1R8EA

Crystal structure of bmrr bound to dna at 2.4a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
275
structure length
275
Chain Sequence
ESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLKYIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPALGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYTSIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYIADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural mechanism for transcription activation by MerR family member multidrug transporter activation, N terminus.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription/dna
molecule keywords 5'-D(*GP*AP*CP*CP*CP*TP*CP*CP*CP*CP*TP*TP*AP*GP*GP*GP*GP*AP*
total genus 84
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2003-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00376 MerR MerR family regulatory protein
A PF06445 GyrI-like GyrI-like small molecule binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.10 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 1r8eA02
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1r8eA03
3.20.80.10 Alpha Beta Alpha-Beta Barrel Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A Regulatory factor, effector binding domain 1r8eA01
1Q07A 4R24B 1BOWA 3D6ZA 4R4EA 3Q1MA 3Q2YA 4R22B 1JBGA 3Q5SA 3QAOA 3T97B 3GP4A 3E0HA 3R8KA 2ZHGA 2HVAA 5I41B 5KAVA 5KATA 2ZHHA 4AYZB 5GQQA 5D90A 5KCBA 2J5UA 1Q0AA 1EXJA 3Q3DA 4B0YA 5KAXA 2VZ4A 3Q5RA 2JMLA 1R8DA 2OQQA 4WLWA 1Q09A 1Q08A 3UCSA 1Q06A 5D8CA 3R8JA 4AYZA 3Q5PA 3D6YA 2KCUA 4R4MA 5KAUA 3D71A 3B49A 1Q05A 4J2NA 5E01A 3GPVA 3HH0A 1R8EA 4R4LA 3D70A 3LURA 2DG6A 3IAOA 1JYHA 2BOWA 3GK6A 1DIPA 4A1MA 4WLSA 5I44A 1D5YA 1EXIA 2GOVA 3G9RA 5KAWA
chains in the Genus database with same CATH superfamily
1NU1J 3V2PA 2H7HA 3O8ZA 4Z1MH 3CI9A 1MFZA 1Q06A 1JY2O 2Z5HA 3E1IA 1SQQD 4YTPC 1YIJP 1EZVI 5KAFE 4BXLA 1SQXK 2YNYA 1LTJB 2GA1A 1S5LX 1SQVK 3TK1A 3HTKA 3CCMP 1N8RQ 3JC22 3VMYA 5CJ0A 1M1JA 1N7LA 4PV1C 4WY4A 3CX5H 3AEBC 4C7RA 1J1DB 4RKUJ 1OVUA 3IN6A 4YPCA 3L35A 1H8AA 1ZMEC 1VQ8P 1NTKG 4PJ0E 3U1AA 2H8PD 1RE3A 3T97A 1PPJE 3PP5A 1JY3N 2CK3H 4D6TD 3L74D 1AVYA 1JYHA 4WLSA 1EDKA 1N2DC 3E7KA 3NXSA 2G8YA 2BCCE 1PP9J 4JYBA 1ZRTD 1VF5C 4L75A 1KYOH 5AW9B 2WPRA 4Y99B 2OYHC 3D71A 3L4FA 4N3YB 2IBZG 1PL5A 3RBXA 3JSVC 2WTYA 2IX7C 1KFNA 3H1KD 3H1ID 1AJYA 1P84D 3RK3C 1VQ7P 3VP9A 2PP6A 4TT3H 1L4AB 2ZT9B 2A45I 1AVOA 1PM6A 3L72J 2E75C 4K35A 1IK7A 3HE4B 5DJUB 3CWBJ 2FYUG 2WITA 1YJNP 1IFNA 1RE4A 1A02J 1QL2A 1YYCA 2E76D 2OGUA 3H1LD 3A2AA 3P8CD 3H1IE 2WT7A 1J1DC 2W6BA 1PGQA 5B66H 2IFNA 1NTMG 1N73B 3H1LJ 3Q1MA 1OIPA 3JCUE 1E79H 3O6QA 3GF3A 2Z5IA 2IYPA 3NMDA 1LTTC 3OW2O 1PP9G 4IL6X 4UB8H 3H1KE 1PP9D 1KC8Q 3L72D 4KJMA 1G2CA 4ZMDA 2C9LY 2FYNC 3WUUA 5CBNA 4PV1D 4MN4C 5GTIH 2B87B 3H1HE 3PH0A 5AW6B 1L2PA 2XV5A 1P84H 4B0YA 4U3FJ 3H1KJ 2PGDA 3CCJP 4EI2A 2K1AA 5GTIE 1FJKA 4DZOA 1Q90D 4ZKPA 4XFJA 3GMAA 2FFDC 2KS1A 5KAWA 3B71A 3L75E 1JBGA 3QAOA 1LTAC 1OW7A 1JCCA 2SPZA 1DD4A 1BGYJ 2JO1A 5E79H 4NPFX 3CD6P 3CXHE 1Q05A 1SQPG 2P7JA 1VQLP 1RHZB 1XTGB 1N73A 3M0AA 2IBZE 2O3JA 1SQVE 1DEBA 1YTZI 2QJYC 2KUBA 3M9QA 1KILB 2IEFA 1MKMA 2B88A 1L0NE 1NU1G 3GPVA 5L8RJ 3S4RA 5B5EE 3BCCD 2AXTH 2L91A 2WT7B 1IZNB 3U59A 3WU2H 3M91A 2WVRA 4AQRD 5EFWB 3W68A 4H0LC 3IFMA 5AVSB 1NKNA 2K9JB 3H1JJ 1CI6B 4C46A 1S1CX 2QJKB 2E74D 2QVAA 1M57D 2MKVA 3A5TA 1H88A 3MHVA 4W7ZA 2B89A 2A45G 1SQXG 3D6YA 3H1HG 4GODA 5KLVD 1PPJG 4EYYQ 3L72G 2RKLA 1BOWA 3D6ZA 1YTZT 1TU3F 1BE3J 1NTMK 4A1MA 3B5ND 5CCHA 1NAFA 3GP4A 1HBWA 1SQQE 2GUVA 5KAUA 4UB6H 4OH8B 5KLVE 4JPZB 2P2UA 3B5NA 3GHGC 1HJBA 3C9IA 1MUUA 3CCQP 1BCCD 3USSA 1HH0A 3H1IG 2Y0EA 1RQVA 1JB0J 1DIPA 3KHUA 1CW5A 2KYVA 1U57A 3SWKA 2POHA 1L0NG 1NTME 2WSFJ 2WSFH 3RGUA 3A0BH 4L74A 1NTZD 1R5LA 5GTHH 1FZAA 3HRNA 4XE5B 1KZUB 3H1LG 1NTMJ 1VL2A 1GDTA 2KSJA 2IBZD 4U3FG 2JWAA 2E5TA 5GQQA 5APWA 3OJAB 2Q9IA 2FBWC 1BDDA 1L0LD 2JJLA 3L70E 4WY4C 1FJPA 1EC5A 3BCCE 2PFXA 1UIXA 3P7KA 1X22A 4W7YA 3H1JG 1LTBC 1NH4A 2YKQA 2KS1B 4AYZB 2QM8A 1NJIQ 2J5UA 3EFFK 1NGMB 5H2FH 1JY2P 1WMKA 3H25A 2C9NY 1RF1B 1FZGA 2V4HA 2JR8A 1OVRA 1L0ND 2QA4P 4WVZA 3M0DA 3GHGB 1N86A 2QJPC 1S2EA 3RK3D 2XNXA 4JYCA 1GMJA 1RF0A 2WPVB 4I1LA 3HH0A 1IFIA 2XZRA 1KD1Q 2NPSC 3RBZA 5AVQB 1PGJA 2OARA 2ZHHA 2J59M 2E5YA 4H44B 1SQPK 3B5NC 1ZXGA 2QRXA 1KN7A 1YITP 2H88C 4R4LA 1PP9E 3CL3D 5KAIH 4I7ZC 1OW8A 1IJDB 3AEDC 1Y8AA 2E74C 4R4EA 1LP1B 3R8KA 1OMIA 4GT1A 2D2CB 2FKWB 1M56D 4I7ZB 4AYZA 1IFDA 4IFFA 5CCHD 4R4MA 2ZVOB 3AE8C 1VQOP 1OFCX 1URQD 1NVOA 2GOVA 2BEZF 2IBZI 4D6TG 1KILE 1FBMA 1SQBG 2FYNB 1NTKE 5AW3B 2OQQA 3MUDC 3HTKB 3TYYA 3B49A 1HUCA 3M06A 2I1KA 3CC7P 3KDPB 1NU1K 3A0HE 2KIKA 1RE3C 4GOEA 4Y28J 3CCVP 2JDIH 3BVHA 3I55P 3E0HA 3EZ2A 1T6AA 2HVAA 3P32A 1FDOA 2XU6A 1YJWP 3BCCG 1SQVG 1URQC 2O1KA 3Q5RA 3AE1C 1K04A 1K73Q 3PJSK 1JO5A 1BSNA 4N78E 2NRGA 2M3BA 2R3SA 2JEEA 1RF0C 2XNDH 4HH2A 4IL6E 1H0TB 2R5BA 1KV4A 2QIWA 1JMBA 1NU1D 4H44C 1DD3A 1FDMA 5D8CA 2KXPB 1ZV8A 4AUWA 5AVTB 2OYIB 3LW5H 3LW5J 3GK6A 1YI2P 2LKMA 1USDA 2FYUE 3GHGA 2KCUA 1MFTA 1WRGA 3M9HA 1N73C 1GW4A 3RK3B 2NPSD 5AVUB 1NO4A 2VRSA 2HODA 4PD4H 1S5LE 2FYUJ 4BRYA 1L0LG 3L75J 5CBOA 1ZN5A 2FXOA 2JWDA 2WSSH 1Z56A 4DCKA 1XTCC 2KSEA 2CPBA 1S5LH 3CWBE 2IYOA 3CCRP 1KB9D 3OAKA 2N9BA 1SQBD 2ZAEB 4H13D 1T3JA 3H6PA 1LWUB 1SQPJ 3H1IJ 1BSHA 1KQGB 3CMAP 2BCCG 4DCZA 1IFJA 5B66E 3PLNA 4YXWH 2KP8A 5KJ7D 2YMYA 3A3YB 5DJTB 3BRVB 2Q1KA 3JCUH 1W2BO 3L73E 3L71G 2P67A 1S9KE 2Q7CA 1LJ2A 1L0LJ 4Y99C 1U7MA 2WPSA 1GL2B 5TISE 2XKMA 4TLFA 4EIJA 1NTMD 1S3JA 4HB1A 3G4SP 5APXA 2W90A 3CC4P 3L37A 1OX3A 5KLVK 1G2CB 1FS0E 3HUSB 2FYUK 2QM7A 3D70A 3CPWO 3FXEA 1AFOA 3LIDA 3W67A 4C7NB 4H13B 3S9OA 1JMMA 1VQPP 3BATA 3AE4C 2L5GB 3UCSA 3L70D 1BDCA 4OGQB 1FU1A 1BE3D 2KNCA 1CI6A 2DG6A 2HODB 2ZYDA 3ABVC 2HFED 1LTGC 1JCDA 3PRJA 3TGUE 3CCUP 3KZIH 2D2CD 1VQ5P 2D2CC 5KAXA 2DW3A 3WUVA 1AA0A 1NYHA 3FWNA 3L36A 5TJHA 1EZVE 3MGNA 1PV3A 2BCCJ 1GU4A 2FYUD 3KZIE 1FOSE 4L73A 4R24B 4K3AA 1KYOE 1SFCA 5KJ7A 5KATA 2GM4A 2P58A 3FGAD 4JBZA 3V4WA 2Y9YA 5AW2B 2O01J 2O01H 3CLQA 1NWQA 2K9YA 2BOWA 1J1EC 4W80A 1GD2E 2M5AA 3Q2YA 1HTLC 2XDJA 1QL1A 3AEGC 2YKPA 1BE3E 1SQQG 3RL0g 2M5AB 2PAJA 3RL0B 4IOIH 1QLED 2HR3A 1R8EA 2LXBA 4O9BA 1RH6A 2QG4A 2C0XA 1HGVA 2QJYB 1GK4A 3TF5A 2Q3EA 1L4AA 1YHQP 3EZ9A 1Y9BA 2QJKC 1FDIA 3BCCJ 5APVA 1N7SB 1NTZG 5AVVB 1KFMA 1GK6A 4DOJA 3WMM0 5KCBA 1M8OB 2UWJE 4WWIA 4UB8E 2C0WA 5CHXA 2ZYGA 3TGUG 2R3CA 3AE5C 1T8ZA 1GZLA 1HWTC 1GW3A 3H1HJ 1D5YA 1P84E 4U3FE 3T97B 3Q5SA 5KLIB 3VTPC 2LR2A 4RJTA 4CPGA 1JNMA 3AEEC 2M8RA 3VOPA 5GTHE 2ZFCA 1S72P 3AE3C 2OYIC 1A02F 5KKZC 3B5NB 1SFCD 4RO0A 1P84I 1JY2N 4R22B 3H32A 3HD7B 1T2KC 3L71J 3UIAA 1LWUA 1YBKA 1VQ4P 5BVZA 1NU1E 5AVXB 1M1JB 2QJPB 5KJ7C 4DJGA 2OG0A 3SWYA 2E76C 2FY8A 2WQYC 3CX5I 5KTBA 3G9RA 5KAFH 3E1RA 1OZHA 3KPEA 2KVVA 4H44D 2O01N 1JY3P 3OA7A 1RH5B 1GL2A 1L0NJ 1G1JA 1LGHB 2I8DA 2E74B 4HKZH 3L71D 1LX8A 3CX5E 3U1CA 2I1JA 1NTKK 3HUSC 2HPCB 3RK2B 5CJ4A 1X0TA 2JMLA 1MZ9A 2W6JH 3FX0A 3AE2C 2FYZA 3A0HH 1HGZA 3C8VA 1AQTA 4PJ0H 3A7OA 1KILD 4LC1A 3AE7C 1DEEG 3C1LA 2A06G 3L74J 2IFMA 4WBAA 4JF7A 2K3RA 1OXZA 4N78D 4WLWA 1PGPA 1ZR4A 2K88A 3AEFC 3IF4A 3SFDC 1E5WA 3L74E 1ZR2A 2V7QH 2V7QJ 1LNQA 1SQXJ 5AW5B 4D6TE 2YMKA 2HYNA 3VMAA 3H32B 3HD7A 3CMEP 1RF1A 1T2KD 5KLVG 4D6TJ 1IFMA 1NHLA 1N7SA 1ZRTE 1QVGO 1BCCJ 4IFDK 1LT9C 1JUNA 3QWOC 3II6A 5AW7B 1VF5D 5CMZA 1IK9A 1LTJC 2WWWA 1SQQJ 3SFEC 4NPDA 3EZ6A 1VQNP 3Q5PA 1JOCA 3RK3E 2ZXXA 3R2PA 1Q82Q 1KB9E 1KQFB 1SP4A 1SQVD 2AEJA 3WUTA 2YKOA 4GIFA 3GG2A 5CCHC 1AV1A 1JEKA 2G3AA 1NTZK 3H1LE 1SLQA 3HE4A 2CPSA 1RY3A 1NKZB 2M3EA 1ZOYC 2FFDA 3CXHI 5E01A 1GL2C 2Y9ZA 2KLUA 5APQA 5AVRB 1L4AC 2B9BA 2KLVA 3GLMA 3L73J 3L70G 4GOFA 1AQ5A 1ZP0C 2M0BA 1USEA 2YIUC 1VQ9P 1VQMP 1L0LE 2H89C 1K8AQ 1EZVG 1KORA 2HPCA 1PPJD 3NTNA 2FXMA 2BEQD 2AEMA 3V2QA 3EWKA 3H1KG 2WMMA 2HLOA 5M1BA 3L73D 3L70J 4WB4A 1EQ7A 1DX7A 1VQ6P 2KZJA 3RL0C 4PD4E 3V5BA 2BCCD 5C39A 5E79E 1SQQK 4HJGH 1M1KQ 1N7SD 3MIWA 5AW4B 4GDOA 3F5HA 2Q6QA 2E43A 2E76B 2OTJP 3HE5A 1NOHA 2P1JA 3NFQA 1SQVJ 3FXDA 3HD7C 4L76A 1IC2A 1LTJA 2GUSA 5I44A 3RK2C 1UIIA 1SQPE 2E75D 2ZT9C 3I5CA 2WSEJ 2WSEH 2QE7H 3WU2E 1FZBA 1HF9A 1VPCA 1NTZJ 1Q08A 4AYCA 3VMXA 3AE9C 3CC2P 2K9JA 1BGYD 1NTZE 5KAVA 1MV8A 2NZ2A 3TNUA 5APYA 2PRRA 3MD0A 4EDFA 1KILC 2Y0CA 4I2LC 5KAIE 3TNUB 5CCGC 1LTIC 3HUSA 3AECC 3TGUD 1SQPD 4U3FD 2Q3IA 1KMIZ 1FE6A 1SQBJ 2KI7B 3L72E 2N1TD 2HG5D 1Q09A 1JY3O 3VP8A 1T3UA 2LXCB 4DT0A 1SQBE 1FZCA 3AE6C 1G1IA 2YXRB 4M3LA 1NTKJ 3L75G 1D7MA 4NPEA 1QVFO 3L75D 2N9YB 4LLHA 3L73G 2OYHB 1S9KD 5AVYB 3LIEA 3G71P 3QH9A 1VF5B 1SS1A 1KQSO 1X8YA 3CXHD 1OVVA 2YO2A 1PGOA 3IR9A 4H0LD 2N1TC 3TSIA 1RF1C 5AW1B 1KQLA 5KLVJ 3F89A 1M1JC 4ZKUA 3V6IA 1N7SC 3RK2D 1U7JA 1LT9A 2E75B 5CCGD 1J2JB 1WT6A 4I6MC 3LURA 4IL6H 1W5CE 5APSA 2YIUB 4H13C 1IFPA 1PZQA 3P8MC 5BU8B 1BE3G 1LWUC 4N6JA 1VDFA 3TDKA 3VYIA 2Z4EA 2WSCH 2WSCJ 3CWBG 2WPQA 1OWAA 3V2RA 1Q07A 4U7JA 1KILA 2ZHGA 1L4AD 2KOGA 1W2EA 5CCGA 2OTKE 2QEXP 2NPSB 4WY4B 1LP1A 3VN0A 2E42A 3PHLA 2P10A 4LGDE 2WZ7A 3G6EP 2ZYAA 4ASWA 3CCEP 1GTWA 1K9MQ 3VMZA 1LT1A 3S1KA 1R8DA 1NAYA 2RH0A 1LTSC 2Q5UA 1EDJA 2W83C 3N4XA 1GL2D 1S4XA 3O6QB 3CX5D 1SQXD 3RL0D 2O1JA 2N1TB 3GW6A 2R5DA 4BWNA 2AEFA 4OWFA 4GKGA 2H43A 1OW6A 3N7NA 3H1JE 3K5BA 1IO4A 1EDIA 4H0LB 2N1TA 2B87A 4J2NA 4YXDC 1HJ0A 2QSIA 1RE4C 4OGQD 5TISH 2KNCB 2K37A 2AXCA 3PTZA 2OYIA 2IZ1A 4ZNCA 2KB7P 2R44A 3MP7B 3ITKA 3ZDMA 1FZCB 4QMAA 1SVFA 3BASA 1BGYE 3IAOA 2RN0A 1Q81Q 4A7PA 4WY4D 3CXHH 2ITAA 4HYTB 1VQKP 3R4YA 5AW0B 1ZW0A 3MUDA 1QEXA 2W27A 2Y0DA 1ZLLA 3R8JA 3AEAC 3EQ2A 1SQXE 1QX8A 1JTHA 3KYQA 1BCCG 3CWBD 2IPPA 1EXIA 3P8CE 1X79B 1PFIA 5KLIC 5B5EH 3M0DC 1CZQA 2A45H 3MZWB 2AXTE 1M7LA 3Q3DA 1EZVD 4UB6E 1Y47A 2J58A 4C7NA 4KHXA 3GF7A 3EZFA 3TGUJ 1PIXA 1CSBA 2A06E 1EDLA 2NPSA 1FAVA 1K05A 4B86A 5KKZB 1NTKD 3M9BA 2ZXEB 2YXQB 4RESB 2RMZA 1KTMA 1KYOD 2ZJSE 3L74G 3SSUA 1SFCB 3H1HD 1Q7YQ 3A0BE 4ASVA 2R32A 5APTA 4JQ0D 1L0NK 3EFGA 3B4SA 4KT0J 1RQUA 1H89A 4BRYB 3V4QA 1KB9I 1FOSF 1Q86Q 2ZT9D 5K5GB 3I56P 2W6AA 5I41B 2IZ0A 2OTLP 1FZFA 1L0LK 4IFMA 2VZ4A 1SFCC 2IDBA 2KK7A 4PD4I 2OYOA 2A06D 1FZEA 2W8ZA 3HE5B 2MJZA 1H0TA 1KYOI 5APUA 1SQBK 5H2FE 1BGYG 3CCLP 3SWFA 1BCCE 3BRTB 5AVZB 2KZIA 1URQA 1YJ9P 1M90Q 1QGKB 2BASA 3V2NA 1URQB 2FFDB 1YQ3C 3CCSP 4OGQC 3KXDA 5BU5A 1KB9H 1JM0A 2OYHA 1J1EB 3MTUE 4XA4A 1EXJA 1JTHB 3FWLA 3HD7D 3KQGA 3G3ZA 5AVWB 2FXPA 2ZVNB 1Q2NA 1HVVA 5AW8B 1R5SA 4PD4D 1DH3A 3H1JD 1FZCC 5D90A 4OVNF 1Q0AA 2JKVA 1LT9B 2JP3A 4PV1B 2YO3A 1Y6UA 4EOTA 1FC2C 1GU5A 3EZ7A 4LHFA 1X9VA 3L71E 1YQ4C 3B8EB
chains in the Genus database with same CATH topology
3B71A 1OW8A 1Q07A 1VL2A 3AEDC 4I7ZC 3D6ZA 2E74C 2ZT9D 1AJYA 4R4EA 2BEQD 3R4YA 3Q2YA 4R22B 4U7JA 1JBGA 1TU3F 3QAOA 3EWKA 1KMIZ 2BOWA 3R8KA 2ZHGA 2YMKA 1OMIA 5I41B 5M1BA 5GQQA 1OW7A 2D2CB 3AEGC 1DD4A 2VZ4A 4I7ZB 2FBWC 2JO1A 4TT3H 4Z1MH 1Q09A 3RL0g 2OG0A 1Q06A 4AYZA 2ZT9B 3R8JA 2IDBA 3AEAC 1PM6A 4R4MA 4YTPC 2E75C 1Q05A 3AE8C 1R8EA 3D70A 1IK7A 2E76C 2WQYC 1RH6A 4A1MA 1ZRTE 2P10A 1EXIA 4GDOA 1UIXA 3G9RA 2GOVA 1S5LX 2BEZF 3AE6C 4H13B 3S9OA 5KLIC 2KVVA 1VF5D 1KILE 3GP4A 2E76B 4H44D 4AYZB 3SFEC 2J5UA 1NGMB 3Q3DA 2E76D 3EZ6A 3AE4C 3EZ9A 1R8DA 1Y9BA 2OQQA 2QJKC 3UCSA 2QJYC 1FDIA 4PV1C 1WMKA 3Q5PA 4OGQB 1VF5B 2E74B 3H25A 3RK3E 3B49A 5KAUA 2IEFA 1MKMA 4H13D 3AEBC 3GPVA 1LX8A 5L8RJ 2DG6A 3GF7A 1KQFB 3ABVC 4RKUJ 1KQGB 3IN6A 3EZFA 5I44A 1PIXA 1YQ3C 4DCZA 4H0LD 4OGQC 4Y28J 3Q1MA 2E75D 2ZT9C 1K05A 2WSEJ 3E0HA 3EZ2A 2HVAA 1FDOA 2G3AA 2D2CD 5KCBA 1EXJA 3O6QA 1OW6A 2D2CC 3GF3A 1ZMEC 5KAXA 1HF9A 3Q5RA 2JMLA 2QJPC 3AE1C 1BOWA 1Q08A 1K04A 1KTMA 1NYHA 4H0LB 1GMJA 4H0LC 2WPVB 1ZOYC 3AE2C 2E75B 3AE5C 4J2NA 5E01A 3C8VA 3HH0A 4IL6X 4YXDC 1RQVA 1PV3A 3LURA 1HJ0A 1JYHA 2FXPA 1JB0J 1DIPA 4WLSA 2QSIA 2FYNC 3AE9C 1D5YA 1S1CX 4OGQD 1U57A 3AE7C 4R24B 4H13C 2G8YA 4PV1D 3GLMA 2E74D 3T97B 3Q5SA 2WSFJ 1VF5C 5KAVA 2MKVA 2ZHHA 5KATA 5D90A 1ZP0C 3FGAD 1Q0AA 2NZ2A 2QIWA 4B0YA 4H44B 4H44C 2JP3A 2YIUC 1DD3A 4KT0J 4WLWA 1RQUA 3AEEC 4PV1B 5D8CA 3D6YA 2H89C 2H88C 1Y6UA 3D71A 3AEFC 3SFDC 2O01J 4R4LA 2K9YA 1Q90D 3IAOA 2WSCJ 1KORA 3AE3C 3LW5J 1PL5A 3EZ7A 4XFJA 4LHFA 5KKZC 2V7QJ 3GK6A 3AECC 3GMAA 2KCUA 1YQ4C 5KAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q07 A;  4R24 B;  1BOW A;  3D6Z A;  4R4E A;  3Q1M A;  3Q2Y A;  4R22 B;  1JBG A;  3Q5S A;  3QAO A;  3T97 B;  3GP4 A;  3E0H A;  3R8K A;  2ZHG A;  2HVA A;  5I41 B;  5KAV A;  5KAT A;  2ZHH A;  4AYZ B;  5GQQ A;  5D90 A;  5KCB A;  2J5U A;  1Q0A A;  1EXJ A;  3Q3D A;  4B0Y A;  5KAX A;  2VZ4 A;  3Q5R A;  2JML A;  1R8D A;  2OQQ A;  4WLW A;  1Q09 A;  1Q08 A;  3UCS A;  1Q06 A;  5D8C A;  3R8J A;  4AYZ A;  3Q5P A;  3D6Y A;  2KCU A;  4R4M A;  5KAU A;  3D71 A;  3B49 A;  1Q05 A;  4J2N A;  5E01 A;  3GPV A;  3HH0 A;  1R8E A;  4R4L A;  3D70 A;  3LUR A;  2DG6 A;  3IAO A;  1JYH A;  2BOW A;  3GK6 A;  1DIP A;  4A1M A;  4WLS A;  5I44 A;  1D5Y A;  1EXI A;  2GOV A;  3G9R A;  5KAW A; 
#chains in the Genus database with same CATH topology
 1NU1 J;  3V2P A;  2H7H A;  3O8Z A;  4Z1M H;  3CI9 A;  1MFZ A;  1Q06 A;  1JY2 O;  2Z5H A;  3E1I A;  1SQQ D;  4YTP C;  1YIJ P;  1EZV I;  5KAF E;  4BXL A;  1SQX K;  2YNY A;  1LTJ B;  2GA1 A;  1S5L X;  1SQV K;  3TK1 A;  3HTK A;  3CCM P;  1N8R Q;  3JC2 2;  3VMY A;  5CJ0 A;  1M1J A;  1N7L A;  4PV1 C;  4WY4 A;  3CX5 H;  3AEB C;  4C7R A;  1J1D B;  4RKU J;  1OVU A;  3IN6 A;  4YPC A;  3L35 A;  1H8A A;  1ZME C;  1VQ8 P;  1NTK G;  4PJ0 E;  3U1A A;  2H8P D;  1RE3 A;  3T97 A;  1PPJ E;  3PP5 A;  1JY3 N;  2CK3 H;  4D6T D;  3L74 D;  1AVY A;  1JYH A;  4WLS A;  1EDK A;  1N2D C;  3E7K A;  3NXS A;  2G8Y A;  2BCC E;  1PP9 J;  4JYB A;  1ZRT D;  1VF5 C;  4L75 A;  1KYO H;  5AW9 B;  2WPR A;  4Y99 B;  2OYH C;  3D71 A;  3L4F A;  4N3Y B;  2IBZ G;  1PL5 A;  3RBX A;  3JSV C;  2WTY A;  2IX7 C;  1KFN A;  3H1K D;  3H1I D;  1AJY A;  1P84 D;  3RK3 C;  1VQ7 P;  3VP9 A;  2PP6 A;  4TT3 H;  1L4A B;  2ZT9 B;  2A45 I;  1AVO A;  1PM6 A;  3L72 J;  2E75 C;  4K35 A;  1IK7 A;  3HE4 B;  5DJU B;  3CWB J;  2FYU G;  2WIT A;  1YJN P;  1IFN A;  1RE4 A;  1A02 J;  1QL2 A;  1YYC A;  2E76 D;  2OGU A;  3H1L D;  3A2A A;  3P8C D;  3H1I E;  2WT7 A;  1J1D C;  2W6B A;  1PGQ A;  5B66 H;  2IFN A;  1NTM G;  1N73 B;  3H1L J;  3Q1M A;  1OIP A;  3JCU E;  1E79 H;  3O6Q A;  3GF3 A;  2Z5I A;  2IYP A;  3NMD A;  1LTT C;  3OW2 O;  1PP9 G;  4IL6 X;  4UB8 H;  3H1K E;  1PP9 D;  1KC8 Q;  3L72 D;  4KJM A;  1G2C A;  4ZMD A;  2C9L Y;  2FYN C;  3WUU A;  5CBN A;  4PV1 D;  4MN4 C;  5GTI H;  2B87 B;  3H1H E;  3PH0 A;  5AW6 B;  1L2P A;  2XV5 A;  1P84 H;  4B0Y A;  4U3F J;  3H1K J;  2PGD A;  3CCJ P;  4EI2 A;  2K1A A;  5GTI E;  1FJK A;  4DZO A;  1Q90 D;  4ZKP A;  4XFJ A;  3GMA A;  2FFD C;  2KS1 A;  5KAW A;  3B71 A;  3L75 E;  1JBG A;  3QAO A;  1LTA C;  1OW7 A;  1JCC A;  2SPZ A;  1DD4 A;  1BGY J;  2JO1 A;  5E79 H;  4NPF X;  3CD6 P;  3CXH E;  1Q05 A;  1SQP G;  2P7J A;  1VQL P;  1RHZ B;  1XTG B;  1N73 A;  3M0A A;  2IBZ E;  2O3J A;  1SQV E;  1DEB A;  1YTZ I;  2QJY C;  2KUB A;  3M9Q A;  1KIL B;  2IEF A;  1MKM A;  2B88 A;  1L0N E;  1NU1 G;  3GPV A;  5L8R J;  3S4R A;  5B5E E;  3BCC D;  2AXT H;  2L91 A;  2WT7 B;  1IZN B;  3U59 A;  3WU2 H;  3M91 A;  2WVR A;  4AQR D;  5EFW B;  3W68 A;  4H0L C;  3IFM A;  5AVS B;  1NKN A;  2K9J B;  3H1J J;  1CI6 B;  4C46 A;  1S1C X;  2QJK B;  2E74 D;  2QVA A;  1M57 D;  2MKV A;  3A5T A;  1H88 A;  3MHV A;  4W7Z A;  2B89 A;  2A45 G;  1SQX G;  3D6Y A;  3H1H G;  4GOD A;  5KLV D;  1PPJ G;  4EYY Q;  3L72 G;  2RKL A;  1BOW A;  3D6Z A;  1YTZ T;  1TU3 F;  1BE3 J;  1NTM K;  4A1M A;  3B5N D;  5CCH A;  1NAF A;  3GP4 A;  1HBW A;  1SQQ E;  2GUV A;  5KAU A;  4UB6 H;  4OH8 B;  5KLV E;  4JPZ B;  2P2U A;  3B5N A;  3GHG C;  1HJB A;  3C9I A;  1MUU A;  3CCQ P;  1BCC D;  3USS A;  1HH0 A;  3H1I G;  2Y0E A;  1RQV A;  1JB0 J;  1DIP A;  3KHU A;  1CW5 A;  2KYV A;  1U57 A;  3SWK A;  2POH A;  1L0N G;  1NTM E;  2WSF J;  2WSF H;  3RGU A;  3A0B H;  4L74 A;  1NTZ D;  1R5L A;  5GTH H;  1FZA A;  3HRN A;  4XE5 B;  1KZU B;  3H1L G;  1NTM J;  1VL2 A;  1GDT A;  2KSJ A;  2IBZ D;  4U3F G;  2JWA A;  2E5T A;  5GQQ A;  5APW A;  3OJA B;  2Q9I A;  2FBW C;  1BDD A;  1L0L D;  2JJL A;  3L70 E;  4WY4 C;  1FJP A;  1EC5 A;  3BCC E;  2PFX A;  1UIX A;  3P7K A;  1X22 A;  4W7Y A;  3H1J G;  1LTB C;  1NH4 A;  2YKQ A;  2KS1 B;  4AYZ B;  2QM8 A;  1NJI Q;  2J5U A;  3EFF K;  1NGM B;  5H2F H;  1JY2 P;  1WMK A;  3H25 A;  2C9N Y;  1RF1 B;  1FZG A;  2V4H A;  2JR8 A;  1OVR A;  1L0N D;  2QA4 P;  4WVZ A;  3M0D A;  3GHG B;  1N86 A;  2QJP C;  1S2E A;  3RK3 D;  2XNX A;  4JYC A;  1GMJ A;  1RF0 A;  2WPV B;  4I1L A;  3HH0 A;  1IFI A;  2XZR A;  1KD1 Q;  2NPS C;  3RBZ A;  5AVQ B;  1PGJ A;  2OAR A;  2ZHH A;  2J59 M;  2E5Y A;  4H44 B;  1SQP K;  3B5N C;  1ZXG A;  2QRX A;  1KN7 A;  1YIT P;  2H88 C;  4R4L A;  1PP9 E;  3CL3 D;  5KAI H;  4I7Z C;  1OW8 A;  1IJD B;  3AED C;  1Y8A A;  2E74 C;  4R4E A;  1LP1 B;  3R8K A;  1OMI A;  4GT1 A;  2D2C B;  2FKW B;  1M56 D;  4I7Z B;  4AYZ A;  1IFD A;  4IFF A;  5CCH D;  4R4M A;  2ZVO B;  3AE8 C;  1VQO P;  1OFC X;  1URQ D;  1NVO A;  2GOV A;  2BEZ F;  2IBZ I;  4D6T G;  1KIL E;  1FBM A;  1SQB G;  2FYN B;  1NTK E;  5AW3 B;  2OQQ A;  3MUD C;  3HTK B;  3TYY A;  3B49 A;  1HUC A;  3M06 A;  2I1K A;  3CC7 P;  3KDP B;  1NU1 K;  3A0H E;  2KIK A;  1RE3 C;  4GOE A;  4Y28 J;  3CCV P;  2JDI H;  3BVH A;  3I55 P;  3E0H A;  3EZ2 A;  1T6A A;  2HVA A;  3P32 A;  1FDO A;  2XU6 A;  1YJW P;  3BCC G;  1SQV G;  1URQ C;  2O1K A;  3Q5R A;  3AE1 C;  1K04 A;  1K73 Q;  3PJS K;  1JO5 A;  1BSN A;  4N78 E;  2NRG A;  2M3B A;  2R3S A;  2JEE A;  1RF0 C;  2XND H;  4HH2 A;  4IL6 E;  1H0T B;  2R5B A;  1KV4 A;  2QIW A;  1JMB A;  1NU1 D;  4H44 C;  1DD3 A;  1FDM A;  5D8C A;  2KXP B;  1ZV8 A;  4AUW A;  5AVT B;  2OYI B;  3LW5 H;  3LW5 J;  3GK6 A;  1YI2 P;  2LKM A;  1USD A;  2FYU E;  3GHG A;  2KCU A;  1MFT A;  1WRG A;  3M9H A;  1N73 C;  1GW4 A;  3RK3 B;  2NPS D;  5AVU B;  1NO4 A;  2VRS A;  2HOD A;  4PD4 H;  1S5L E;  2FYU J;  4BRY A;  1L0L G;  3L75 J;  5CBO A;  1ZN5 A;  2FXO A;  2JWD A;  2WSS H;  1Z56 A;  4DCK A;  1XTC C;  2KSE A;  2CPB A;  1S5L H;  3CWB E;  2IYO A;  3CCR P;  1KB9 D;  3OAK A;  2N9B A;  1SQB D;  2ZAE B;  4H13 D;  1T3J A;  3H6P A;  1LWU B;  1SQP J;  3H1I J;  1BSH A;  1KQG B;  3CMA P;  2BCC G;  4DCZ A;  1IFJ A;  5B66 E;  3PLN A;  4YXW H;  2KP8 A;  5KJ7 D;  2YMY A;  3A3Y B;  5DJT B;  3BRV B;  2Q1K A;  3JCU H;  1W2B O;  3L73 E;  3L71 G;  2P67 A;  1S9K E;  2Q7C A;  1LJ2 A;  1L0L J;  4Y99 C;  1U7M A;  2WPS A;  1GL2 B;  5TIS E;  2XKM A;  4TLF A;  4EIJ A;  1NTM D;  1S3J A;  4HB1 A;  3G4S P;  5APX A;  2W90 A;  3CC4 P;  3L37 A;  1OX3 A;  5KLV K;  1G2C B;  1FS0 E;  3HUS B;  2FYU K;  2QM7 A;  3D70 A;  3CPW O;  3FXE A;  1AFO A;  3LID A;  3W67 A;  4C7N B;  4H13 B;  3S9O A;  1JMM A;  1VQP P;  3BAT A;  3AE4 C;  2L5G B;  3UCS A;  3L70 D;  1BDC A;  4OGQ B;  1FU1 A;  1BE3 D;  2KNC A;  1CI6 A;  2DG6 A;  2HOD B;  2ZYD A;  3ABV C;  2HFE D;  1LTG C;  1JCD A;  3PRJ A;  3TGU E;  3CCU P;  3KZI H;  2D2C D;  1VQ5 P;  2D2C C;  5KAX A;  2DW3 A;  3WUV A;  1AA0 A;  1NYH A;  3FWN A;  3L36 A;  5TJH A;  1EZV E;  3MGN A;  1PV3 A;  2BCC J;  1GU4 A;  2FYU D;  3KZI E;  1FOS E;  4L73 A;  4R24 B;  4K3A A;  1KYO E;  1SFC A;  5KJ7 A;  5KAT A;  2GM4 A;  2P58 A;  3FGA D;  4JBZ A;  3V4W A;  2Y9Y A;  5AW2 B;  2O01 J;  2O01 H;  3CLQ A;  1NWQ A;  2K9Y A;  2BOW A;  1J1E C;  4W80 A;  1GD2 E;  2M5A A;  3Q2Y A;  1HTL C;  2XDJ A;  1QL1 A;  3AEG C;  2YKP A;  1BE3 E;  1SQQ G;  3RL0 g;  2M5A B;  2PAJ A;  3RL0 B;  4IOI H;  1QLE D;  2HR3 A;  1R8E A;  2LXB A;  4O9B A;  1RH6 A;  2QG4 A;  2C0X A;  1HGV A;  2QJY B;  1GK4 A;  3TF5 A;  2Q3E A;  1L4A A;  1YHQ P;  3EZ9 A;  1Y9B A;  2QJK C;  1FDI A;  3BCC J;  5APV A;  1N7S B;  1NTZ G;  5AVV B;  1KFM A;  1GK6 A;  4DOJ A;  3WMM 0;  5KCB A;  1M8O B;  2UWJ E;  4WWI A;  4UB8 E;  2C0W A;  5CHX A;  2ZYG A;  3TGU G;  2R3C A;  3AE5 C;  1T8Z A;  1GZL A;  1HWT C;  1GW3 A;  3H1H J;  1D5Y A;  1P84 E;  4U3F E;  3T97 B;  3Q5S A;  5KLI B;  3VTP C;  2LR2 A;  4RJT A;  4CPG A;  1JNM A;  3AEE C;  2M8R A;  3VOP A;  5GTH E;  2ZFC A;  1S72 P;  3AE3 C;  2OYI C;  1A02 F;  5KKZ C;  3B5N B;  1SFC D;  4RO0 A;  1P84 I;  1JY2 N;  4R22 B;  3H32 A;  3HD7 B;  1T2K C;  3L71 J;  3UIA A;  1LWU A;  1YBK A;  1VQ4 P;  5BVZ A;  1NU1 E;  5AVX B;  1M1J B;  2QJP B;  5KJ7 C;  4DJG A;  2OG0 A;  3SWY A;  2E76 C;  2FY8 A;  2WQY C;  3CX5 I;  5KTB A;  3G9R A;  5KAF H;  3E1R A;  1OZH A;  3KPE A;  2KVV A;  4H44 D;  2O01 N;  1JY3 P;  3OA7 A;  1RH5 B;  1GL2 A;  1L0N J;  1G1J A;  1LGH B;  2I8D A;  2E74 B;  4HKZ H;  3L71 D;  1LX8 A;  3CX5 E;  3U1C A;  2I1J A;  1NTK K;  3HUS C;  2HPC B;  3RK2 B;  5CJ4 A;  1X0T A;  2JML A;  1MZ9 A;  2W6J H;  3FX0 A;  3AE2 C;  2FYZ A;  3A0H H;  1HGZ A;  3C8V A;  1AQT A;  4PJ0 H;  3A7O A;  1KIL D;  4LC1 A;  3AE7 C;  1DEE G;  3C1L A;  2A06 G;  3L74 J;  2IFM A;  4WBA A;  4JF7 A;  2K3R A;  1OXZ A;  4N78 D;  4WLW A;  1PGP A;  1ZR4 A;  2K88 A;  3AEF C;  3IF4 A;  3SFD C;  1E5W A;  3L74 E;  1ZR2 A;  2V7Q H;  2V7Q J;  1LNQ A;  1SQX J;  5AW5 B;  4D6T E;  2YMK A;  2HYN A;  3VMA A;  3H32 B;  3HD7 A;  3CME P;  1RF1 A;  1T2K D;  5KLV G;  4D6T J;  1IFM A;  1NHL A;  1N7S A;  1ZRT E;  1QVG O;  1BCC J;  4IFD K;  1LT9 C;  1JUN A;  3QWO C;  3II6 A;  5AW7 B;  1VF5 D;  5CMZ A;  1IK9 A;  1LTJ C;  2WWW A;  1SQQ J;  3SFE C;  4NPD A;  3EZ6 A;  1VQN P;  3Q5P A;  1JOC A;  3RK3 E;  2ZXX A;  3R2P A;  1Q82 Q;  1KB9 E;  1KQF B;  1SP4 A;  1SQV D;  2AEJ A;  3WUT A;  2YKO A;  4GIF A;  3GG2 A;  5CCH C;  1AV1 A;  1JEK A;  2G3A A;  1NTZ K;  3H1L E;  1SLQ A;  3HE4 A;  2CPS A;  1RY3 A;  1NKZ B;  2M3E A;  1ZOY C;  2FFD A;  3CXH I;  5E01 A;  1GL2 C;  2Y9Z A;  2KLU A;  5APQ A;  5AVR B;  1L4A C;  2B9B A;  2KLV A;  3GLM A;  3L73 J;  3L70 G;  4GOF A;  1AQ5 A;  1ZP0 C;  2M0B A;  1USE A;  2YIU C;  1VQ9 P;  1VQM P;  1L0L E;  2H89 C;  1K8A Q;  1EZV G;  1KOR A;  2HPC A;  1PPJ D;  3NTN A;  2FXM A;  2BEQ D;  2AEM A;  3V2Q A;  3EWK A;  3H1K G;  2WMM A;  2HLO A;  5M1B A;  3L73 D;  3L70 J;  4WB4 A;  1EQ7 A;  1DX7 A;  1VQ6 P;  2KZJ A;  3RL0 C;  4PD4 E;  3V5B A;  2BCC D;  5C39 A;  5E79 E;  1SQQ K;  4HJG H;  1M1K Q;  1N7S D;  3MIW A;  5AW4 B;  4GDO A;  3F5H A;  2Q6Q A;  2E43 A;  2E76 B;  2OTJ P;  3HE5 A;  1NOH A;  2P1J A;  3NFQ A;  1SQV J;  3FXD A;  3HD7 C;  4L76 A;  1IC2 A;  1LTJ A;  2GUS A;  5I44 A;  3RK2 C;  1UII A;  1SQP E;  2E75 D;  2ZT9 C;  3I5C A;  2WSE J;  2WSE H;  2QE7 H;  3WU2 E;  1FZB A;  1HF9 A;  1VPC A;  1NTZ J;  1Q08 A;  4AYC A;  3VMX A;  3AE9 C;  3CC2 P;  2K9J A;  1BGY D;  1NTZ E;  5KAV A;  1MV8 A;  2NZ2 A;  3TNU A;  5APY A;  2PRR A;  3MD0 A;  4EDF A;  1KIL C;  2Y0C A;  4I2L C;  5KAI E;  3TNU B;  5CCG C;  1LTI C;  3HUS A;  3AEC C;  3TGU D;  1SQP D;  4U3F D;  2Q3I A;  1KMI Z;  1FE6 A;  1SQB J;  2KI7 B;  3L72 E;  2N1T D;  2HG5 D;  1Q09 A;  1JY3 O;  3VP8 A;  1T3U A;  2LXC B;  4DT0 A;  1SQB E;  1FZC A;  3AE6 C;  1G1I A;  2YXR B;  4M3L A;  1NTK J;  3L75 G;  1D7M A;  4NPE A;  1QVF O;  3L75 D;  2N9Y B;  4LLH A;  3L73 G;  2OYH B;  1S9K D;  5AVY B;  3LIE A;  3G71 P;  3QH9 A;  1VF5 B;  1SS1 A;  1KQS O;  1X8Y A;  3CXH D;  1OVV A;  2YO2 A;  1PGO A;  3IR9 A;  4H0L D;  2N1T C;  3TSI A;  1RF1 C;  5AW1 B;  1KQL A;  5KLV J;  3F89 A;  1M1J C;  4ZKU A;  3V6I A;  1N7S C;  3RK2 D;  1U7J A;  1LT9 A;  2E75 B;  5CCG D;  1J2J B;  1WT6 A;  4I6M C;  3LUR A;  4IL6 H;  1W5C E;  5APS A;  2YIU B;  4H13 C;  1IFP A;  1PZQ A;  3P8M C;  5BU8 B;  1BE3 G;  1LWU C;  4N6J A;  1VDF A;  3TDK A;  3VYI A;  2Z4E A;  2WSC H;  2WSC J;  3CWB G;  2WPQ A;  1OWA A;  3V2R A;  1Q07 A;  4U7J A;  1KIL A;  2ZHG A;  1L4A D;  2KOG A;  1W2E A;  5CCG A;  2OTK E;  2QEX P;  2NPS B;  4WY4 B;  1LP1 A;  3VN0 A;  2E42 A;  3PHL A;  2P10 A;  4LGD E;  2WZ7 A;  3G6E P;  2ZYA A;  4ASW A;  3CCE P;  1GTW A;  1K9M Q;  3VMZ A;  1LT1 A;  3S1K A;  1R8D A;  1NAY A;  2RH0 A;  1LTS C;  2Q5U A;  1EDJ A;  2W83 C;  3N4X A;  1GL2 D;  1S4X A;  3O6Q B;  3CX5 D;  1SQX D;  3RL0 D;  2O1J A;  2N1T B;  3GW6 A;  2R5D A;  4BWN A;  2AEF A;  4OWF A;  4GKG A;  2H43 A;  1OW6 A;  3N7N A;  3H1J E;  3K5B A;  1IO4 A;  1EDI A;  4H0L B;  2N1T A;  2B87 A;  4J2N A;  4YXD C;  1HJ0 A;  2QSI A;  1RE4 C;  4OGQ D;  5TIS H;  2KNC B;  2K37 A;  2AXC A;  3PTZ A;  2OYI A;  2IZ1 A;  4ZNC A;  2KB7 P;  2R44 A;  3MP7 B;  3ITK A;  3ZDM A;  1FZC B;  4QMA A;  1SVF A;  3BAS A;  1BGY E;  3IAO A;  2RN0 A;  1Q81 Q;  4A7P A;  4WY4 D;  3CXH H;  2ITA A;  4HYT B;  1VQK P;  3R4Y A;  5AW0 B;  1ZW0 A;  3MUD A;  1QEX A;  2W27 A;  2Y0D A;  1ZLL A;  3R8J A;  3AEA C;  3EQ2 A;  1SQX E;  1QX8 A;  1JTH A;  3KYQ A;  1BCC G;  3CWB D;  2IPP A;  1EXI A;  3P8C E;  1X79 B;  1PFI A;  5KLI C;  5B5E H;  3M0D C;  1CZQ A;  2A45 H;  3MZW B;  2AXT E;  1M7L A;  3Q3D A;  1EZV D;  4UB6 E;  1Y47 A;  2J58 A;  4C7N A;  4KHX A;  3GF7 A;  3EZF A;  3TGU J;  1PIX A;  1CSB A;  2A06 E;  1EDL A;  2NPS A;  1FAV A;  1K05 A;  4B86 A;  5KKZ B;  1NTK D;  3M9B A;  2ZXE B;  2YXQ B;  4RES B;  2RMZ A;  1KTM A;  1KYO D;  2ZJS E;  3L74 G;  3SSU A;  1SFC B;  3H1H D;  1Q7Y Q;  3A0B E;  4ASV A;  2R32 A;  5APT A;  4JQ0 D;  1L0N K;  3EFG A;  3B4S A;  4KT0 J;  1RQU A;  1H89 A;  4BRY B;  3V4Q A;  1KB9 I;  1FOS F;  1Q86 Q;  2ZT9 D;  5K5G B;  3I56 P;  2W6A A;  5I41 B;  2IZ0 A;  2OTL P;  1FZF A;  1L0L K;  4IFM A;  2VZ4 A;  1SFC C;  2IDB A;  2KK7 A;  4PD4 I;  2OYO A;  2A06 D;  1FZE A;  2W8Z A;  3HE5 B;  2MJZ A;  1H0T A;  1KYO I;  5APU A;  1SQB K;  5H2F E;  1BGY G;  3CCL P;  3SWF A;  1BCC E;  3BRT B;  5AVZ B;  2KZI A;  1URQ A;  1YJ9 P;  1M90 Q;  1QGK B;  2BAS A;  3V2N A;  1URQ B;  2FFD B;  1YQ3 C;  3CCS P;  4OGQ C;  3KXD A;  5BU5 A;  1KB9 H;  1JM0 A;  2OYH A;  1J1E B;  3MTU E;  4XA4 A;  1EXJ A;  1JTH B;  3FWL A;  3HD7 D;  3KQG A;  3G3Z A;  5AVW B;  2FXP A;  2ZVN B;  1Q2N A;  1HVV A;  5AW8 B;  1R5S A;  4PD4 D;  1DH3 A;  3H1J D;  1FZC C;  5D90 A;  4OVN F;  1Q0A A;  2JKV A;  1LT9 B;  2JP3 A;  4PV1 B;  2YO3 A;  1Y6U A;  4EOT A;  1FC2 C;  1GU5 A;  3EZ7 A;  4LHF A;  1X9V A;  3L71 E;  1YQ4 C;  3B8E B; 
#chains in the Genus database with same CATH homology
 3B71 A;  1OW8 A;  1Q07 A;  1VL2 A;  3AED C;  4I7Z C;  3D6Z A;  2E74 C;  2ZT9 D;  1AJY A;  4R4E A;  2BEQ D;  3R4Y A;  3Q2Y A;  4R22 B;  4U7J A;  1JBG A;  1TU3 F;  3QAO A;  3EWK A;  1KMI Z;  2BOW A;  3R8K A;  2ZHG A;  2YMK A;  1OMI A;  5I41 B;  5M1B A;  5GQQ A;  1OW7 A;  2D2C B;  3AEG C;  1DD4 A;  2VZ4 A;  4I7Z B;  2FBW C;  2JO1 A;  4TT3 H;  4Z1M H;  1Q09 A;  3RL0 g;  2OG0 A;  1Q06 A;  4AYZ A;  2ZT9 B;  3R8J A;  2IDB A;  3AEA C;  1PM6 A;  4R4M A;  4YTP C;  2E75 C;  1Q05 A;  3AE8 C;  1R8E A;  3D70 A;  1IK7 A;  2E76 C;  2WQY C;  1RH6 A;  4A1M A;  1ZRT E;  2P10 A;  1EXI A;  4GDO A;  1UIX A;  3G9R A;  2GOV A;  1S5L X;  2BEZ F;  3AE6 C;  4H13 B;  3S9O A;  5KLI C;  2KVV A;  1VF5 D;  1KIL E;  3GP4 A;  2E76 B;  4H44 D;  4AYZ B;  3SFE C;  2J5U A;  1NGM B;  3Q3D A;  2E76 D;  3EZ6 A;  3AE4 C;  3EZ9 A;  1R8D A;  1Y9B A;  2OQQ A;  2QJK C;  3UCS A;  2QJY C;  1FDI A;  4PV1 C;  1WMK A;  3Q5P A;  4OGQ B;  1VF5 B;  2E74 B;  3H25 A;  3RK3 E;  3B49 A;  5KAU A;  2IEF A;  1MKM A;  4H13 D;  3AEB C;  3GPV A;  1LX8 A;  5L8R J;  2DG6 A;  3GF7 A;  1KQF B;  3ABV C;  4RKU J;  1KQG B;  3IN6 A;  3EZF A;  5I44 A;  1PIX A;  1YQ3 C;  4DCZ A;  4H0L D;  4OGQ C;  4Y28 J;  3Q1M A;  2E75 D;  2ZT9 C;  1K05 A;  2WSE J;  3E0H A;  3EZ2 A;  2HVA A;  1FDO A;  2G3A A;  2D2C D;  5KCB A;  1EXJ A;  3O6Q A;  1OW6 A;  2D2C C;  3GF3 A;  1ZME C;  5KAX A;  1HF9 A;  3Q5R A;  2JML A;  2QJP C;  3AE1 C;  1BOW A;  1Q08 A;  1K04 A;  1KTM A;  1NYH A;  4H0L B;  1GMJ A;  4H0L C;  2WPV B;  1ZOY C;  3AE2 C;  2E75 B;  3AE5 C;  4J2N A;  5E01 A;  3C8V A;  3HH0 A;  4IL6 X;  4YXD C;  1RQV A;  1PV3 A;  3LUR A;  1HJ0 A;  1JYH A;  2FXP A;  1JB0 J;  1DIP A;  4WLS A;  2QSI A;  2FYN C;  3AE9 C;  1D5Y A;  1S1C X;  4OGQ D;  1U57 A;  3AE7 C;  4R24 B;  4H13 C;  2G8Y A;  4PV1 D;  3GLM A;  2E74 D;  3T97 B;  3Q5S A;  2WSF J;  1VF5 C;  5KAV A;  2MKV A;  2ZHH A;  5KAT A;  5D90 A;  1ZP0 C;  3FGA D;  1Q0A A;  2NZ2 A;  2QIW A;  4B0Y A;  4H44 B;  4H44 C;  2JP3 A;  2YIU C;  1DD3 A;  4KT0 J;  4WLW A;  1RQU A;  3AEE C;  4PV1 B;  5D8C A;  3D6Y A;  2H89 C;  2H88 C;  1Y6U A;  3D71 A;  3AEF C;  3SFD C;  2O01 J;  4R4L A;  2K9Y A;  1Q90 D;  3IAO A;  2WSC J;  1KOR A;  3AE3 C;  3LW5 J;  1PL5 A;  3EZ7 A;  4XFJ A;  4LHF A;  5KKZ C;  2V7Q J;  3GK6 A;  3AEC C;  3GMA A;  2KCU A;  1YQ4 C;  5KAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...