1R8EA

Crystal structure of bmrr bound to dna at 2.4a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
275
structure length
275
Chain Sequence
b'ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*AP*CP*CP*CP*TP*CP*CP*CP*CP*TP*TP*AP*GP*GP*GP*GP*AP*
publication title The structural mechanism for transcription activation by MerR family member multidrug transporter activation, N terminus.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
total genus 84
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2003-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 1r8eA02
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1r8eA03
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 1r8eA01
3Q2YA 1R8EA 4R4EA 4AYZB 1BOWA 1EXJA 4R24B 4WLSA 3HH0A 1JBGA 3Q3DA 3LURA 4J2NA 5I41B 3B49A 1Q08A 3D6ZA 1Q05A 3Q5SA 4A1MA 5D90A 3Q1MA 3D70A 3E0HA 3UCSA 2GOVA 5I44A 1EXIA 1D5YA 5KAWA 2JMLA 4R22B 3Q5PA 1R8DA 3IAOA 2J5UA 4R4LA 3GK6A 5KCBA 4AYZA 3T97B 3R8JA 4B0YA 3D6YA 1Q09A 2DG6A 3R8KA 5GQQA 2ZHHA 5D8CA 2HVAA 3G9RA 5KAUA 2ZHGA 1Q06A 3Q5RA 3GP4A 4WLWA 2BOWA 1Q0AA 4R4MA 2VZ4A 5KATA 3GPVA 5KAXA 1DIPA 3D71A 2OQQA 2KCUA 3QAOA 5E01A 5KAVA 1JYHA 1Q07A
chains in the Genus database with same CATH superfamily
2IBZD 1URQC 1BCCD 3P8MC 4D6TE 3TGUE 1IFMA 2A06G 1NOHA 2K3RA 1SQQJ 1L0ND 2KI7B 2BASA 3MD0A 3AE7C 1K04A 1AV1A 3RL0B 1PZQA 4MN4C 3CX5I 5CCHC 4EYYQ 4RESB 4KHXA 3AE8C 3G4SP 4D6TD 2IDBA 3TGUD 4EDFA 4H0LD 4OGQB 1VQLP 5AVTB 1J1EB 5CCHA 1X8YA 4WVZA 3Q5RA 2JWDA 1GTWA 4IFDK 4IL6H 2YKOA 2C9NY 1OW8A 2D2CB 2YNYA 2PP6A 3VP9A 4GOEA 3KPEA 1USDA 1HJBA 1AFOA 3EZ9A 2E5YA 2XKMA 2W90A 1S1CX 1SQBE 1ZRTE 2QA4P 3L37A 1ZR2A 3E1RA 2YO3A 5DJTB 3HE5A 2JR8A 4C46A 3JSVC 4R22B 1GK4A 3TYYA 1Q81Q 2OYIB 5CCGA 3L74G 1N8RQ 2ZT9B 1LT1A 4U3FE 1BE3J 3N7NA 4LGDE 5KATA 4W7YA 3L4FA 3RK3E 1ZRTD 1S9KE 3IFMA 1HBWA 2B89A 2FBWC 2PFXA 5AVUB 1YIJP 4I6MC 2E76D 3JC22 2I8DA 5AW6B 5KKZC 5KAFE 3FX0A 5GQQA 1SLQA 4U3FD 2A45I 3HD7C 4LC1A 3RK3D 1SQPK 4JYBA 1S9KD 2P10A 2GA1A 2K9JB 1NTZJ 2W27A 5M1BA 3HD7A 3O6QB 3UCSA 2KLUA 2JMLA 3M9HA 1KTMA 1SQBG 3CCMP 3L75E 1NGMB 1ZLLA 1JEKA 1DX7A 1IO4A 3V2NA 1FZCB 3HUSC 5CJ0A 3D6ZA 1LTBC 2JP3A 5KAFH 3HTKB 2M8RA 4U3FG 2FY8A 3L75D 5BU5A 2JDIH 4N3YB 2QE7H 2YIUC 3GHGB 4UB8E 4C7NB 3C8VA 4K3AA 1EDJA 1K05A 3GF3A 2NZ2A 3C1LA 4GIFA 3SFDC 3QH9A 1LT9C 1FOSE 5KAXA 1H0TA 3QAOA 4H13D 3RK2B 1KB9E 3H1KG 3Q3DA 2OYHA 5KJ7C 2KSJA 2WITA 2WT7A 1NU1K 5AW9B 2C0WA 2WVRA 1H89A 1HGVA 2QJKC 1T2KD 1YQ3C 4OVNF 4UB8H 1KB9D 1PGOA 1JM0A 2FYUE 1GU4A 1L0LE 3MHVA 3R4YA 2IYOA 1S72P 3BRTB 3AE1C 3H1LE 2KXPB 3OJAB 3UIAA 2KP8A 3E7KA 1DIPA 3A5TA 3AE4C 2FYUD 3H32A 2SPZA 1NTMG 1L0LD 3W68A 3CCQP 2M5AA 1RF1C 3GMAA 3EFFK 3H1LD 1Q06A 1PP9J 4YXWH 5AVXB 1FJKA 3B8EB 4I7ZC 2K88A 2POHA 4R4EA 3B5ND 4R24B 1P84H 3V6IA 1BGYJ 3VMXA 4ZMDA 1XTCC 3M91A 4CPGA 4PD4E 3RK3C 1SQPJ 1NAYA 1KQGB 1ZXGA 1W2BO 2PGDA 5KAUA 1IFDA 4NPFX 1ZMEC 3I56P 3TDKA 5APQA 2XNDH 3H1HE 2R5DA 2WSFJ 1NKZB 1ZN5A 2H8PD 1W2EA 1OIPA 3GLMA 5KAIE 2HPCA 2FXMA 1IZNB 2Y0EA 2IZ0A 1RHZB 1CW5A 1FZEA 1FDMA 1EDLA 2C0XA 2W6AA 3AEDC 3H1HD 1PV3A 4PD4H 3A0HE 1HUCA 4BXLA 1S3JA 1A02F 5KLIB 3G71P 3RL0g 2JO1A 2KSEA 1YTZT 2XDJA 3HE5B 3EZFA 2B9BA 4DCZA 3AE9C 1VQ8P 3L73G 3A0BH 5KAIH 2WSCH 2OTJP 1U7JA 2J5UA 4H13C 1WT6A 1VL2A 1S5LX 2KIKA 1X0TA 3NMDA 2WTYA 2OYOA 1ZP0C 1T3UA 1QEXA 2OQQA 1E5WA 1NU1J 1WMKA 1OMIA 3A0HH 4GDOA 5AW2B 1SQBK 4YPCA 1KYOE 3VP8A 2Q3IA 2R3SA 2XU6A 5KKZB 3VMYA 1JOCA 3HD7B 1GU5A 1RH5B 2M3BA 3R2PA 4ASWA 3H1JJ 2WSSH 3L71E 1KYOD 4WB4A 1NKNA 3CX5H 2J58A 1KQFB 2O1KA 3CWBE 4AYCA 2LXCB 2E5TA 3CCLP 2BCCG 3H1IE 3WUVA 5AVQB 1Z56A 4DCKA 3O8ZA 1KN7A 3L71D 3GHGA 1SQXE 1GW3A 2YMKA 5KAWA 3B5NC 4NPEA 1VQKP 2P67A 3CWBD 3L70J 2DW3A 1JMMA 2V7QJ 1LNQA 2KCUA 3B5NA 3H1ID 2QJYC 4JF7A 2WSEJ 1OVUA 4UB6E 1SQXD 1EZVI 1H0TB 3S1KA 3HE4A 3AECC 1G2CA 3NXSA 3A3YB 1N7SD 2K9YA 4H0LB 1Q0AA 2WZ7A 2JWAA 2WT7B 1FC2C 1LTJC 1NTKE 3SWKA 1RF0C 2M3EA 1HJ0A 1FDIA 5CMZA 4L76A 2WWWA 5KTBA 3CC7P 3L72G 4ZNCA 3CWBG 2Z5HA 3M9QA 5AVYB 2QM7A 3II6A 3L74J 5CJ4A 2QJKB 3AEGC 1NTKD 3F5HA 1LWUA 2IYPA 1BSHA 3M0DC 2A45H 4UB6H 5L8RJ 5TISE 1ZW0A 1FZFA 2NPSD 3H32B 3U1CA 5B66E 2M5AB 4EIJA 1M1JC 2WPVB 1JCCA 1PPJG 1NH4A 4WY4A 2YXRB 3TF5A 2VRSA 5KLVE 1GL2D 1FE6A 2FYUK 3PJSK 1KQLA 3PLNA 1URQA 1L0LK 3KHUA 1K8AQ 1N2DC 1SQBJ 1L4AD 3BCCJ 2E76B 4I7ZB 3R8KA 2JEEA 2N9YB 1DD4A 3Q1MA 3RK3B 5KLVD 3G3ZA 3IAOA 3B71A 3R8JA 1KORA 2IBZG 5KJ7D 5B66H 1KYOI 2HPCB 4LHFA 1VQ7P 2G3AA 2IX7C 2R3CA 1BCCG 4N6JA 5EFWB 3SFEC 1X22A 2L91A 3CCRP 1L0NG 1HGZA 3V4QA 4BRYA 1QVGO 2ZXEB 2IPPA 1RE3C 2KZJA 3VMZA 1GD2E 4DOJA 2VZ4A 5TJHA 2AXCA 1N86A 4ASVA 1DEEG 3KDPB 2Q5UA 4D6TG 1PFIA 3TGUG 2FXOA 2N9BA 3H1KJ 5APXA 1SQQE 4XE5B 2JKVA 3CCSP 4HKZH 2DG6A 3P8CE 3NFQA 3BATA 3V2RA 2H43A 3CD6P 3ZDMA 1N7SC 2Z5IA 1YYCA 2OTLP 1KILC 1SQQD 3CL3D 3EQ2A 1OX3A 1N7SA 2MKVA 2KYVA 2N1TD 1FZGA 2YMYA 3P8CD 5APTA 3CI9A 4RO0A 1S5LE 4EOTA 4BWNA 1RE4C 3JCUE 1N7LA 1Q86Q 2KVVA 1NTMJ 5BVZA 3QWOC 5CBNA 1VF5D 2AEFA 3G9RA 1RE4A 2QM8A 1OFCX 1KQSO 2NPSC 3KZIE 3WUTA 4OGQD 2RKLA 1MKMA 1JMBA 1IC2A 1SQQG 2L5GB 1JY2P 4LLHA 2B88A 3HUSA 1PIXA 1BE3E 2D2CD 2HODB 2ZYDA 3SWFA 5AW1B 1GL2C 4K35A 2H89C 1JY2O 1BSNA 1FU1A 1L4AC 4A1MA 3D70A 1GL2A 2WPRA 3B5NB 2AXTE 2LR2A 1FOSF 1WRGA 2Q6QA 5D8CA 1BE3D 2W6BA 1RQUA 2IFNA 1AA0A 3FWLA 3KZIH 2FYZA 1FS0E 4Z1MH 2E43A 3HE4B 4Y99C 4WBAA 1G2CB 3RBXA 4PV1D 1CI6A 1NTZE 1EDKA 5I41B 1Q08A 5APUA 3Q5SA 1LT9A 2QSIA 1IFIA 5KCBA 4OH8B 1VQPP 3L75G 3VYIA 2WPSA 1JO5A 5KJ7A 2O01J 1Q82Q 1U57A 1NTZD 3USSA 1G1JA 3ITKA 2HYNA 1SFCD 1UIXA 1DEBA 4IFMA 2WMMA 4XA4A 3H6PA 3L73J 2AXTH 1GW4A 4XFJA 1LWUB 4W7ZA 1KFMA 2IZ1A 1J1DC 3PHLA 2FXPA 2R32A 2P58A 1R8EA 3MUDC 1KB9H 4ZKPA 3CXHD 1YQ4C 2UWJE 1BDCA 4IL6X 1M8OB 1KV4A 2YKPA 3MUDA 1UIIA 1OWAA 1GMJA 1EZVE 4WY4B 1RH6A 1RF1A 1JUNA 4WLSA 2N1TC 5APSA 4J2NA 1URQB 3TNUA 2GOVA 1LX8A 2YXQB 3TSIA 2N1TA 2ZVOB 1EZVD 1HTLC 3RL0C 1A02J 1YHQP 2FYUG 1L0NK 1VF5C 1ZV8A 1L0LG 2BCCJ 2QJPC 4I1LA 3BASA 5AW5B 4YTPC 4OGQC 3H1LG 3LW5J 2Q9IA 1E79H 3HRNA 3FXEA 2V4HA 1NJIQ 3S9OA 3MTUE 1JTHA 1OZHA 4BRYB 1IFPA 5AVVB 2D2CC 1FBMA 1CZQA 2H7HA 2P2UA 1PGJA 3W67A 1PP9E 4PJ0E 4M3LA 1NWQA 2HR3A 5K5GB 1BGYE 3SWYA 1DH3A 4L74A 5BU8B 2FFDC 1D5YA 1SQPE 2E75D 4PV1C 1QLED 1PP9D 1IFJA 3L72J 2FFDA 4W80A 2LKMA 3H1HG 4ZKUA 1BGYD 1BOWA 1N7SB 1SQPD 2FYNC 1AVOA 1SFCC 4L73A 1AQ5A 2WPQA 1SQQK 1EC5A 3WMM0 3L35A 1NVOA 1L2PA 1SFCA 2XV5A 1USEA 2I1JA 5I44A 3MP7B 1JCDA 1Y8AA 1SP4A 1FZCC 3CXHI 3SSUA 5AW0B 1SQVE 3HUSB 1LTAC 2HODA 3N4XA 3BRVB 1KYOH 4JQ0D 1FJPA 1P84I 2QIWA 2YIUB 1NU1E 1GL2B 1KILE 1X9VA 1FDOA 2Q1KA 1SQVD 1R5LA 1BCCJ 2ZAEB 1TU3F 1R8DA 5CCGD 1L0NJ 2NRGA 3GG2A 1CI6B 1K73Q 3M9BA 5E79E 1NU1D 1OVVA 1LT9B 1T6AA 1KILD 1M57D 3RK2C 3Q2YA 4Y99B 4IFFA 1YJNP 3L71G 1HF9A 3H1JE 3LURA 5B5EE 1H88A 4D6TJ 3TGUJ 3Q5PA 1LTJA 2YKQA 2A06E 1Y9BA 3I5CA 2IEFA 1LGHB 3M0AA 1RF0A 2OGUA 4R4MA 3H1IG 5CBOA 1SQVG 3CCJP 3H1JD 1NHLA 2Y0DA 3V2QA 2R44A 1SQXG 2ZVNB 5AW7B 1LTTC 2A06D 3V2PA 5AVSB 1BDDA 3L70E 3M0DA 3CCVP 2CPBA 2E75C 1YI2P 5H2FE 2M0BA 2QEXP 2A45G 1KFNA 4AUWA 5B5EH 4TLFA 3CCEP 4HYTB 5AVRB 4B86A 2BEQD 4DZOA 3S4RA 5GTIE 1RF1B 2B87A 1M1JA 3L70D 3RGUA 2OG0A 1NTKG 2GUSA 3TNUB 2KS1A 1YTZI 4IL6E 3EZ7A 2N1TB 1IJDB 1VPCA 3FWNA 4JBZA 3B49A 5TISH 4GT1A 4Y28J 1HWTC 4KT0J 3WU2E 2V7QH 1U7MA 3L74E 3VTPC 4U3FJ 2JJLA 5APWA 5H2FH 2WSEH 1N73C 1VF5B 1S2EA 1YJWP 1OXZA 2C9LY 2K1AA 2O1JA 2QJPB 2E74D 3RBZA 3V5BA 1N73A 5GTIH 3L70G 2RMZA 3D6YA 1JTHB 3L74D 3AE6C 3AE5C 5GTHE 5E01A 4EI2A 3B4SA 3AE3C 5KLVG 1RE3A 3WU2H 5KLIC 4C7RA 1LP1A 3NTNA 2AEJA 2R5BA 4OWFA 3L75J 2BOWA 1M56D 3BCCE 4H44D 2O3JA 2YO2A 2LXBA 1Q07A 5CCGC 1H8AA 1KMIZ 2RH0A 3CMEP 2FFDB 4NPDA 1M90Q 5APYA 4H13B 4PV1B 1T3JA 4JPZB 1SQBD 1SS1A 3BCCD 1KILA 5GTHH 1QL2A 3LIDA 5AW8B 3VMAA 3V4WA 1NYHA 2KNCA 2HLOA 3RL0D 2W8ZA 1PGPA 4AYZA 2PAJA 2FYNB 4GKGA 3IF4A 1SFCB 3CC2P 3AEBC 1RY3A 3EZ6A 1VQMP 3H1KE 1MZ9A 3EFGA 1YITP 1MFTA 2NPSA 3BCCG 2Z4EA 3PH0A 3KXDA 1S5LH 2GM4A 3GF7A 2FYUJ 3AEAC 1JY3N 3H1KD 1L0LJ 3JCUH 2IBZI 1T8ZA 1Y6UA 3H1LJ 3P32A 1L4AA 1DD3A 5KAVA 1GDTA 2QJYB 3HH0A 2Y0CA 3GW6A 3WUUA 1MFZA 2ZT9D 1NTME 1VQ4P 3KYQA 2Q7CA 3OW2O 1PL5A 1SQVK 3CLQA 5AW3B 2OYHC 3A7OA 2KK7A 1JB0J 3K5BA 4H0LC 2E74C 1SQXK 2IFMA 5AW4B 1LTJB 2QVAA 4RJTA 1NTMD 3CXHE 2ITAA 4R4LA 1IK7A 3L36A 1LJ2A 3C9IA 1BE3G 4WWIA 3BVHA 3D71A 2Q3EA 1IK9A 1VQ6P 1EXJA 1P84E 3H1HJ 1D7MA 4HH2A 4H44C 2GUVA 1M7LA 5DJUB 1NTKK 2WSCJ 2E42A 3PP5A 1AVYA 1OW7A 2CPSA 2E75B 4YXDC 3T97A 4U7JA 1NTZG 1S4XA 1P84D 2B87B 1M1JB 1IFNA 1JBGA 1Q7YQ 2Y9YA 3CXHH 1CSBA 3KQGA 1VDFA 3MIWA 2KS1B 2ZXXA 4AQRD 1ZR4A 2HVAA 4TT3H 3E1IA 1G1IA 2E76C 4I2LC 1KC8Q 2OTKE 1VQNP 3OA7A 3L73E 1KD1Q 2ZYAA 1J1EC 3IN6A 3RK2D 4GODA 1RQVA 2BEZF 5KLVK 3CPWO 4A7PA 1XTGB 1N73B 1FZAA 2MJZA 2P1JA 4PD4D 3A0BE 1R5SA 3L73D 1X79B 3GK6A 1LTIC 1EZVG 2ZHHA 3TK1A 2O01H 2ZHGA 3ABVC 2KUBA 1OW6A 3CCUP 1LP1B 5AVWB 2QRXA 1Q05A 3L71J 4RKUJ 1KZUB 5D90A 3E0HA 3OAKA 2OYIC 2J59M 2ZT9C 2RN0A 3CWBJ 3MZWB 1HVVA 1Q90D 4DJGA 2OYIA 1PM6A 3AEFC 3EWKA 3H1IJ 2BCCE 2QG4A 1SQVJ 2KZIA 4WY4D 1KILB 1SQXJ 3CX5E 1EDIA 3VN0A 1MUUA 1URQD 2H88C 1YBKA 4PJ0H 2KNCB 3P7KA 2KOGA 1K9MQ 2XZRA 1Y47A 4AYZB 1FZBA 2BCCD 1VQOP 2XNXA 1Q2NA 1W5CE 1QL1A 1T2KC 2CK3H 3PTZA 1NO4A 3CX5D 4GOFA 4IOIH 1PP9G 1KB9I 2K9JA 3A2AA 5CCHD 3GP4A 1NAFA 3O6QA 1QVFO 3IR9A 4QMAA 1BGYG 1AJYA 2NPSB 1NTKJ 3PRJA 2WSFH 1MV8A 2HG5D 3MGNA 1SQPG 3AEEC 1EXIA 1JY2N 1FZCA 2W6JH 1ZOYC 3LW5H 1Q09A 1LTSC 1M1KQ 3L72E 3FGAD 2OARA 2HFED 4O9BA 4WLWA 3GHGC 2ZJSE 4HJGH 2I1KA 2Y9ZA 2P7JA 3HTKA 1JY3P 2O01N 2PRRA 2FKWB 3CC4P 2K37A 3LIEA 1L4AB 1EQ7A 3H25A 4C7NA 1VQ9P 3G6EP 3F89A 1FAVA 3L72D 1YJ9P 1JY3O 4JYCA 1AQTA 1JYHA 3M06A 5AVZB 2ZFCA 1SVFA 1PPJE 3U1AA 1OVRA 3I55P 2ZYGA 5KLVJ 2OYHB 5C39A 2E74B 4L75A 4PD4I 3GPVA 4N78E 3AE2C 1QGKB 1PPJD 1J2JB 1LWUC 3HD7D 2KB7P 4HB1A 2WQYC 1QX8A 2AEMA 1NTZK 3VOPA 1VQ5P 1J1DB 1NTMK 1NU1G 5E79H 5CHXA 2G8YA 4N78D 4DT0A 2KLVA 4KJMA 2IBZE 1GK6A 3EZ2A 1BCCE 4H44B 1GZLA 3CMAP 3T97B 1L0NE 3U59A 4B0YA 5APVA 4WY4C 3FXDA 1HH0A 1LTGC 1JNMA 1PGQA 2W83C 3H1JG
chains in the Genus database with same CATH topology
3Q2YA 4H13D 3AEBC 1BOWA 1EXJA 1VF5B 1HF9A 3EZ6A 4WLSA 2FBWC 3Q3DA 2WSFJ 3LURA 4J2NA 4H44C 1Q05A 5L8RJ 4RKUJ 4A1MA 5D90A 3D70A 2E74D 3GLMA 3E0HA 2GOVA 1LX8A 3Q5PA 2WSCJ 3H25A 2E76D 1Y9BA 2FYNC 5KKZC 3D6YA 2IEFA 3AE7C 2DG6A 1KQFB 5GQQA 5D8CA 2ZT9C 1K04A 1RQUA 1OW7A 3AE6C 4R4MA 2QJKC 2E75B 3AE5C 5E01A 4YXDC 1YQ3C 1Q90D 1JYHA 4Z1MH 4U7JA 1PM6A 3AEFC 1VF5C 3EWKA 3AEDC 1PV3A 2P10A 2WPVB 4PV1D 3AE3C 1JBGA 5I41B 3GF7A 2QJPC 3AEAC 3AE8C 1Q08A 5M1BA 3Q5SA 2IDBA 3R4YA 2QSIA 4H0LD 3UCSA 2YMKA 5I44A 4YTPC 5KAWA 2JMLA 4OGQC 5KCBA 5KLIC 1KTMA 4OGQB 3AE1C 3LW5J 2HVAA 2MKVA 1Y6UA 2H88C 2BOWA 3Q5RA 2V7QJ 2E74B 4TT3H 2O01J 4H44D 2JO1A 2E76C 3GPVA 2E75C 3RL0g 1NGMB 1DIPA 3S9OA 1DD3A 2KCUA 3AE4C 2E76B 5KAVA 4I7ZB 1Q07A 2QJYC 3R8KA 3EZFA 4AYZB 3AE2C 1KMIZ 1U57A 2WSEJ 4DCZA 2D2CC 3AE9C 3HH0A 1OW8A 2D2CB 3D6ZA 1DD4A 2ZT9D 3Q1MA 1UIXA 2KVVA 2BEQD 2J5UA 4H13C 3AECC 3IAOA 3EZ9A 2JP3A 2WQYC 3B71A 1VL2A 4H13B 1S5LX 4PV1B 3GMAA 4XFJA 1PL5A 3R8JA 3IN6A 1VF5D 1JB0J 3G9RA 1RQVA 2K9YA 1S1CX 2FXPA 4H0LC 1Q06A 2E74C 3GP4A 2YIUC 2BEZF 2OG0A 3O6QA 1Q0AA 4H0LB 1ZP0C 2QIWA 1KORA 2OQQA 2G8YA 4I7ZC 1KILE 1ZRTE 1AJYA 4LHFA 1WMKA 1R8EA 4R4EA 4OGQD 3EZ7A 1FDOA 4R24B 2G3AA 1MKMA 1OMIA 3EZ2A 1NYHA 4GDOA 3B49A 1HJ0A 1FDIA 4H44B 3SFEC 1YQ4C 3AEEC 4Y28J 3C8VA 1EXIA 4KT0J 1D5YA 1TU3F 4R22B 1R8DA 2E75D 4R4LA 3GK6A 4AYZA 4IL6X 1IK7A 1KQGB 1ZOYC 4PV1C 3T97B 4B0YA 1K05A 3GF3A 1Q09A 2NZ2A 2ZHHA 1PIXA 1GMJA 2D2CD 5KAUA 3FGAD 2ZT9B 2ZHGA 4WLWA 3SFDC 5KATA 2VZ4A 3ABVC 5KAXA 3D71A 3AEGC 3RK3E 3QAOA 1RH6A 1ZMEC 1OW6A 2H89C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2Y A;  1R8E A;  4R4E A;  4AYZ B;  1BOW A;  1EXJ A;  4R24 B;  4WLS A;  3HH0 A;  1JBG A;  3Q3D A;  3LUR A;  4J2N A;  5I41 B;  3B49 A;  1Q08 A;  3D6Z A;  1Q05 A;  3Q5S A;  4A1M A;  5D90 A;  3Q1M A;  3D70 A;  3E0H A;  3UCS A;  2GOV A;  5I44 A;  1EXI A;  1D5Y A;  5KAW A;  2JML A;  4R22 B;  3Q5P A;  1R8D A;  3IAO A;  2J5U A;  4R4L A;  3GK6 A;  5KCB A;  4AYZ A;  3T97 B;  3R8J A;  4B0Y A;  3D6Y A;  1Q09 A;  2DG6 A;  3R8K A;  5GQQ A;  2ZHH A;  5D8C A;  2HVA A;  3G9R A;  5KAU A;  2ZHG A;  1Q06 A;  3Q5R A;  3GP4 A;  4WLW A;  2BOW A;  1Q0A A;  4R4M A;  2VZ4 A;  5KAT A;  3GPV A;  5KAX A;  1DIP A;  3D71 A;  2OQQ A;  2KCU A;  3QAO A;  5E01 A;  5KAV A;  1JYH A;  1Q07 A; 
#chains in the Genus database with same CATH topology
 2IBZ D;  1URQ C;  1BCC D;  3P8M C;  4D6T E;  3TGU E;  1IFM A;  2A06 G;  1NOH A;  2K3R A;  1SQQ J;  1L0N D;  2KI7 B;  2BAS A;  3MD0 A;  3AE7 C;  1K04 A;  1AV1 A;  3RL0 B;  1PZQ A;  4MN4 C;  3CX5 I;  5CCH C;  4EYY Q;  4RES B;  4KHX A;  3AE8 C;  3G4S P;  4D6T D;  2IDB A;  3TGU D;  4EDF A;  4H0L D;  4OGQ B;  1VQL P;  5AVT B;  1J1E B;  5CCH A;  1X8Y A;  4WVZ A;  3Q5R A;  2JWD A;  1GTW A;  4IFD K;  4IL6 H;  2YKO A;  2C9N Y;  1OW8 A;  2D2C B;  2YNY A;  2PP6 A;  3VP9 A;  4GOE A;  3KPE A;  1USD A;  1HJB A;  1AFO A;  3EZ9 A;  2E5Y A;  2XKM A;  2W90 A;  1S1C X;  1SQB E;  1ZRT E;  2QA4 P;  3L37 A;  1ZR2 A;  3E1R A;  2YO3 A;  5DJT B;  3HE5 A;  2JR8 A;  4C46 A;  3JSV C;  4R22 B;  1GK4 A;  3TYY A;  1Q81 Q;  2OYI B;  5CCG A;  3L74 G;  1N8R Q;  2ZT9 B;  1LT1 A;  4U3F E;  1BE3 J;  3N7N A;  4LGD E;  5KAT A;  4W7Y A;  3L4F A;  3RK3 E;  1ZRT D;  1S9K E;  3IFM A;  1HBW A;  2B89 A;  2FBW C;  2PFX A;  5AVU B;  1YIJ P;  4I6M C;  2E76 D;  3JC2 2;  2I8D A;  5AW6 B;  5KKZ C;  5KAF E;  3FX0 A;  5GQQ A;  1SLQ A;  4U3F D;  2A45 I;  3HD7 C;  4LC1 A;  3RK3 D;  1SQP K;  4JYB A;  1S9K D;  2P10 A;  2GA1 A;  2K9J B;  1NTZ J;  2W27 A;  5M1B A;  3HD7 A;  3O6Q B;  3UCS A;  2KLU A;  2JML A;  3M9H A;  1KTM A;  1SQB G;  3CCM P;  3L75 E;  1NGM B;  1ZLL A;  1JEK A;  1DX7 A;  1IO4 A;  3V2N A;  1FZC B;  3HUS C;  5CJ0 A;  3D6Z A;  1LTB C;  2JP3 A;  5KAF H;  3HTK B;  2M8R A;  4U3F G;  2FY8 A;  3L75 D;  5BU5 A;  2JDI H;  4N3Y B;  2QE7 H;  2YIU C;  3GHG B;  4UB8 E;  4C7N B;  3C8V A;  4K3A A;  1EDJ A;  1K05 A;  3GF3 A;  2NZ2 A;  3C1L A;  4GIF A;  3SFD C;  3QH9 A;  1LT9 C;  1FOS E;  5KAX A;  1H0T A;  3QAO A;  4H13 D;  3RK2 B;  1KB9 E;  3H1K G;  3Q3D A;  2OYH A;  5KJ7 C;  2KSJ A;  2WIT A;  2WT7 A;  1NU1 K;  5AW9 B;  2C0W A;  2WVR A;  1H89 A;  1HGV A;  2QJK C;  1T2K D;  1YQ3 C;  4OVN F;  4UB8 H;  1KB9 D;  1PGO A;  1JM0 A;  2FYU E;  1GU4 A;  1L0L E;  3MHV A;  3R4Y A;  2IYO A;  1S72 P;  3BRT B;  3AE1 C;  3H1L E;  2KXP B;  3OJA B;  3UIA A;  2KP8 A;  3E7K A;  1DIP A;  3A5T A;  3AE4 C;  2FYU D;  3H32 A;  2SPZ A;  1NTM G;  1L0L D;  3W68 A;  3CCQ P;  2M5A A;  1RF1 C;  3GMA A;  3EFF K;  3H1L D;  1Q06 A;  1PP9 J;  4YXW H;  5AVX B;  1FJK A;  3B8E B;  4I7Z C;  2K88 A;  2POH A;  4R4E A;  3B5N D;  4R24 B;  1P84 H;  3V6I A;  1BGY J;  3VMX A;  4ZMD A;  1XTC C;  3M91 A;  4CPG A;  4PD4 E;  3RK3 C;  1SQP J;  1NAY A;  1KQG B;  1ZXG A;  1W2B O;  2PGD A;  5KAU A;  1IFD A;  4NPF X;  1ZME C;  3I56 P;  3TDK A;  5APQ A;  2XND H;  3H1H E;  2R5D A;  2WSF J;  1NKZ B;  1ZN5 A;  2H8P D;  1W2E A;  1OIP A;  3GLM A;  5KAI E;  2HPC A;  2FXM A;  1IZN B;  2Y0E A;  2IZ0 A;  1RHZ B;  1CW5 A;  1FZE A;  1FDM A;  1EDL A;  2C0X A;  2W6A A;  3AED C;  3H1H D;  1PV3 A;  4PD4 H;  3A0H E;  1HUC A;  4BXL A;  1S3J A;  1A02 F;  5KLI B;  3G71 P;  3RL0 g;  2JO1 A;  2KSE A;  1YTZ T;  2XDJ A;  3HE5 B;  3EZF A;  2B9B A;  4DCZ A;  3AE9 C;  1VQ8 P;  3L73 G;  3A0B H;  5KAI H;  2WSC H;  2OTJ P;  1U7J A;  2J5U A;  4H13 C;  1WT6 A;  1VL2 A;  1S5L X;  2KIK A;  1X0T A;  3NMD A;  2WTY A;  2OYO A;  1ZP0 C;  1T3U A;  1QEX A;  2OQQ A;  1E5W A;  1NU1 J;  1WMK A;  1OMI A;  3A0H H;  4GDO A;  5AW2 B;  1SQB K;  4YPC A;  1KYO E;  3VP8 A;  2Q3I A;  2R3S A;  2XU6 A;  5KKZ B;  3VMY A;  1JOC A;  3HD7 B;  1GU5 A;  1RH5 B;  2M3B A;  3R2P A;  4ASW A;  3H1J J;  2WSS H;  3L71 E;  1KYO D;  4WB4 A;  1NKN A;  3CX5 H;  2J58 A;  1KQF B;  2O1K A;  3CWB E;  4AYC A;  2LXC B;  2E5T A;  3CCL P;  2BCC G;  3H1I E;  3WUV A;  5AVQ B;  1Z56 A;  4DCK A;  3O8Z A;  1KN7 A;  3L71 D;  3GHG A;  1SQX E;  1GW3 A;  2YMK A;  5KAW A;  3B5N C;  4NPE A;  1VQK P;  2P67 A;  3CWB D;  3L70 J;  2DW3 A;  1JMM A;  2V7Q J;  1LNQ A;  2KCU A;  3B5N A;  3H1I D;  2QJY C;  4JF7 A;  2WSE J;  1OVU A;  4UB6 E;  1SQX D;  1EZV I;  1H0T B;  3S1K A;  3HE4 A;  3AEC C;  1G2C A;  3NXS A;  3A3Y B;  1N7S D;  2K9Y A;  4H0L B;  1Q0A A;  2WZ7 A;  2JWA A;  2WT7 B;  1FC2 C;  1LTJ C;  1NTK E;  3SWK A;  1RF0 C;  2M3E A;  1HJ0 A;  1FDI A;  5CMZ A;  4L76 A;  2WWW A;  5KTB A;  3CC7 P;  3L72 G;  4ZNC A;  3CWB G;  2Z5H A;  3M9Q A;  5AVY B;  2QM7 A;  3II6 A;  3L74 J;  5CJ4 A;  2QJK B;  3AEG C;  1NTK D;  3F5H A;  1LWU A;  2IYP A;  1BSH A;  3M0D C;  2A45 H;  4UB6 H;  5L8R J;  5TIS E;  1ZW0 A;  1FZF A;  2NPS D;  3H32 B;  3U1C A;  5B66 E;  2M5A B;  4EIJ A;  1M1J C;  2WPV B;  1JCC A;  1PPJ G;  1NH4 A;  4WY4 A;  2YXR B;  3TF5 A;  2VRS A;  5KLV E;  1GL2 D;  1FE6 A;  2FYU K;  3PJS K;  1KQL A;  3PLN A;  1URQ A;  1L0L K;  3KHU A;  1K8A Q;  1N2D C;  1SQB J;  1L4A D;  3BCC J;  2E76 B;  4I7Z B;  3R8K A;  2JEE A;  2N9Y B;  1DD4 A;  3Q1M A;  3RK3 B;  5KLV D;  3G3Z A;  3IAO A;  3B71 A;  3R8J A;  1KOR A;  2IBZ G;  5KJ7 D;  5B66 H;  1KYO I;  2HPC B;  4LHF A;  1VQ7 P;  2G3A A;  2IX7 C;  2R3C A;  1BCC G;  4N6J A;  5EFW B;  3SFE C;  1X22 A;  2L91 A;  3CCR P;  1L0N G;  1HGZ A;  3V4Q A;  4BRY A;  1QVG O;  2ZXE B;  2IPP A;  1RE3 C;  2KZJ A;  3VMZ A;  1GD2 E;  4DOJ A;  2VZ4 A;  5TJH A;  2AXC A;  1N86 A;  4ASV A;  1DEE G;  3KDP B;  2Q5U A;  4D6T G;  1PFI A;  3TGU G;  2FXO A;  2N9B A;  3H1K J;  5APX A;  1SQQ E;  4XE5 B;  2JKV A;  3CCS P;  4HKZ H;  2DG6 A;  3P8C E;  3NFQ A;  3BAT A;  3V2R A;  2H43 A;  3CD6 P;  3ZDM A;  1N7S C;  2Z5I A;  1YYC A;  2OTL P;  1KIL C;  1SQQ D;  3CL3 D;  3EQ2 A;  1OX3 A;  1N7S A;  2MKV A;  2KYV A;  2N1T D;  1FZG A;  2YMY A;  3P8C D;  5APT A;  3CI9 A;  4RO0 A;  1S5L E;  4EOT A;  4BWN A;  1RE4 C;  3JCU E;  1N7L A;  1Q86 Q;  2KVV A;  1NTM J;  5BVZ A;  3QWO C;  5CBN A;  1VF5 D;  2AEF A;  3G9R A;  1RE4 A;  2QM8 A;  1OFC X;  1KQS O;  2NPS C;  3KZI E;  3WUT A;  4OGQ D;  2RKL A;  1MKM A;  1JMB A;  1IC2 A;  1SQQ G;  2L5G B;  1JY2 P;  4LLH A;  2B88 A;  3HUS A;  1PIX A;  1BE3 E;  2D2C D;  2HOD B;  2ZYD A;  3SWF A;  5AW1 B;  1GL2 C;  4K35 A;  2H89 C;  1JY2 O;  1BSN A;  1FU1 A;  1L4A C;  4A1M A;  3D70 A;  1GL2 A;  2WPR A;  3B5N B;  2AXT E;  2LR2 A;  1FOS F;  1WRG A;  2Q6Q A;  5D8C A;  1BE3 D;  2W6B A;  1RQU A;  2IFN A;  1AA0 A;  3FWL A;  3KZI H;  2FYZ A;  1FS0 E;  4Z1M H;  2E43 A;  3HE4 B;  4Y99 C;  4WBA A;  1G2C B;  3RBX A;  4PV1 D;  1CI6 A;  1NTZ E;  1EDK A;  5I41 B;  1Q08 A;  5APU A;  3Q5S A;  1LT9 A;  2QSI A;  1IFI A;  5KCB A;  4OH8 B;  1VQP P;  3L75 G;  3VYI A;  2WPS A;  1JO5 A;  5KJ7 A;  2O01 J;  1Q82 Q;  1U57 A;  1NTZ D;  3USS A;  1G1J A;  3ITK A;  2HYN A;  1SFC D;  1UIX A;  1DEB A;  4IFM A;  2WMM A;  4XA4 A;  3H6P A;  3L73 J;  2AXT H;  1GW4 A;  4XFJ A;  1LWU B;  4W7Z A;  1KFM A;  2IZ1 A;  1J1D C;  3PHL A;  2FXP A;  2R32 A;  2P58 A;  1R8E A;  3MUD C;  1KB9 H;  4ZKP A;  3CXH D;  1YQ4 C;  2UWJ E;  1BDC A;  4IL6 X;  1M8O B;  1KV4 A;  2YKP A;  3MUD A;  1UII A;  1OWA A;  1GMJ A;  1EZV E;  4WY4 B;  1RH6 A;  1RF1 A;  1JUN A;  4WLS A;  2N1T C;  5APS A;  4J2N A;  1URQ B;  3TNU A;  2GOV A;  1LX8 A;  2YXQ B;  3TSI A;  2N1T A;  2ZVO B;  1EZV D;  1HTL C;  3RL0 C;  1A02 J;  1YHQ P;  2FYU G;  1L0N K;  1VF5 C;  1ZV8 A;  1L0L G;  2BCC J;  2QJP C;  4I1L A;  3BAS A;  5AW5 B;  4YTP C;  4OGQ C;  3H1L G;  3LW5 J;  2Q9I A;  1E79 H;  3HRN A;  3FXE A;  2V4H A;  1NJI Q;  3S9O A;  3MTU E;  1JTH A;  1OZH A;  4BRY B;  1IFP A;  5AVV B;  2D2C C;  1FBM A;  1CZQ A;  2H7H A;  2P2U A;  1PGJ A;  3W67 A;  1PP9 E;  4PJ0 E;  4M3L A;  1NWQ A;  2HR3 A;  5K5G B;  1BGY E;  3SWY A;  1DH3 A;  4L74 A;  5BU8 B;  2FFD C;  1D5Y A;  1SQP E;  2E75 D;  4PV1 C;  1QLE D;  1PP9 D;  1IFJ A;  3L72 J;  2FFD A;  4W80 A;  2LKM A;  3H1H G;  4ZKU A;  1BGY D;  1BOW A;  1N7S B;  1SQP D;  2FYN C;  1AVO A;  1SFC C;  4L73 A;  1AQ5 A;  2WPQ A;  1SQQ K;  1EC5 A;  3WMM 0;  3L35 A;  1NVO A;  1L2P A;  1SFC A;  2XV5 A;  1USE A;  2I1J A;  5I44 A;  3MP7 B;  1JCD A;  1Y8A A;  1SP4 A;  1FZC C;  3CXH I;  3SSU A;  5AW0 B;  1SQV E;  3HUS B;  1LTA C;  2HOD A;  3N4X A;  3BRV B;  1KYO H;  4JQ0 D;  1FJP A;  1P84 I;  2QIW A;  2YIU B;  1NU1 E;  1GL2 B;  1KIL E;  1X9V A;  1FDO A;  2Q1K A;  1SQV D;  1R5L A;  1BCC J;  2ZAE B;  1TU3 F;  1R8D A;  5CCG D;  1L0N J;  2NRG A;  3GG2 A;  1CI6 B;  1K73 Q;  3M9B A;  5E79 E;  1NU1 D;  1OVV A;  1LT9 B;  1T6A A;  1KIL D;  1M57 D;  3RK2 C;  3Q2Y A;  4Y99 B;  4IFF A;  1YJN P;  3L71 G;  1HF9 A;  3H1J E;  3LUR A;  5B5E E;  1H88 A;  4D6T J;  3TGU J;  3Q5P A;  1LTJ A;  2YKQ A;  2A06 E;  1Y9B A;  3I5C A;  2IEF A;  1LGH B;  3M0A A;  1RF0 A;  2OGU A;  4R4M A;  3H1I G;  5CBO A;  1SQV G;  3CCJ P;  3H1J D;  1NHL A;  2Y0D A;  3V2Q A;  2R44 A;  1SQX G;  2ZVN B;  5AW7 B;  1LTT C;  2A06 D;  3V2P A;  5AVS B;  1BDD A;  3L70 E;  3M0D A;  3CCV P;  2CPB A;  2E75 C;  1YI2 P;  5H2F E;  2M0B A;  2QEX P;  2A45 G;  1KFN A;  4AUW A;  5B5E H;  4TLF A;  3CCE P;  4HYT B;  5AVR B;  4B86 A;  2BEQ D;  4DZO A;  3S4R A;  5GTI E;  1RF1 B;  2B87 A;  1M1J A;  3L70 D;  3RGU A;  2OG0 A;  1NTK G;  2GUS A;  3TNU B;  2KS1 A;  1YTZ I;  4IL6 E;  3EZ7 A;  2N1T B;  1IJD B;  1VPC A;  3FWN A;  4JBZ A;  3B49 A;  5TIS H;  4GT1 A;  4Y28 J;  1HWT C;  4KT0 J;  3WU2 E;  2V7Q H;  1U7M A;  3L74 E;  3VTP C;  4U3F J;  2JJL A;  5APW A;  5H2F H;  2WSE H;  1N73 C;  1VF5 B;  1S2E A;  1YJW P;  1OXZ A;  2C9L Y;  2K1A A;  2O1J A;  2QJP B;  2E74 D;  3RBZ A;  3V5B A;  1N73 A;  5GTI H;  3L70 G;  2RMZ A;  3D6Y A;  1JTH B;  3L74 D;  3AE6 C;  3AE5 C;  5GTH E;  5E01 A;  4EI2 A;  3B4S A;  3AE3 C;  5KLV G;  1RE3 A;  3WU2 H;  5KLI C;  4C7R A;  1LP1 A;  3NTN A;  2AEJ A;  2R5B A;  4OWF A;  3L75 J;  2BOW A;  1M56 D;  3BCC E;  4H44 D;  2O3J A;  2YO2 A;  2LXB A;  1Q07 A;  5CCG C;  1H8A A;  1KMI Z;  2RH0 A;  3CME P;  2FFD B;  4NPD A;  1M90 Q;  5APY A;  4H13 B;  4PV1 B;  1T3J A;  4JPZ B;  1SQB D;  1SS1 A;  3BCC D;  1KIL A;  5GTH H;  1QL2 A;  3LID A;  5AW8 B;  3VMA A;  3V4W A;  1NYH A;  2KNC A;  2HLO A;  3RL0 D;  2W8Z A;  1PGP A;  4AYZ A;  2PAJ A;  2FYN B;  4GKG A;  3IF4 A;  1SFC B;  3CC2 P;  3AEB C;  1RY3 A;  3EZ6 A;  1VQM P;  3H1K E;  1MZ9 A;  3EFG A;  1YIT P;  1MFT A;  2NPS A;  3BCC G;  2Z4E A;  3PH0 A;  3KXD A;  1S5L H;  2GM4 A;  3GF7 A;  2FYU J;  3AEA C;  1JY3 N;  3H1K D;  1L0L J;  3JCU H;  2IBZ I;  1T8Z A;  1Y6U A;  3H1L J;  3P32 A;  1L4A A;  1DD3 A;  5KAV A;  1GDT A;  2QJY B;  3HH0 A;  2Y0C A;  3GW6 A;  3WUU A;  1MFZ A;  2ZT9 D;  1NTM E;  1VQ4 P;  3KYQ A;  2Q7C A;  3OW2 O;  1PL5 A;  1SQV K;  3CLQ A;  5AW3 B;  2OYH C;  3A7O A;  2KK7 A;  1JB0 J;  3K5B A;  4H0L C;  2E74 C;  1SQX K;  2IFM A;  5AW4 B;  1LTJ B;  2QVA A;  4RJT A;  1NTM D;  3CXH E;  2ITA A;  4R4L A;  1IK7 A;  3L36 A;  1LJ2 A;  3C9I A;  1BE3 G;  4WWI A;  3BVH A;  3D71 A;  2Q3E A;  1IK9 A;  1VQ6 P;  1EXJ A;  1P84 E;  3H1H J;  1D7M A;  4HH2 A;  4H44 C;  2GUV A;  1M7L A;  5DJU B;  1NTK K;  2WSC J;  2E42 A;  3PP5 A;  1AVY A;  1OW7 A;  2CPS A;  2E75 B;  4YXD C;  3T97 A;  4U7J A;  1NTZ G;  1S4X A;  1P84 D;  2B87 B;  1M1J B;  1IFN A;  1JBG A;  1Q7Y Q;  2Y9Y A;  3CXH H;  1CSB A;  3KQG A;  1VDF A;  3MIW A;  2KS1 B;  2ZXX A;  4AQR D;  1ZR4 A;  2HVA A;  4TT3 H;  3E1I A;  1G1I A;  2E76 C;  4I2L C;  1KC8 Q;  2OTK E;  1VQN P;  3OA7 A;  3L73 E;  1KD1 Q;  2ZYA A;  1J1E C;  3IN6 A;  3RK2 D;  4GOD A;  1RQV A;  2BEZ F;  5KLV K;  3CPW O;  4A7P A;  1XTG B;  1N73 B;  1FZA A;  2MJZ A;  2P1J A;  4PD4 D;  3A0B E;  1R5S A;  3L73 D;  1X79 B;  3GK6 A;  1LTI C;  1EZV G;  2ZHH A;  3TK1 A;  2O01 H;  2ZHG A;  3ABV C;  2KUB A;  1OW6 A;  3CCU P;  1LP1 B;  5AVW B;  2QRX A;  1Q05 A;  3L71 J;  4RKU J;  1KZU B;  5D90 A;  3E0H A;  3OAK A;  2OYI C;  2J59 M;  2ZT9 C;  2RN0 A;  3CWB J;  3MZW B;  1HVV A;  1Q90 D;  4DJG A;  2OYI A;  1PM6 A;  3AEF C;  3EWK A;  3H1I J;  2BCC E;  2QG4 A;  1SQV J;  2KZI A;  4WY4 D;  1KIL B;  1SQX J;  3CX5 E;  1EDI A;  3VN0 A;  1MUU A;  1URQ D;  2H88 C;  1YBK A;  4PJ0 H;  2KNC B;  3P7K A;  2KOG A;  1K9M Q;  2XZR A;  1Y47 A;  4AYZ B;  1FZB A;  2BCC D;  1VQO P;  2XNX A;  1Q2N A;  1W5C E;  1QL1 A;  1T2K C;  2CK3 H;  3PTZ A;  1NO4 A;  3CX5 D;  4GOF A;  4IOI H;  1PP9 G;  1KB9 I;  2K9J A;  3A2A A;  5CCH D;  3GP4 A;  1NAF A;  3O6Q A;  1QVF O;  3IR9 A;  4QMA A;  1BGY G;  1AJY A;  2NPS B;  1NTK J;  3PRJ A;  2WSF H;  1MV8 A;  2HG5 D;  3MGN A;  1SQP G;  3AEE C;  1EXI A;  1JY2 N;  1FZC A;  2W6J H;  1ZOY C;  3LW5 H;  1Q09 A;  1LTS C;  1M1K Q;  3L72 E;  3FGA D;  2OAR A;  2HFE D;  4O9B A;  4WLW A;  3GHG C;  2ZJS E;  4HJG H;  2I1K A;  2Y9Z A;  2P7J A;  3HTK A;  1JY3 P;  2O01 N;  2PRR A;  2FKW B;  3CC4 P;  2K37 A;  3LIE A;  1L4A B;  1EQ7 A;  3H25 A;  4C7N A;  1VQ9 P;  3G6E P;  3F89 A;  1FAV A;  3L72 D;  1YJ9 P;  1JY3 O;  4JYC A;  1AQT A;  1JYH A;  3M06 A;  5AVZ B;  2ZFC A;  1SVF A;  1PPJ E;  3U1A A;  1OVR A;  3I55 P;  2ZYG A;  5KLV J;  2OYH B;  5C39 A;  2E74 B;  4L75 A;  4PD4 I;  3GPV A;  4N78 E;  3AE2 C;  1QGK B;  1PPJ D;  1J2J B;  1LWU C;  3HD7 D;  2KB7 P;  4HB1 A;  2WQY C;  1QX8 A;  2AEM A;  1NTZ K;  3VOP A;  1VQ5 P;  1J1D B;  1NTM K;  1NU1 G;  5E79 H;  5CHX A;  2G8Y A;  4N78 D;  4DT0 A;  2KLV A;  4KJM A;  2IBZ E;  1GK6 A;  3EZ2 A;  1BCC E;  4H44 B;  1GZL A;  3CMA P;  3T97 B;  1L0N E;  3U59 A;  4B0Y A;  5APV A;  4WY4 C;  3FXD A;  1HH0 A;  1LTG C;  1JNM A;  1PGQ A;  2W83 C;  3H1J G; 
#chains in the Genus database with same CATH homology
 3Q2Y A;  4H13 D;  3AEB C;  1BOW A;  1EXJ A;  1VF5 B;  1HF9 A;  3EZ6 A;  4WLS A;  2FBW C;  3Q3D A;  2WSF J;  3LUR A;  4J2N A;  4H44 C;  1Q05 A;  5L8R J;  4RKU J;  4A1M A;  5D90 A;  3D70 A;  2E74 D;  3GLM A;  3E0H A;  2GOV A;  1LX8 A;  3Q5P A;  2WSC J;  3H25 A;  2E76 D;  1Y9B A;  2FYN C;  5KKZ C;  3D6Y A;  2IEF A;  3AE7 C;  2DG6 A;  1KQF B;  5GQQ A;  5D8C A;  2ZT9 C;  1K04 A;  1RQU A;  1OW7 A;  3AE6 C;  4R4M A;  2QJK C;  2E75 B;  3AE5 C;  5E01 A;  4YXD C;  1YQ3 C;  1Q90 D;  1JYH A;  4Z1M H;  4U7J A;  1PM6 A;  3AEF C;  1VF5 C;  3EWK A;  3AED C;  1PV3 A;  2P10 A;  2WPV B;  4PV1 D;  3AE3 C;  1JBG A;  5I41 B;  3GF7 A;  2QJP C;  3AEA C;  3AE8 C;  1Q08 A;  5M1B A;  3Q5S A;  2IDB A;  3R4Y A;  2QSI A;  4H0L D;  3UCS A;  2YMK A;  5I44 A;  4YTP C;  5KAW A;  2JML A;  4OGQ C;  5KCB A;  5KLI C;  1KTM A;  4OGQ B;  3AE1 C;  3LW5 J;  2HVA A;  2MKV A;  1Y6U A;  2H88 C;  2BOW A;  3Q5R A;  2V7Q J;  2E74 B;  4TT3 H;  2O01 J;  4H44 D;  2JO1 A;  2E76 C;  3GPV A;  2E75 C;  3RL0 g;  1NGM B;  1DIP A;  3S9O A;  1DD3 A;  2KCU A;  3AE4 C;  2E76 B;  5KAV A;  4I7Z B;  1Q07 A;  2QJY C;  3R8K A;  3EZF A;  4AYZ B;  3AE2 C;  1KMI Z;  1U57 A;  2WSE J;  4DCZ A;  2D2C C;  3AE9 C;  3HH0 A;  1OW8 A;  2D2C B;  3D6Z A;  1DD4 A;  2ZT9 D;  3Q1M A;  1UIX A;  2KVV A;  2BEQ D;  2J5U A;  4H13 C;  3AEC C;  3IAO A;  3EZ9 A;  2JP3 A;  2WQY C;  3B71 A;  1VL2 A;  4H13 B;  1S5L X;  4PV1 B;  3GMA A;  4XFJ A;  1PL5 A;  3R8J A;  3IN6 A;  1VF5 D;  1JB0 J;  3G9R A;  1RQV A;  2K9Y A;  1S1C X;  2FXP A;  4H0L C;  1Q06 A;  2E74 C;  3GP4 A;  2YIU C;  2BEZ F;  2OG0 A;  3O6Q A;  1Q0A A;  4H0L B;  1ZP0 C;  2QIW A;  1KOR A;  2OQQ A;  2G8Y A;  4I7Z C;  1KIL E;  1ZRT E;  1AJY A;  4LHF A;  1WMK A;  1R8E A;  4R4E A;  4OGQ D;  3EZ7 A;  1FDO A;  4R24 B;  2G3A A;  1MKM A;  1OMI A;  3EZ2 A;  1NYH A;  4GDO A;  3B49 A;  1HJ0 A;  1FDI A;  4H44 B;  3SFE C;  1YQ4 C;  3AEE C;  4Y28 J;  3C8V A;  1EXI A;  4KT0 J;  1D5Y A;  1TU3 F;  4R22 B;  1R8D A;  2E75 D;  4R4L A;  3GK6 A;  4AYZ A;  4IL6 X;  1IK7 A;  1KQG B;  1ZOY C;  4PV1 C;  3T97 B;  4B0Y A;  1K05 A;  3GF3 A;  1Q09 A;  2NZ2 A;  2ZHH A;  1PIX A;  1GMJ A;  2D2C D;  5KAU A;  3FGA D;  2ZT9 B;  2ZHG A;  4WLW A;  3SFD C;  5KAT A;  2VZ4 A;  3ABV C;  5KAX A;  3D71 A;  3AEG C;  3RK3 E;  3QAO A;  1RH6 A;  1ZME C;  1OW6 A;  2H89 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...