQ A;  1D5Y A;  2FYU E;  5KLV E;  5AVV B;  1NH4 A;  2VZ4 A;  4UB8 E;  1YIT P;  3WUU A;  1VQ8 P;  1AQT A;  2IDB A;  1IFP A;  2C9N Y;  1FZC A;  1L0N K;  1OIP A;  1RF0 A;  2GM4 A;  5KJ7 D;  3L70 D;  1JTH A;  1G2C A;  2ZT9 D;  3ABV C;  1VQ4 P;  1FAV A;  1BDD A;  1FZF A;  1EDJ A;  3GP4 A;  2O01 H;  4DJG A;  4NPF X;  3A0B H;  2O01 J;  2WQY C;  3N4X A;  1RE4 C;  1LTS C;  1MFT A;  3VN0 A;  4PD4 I;  3G9R A;  5KAW A;  3KDP B;  5AVQ B;  3MUD C;  3EZ9 A;  5KAT A;  1AV1 A;  3F5H A;  1Y6U A;  3TSI A;  2HOD A;  1PGP A;  1NJI Q;  3H1H E;  3AE8 C;  5AVU B;  1LTA C;  3M9Q A;  1SQQ J;  4YPC A;  3LUR A;  5CCG C;  4H44 D;  3CX5 D;  3RK3 E;  3B5N C;  2P7J A;  1KYO E;  2LXC B;  5AVR B;  2P67 A;  3PRJ A;  4RES B;  1M1J C;  3VTP C;  1SQP E;  1CZQ A;  1OW8 A;  1U7J A;  2K37 A;  1SQQ G;  5H2F E;  4JBZ A;  4L75 A;  2QJK C;  2JP3 A;  3E0H A;  2IBZ G;  4OGQ B;  2WZ7 A;  4WLS A;  2O1K A;  2Q5U A;  1FJK A;  1NTZ E;  2Q3E A;  3L72 D;  3H1L J;  1QLE D;  3CXH H;  1PP9 J;  2XZR A;  1IFM A;  3AE3 C;  2MJZ A;  4AQR D;  3SFE C;  4KHX A;  1NTM D;  2O1J A;  5BU8 B;  1RQV A;  3AEE C;  1AA0 A;  3H1L G;  3CCV P;  4BXL A;  1Q08 A;  2KXP B;  1G1I A;  2PRR A;  2E43 A;  1PP9 G;  1L4A A;  1YBK A;  5KAF H;  3BAS A;  5AW0 B;  2K3R A;  3P8C D;  3HE5 B;  3RBZ A;  1FZB A;  1BE3 J;  2D2C D;  1KMI Z;  1Q0A A;  1WT6 A;  2ZYG A;  1JNM A;  2N1T C;  1HVV A;  1EDI A;  2Z5I A;  3E1R A;  2HFE D;  5DJT B;  3R8J A;  1PGO A;  2HPC A;  4PD4 H;  4WY4 A;  2FXM A;  1S4X A;  1BE3 G;  3L71 D;  1NTK D;  1X0T A;  3NFQ A;  2QEX P;  3GW6 A;  3H1K D;  1JM0 A;  2JDI H;  1RF1 C;  2WIT A;  1NAY A;  1SFC A;  1HGV A;  3A3Y B;  1W2B O;  1YYC A;  1Q05 A;  2PAJ A;  1LGH B;  3WMM 0;  2YXR B;  1M56 D;  3AE5 C;  2QJK B;  3KXD A;  1HH0 A;  1NGM B;  3LIE A;  2OYH A;  1YI2 P;  4I7Z B;  5B66 E;  1N73 B;  1T3U A;  2R32 A;  4C46 A;  1NU1 J;  1KB9 E;  3F89 A;  2H43 A;  3AE9 C;  1LP1 A;  2DW3 A;  1FDM A;  1FBM A;  1BCC E;  1IFJ A;  2WSE H;  1NKZ B;  5AW8 B;  3SSU A;  4PJ0 H;  3LW5 H;  1OXZ A;  3AEG C;  2WMM A;  1S1C X;  3IF4 A;  1PPJ E;  1NU1 G;  4N78 D;  3H1J J;  4DZO A;  1QL2 A;  3LW5 J;  3V4W A;  4HB1 A;  3BRT B;  2GOV A;  4OGQ D;  1XTG B;  3H1I E;  3IR9 A;  3RL0 g;  1SQB J;  1MZ9 A;  2JWD A;  2KS1 A;  3H6P A;  1Y9B A;  3C8V A;  4KT0 J;  2A45 H;  1RH6 A;  1FZA A;  3IAO A;  1Q7Y Q;  3B49 A;  3CWB E;  3H1J G;  1PIX A;  3AE4 C;  1U57 A;  2NPS C;  1N2D C;  1PM6 A;  1BOW A;  1SQB G;  3WUT A;  3MTU E;  2ITA A;  1J1D C;  2M3E A;  3HRN A;  3WU2 E;  4IFD K;  3L4F A;  1EXJ A;  3V6I A;  5AVZ B;  2WPR A;  3HUS A;  1NKN A;  4ASW A;  2BCC E;  3TNU B;  3VP9 A;  1RE3 C;  3D6Y A;  1JY2 O;  3A0H E;  3CXH E;  1VDF A;  4UB8 H;  3L74 J;  3O8Z A;  3SWY A;  3P7K A;  5KJ7 A;  2W6A A;  2FYU J;  1S2E A;  2FYN C;  1KFM A;  3IN6 A;  1AVY A;  2G8Y A;  3AE1 C;  2Q6Q A;  1QL1 A;  1VPC A;  1P84 D;  1IFN A;  4OVN F;  5E01 A;  2YXQ B;  1LNQ A;  1LTJ B;  3L74 G;  1EQ7 A;  1OVR A;  2P2U A;  5BU5 A;  1SQQ D;  2FYU G;  2YIU C;  1H0T B;  1CSB A;  2PP6 A;  3E7K A;  3L75 E;  1NTM K;  5AW9 B;  2IBZ D;  5CHX A;  5BVZ A;  1NAF A;  5KAU A;  5CCG D;  1X9V A;  3PTZ A;  3PH0 A;  1BGY E;  3H32 A;  2K9J B;  4IOI H;  4HYT B;  3BVH A;  4R4L A;  1YJW P;  4IFF A;  3HD7 C;  1ZRT D;  3MD0 A;  5GTH E;  2L91 A;  2FFD A;  3T97 B;  3JC2 2;  5AVW B;  2PGD A;  1Q07 A;  1GW3 A;  1KYO H;  3H1L D;  5APV A;  1JYH A;  1EZV D;  1GU4 A;  4I1L A;  3HE4 A;  3AE6 C;  2NPS B;  3QWO C;  1GK4 A;  5H2F H;  1UII A;  3V2N A;  1ZW0 A;  3AEA C;  4CPG A;  1MFZ A;  5GTI E;  4LLH A;  1H89 A;  2JO1 A;  1Z56 A;  2XDJ A;  2W8Z A;  2HR3 A;  1GD2 E;  2E5T A;  3PLN A;  1NTZ J;  2KLU A;  3AEB C;  1KTM A;  1BE3 D;  4YXW H;  2OG0 A;  2W27 A;  1SQX J;  2J59 M;  3V4Q A;  1DIP A;  1DEB A;  3O6Q A;  2FYN B;  1HUC A;  1NTZ G;  2R3C A;  3L70 E;  2PFX A;  1DD4 A;  1K8A Q;  4BRY A;  1VQN P;  1FU1 A;  4DCK A;  1SVF A;  1RF0 C;  4LC1 A;  1SQX G;  3S9O A;  5M1B A;  1JMM A;  4PD4 D;  4YXD C;  1FDI A;  2YIU B;  5AVY B;  1NHL A;  4UB6 E;  2LKM A;  1LJ2 A;  2KCU A;  4Y99 B;  2OQQ A;  2IFM A;  2QVA A;  3M9H A;  2UWJ E;  3EWK A;  1GL2 A;  2FXP A;  2IZ1 A;  2FBW C;  4R4M A;  3TGU D;  3CXH I;  3HD7 B;  4BWN A;  1OW7 A;  3KHU A;  1VQ6 P;  2W90 A;  1PGQ A;  1EDK A;  3C1L A;  1NU1 D;  1E5W A;  1IC2 A;  3CX5 E;  2JJL A;  2V4H A;  1GMJ A;  3KZI E;  2OYO A;  3RK3 B;  2LXB A;  2POH A;  5CCH A;  3FWL A;  1IJD B;  2RMZ A;  2FY8 A;  2WPS A;  1IFI A;  3H1J D;  1H88 A;  4HJG H;  5I44 A;  3H25 A;  3TDK A;  2QJP C;  5B66 H;  2G3A A;  3L72 E;  1SQB D;  1KB9 H;  1NO4 A;  2QJY C;  2QG4 A;  2XND H;  4I6M C;  3CC7 P;  2OYI A;  1JY3 P;  3E1I A;  4H13 C;  1D7M A;  2M8R A;  1S72 P;  1SQQ K;  2KB7 P;  1QEX A;  2CK3 H;  1KIL C;  4A7P A;  1Q86 Q;  1JB0 J;  2NPS D;  1NTM E;  1R5S A;  2B89 A;  3TYY A;  4L74 A;  4N3Y B;  1VQ7 P;  1OZH A;  2OTL P;  2CPS A;  1K05 A;  1FZC B;  2A06 E;  3L37 A;  2JR8 A;  4IFM A;  2XU6 A;  1URQ A;  5APQ A;  3BCC J;  1JTH B;  3H1I J;  1L0L K;  2KYV A;  3P8C E;  3GPV A;  2K9Y A;  1DX7 A;  3CC4 P;  3VMA A;  1JCC A;  2M5A A;  2C0W A;  2FXO A;  1YTZ I;  1QVG O;  3CWB J;  1HGZ A;  2FYU D;  1PPJ G;  3RK2 C;  4ASV A;  4W7Y A;  3C9I A;  3B71 A;  4TT3 H;  4ZNC A;  4I7Z C;  1FE6 A;  2W6B A;  3CLQ A;  3BCC G;  3WU2 H;  3H1I G;  1N73 C;  1OVU A;  5C39 A;  2RKL A;  2Z4E A;  3MHV A;  1ZME C;  3EFF K;  1DH3 A;  1SQV J;  3P32 A;  3HE5 A;  3H1K E;  3CWB G;  2K1A A;  2H89 C;  2Q3I A;  1HBW A;  2HOD B;  3A0H H;  2BCC J;  2IZ0 A;  4B86 A;  1DEE G;  4WB4 A;  3AED C;  1HJB A;  1VQK P;  4WLW A;  5AW3 B;  4AUW A;  2A45 I;  1SQV G;  3MP7 B;  3FGA D;  1LWU C;  3CPW O;  2BCC G;  4IL6 E;  5I41 B;  1Q82 Q;  2ZXX A;  3RBX A;  5CCG A;  2QJP B;  1XTC C;  3HD7 D;  1VF5 B;  4TLF A;  5AVT B;  3UCS A;  3B5N A;  2H7H A;  2ZHG A;  2QJY B;  1DD3 A;  2XV5 A;  2BEZ F;  1M1J A;  3L75 J;  1IZN B;  4JPZ B;  3PP5 A;  3OAK A;  4H13 B;  1SLQ A;  3RK3 D;  1EC5 A;  1JOC A;  1UIX A;  2QE7 H;  2QSI A;  4N78 E;  1KIL B;  4WVZ A;  2R5B A;  3FXD A;  1ZR2 A;  3V2R A;  1NOH A;  1VQ5 P;  4ZMD A;  2KOG A;  3L75 G;  1M7L A;  1YTZ T;  5GTH H;  1YJN P;  2M0B A;  3A5T A;  1NTZ D;  5AW5 B;  2ZJS E;  2KP8 A;  3CCS P;  1MUU A;  1GTW A;  1SQX D;  1L4A B;  3MGN A;  1BSH A;  1FZG A;  1A02 J;  5KLI B;  4GIF A;  3RK2 B;  1FOS F;  2GUS A;  2ZXE B;  5B5E E;  1WMK A;  1LTJ C;  2KNC A;  2L5G B;  5GTI H;  2NRG A;  3VMZ A;  4A1M A;  1ZN5 A;  1VQO P;  5AW7 B;  3L35 A;  1L0N E;  2IYO A;  3HTK A;  2B87 A;  2HPC B;  2MKV A;  4JQ0 D;  1RHZ B;  2HVA A;  3HUS C;  3BRV B;  1KD1 Q;  1CI6 A;  3FXE A;  2C0X A;  4IL6 X;  1SQB K;  2JEE A;  2N1T A;  2WSE J;  3SFD C;  1GK6 A;  2HLO A;  1KYO I;  1SFC B;  5E79 E;  3OW2 O;  1P84 E;  4YTP C;  1LWU B;  3CMA P;  4EOT A;  2E76 C;  4U3F E;  1AFO A;  2IBZ E;  4UB6 H;  3K5B A;  1RF1 A;  2OYH B;  3V2P A;  1ZR4 A;  3II6 A;  2H8P D;  4AYZ A;  3L70 G;  3I55 P;  1VQL P;  1L0L E;  1S5L E;  2ZYD A;  1LTT C;  4DT0 A;  2A45 G;  1QGK B;  3QH9 A;  2N9B A;  1RY3 A;  4XFJ A;  4C7N A;  2YKQ A;  3BAT A;  1AJY A;  2I8D A;  1IK9 A;  3CX5 H;  2E5Y A;  3U1C A;  4D6T E;  1R5L A;  5KLV J;  1VF5 D;  3H1L E;  3KZI H;  1EZV E;  4C7R A;  3GHG A;  5CBO A;  4L76 A;  2K9J A;  3M0D C;  1BSN A;  2GA1 A;  3ITK A;  2AXT E;  3L73 E;  1JY3 N;  4H13 D;  2FKW B;  1JY2 P;  3CI9 A;  3CD6 P;  1KIL D;  5D8C A;  5KLV G;  4RJT A;  1PPJ D;  2ZVN B;  3U59 A;  2WTY A;  3AE7 C;  4Y99 C;  3UIA A;  3EZ2 A;  3BCC D;  3H1I D;  2KK7 A;  3L36 A;  1KZU B;  2Y0E A;  1GW4 A;  3MIW A;  3USS A;  5TJH A;  3JCU E;  3HUS B;  1AVO A;  2WT7 A;  3NTN A;  1HJ0 A;  2V7Q H;  1VQM P;  3CWB D;  2ZVO B;  1L4A D;  1PV3 A;  3EQ2 A;  1USE A;  2V7Q J;  3RK2 D;  3Q3D A;  1LT9 C;  2KVV A;  3H1H J;  5KAI E;  1SQV D;  1GDT A;  1T3J A;  2JWA A;  3RK3 C;  2E76 B;  3M06 A;  1RE3 A;  4B0Y A;  1S5L X;  1J1E B;  1NTK K;  2AEM A;  2FYZ A;  2WVR A;  1JBG A;  1PP9 D;  3U1A A;  2J58 A;  1SQP J;  1KQF B;  4H0L B;  3H1H G;  3CXH D;  1NTM G;  1KB9 I;  1OWA A;  5CJ0 A;  1BDC A;  4GKG A;  3NMD A;  3CCR P;  2GUV A;  1PZQ A;  2A06 G;  3R2P A;  3TGU E;  1NVO A;  1SQX K;  2R5D A;  3OJA B;  3HH0 A;  3H32 B;  2KUB A;  3W68 A;  5CMZ A;  2YMY A;  1SQP G;  1N7S C;  1KOR A;  4GOE A;  3V5B A;  1IO4 A;  2KZJ A;  3H1K J;  4N6J A;  5TIS E;  1R8D A;  3L75 D;  2FFD B;  1WRG A;  1LTI C;  4DOJ A;  2JKV A;  3RL0 B;  5CBN A;  3RGU A; 
#chains in the Genus database with same CATH homology
 3E0H A;  3T97 B;  3R4Y A;  4YTP C;  2VZ4 A;  1K05 A;  4OGQ B;  2JML A;  4WLS A;  4H13 B;  4R22 B;  1Q07 A;  4H44 B;  2E76 D;  1K04 A;  2WSC J;  5KCB A;  1HJ0 A;  2E76 C;  1LX8 A;  1RQU A;  1EXJ A;  1UIX A;  3EWK A;  3EZ7 A;  3Q5R A;  2FXP A;  2IDB A;  3Q5S A;  2P10 A;  1OMI A;  3GPV A;  2FBW C;  2QSI A;  4R4M A;  1JYH A;  1Q05 A;  2K9Y A;  5KKZ C;  1PV3 A;  3GK6 A;  4AYZ B;  2V7Q J;  2WSF J;  2YMK A;  2E74 B;  4Z1M H;  3AE6 C;  1R8E A;  3AE5 C;  3Q3D A;  3GMA A;  4GDO A;  4H0L D;  2ZT9 D;  2KVV A;  1OW7 A;  3ABV C;  1ZOY C;  2J5U A;  3D6Y A;  2ZT9 C;  4AYZ A;  4LHF A;  3AEA C;  4Y28 J;  1NGM B;  3D6Z A;  3GP4 A;  3B71 A;  4TT3 H;  4I7Z B;  4I7Z C;  1KIL E;  2JO1 A;  1GMJ A;  3GLM A;  2E76 B;  5D90 A;  2FYN C;  3AE3 C;  4B0Y A;  3D70 A;  1IK7 A;  2O01 J;  1S5L X;  3SFE C;  5KAV A;  2WQY C;  3IN6 A;  1ZME C;  3AE9 C;  1NYH A;  2BEQ D;  2BOW A;  2G8Y A;  5KAX A;  1JBG A;  3AE1 C;  1MKM A;  3AEB C;  4XFJ A;  1ZP0 C;  1RQV A;  1OW6 A;  3AEE C;  3AEF C;  4PV1 D;  5KLI C;  3G9R A;  2DG6 A;  1Q08 A;  2H89 C;  5KAW A;  4PV1 C;  1KQG B;  3QAO A;  1KQF B;  1KTM A;  4H0L B;  4H0L C;  3Q1M A;  2OG0 A;  5E01 A;  1WMK A;  2E75 D;  2ZT9 B;  1AJY A;  4U7J A;  1TU3 F;  1YQ4 C;  5I44 A;  3EZ9 A;  1EXI A;  1PL5 A;  2E75 C;  5KAT A;  1VL2 A;  3H25 A;  1HF9 A;  3AEG C;  2YIU C;  2QJP C;  1S1C X;  1Y6U A;  1VF5 D;  3AE2 C;  2G3A A;  4A1M A;  1DIP A;  3AED C;  2H88 C;  3O6Q A;  2D2C D;  1YQ3 C;  4WLW A;  3LW5 J;  3AE8 C;  1KMI Z;  1ZRT E;  1Q0A A;  2D2C B;  2D2C C;  3AEC C;  2ZHH A;  2QJY C;  5KAU A;  1DD4 A;  1FDO A;  3HH0 A;  5GQQ A;  2GOV A;  3D71 A;  4OGQ D;  3LUR A;  4R24 B;  4R4E A;  3GF3 A;  3Q2Y A;  4H13 D;  3R8K A;  3RL0 g;  4H44 D;  3FGA D;  4OGQ C;  2MKV A;  1KOR A;  4DCZ A;  1Q09 A;  1Q90 D;  4H13 C;  4PV1 B;  4H44 C;  2HVA A;  1Y9B A;  3C8V A;  3RK3 E;  4KT0 J;  1RH6 A;  3S9O A;  5L8R J;  2NZ2 A;  5M1B A;  3EZF A;  3Q5P A;  2E75 B;  3GF7 A;  3IAO A;  4YXD C;  1R8D A;  5I41 B;  5D8C A;  3B49 A;  1FDI A;  4IL6 X;  3R8J A;  4R4L A;  4RKU J;  2E74 D;  2WSE J;  1Q06 A;  1JB0 J;  1PIX A;  3AE4 C;  1OW8 A;  1VF5 C;  1VF5 B;  3SFD C;  2E74 C;  3UCS A;  1U57 A;  2KCU A;  2ZHG A;  3AE7 C;  2OQQ A;  2IEF A;  2QIW A;  3EZ6 A;  1DD3 A;  2QJK C;  2BEZ F;  4J2N A;  3EZ2 A;  2WPV B;  1PM6 A;  1BOW A;  1D5Y A;  2JP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...