1R8OA

Crystal structure of an unusual kunitz-type trypsin inhibitor from copaifera langsdorffii seeds
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
96
structure length
96
Chain Sequence
RLVDTDGKPIENDGAEYYILPSVRGKGGGLVLAKSGGEKCPLSVVQSPSELSNGLPVRFKASPRSKYISVGMLLGIEVIESPECAPKPSMWSVKSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kunitz trypsin inhibitor
publication title Three-dimensional structure of an unusual Kunitz (STI) type trypsin inhibitor from Copaifera langsdorffii.
pubmed doi rcsb
molecule tags Hydrolase inhibitor
total genus 9
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2003-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1r8oA01
1XYFA 1YBIA 1NUNA 3POKA 4IHZA 2RQ9A 1BFCA 1VCLA 3OJ2A 4LO7B 4H9WA 3K1XA 4J2XA 3QYDA 2DS0A 5BVPI 4IQPA 4XFTA 1FV2A 3AZVA 1I1BA 1R8NA 1TWEA 3IIRA 4TLPA 2QYIB 4J2KA 3VT1A 1T9FA 4QD2C 1ITBA 3B9UA 1JQZA 3AKIA 2K8RA 4JRAA 2K4AB 1YF8B 1JY0A 1DLLA 1AVAC 5DUYA 1XZZA 3FJ9A 1YTOA 1DFQA 3V79C 4I4XA 3OGGA 3AH2A 3AKFA 1WBCA 9ILBA 4X3AA 4QBVA 1BARA 3V0BB 1PWAA 1DJSB 1XHBA 4KBBA 4OEEA 3P53A 5DSSB 1HKNA 1M2TB 3O44A 3WINC 1S0BA 2DRZA 1FQ9A 3LLPA 4JKQA 2D43A 2LIQA 1ISXA 4IY9A 3V0BA 4H04A 3O5WB 3FJDA 3O4OA 2GO2A 2HZ9A 3FJFA 3IAGC 3D7WB 2D7RA 3CRIA 3I2XA 1WD4A 4LO0A 2VU9A 4KEKA 3BAOA 1W3AA 31BIA 3H6RB 3FGMA 4I1BA 3I29B 2Y9FA 3BA4A 2ZQNA 1W3GA 4X39A 4EEEB 1SZ6B 3H6RA 4ZKTB 1V6VA 2NZ9A 5DZUA 3HOMA 3VSFA 4G9NA 3WA1A 4AN7B 2NP0A 2K43A 2HWMA 1EVTA 4I3NA 4D8HA 1ISWA 4KEIA 3S8JA 3CA3A 3F1RA 3MALA 3R4SA 4XKIA 2D22A 2DREA 2R9KB 2IWTB 3N0KA 4IYBA 1EPWA 5EG6C 1YYNA 4Q91A 4ZLBB 3CQAA 4L4HA 1WD3A 5BQUC 3WMVA 3JRRA 4J2SA 1BASA 4EFRA 3UD7A 2VUAA 4A7YA 3O4AA 4I4OA 4LO1A 4EFQA 2Y9GA 2Z48A 1BA7A 2M49A 1DZCA 1FMZA 2KKIA 5BP5A 1JT7A 3WO3A 2FFUA 2VXRA 3CU1B 2E4MA 3QR5A 2DRYA 4EFPA 6I1BA 1Q03A 1QXMA 1EYLA 3CA1A 3CRGA 1JT5A 3AKGA 3O4CA 2MC2A 5BXPA 2AQZA 4ZBVB 2FO1A 1FWVA 2Q3NB 4OW4A 3NBCA 5E24E 5JLVA 1RY7A 3ZC9A 4LO2A 1OQLB 3FJKA 5BXRA 1S0CA 2D24A 1ABRB 1Z0HA 3NBEA 2ERMA 4GOYA 3BB2A 4I4PA 4QALA 4QKRA 3IM7A 2X2SA 2VSAA 3UJ4A 3A22A 3FJIA 4QBCA 5GAQA 3PHZA 41BIA 4J2YA 3OBTA 2MLLB 3O4DA 2D23A 1QQKA 5HPZA 3KMVA 5FZYA 1IT0A 4IZEA 5DVHA 3VT2A 3WO2A 3F62B 3Q7XA 3RMXA 4I4VA 3ZX7A 5D61A 1TOOA 3UD8A 4Q9GA 5BXSA 1FV3A 4JAWA 3I2AA 4G6JA 1BFBA 2AAIB 3CA4A 1KNMA 4LO7C 4I4YA 1UPSA 4LO3A 3RSJA 1G9AA 3Q7WA 5F90A 5B2HA 2BEAA 3BRFA 4LO8B 2BEBA 2WBCA 4X38A 5EHAA 4P6AA 3O49A 3W9TA 1NZKA 4L4IA 3N7LA 4IONA 1TP0A 4GOVA 2F2FC 3R4UA 4P0LA 2ET2A 2UUSA 4OWKA 3V0AB 4AN6A 4II0A 1PUUB 2Y9WC 1TIEA 3MPPG 1FGAA 4I4SA 4A7ZA 3V0AA 1IRAX 4IY8A 2D7IA 3WMUA 1CE7B 4ENDA 4ZFYB 3HMYA 1MC9A 4I1EA 1AFCA 4QO3A 2IHOA 3IM5A 5EC5A 4X37A 3FJBA 2F8XC 4Z9WB 2FFVA 1HCDA 5F8SA 1IOBA 5FZZA 3BAUA 1S0GA 2KI6B 1PUMB 2BFHA 3P6IA 4PC4A 1MD6A 1ISYA 4LO0C 3H6SE 4I7IA 1DQOA 1AXMA 1E0OA 4XFSA 1F31A 1DFCA 3BAVA 3OGFA 2VLCA 4OEFA 4OUJA 4I2SA 1W3FA 2VSEA 3WO4A 3JUTA 5D63A 4ZA3B 4JP0A 3HALA 1JT3A 4DEPA 3OJMA 3S8KA 2D1ZA 1TTUA 1DZDA 2QN4A 3HN1A 4GAFA 3ILAA 3BADA 3CA0A 21BIA 3AZWA 2J3PA 3NJ5A 1JT4A 4GAIA 1RG8A 3TC2A 1S0DA 1FMMS 3ZXGA 2P23A 2KH2A 5JMCA 2NYYA 1DQGA 3FUQA 1I1EA 3EF2A 5G00A 1CVSA 3IM6A 2FGFA 3ZXDA 1SR4C 4KEJA 4D0ZA 3FJCA 4USPA 1Q04A 4I37A 3FJHA 1Z4SA 1S0FA 3OBRA 3A21A 4I4UA 4G6MA 4QD2B 1ILR1 1HIBA 2P39A 1L2HA 2Y9XE 1G9BA 1D0HA 1WBAA 3RTIB 1IRPA 1QQLA 2NM1A 4ISQA 4LO1C 1T4QA 2ZR1B 4I6IA 1FWUA 3BAHA 4I0YA 1XG6A 5BP5C 4QKSA 3Q7YA 2I1BA 1HWNB 2E4MC 2ZQOA 4JPZA 1J0SA 1PZZA 5BXTA 3CA6A 1FN0A 1G9CA 2LIEA 2VXTI 4ZGRB 1JTCA 2AFGA 2XOAA 3WINA 4HA2A 5F8YA 4LO2C 1G9DA 1BFFA 1P63A 1YXWA 4D0TA 1IILA 2MIBA 1IJTA 4OWJA 1S0EA 1BFGA 3HSMA 5FNXA 1II4A 2Z49A 4I8MA 1HWOB 4I4QA 1AVWB 3ZC8A 2FDBM 2F2FA 3O4BA 1AVXB 1AVUA 4A7KA 3FJAA 4ZFUB 1GGPB 5FNWA 3BA5A 1DIWA 1PC8B 2GZBA 3RMYA 3NBNA 1ISVA 1G82A 3SNVA 1Q1UA 1N4KA 3VEQA 3BX1C 2D44A 2HWAA 3N7KA 3RTJB 4I4RA 3UJ0A 1V6XA 4CJMA 4OWLA 1Z2VA 1JLYA 2ESUA 5BOWA 4DENA 1EV2A 2AXMA 3FFZA 2D20A 1RZOB 4GP3A 1ONKB 4Z8SB 5FZUA 4WBCA 4F83A 3LTQA 4HR6C 2Q9XA 3N7MA 4LO3C 4KC3A 5I1BA 4Q9PA 4HJJA 3O3QA 4DCKC 5BQUA 3BRDA 3CAHA 4JKXB 3A23A 2NTDA 1AF9A 3N7JA 1A8DA 3AH1A 3OJVA 4IZXA 1HCEA 4J23B 4XFUA 4P0JA 4EB2B 2RG9B 8I1BA 2RSTA 4G1RA 1BLDA 1IHKA 3CRHA 4P0KA 2KLLA 1K5UA 5F8WA 3CA5A 4ZFWB 2L5XA 4GP0A 3AJ6A 3HBWA 3AH4A 1R8OA 3AJ5A 3BAQA 3NBDA 3FJ8A 1SR4A 5D62A 3E8LC 3VWCA 1K5VA 4ZOTA 3P6JA 3AKHA 1HWMB 3UD9A 1S0LA 3PUBA 4EKXB 2NVHA 2HW9A 4USOA 2KI4A 3VSZA 1JLXA 1TWMA 4F34A 1V6UA 3PMEA 3T8SA 3C9ZA 3UDAA 3VUOA 1M16A 4FVVA 3FUOA 3H6QA 3A07A 3PG0A 4I96A 2X2TA 1BLAA 1HWPB 4JQ0A 4R6UB 3VT0A 3FJEA 3BAGA 3FJJA 2WRYA 4G9MA 4FGFA 3BTAA 2YUGA 7I1BA 3BRGC 4QC4A 4ISRA 3BA7A 1ISZA 1TFMB 4OEGA 1V6WA 4YOLA 1RMLA
chains in the Genus database with same CATH superfamily
1XYFA 1YBIA 1NUNA 3POKA 4IHZA 2RQ9A 1BFCA 1VCLA 3OJ2A 4LO7B 4H9WA 3K1XA 4J2XA 3QYDA 2DS0A 5BVPI 4IQPA 4XFTA 1FV2A 3AZVA 1I1BA 1R8NA 1TWEA 3IIRA 4TLPA 2QYIB 4J2KA 3VT1A 1T9FA 4QD2C 1ITBA 3B9UA 1JQZA 3AKIA 2K8RA 4JRAA 2K4AB 1YF8B 1JY0A 1DLLA 1AVAC 5DUYA 1XZZA 3FJ9A 1YTOA 1DFQA 3V79C 4I4XA 3OGGA 3AH2A 3AKFA 1WBCA 9ILBA 4X3AA 4QBVA 1BARA 3V0BB 1PWAA 1DJSB 1XHBA 4KBBA 4OEEA 3P53A 5DSSB 1HKNA 1M2TB 3O44A 3WINC 1S0BA 2DRZA 1FQ9A 3LLPA 4JKQA 2D43A 2LIQA 1ISXA 4IY9A 3V0BA 4H04A 3O5WB 3FJDA 3O4OA 2GO2A 2HZ9A 3FJFA 3IAGC 3D7WB 2D7RA 3CRIA 3I2XA 1WD4A 4LO0A 2VU9A 4KEKA 3BAOA 1W3AA 31BIA 3H6RB 3FGMA 4I1BA 3I29B 2Y9FA 3BA4A 2ZQNA 1W3GA 4X39A 4EEEB 1SZ6B 3H6RA 4ZKTB 1V6VA 2NZ9A 5DZUA 3HOMA 3VSFA 4G9NA 3WA1A 4AN7B 2NP0A 4MZHA 2K43A 2HWMA 1EVTA 4I3NA 4D8HA 1ISWA 4KEIA 3S8JA 3CA3A 3F1RA 3MALA 3R4SA 4XKIA 2D22A 2DREA 2R9KB 2IWTB 3N0KA 4IYBA 1EPWA 5EG6C 1YYNA 4Q91A 4ZLBB 3CQAA 4L4HA 1WD3A 5BQUC 3WMVA 3JRRA 4J2SA 1BASA 4EFRA 3UD7A 2VUAA 4A7YA 3O4AA 4I4OA 4LO1A 4EFQA 2Y9GA 2Z48A 1BA7A 2M49A 1DZCA 1FMZA 2KKIA 2NS2A 5BP5A 1JT7A 3WO3A 2FFUA 2VXRA 3CU1B 2E4MA 3QR5A 2DRYA 4EFPA 6I1BA 1Q03A 1QXMA 1EYLA 3CA1A 3CRGA 1JT5A 3AKGA 3O4CA 2MC2A 5BXPA 2AQZA 4ZBVB 2FO1A 1FWVA 2Q3NB 4OW4A 3NBCA 5E24E 5JLVA 1RY7A 3ZC9A 4LO2A 1OQLB 3FJKA 5BXRA 1S0CA 2D24A 1ABRB 1Z0HA 3NBEA 2ERMA 4GOYA 3BB2A 4I4PA 4QALA 4QKRA 3IM7A 2X2SA 2VSAA 3UJ4A 3A22A 3FJIA 4QBCA 5GAQA 3PHZA 41BIA 4J2YA 3OBTA 2MLLB 3O4DA 2D23A 1QQKA 5HPZA 3KMVA 5FZYA 1IT0A 4IZEA 5DVHA 3VT2A 3WO2A 3F62B 3Q7XA 3RMXA 4I4VA 3ZX7A 5D61A 1TOOA 3UD8A 4Q9GA 5BXSA 1FV3A 4JAWA 3I2AA 4G6JA 1BFBA 2AAIB 3CA4A 1KNMA 4LO7C 4I4YA 1UPSA 4LO3A 3RSJA 1G9AA 3Q7WA 5F90A 5B2HA 2BEAA 3BRFA 4LO8B 2BEBA 2WBCA 4X38A 5EHAA 4P6AA 3O49A 3W9TA 1NZKA 4L4IA 3N7LA 4IONA 1TP0A 4GOVA 4MZGB 2F2FC 3R4UA 4P0LA 2ET2A 2UUSA 4OWKA 3V0AB 4AN6A 4II0A 1PUUB 2Y9WC 1TIEA 3MPPG 1FGAA 4I4SA 4A7ZA 3V0AA 1IRAX 4IY8A 2D7IA 3WMUA 1CE7B 4ENDA 4ZFYB 3HMYA 1MC9A 4I1EA 1AFCA 4QO3A 2IHOA 3IM5A 5EC5A 4X37A 3FJBA 2F8XC 4Z9WB 2FFVA 1HCDA 5F8SA 1IOBA 5FZZA 3BAUA 1S0GA 2KI6B 1PUMB 2BFHA 3P6IA 4PC4A 1MD6A 1ISYA 4LO0C 3H6SE 4I7IA 1DQOA 1AXMA 1E0OA 4XFSA 1F31A 1DFCA 3BAVA 3OGFA 2VLCA 4OEFA 4OUJA 4I2SA 1W3FA 2VSEA 3WO4A 3JUTA 5D63A 4ZA3B 4JP0A 3HALA 1JT3A 4DEPA 3OJMA 3S8KA 2D1ZA 1TTUA 1DZDA 2QN4A 3HN1A 4GAFA 3ILAA 3BADA 3CA0A 21BIA 3AZWA 2J3PA 3NJ5A 1JT4A 4GAIA 1RG8A 3TC2A 1S0DA 1FMMS 3ZXGA 2P23A 2KH2A 5JMCA 2NYYA 1DQGA 3FUQA 1I1EA 3EF2A 5G00A 1CVSA 3IM6A 2FGFA 3ZXDA 1SR4C 4KEJA 4MZFB 4D0ZA 3FJCA 4USPA 1Q04A 4I37A 3FJHA 1Z4SA 1S0FA 3OBRA 3A21A 4I4UA 4G6MA 4QD2B 1ILR1 1HIBA 2P39A 1L2HA 2Y9XE 1G9BA 1D0HA 1WBAA 3RTIB 1IRPA 1QQLA 2NM1A 4ISQA 4LO1C 1T4QA 2ZR1B 4I6IA 1FWUA 3BAHA 4I0YA 1XG6A 5BP5C 4QKSA 3Q7YA 2I1BA 1HWNB 2E4MC 2ZQOA 4JPZA 1J0SA 1PZZA 5BXTA 3CA6A 1FN0A 1G9CA 2LIEA 2VXTI 4ZGRB 1JTCA 2AFGA 2XOAA 3WINA 4HA2A 5F8YA 4LO2C 1G9DA 1BFFA 1P63A 1YXWA 4D0TA 4UY4A 1IILA 2MIBA 1IJTA 4OWJA 1S0EA 1BFGA 3HSMA 5FNXA 1II4A 2Z49A 4I8MA 1HWOB 4I4QA 1AVWB 3ZC8A 2FDBM 2F2FA 3O4BA 1AVXB 1AVUA 4A7KA 3FJAA 4ZFUB 1GGPB 5FNWA 3BA5A 1DIWA 1PC8B 2GZBA 3RMYA 3NBNA 1ISVA 1G82A 3SNVA 1Q1UA 1N4KA 3VEQA 3BX1C 2D44A 2HWAA 3N7KA 3RTJB 4I4RA 3UJ0A 1V6XA 4CJMA 4OWLA 1Z2VA 1JLYA 2ESUA 5BOWA 4DENA 1EV2A 2AXMA 3FFZA 2D20A 1RZOB 4GP3A 1ONKB 4Z8SB 5FZUA 4WBCA 4F83A 3LTQA 4HR6C 2Q9XA 3N7MA 4LO3C 4KC3A 5I1BA 4Q9PA 4HJJA 3O3QA 4DCKC 5BQUA 3BRDA 3CAHA 4H75A 4JKXB 3A23A 2NTDA 1AF9A 3N7JA 1A8DA 3AH1A 3OJVA 4IZXA 1HCEA 4J23B 4XFUA 4P0JA 4EB2B 2RG9B 8I1BA 2RSTA 4G1RA 1BLDA 1IHKA 3CRHA 4P0KA 2KLLA 1K5UA 5F8WA 3CA5A 4ZFWB 2L5XA 4GP0A 3AJ6A 3HBWA 3AH4A 1R8OA 3AJ5A 3BAQA 3NBDA 3FJ8A 1SR4A 5D62A 3E8LC 3VWCA 1K5VA 4ZOTA 3P6JA 3AKHA 1HWMB 3UD9A 1S0LA 3PUBA 4EKXB 2NVHA 2HW9A 4USOA 2KI4A 3VSZA 1JLXA 1TWMA 4F34A 1V6UA 3PMEA 3T8SA 3C9ZA 3UDAA 3VUOA 1M16A 4FVVA 3FUOA 3H6QA 3A07A 3PG0A 4I96A 2X2TA 1BLAA 1HWPB 4JQ0A 4R6UB 3VT0A 3FJEA 3BAGA 3FJJA 2WRYA 4G9MA 4FGFA 3BTAA 2YUGA 7I1BA 3BRGC 4QC4A 4ISRA 3BA7A 1ISZA 1TFMB 4OEGA 1V6WA 4YOLA 1RMLA
chains in the Genus database with same CATH topology
1XYFA 1YBIA 1NUNA 3POKA 4IHZA 2RQ9A 1BFCA 1VCLA 3OJ2A 4LO7B 4H9WA 3K1XA 4J2XA 3QYDA 2DS0A 5BVPI 4IQPA 4XFTA 1FV2A 3AZVA 1I1BA 1R8NA 1TWEA 3IIRA 4TLPA 2QYIB 4J2KA 3VT1A 1T9FA 4QD2C 1ITBA 3B9UA 1JQZA 3AKIA 2K8RA 4JRAA 2K4AB 1YF8B 1JY0A 1DLLA 1AVAC 5DUYA 1XZZA 3FJ9A 1YTOA 1DFQA 3V79C 4I4XA 3OGGA 3AH2A 3AKFA 1WBCA 9ILBA 4X3AA 4QBVA 1BARA 3V0BB 1PWAA 1DJSB 1XHBA 4KBBA 4OEEA 3P53A 5DSSB 1HKNA 1M2TB 3O44A 3WINC 1S0BA 2DRZA 1FQ9A 3LLPA 4JKQA 2D43A 2LIQA 1ISXA 4IY9A 3V0BA 4H04A 3O5WB 3FJDA 3O4OA 2GO2A 2HZ9A 3FJFA 3IAGC 3D7WB 2D7RA 3CRIA 3I2XA 1WD4A 4LO0A 2VU9A 4KEKA 3BAOA 1W3AA 31BIA 3H6RB 3FGMA 4I1BA 3I29B 2Y9FA 3BA4A 2ZQNA 1W3GA 4X39A 4EEEB 1SZ6B 3H6RA 4ZKTB 1V6VA 2NZ9A 5DZUA 3HOMA 3VSFA 4G9NA 3WA1A 4AN7B 2NP0A 4MZHA 2K43A 2HWMA 1EVTA 4I3NA 4D8HA 1ISWA 4KEIA 3S8JA 3CA3A 3F1RA 3MALA 3R4SA 4XKIA 2D22A 2DREA 2R9KB 2IWTB 3N0KA 4IYBA 1EPWA 5EG6C 1YYNA 4Q91A 4ZLBB 3CQAA 4L4HA 1WD3A 5BQUC 3WMVA 3JRRA 4J2SA 1BASA 4EFRA 3UD7A 2VUAA 4A7YA 3O4AA 4I4OA 4LO1A 4EFQA 2Y9GA 2Z48A 1BA7A 2M49A 1DZCA 1FMZA 2KKIA 2NS2A 5BP5A 1JT7A 3WO3A 2FFUA 2VXRA 3CU1B 2E4MA 3QR5A 2DRYA 4EFPA 6I1BA 1Q03A 1QXMA 1EYLA 3CA1A 3CRGA 1JT5A 3AKGA 3O4CA 2MC2A 5BXPA 2AQZA 4ZBVB 2FO1A 1FWVA 2Q3NB 4OW4A 3NBCA 5E24E 5JLVA 1RY7A 3ZC9A 4LO2A 1OQLB 3FJKA 5BXRA 1S0CA 2D24A 1ABRB 1Z0HA 3NBEA 2ERMA 4GOYA 3BB2A 4I4PA 4QALA 4QKRA 3IM7A 2X2SA 2VSAA 3UJ4A 3A22A 3FJIA 4QBCA 5GAQA 3PHZA 41BIA 4J2YA 3OBTA 2MLLB 3O4DA 2D23A 1QQKA 5HPZA 3KMVA 5FZYA 1IT0A 4IZEA 5DVHA 3VT2A 3WO2A 3F62B 3Q7XA 3RMXA 4I4VA 3ZX7A 5D61A 1TOOA 3UD8A 4Q9GA 5BXSA 1FV3A 4JAWA 3I2AA 4G6JA 1BFBA 2AAIB 3CA4A 1KNMA 4LO7C 4I4YA 1UPSA 4LO3A 3RSJA 1G9AA 3Q7WA 5F90A 5B2HA 2BEAA 3BRFA 4LO8B 2BEBA 2WBCA 4X38A 5EHAA 4P6AA 3O49A 3W9TA 1NZKA 4L4IA 3N7LA 4IONA 1TP0A 4GOVA 4MZGB 2F2FC 3R4UA 4P0LA 2ET2A 2UUSA 4OWKA 3V0AB 4AN6A 4II0A 1PUUB 2Y9WC 1TIEA 3MPPG 1FGAA 4I4SA 4A7ZA 3V0AA 1IRAX 4IY8A 2D7IA 3WMUA 1CE7B 4ENDA 4ZFYB 3HMYA 1MC9A 4I1EA 1AFCA 4QO3A 2IHOA 3IM5A 5EC5A 4X37A 3FJBA 2F8XC 4Z9WB 2FFVA 1HCDA 5F8SA 1IOBA 5FZZA 3BAUA 1S0GA 2KI6B 1PUMB 2BFHA 3P6IA 4PC4A 1MD6A 1ISYA 4LO0C 3H6SE 4I7IA 1DQOA 1AXMA 1E0OA 4XFSA 1F31A 1DFCA 3BAVA 3OGFA 2VLCA 4OEFA 4OUJA 4I2SA 1W3FA 2VSEA 3WO4A 3JUTA 5D63A 4ZA3B 4JP0A 3HALA 1JT3A 4DEPA 3OJMA 3S8KA 2D1ZA 1TTUA 1DZDA 2QN4A 3HN1A 4GAFA 3ILAA 3BADA 3CA0A 21BIA 3AZWA 2J3PA 3NJ5A 1JT4A 4GAIA 1RG8A 3TC2A 1S0DA 1FMMS 3ZXGA 2P23A 2KH2A 5JMCA 2NYYA 1DQGA 3FUQA 1I1EA 3EF2A 5G00A 1CVSA 3IM6A 2FGFA 3ZXDA 1SR4C 4KEJA 4MZFB 4D0ZA 3FJCA 4USPA 1Q04A 4I37A 3FJHA 1Z4SA 1S0FA 3OBRA 3A21A 4I4UA 4G6MA 4QD2B 1ILR1 1HIBA 2P39A 1L2HA 2Y9XE 1G9BA 1D0HA 1WBAA 3RTIB 1IRPA 1QQLA 2NM1A 4ISQA 4LO1C 1T4QA 2ZR1B 4I6IA 1FWUA 3BAHA 4I0YA 1XG6A 5BP5C 4QKSA 3Q7YA 2I1BA 1HWNB 2E4MC 2ZQOA 4JPZA 1J0SA 1PZZA 5BXTA 3CA6A 1FN0A 1G9CA 2LIEA 2VXTI 4ZGRB 1JTCA 2AFGA 2XOAA 3WINA 4HA2A 5F8YA 4LO2C 1G9DA 1BFFA 1P63A 1YXWA 4D0TA 4UY4A 1IILA 2MIBA 1IJTA 4OWJA 1S0EA 1BFGA 3HSMA 5FNXA 1II4A 2Z49A 4I8MA 1HWOB 4I4QA 1AVWB 3ZC8A 2FDBM 2F2FA 3O4BA 1AVXB 1AVUA 4A7KA 3FJAA 4ZFUB 1GGPB 5FNWA 3BA5A 1DIWA 1PC8B 2GZBA 3RMYA 3NBNA 1ISVA 1G82A 3SNVA 1Q1UA 1N4KA 3VEQA 3BX1C 2D44A 2HWAA 3N7KA 3RTJB 4I4RA 3UJ0A 1V6XA 4CJMA 4OWLA 1Z2VA 1JLYA 2ESUA 5BOWA 4DENA 1EV2A 2AXMA 3FFZA 2D20A 1RZOB 4GP3A 1ONKB 4Z8SB 5FZUA 4WBCA 4F83A 3LTQA 4HR6C 2Q9XA 3N7MA 4LO3C 4KC3A 5I1BA 4Q9PA 4HJJA 3O3QA 4DCKC 5BQUA 3BRDA 3CAHA 4H75A 4JKXB 3A23A 2NTDA 1AF9A 3N7JA 1A8DA 3AH1A 3OJVA 4IZXA 1HCEA 4J23B 4XFUA 4P0JA 4EB2B 2RG9B 8I1BA 2RSTA 4G1RA 1BLDA 1IHKA 3CRHA 4P0KA 2KLLA 1K5UA 5F8WA 3CA5A 4ZFWB 2L5XA 4GP0A 3AJ6A 3HBWA 3AH4A 1R8OA 3AJ5A 3BAQA 3NBDA 3FJ8A 1SR4A 5D62A 3E8LC 3VWCA 1K5VA 4ZOTA 3P6JA 3AKHA 1HWMB 3UD9A 1S0LA 3PUBA 4EKXB 2NVHA 2HW9A 4USOA 2KI4A 3VSZA 1JLXA 1TWMA 4F34A 1V6UA 3PMEA 3T8SA 3C9ZA 3UDAA 3VUOA 1M16A 4FVVA 3FUOA 3H6QA 3A07A 3PG0A 4I96A 2X2TA 1BLAA 1HWPB 4JQ0A 4R6UB 3VT0A 3FJEA 3BAGA 3FJJA 2WRYA 4G9MA 4FGFA 3BTAA 2YUGA 7I1BA 3BRGC 4QC4A 4ISRA 3BA7A 1ISZA 1TFMB 4OEGA 1V6WA 4YOLA 1RMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XYF A;  1YBI A;  1NUN A;  3POK A;  4IHZ A;  2RQ9 A;  1BFC A;  1VCL A;  3OJ2 A;  4LO7 B;  4H9W A;  3K1X A;  4J2X A;  3QYD A;  2DS0 A;  5BVP I;  4IQP A;  4XFT A;  1FV2 A;  3AZV A;  1I1B A;  1R8N A;  1TWE A;  3IIR A;  4TLP A;  2QYI B;  4J2K A;  3VT1 A;  1T9F A;  4QD2 C;  1ITB A;  3B9U A;  1JQZ A;  3AKI A;  2K8R A;  4JRA A;  2K4A B;  1YF8 B;  1JY0 A;  1DLL A;  1AVA C;  5DUY A;  1XZZ A;  3FJ9 A;  1YTO A;  1DFQ A;  3V79 C;  4I4X A;  3OGG A;  3AH2 A;  3AKF A;  1WBC A;  9ILB A;  4X3A A;  4QBV A;  1BAR A;  3V0B B;  1PWA A;  1DJS B;  1XHB A;  4KBB A;  4OEE A;  3P53 A;  5DSS B;  1HKN A;  1M2T B;  3O44 A;  3WIN C;  1S0B A;  2DRZ A;  1FQ9 A;  3LLP A;  4JKQ A;  2D43 A;  2LIQ A;  1ISX A;  4IY9 A;  3V0B A;  4H04 A;  3O5W B;  3FJD A;  3O4O A;  2GO2 A;  2HZ9 A;  3FJF A;  3IAG C;  3D7W B;  2D7R A;  3CRI A;  3I2X A;  1WD4 A;  4LO0 A;  2VU9 A;  4KEK A;  3BAO A;  1W3A A;  31BI A;  3H6R B;  3FGM A;  4I1B A;  3I29 B;  2Y9F A;  3BA4 A;  2ZQN A;  1W3G A;  4X39 A;  4EEE B;  1SZ6 B;  3H6R A;  4ZKT B;  1V6V A;  2NZ9 A;  5DZU A;  3HOM A;  3VSF A;  4G9N A;  3WA1 A;  4AN7 B;  2NP0 A;  2K43 A;  2HWM A;  1EVT A;  4I3N A;  4D8H A;  1ISW A;  4KEI A;  3S8J A;  3CA3 A;  3F1R A;  3MAL A;  3R4S A;  4XKI A;  2D22 A;  2DRE A;  2R9K B;  2IWT B;  3N0K A;  4IYB A;  1EPW A;  5EG6 C;  1YYN A;  4Q91 A;  4ZLB B;  3CQA A;  4L4H A;  1WD3 A;  5BQU C;  3WMV A;  3JRR A;  4J2S A;  1BAS A;  4EFR A;  3UD7 A;  2VUA A;  4A7Y A;  3O4A A;  4I4O A;  4LO1 A;  4EFQ A;  2Y9G A;  2Z48 A;  1BA7 A;  2M49 A;  1DZC A;  1FMZ A;  2KKI A;  5BP5 A;  1JT7 A;  3WO3 A;  2FFU A;  2VXR A;  3CU1 B;  2E4M A;  3QR5 A;  2DRY A;  4EFP A;  6I1B A;  1Q03 A;  1QXM A;  1EYL A;  3CA1 A;  3CRG A;  1JT5 A;  3AKG A;  3O4C A;  2MC2 A;  5BXP A;  2AQZ A;  4ZBV B;  2FO1 A;  1FWV A;  2Q3N B;  4OW4 A;  3NBC A;  5E24 E;  5JLV A;  1RY7 A;  3ZC9 A;  4LO2 A;  1OQL B;  3FJK A;  5BXR A;  1S0C A;  2D24 A;  1ABR B;  1Z0H A;  3NBE A;  2ERM A;  4GOY A;  3BB2 A;  4I4P A;  4QAL A;  4QKR A;  3IM7 A;  2X2S A;  2VSA A;  3UJ4 A;  3A22 A;  3FJI A;  4QBC A;  5GAQ A;  3PHZ A;  41BI A;  4J2Y A;  3OBT A;  2MLL B;  3O4D A;  2D23 A;  1QQK A;  5HPZ A;  3KMV A;  5FZY A;  1IT0 A;  4IZE A;  5DVH A;  3VT2 A;  3WO2 A;  3F62 B;  3Q7X A;  3RMX A;  4I4V A;  3ZX7 A;  5D61 A;  1TOO A;  3UD8 A;  4Q9G A;  5BXS A;  1FV3 A;  4JAW A;  3I2A A;  4G6J A;  1BFB A;  2AAI B;  3CA4 A;  1KNM A;  4LO7 C;  4I4Y A;  1UPS A;  4LO3 A;  3RSJ A;  1G9A A;  3Q7W A;  5F90 A;  5B2H A;  2BEA A;  3BRF A;  4LO8 B;  2BEB A;  2WBC A;  4X38 A;  5EHA A;  4P6A A;  3O49 A;  3W9T A;  1NZK A;  4L4I A;  3N7L A;  4ION A;  1TP0 A;  4GOV A;  2F2F C;  3R4U A;  4P0L A;  2ET2 A;  2UUS A;  4OWK A;  3V0A B;  4AN6 A;  4II0 A;  1PUU B;  2Y9W C;  1TIE A;  3MPP G;  1FGA A;  4I4S A;  4A7Z A;  3V0A A;  1IRA X;  4IY8 A;  2D7I A;  3WMU A;  1CE7 B;  4END A;  4ZFY B;  3HMY A;  1MC9 A;  4I1E A;  1AFC A;  4QO3 A;  2IHO A;  3IM5 A;  5EC5 A;  4X37 A;  3FJB A;  2F8X C;  4Z9W B;  2FFV A;  1HCD A;  5F8S A;  1IOB A;  5FZZ A;  3BAU A;  1S0G A;  2KI6 B;  1PUM B;  2BFH A;  3P6I A;  4PC4 A;  1MD6 A;  1ISY A;  4LO0 C;  3H6S E;  4I7I A;  1DQO A;  1AXM A;  1E0O A;  4XFS A;  1F31 A;  1DFC A;  3BAV A;  3OGF A;  2VLC A;  4OEF A;  4OUJ A;  4I2S A;  1W3F A;  2VSE A;  3WO4 A;  3JUT A;  5D63 A;  4ZA3 B;  4JP0 A;  3HAL A;  1JT3 A;  4DEP A;  3OJM A;  3S8K A;  2D1Z A;  1TTU A;  1DZD A;  2QN4 A;  3HN1 A;  4GAF A;  3ILA A;  3BAD A;  3CA0 A;  21BI A;  3AZW A;  2J3P A;  3NJ5 A;  1JT4 A;  4GAI A;  1RG8 A;  3TC2 A;  1S0D A;  1FMM S;  3ZXG A;  2P23 A;  2KH2 A;  5JMC A;  2NYY A;  1DQG A;  3FUQ A;  1I1E A;  3EF2 A;  5G00 A;  1CVS A;  3IM6 A;  2FGF A;  3ZXD A;  1SR4 C;  4KEJ A;  4D0Z A;  3FJC A;  4USP A;  1Q04 A;  4I37 A;  3FJH A;  1Z4S A;  1S0F A;  3OBR A;  3A21 A;  4I4U A;  4G6M A;  4QD2 B;  1ILR 1;  1HIB A;  2P39 A;  1L2H A;  2Y9X E;  1G9B A;  1D0H A;  1WBA A;  3RTI B;  1IRP A;  1QQL A;  2NM1 A;  4ISQ A;  4LO1 C;  1T4Q A;  2ZR1 B;  4I6I A;  1FWU A;  3BAH A;  4I0Y A;  1XG6 A;  5BP5 C;  4QKS A;  3Q7Y A;  2I1B A;  1HWN B;  2E4M C;  2ZQO A;  4JPZ A;  1J0S A;  1PZZ A;  5BXT A;  3CA6 A;  1FN0 A;  1G9C A;  2LIE A;  2VXT I;  4ZGR B;  1JTC A;  2AFG A;  2XOA A;  3WIN A;  4HA2 A;  5F8Y A;  4LO2 C;  1G9D A;  1BFF A;  1P63 A;  1YXW A;  4D0T A;  1IIL A;  2MIB A;  1IJT A;  4OWJ A;  1S0E A;  1BFG A;  3HSM A;  5FNX A;  1II4 A;  2Z49 A;  4I8M A;  1HWO B;  4I4Q A;  1AVW B;  3ZC8 A;  2FDB M;  2F2F A;  3O4B A;  1AVX B;  1AVU A;  4A7K A;  3FJA A;  4ZFU B;  1GGP B;  5FNW A;  3BA5 A;  1DIW A;  1PC8 B;  2GZB A;  3RMY A;  3NBN A;  1ISV A;  1G82 A;  3SNV A;  1Q1U A;  1N4K A;  3VEQ A;  3BX1 C;  2D44 A;  2HWA A;  3N7K A;  3RTJ B;  4I4R A;  3UJ0 A;  1V6X A;  4CJM A;  4OWL A;  1Z2V A;  1JLY A;  2ESU A;  5BOW A;  4DEN A;  1EV2 A;  2AXM A;  3FFZ A;  2D20 A;  1RZO B;  4GP3 A;  1ONK B;  4Z8S B;  5FZU A;  4WBC A;  4F83 A;  3LTQ A;  4HR6 C;  2Q9X A;  3N7M A;  4LO3 C;  4KC3 A;  5I1B A;  4Q9P A;  4HJJ A;  3O3Q A;  4DCK C;  5BQU A;  3BRD A;  3CAH A;  4JKX B;  3A23 A;  2NTD A;  1AF9 A;  3N7J A;  1A8D A;  3AH1 A;  3OJV A;  4IZX A;  1HCE A;  4J23 B;  4XFU A;  4P0J A;  4EB2 B;  2RG9 B;  8I1B A;  2RST A;  4G1R A;  1BLD A;  1IHK A;  3CRH A;  4P0K A;  2KLL A;  1K5U A;  5F8W A;  3CA5 A;  4ZFW B;  2L5X A;  4GP0 A;  3AJ6 A;  3HBW A;  3AH4 A;  1R8O A;  3AJ5 A;  3BAQ A;  3NBD A;  3FJ8 A;  1SR4 A;  5D62 A;  3E8L C;  3VWC A;  1K5V A;  4ZOT A;  3P6J A;  3AKH A;  1HWM B;  3UD9 A;  1S0L A;  3PUB A;  4EKX B;  2NVH A;  2HW9 A;  4USO A;  2KI4 A;  3VSZ A;  1JLX A;  1TWM A;  4F34 A;  1V6U A;  3PME A;  3T8S A;  3C9Z A;  3UDA A;  3VUO A;  1M16 A;  4FVV A;  3FUO A;  3H6Q A;  3A07 A;  3PG0 A;  4I96 A;  2X2T A;  1BLA A;  1HWP B;  4JQ0 A;  4R6U B;  3VT0 A;  3FJE A;  3BAG A;  3FJJ A;  2WRY A;  4G9M A;  4FGF A;  3BTA A;  2YUG A;  7I1B A;  3BRG C;  4QC4 A;  4ISR A;  3BA7 A;  1ISZ A;  1TFM B;  4OEG A;  1V6W A;  4YOL A;  1RML A; 
#chains in the Genus database with same CATH topology
 1XYF A;  1YBI A;  1NUN A;  3POK A;  4IHZ A;  2RQ9 A;  1BFC A;  1VCL A;  3OJ2 A;  4LO7 B;  4H9W A;  3K1X A;  4J2X A;  3QYD A;  2DS0 A;  5BVP I;  4IQP A;  4XFT A;  1FV2 A;  3AZV A;  1I1B A;  1R8N A;  1TWE A;  3IIR A;  4TLP A;  2QYI B;  4J2K A;  3VT1 A;  1T9F A;  4QD2 C;  1ITB A;  3B9U A;  1JQZ A;  3AKI A;  2K8R A;  4JRA A;  2K4A B;  1YF8 B;  1JY0 A;  1DLL A;  1AVA C;  5DUY A;  1XZZ A;  3FJ9 A;  1YTO A;  1DFQ A;  3V79 C;  4I4X A;  3OGG A;  3AH2 A;  3AKF A;  1WBC A;  9ILB A;  4X3A A;  4QBV A;  1BAR A;  3V0B B;  1PWA A;  1DJS B;  1XHB A;  4KBB A;  4OEE A;  3P53 A;  5DSS B;  1HKN A;  1M2T B;  3O44 A;  3WIN C;  1S0B A;  2DRZ A;  1FQ9 A;  3LLP A;  4JKQ A;  2D43 A;  2LIQ A;  1ISX A;  4IY9 A;  3V0B A;  4H04 A;  3O5W B;  3FJD A;  3O4O A;  2GO2 A;  2HZ9 A;  3FJF A;  3IAG C;  3D7W B;  2D7R A;  3CRI A;  3I2X A;  1WD4 A;  4LO0 A;  2VU9 A;  4KEK A;  3BAO A;  1W3A A;  31BI A;  3H6R B;  3FGM A;  4I1B A;  3I29 B;  2Y9F A;  3BA4 A;  2ZQN A;  1W3G A;  4X39 A;  4EEE B;  1SZ6 B;  3H6R A;  4ZKT B;  1V6V A;  2NZ9 A;  5DZU A;  3HOM A;  3VSF A;  4G9N A;  3WA1 A;  4AN7 B;  2NP0 A;  4MZH A;  2K43 A;  2HWM A;  1EVT A;  4I3N A;  4D8H A;  1ISW A;  4KEI A;  3S8J A;  3CA3 A;  3F1R A;  3MAL A;  3R4S A;  4XKI A;  2D22 A;  2DRE A;  2R9K B;  2IWT B;  3N0K A;  4IYB A;  1EPW A;  5EG6 C;  1YYN A;  4Q91 A;  4ZLB B;  3CQA A;  4L4H A;  1WD3 A;  5BQU C;  3WMV A;  3JRR A;  4J2S A;  1BAS A;  4EFR A;  3UD7 A;  2VUA A;  4A7Y A;  3O4A A;  4I4O A;  4LO1 A;  4EFQ A;  2Y9G A;  2Z48 A;  1BA7 A;  2M49 A;  1DZC A;  1FMZ A;  2KKI A;  2NS2 A;  5BP5 A;  1JT7 A;  3WO3 A;  2FFU A;  2VXR A;  3CU1 B;  2E4M A;  3QR5 A;  2DRY A;  4EFP A;  6I1B A;  1Q03 A;  1QXM A;  1EYL A;  3CA1 A;  3CRG A;  1JT5 A;  3AKG A;  3O4C A;  2MC2 A;  5BXP A;  2AQZ A;  4ZBV B;  2FO1 A;  1FWV A;  2Q3N B;  4OW4 A;  3NBC A;  5E24 E;  5JLV A;  1RY7 A;  3ZC9 A;  4LO2 A;  1OQL B;  3FJK A;  5BXR A;  1S0C A;  2D24 A;  1ABR B;  1Z0H A;  3NBE A;  2ERM A;  4GOY A;  3BB2 A;  4I4P A;  4QAL A;  4QKR A;  3IM7 A;  2X2S A;  2VSA A;  3UJ4 A;  3A22 A;  3FJI A;  4QBC A;  5GAQ A;  3PHZ A;  41BI A;  4J2Y A;  3OBT A;  2MLL B;  3O4D A;  2D23 A;  1QQK A;  5HPZ A;  3KMV A;  5FZY A;  1IT0 A;  4IZE A;  5DVH A;  3VT2 A;  3WO2 A;  3F62 B;  3Q7X A;  3RMX A;  4I4V A;  3ZX7 A;  5D61 A;  1TOO A;  3UD8 A;  4Q9G A;  5BXS A;  1FV3 A;  4JAW A;  3I2A A;  4G6J A;  1BFB A;  2AAI B;  3CA4 A;  1KNM A;  4LO7 C;  4I4Y A;  1UPS A;  4LO3 A;  3RSJ A;  1G9A A;  3Q7W A;  5F90 A;  5B2H A;  2BEA A;  3BRF A;  4LO8 B;  2BEB A;  2WBC A;  4X38 A;  5EHA A;  4P6A A;  3O49 A;  3W9T A;  1NZK A;  4L4I A;  3N7L A;  4ION A;  1TP0 A;  4GOV A;  4MZG B;  2F2F C;  3R4U A;  4P0L A;  2ET2 A;  2UUS A;  4OWK A;  3V0A B;  4AN6 A;  4II0 A;  1PUU B;  2Y9W C;  1TIE A;  3MPP G;  1FGA A;  4I4S A;  4A7Z A;  3V0A A;  1IRA X;  4IY8 A;  2D7I A;  3WMU A;  1CE7 B;  4END A;  4ZFY B;  3HMY A;  1MC9 A;  4I1E A;  1AFC A;  4QO3 A;  2IHO A;  3IM5 A;  5EC5 A;  4X37 A;  3FJB A;  2F8X C;  4Z9W B;  2FFV A;  1HCD A;  5F8S A;  1IOB A;  5FZZ A;  3BAU A;  1S0G A;  2KI6 B;  1PUM B;  2BFH A;  3P6I A;  4PC4 A;  1MD6 A;  1ISY A;  4LO0 C;  3H6S E;  4I7I A;  1DQO A;  1AXM A;  1E0O A;  4XFS A;  1F31 A;  1DFC A;  3BAV A;  3OGF A;  2VLC A;  4OEF A;  4OUJ A;  4I2S A;  1W3F A;  2VSE A;  3WO4 A;  3JUT A;  5D63 A;  4ZA3 B;  4JP0 A;  3HAL A;  1JT3 A;  4DEP A;  3OJM A;  3S8K A;  2D1Z A;  1TTU A;  1DZD A;  2QN4 A;  3HN1 A;  4GAF A;  3ILA A;  3BAD A;  3CA0 A;  21BI A;  3AZW A;  2J3P A;  3NJ5 A;  1JT4 A;  4GAI A;  1RG8 A;  3TC2 A;  1S0D A;  1FMM S;  3ZXG A;  2P23 A;  2KH2 A;  5JMC A;  2NYY A;  1DQG A;  3FUQ A;  1I1E A;  3EF2 A;  5G00 A;  1CVS A;  3IM6 A;  2FGF A;  3ZXD A;  1SR4 C;  4KEJ A;  4MZF B;  4D0Z A;  3FJC A;  4USP A;  1Q04 A;  4I37 A;  3FJH A;  1Z4S A;  1S0F A;  3OBR A;  3A21 A;  4I4U A;  4G6M A;  4QD2 B;  1ILR 1;  1HIB A;  2P39 A;  1L2H A;  2Y9X E;  1G9B A;  1D0H A;  1WBA A;  3RTI B;  1IRP A;  1QQL A;  2NM1 A;  4ISQ A;  4LO1 C;  1T4Q A;  2ZR1 B;  4I6I A;  1FWU A;  3BAH A;  4I0Y A;  1XG6 A;  5BP5 C;  4QKS A;  3Q7Y A;  2I1B A;  1HWN B;  2E4M C;  2ZQO A;  4JPZ A;  1J0S A;  1PZZ A;  5BXT A;  3CA6 A;  1FN0 A;  1G9C A;  2LIE A;  2VXT I;  4ZGR B;  1JTC A;  2AFG A;  2XOA A;  3WIN A;  4HA2 A;  5F8Y A;  4LO2 C;  1G9D A;  1BFF A;  1P63 A;  1YXW A;  4D0T A;  4UY4 A;  1IIL A;  2MIB A;  1IJT A;  4OWJ A;  1S0E A;  1BFG A;  3HSM A;  5FNX A;  1II4 A;  2Z49 A;  4I8M A;  1HWO B;  4I4Q A;  1AVW B;  3ZC8 A;  2FDB M;  2F2F A;  3O4B A;  1AVX B;  1AVU A;  4A7K A;  3FJA A;  4ZFU B;  1GGP B;  5FNW A;  3BA5 A;  1DIW A;  1PC8 B;  2GZB A;  3RMY A;  3NBN A;  1ISV A;  1G82 A;  3SNV A;  1Q1U A;  1N4K A;  3VEQ A;  3BX1 C;  2D44 A;  2HWA A;  3N7K A;  3RTJ B;  4I4R A;  3UJ0 A;  1V6X A;  4CJM A;  4OWL A;  1Z2V A;  1JLY A;  2ESU A;  5BOW A;  4DEN A;  1EV2 A;  2AXM A;  3FFZ A;  2D20 A;  1RZO B;  4GP3 A;  1ONK B;  4Z8S B;  5FZU A;  4WBC A;  4F83 A;  3LTQ A;  4HR6 C;  2Q9X A;  3N7M A;  4LO3 C;  4KC3 A;  5I1B A;  4Q9P A;  4HJJ A;  3O3Q A;  4DCK C;  5BQU A;  3BRD A;  3CAH A;  4H75 A;  4JKX B;  3A23 A;  2NTD A;  1AF9 A;  3N7J A;  1A8D A;  3AH1 A;  3OJV A;  4IZX A;  1HCE A;  4J23 B;  4XFU A;  4P0J A;  4EB2 B;  2RG9 B;  8I1B A;  2RST A;  4G1R A;  1BLD A;  1IHK A;  3CRH A;  4P0K A;  2KLL A;  1K5U A;  5F8W A;  3CA5 A;  4ZFW B;  2L5X A;  4GP0 A;  3AJ6 A;  3HBW A;  3AH4 A;  1R8O A;  3AJ5 A;  3BAQ A;  3NBD A;  3FJ8 A;  1SR4 A;  5D62 A;  3E8L C;  3VWC A;  1K5V A;  4ZOT A;  3P6J A;  3AKH A;  1HWM B;  3UD9 A;  1S0L A;  3PUB A;  4EKX B;  2NVH A;  2HW9 A;  4USO A;  2KI4 A;  3VSZ A;  1JLX A;  1TWM A;  4F34 A;  1V6U A;  3PME A;  3T8S A;  3C9Z A;  3UDA A;  3VUO A;  1M16 A;  4FVV A;  3FUO A;  3H6Q A;  3A07 A;  3PG0 A;  4I96 A;  2X2T A;  1BLA A;  1HWP B;  4JQ0 A;  4R6U B;  3VT0 A;  3FJE A;  3BAG A;  3FJJ A;  2WRY A;  4G9M A;  4FGF A;  3BTA A;  2YUG A;  7I1B A;  3BRG C;  4QC4 A;  4ISR A;  3BA7 A;  1ISZ A;  1TFM B;  4OEG A;  1V6W A;  4YOL A;  1RML A; 
#chains in the Genus database with same CATH homology
 1XYF A;  1YBI A;  1NUN A;  3POK A;  4IHZ A;  2RQ9 A;  1BFC A;  1VCL A;  3OJ2 A;  4LO7 B;  4H9W A;  3K1X A;  4J2X A;  3QYD A;  2DS0 A;  5BVP I;  4IQP A;  4XFT A;  1FV2 A;  3AZV A;  1I1B A;  1R8N A;  1TWE A;  3IIR A;  4TLP A;  2QYI B;  4J2K A;  3VT1 A;  1T9F A;  4QD2 C;  1ITB A;  3B9U A;  1JQZ A;  3AKI A;  2K8R A;  4JRA A;  2K4A B;  1YF8 B;  1JY0 A;  1DLL A;  1AVA C;  5DUY A;  1XZZ A;  3FJ9 A;  1YTO A;  1DFQ A;  3V79 C;  4I4X A;  3OGG A;  3AH2 A;  3AKF A;  1WBC A;  9ILB A;  4X3A A;  4QBV A;  1BAR A;  3V0B B;  1PWA A;  1DJS B;  1XHB A;  4KBB A;  4OEE A;  3P53 A;  5DSS B;  1HKN A;  1M2T B;  3O44 A;  3WIN C;  1S0B A;  2DRZ A;  1FQ9 A;  3LLP A;  4JKQ A;  2D43 A;  2LIQ A;  1ISX A;  4IY9 A;  3V0B A;  4H04 A;  3O5W B;  3FJD A;  3O4O A;  2GO2 A;  2HZ9 A;  3FJF A;  3IAG C;  3D7W B;  2D7R A;  3CRI A;  3I2X A;  1WD4 A;  4LO0 A;  2VU9 A;  4KEK A;  3BAO A;  1W3A A;  31BI A;  3H6R B;  3FGM A;  4I1B A;  3I29 B;  2Y9F A;  3BA4 A;  2ZQN A;  1W3G A;  4X39 A;  4EEE B;  1SZ6 B;  3H6R A;  4ZKT B;  1V6V A;  2NZ9 A;  5DZU A;  3HOM A;  3VSF A;  4G9N A;  3WA1 A;  4AN7 B;  2NP0 A;  4MZH A;  2K43 A;  2HWM A;  1EVT A;  4I3N A;  4D8H A;  1ISW A;  4KEI A;  3S8J A;  3CA3 A;  3F1R A;  3MAL A;  3R4S A;  4XKI A;  2D22 A;  2DRE A;  2R9K B;  2IWT B;  3N0K A;  4IYB A;  1EPW A;  5EG6 C;  1YYN A;  4Q91 A;  4ZLB B;  3CQA A;  4L4H A;  1WD3 A;  5BQU C;  3WMV A;  3JRR A;  4J2S A;  1BAS A;  4EFR A;  3UD7 A;  2VUA A;  4A7Y A;  3O4A A;  4I4O A;  4LO1 A;  4EFQ A;  2Y9G A;  2Z48 A;  1BA7 A;  2M49 A;  1DZC A;  1FMZ A;  2KKI A;  2NS2 A;  5BP5 A;  1JT7 A;  3WO3 A;  2FFU A;  2VXR A;  3CU1 B;  2E4M A;  3QR5 A;  2DRY A;  4EFP A;  6I1B A;  1Q03 A;  1QXM A;  1EYL A;  3CA1 A;  3CRG A;  1JT5 A;  3AKG A;  3O4C A;  2MC2 A;  5BXP A;  2AQZ A;  4ZBV B;  2FO1 A;  1FWV A;  2Q3N B;  4OW4 A;  3NBC A;  5E24 E;  5JLV A;  1RY7 A;  3ZC9 A;  4LO2 A;  1OQL B;  3FJK A;  5BXR A;  1S0C A;  2D24 A;  1ABR B;  1Z0H A;  3NBE A;  2ERM A;  4GOY A;  3BB2 A;  4I4P A;  4QAL A;  4QKR A;  3IM7 A;  2X2S A;  2VSA A;  3UJ4 A;  3A22 A;  3FJI A;  4QBC A;  5GAQ A;  3PHZ A;  41BI A;  4J2Y A;  3OBT A;  2MLL B;  3O4D A;  2D23 A;  1QQK A;  5HPZ A;  3KMV A;  5FZY A;  1IT0 A;  4IZE A;  5DVH A;  3VT2 A;  3WO2 A;  3F62 B;  3Q7X A;  3RMX A;  4I4V A;  3ZX7 A;  5D61 A;  1TOO A;  3UD8 A;  4Q9G A;  5BXS A;  1FV3 A;  4JAW A;  3I2A A;  4G6J A;  1BFB A;  2AAI B;  3CA4 A;  1KNM A;  4LO7 C;  4I4Y A;  1UPS A;  4LO3 A;  3RSJ A;  1G9A A;  3Q7W A;  5F90 A;  5B2H A;  2BEA A;  3BRF A;  4LO8 B;  2BEB A;  2WBC A;  4X38 A;  5EHA A;  4P6A A;  3O49 A;  3W9T A;  1NZK A;  4L4I A;  3N7L A;  4ION A;  1TP0 A;  4GOV A;  4MZG B;  2F2F C;  3R4U A;  4P0L A;  2ET2 A;  2UUS A;  4OWK A;  3V0A B;  4AN6 A;  4II0 A;  1PUU B;  2Y9W C;  1TIE A;  3MPP G;  1FGA A;  4I4S A;  4A7Z A;  3V0A A;  1IRA X;  4IY8 A;  2D7I A;  3WMU A;  1CE7 B;  4END A;  4ZFY B;  3HMY A;  1MC9 A;  4I1E A;  1AFC A;  4QO3 A;  2IHO A;  3IM5 A;  5EC5 A;  4X37 A;  3FJB A;  2F8X C;  4Z9W B;  2FFV A;  1HCD A;  5F8S A;  1IOB A;  5FZZ A;  3BAU A;  1S0G A;  2KI6 B;  1PUM B;  2BFH A;  3P6I A;  4PC4 A;  1MD6 A;  1ISY A;  4LO0 C;  3H6S E;  4I7I A;  1DQO A;  1AXM A;  1E0O A;  4XFS A;  1F31 A;  1DFC A;  3BAV A;  3OGF A;  2VLC A;  4OEF A;  4OUJ A;  4I2S A;  1W3F A;  2VSE A;  3WO4 A;  3JUT A;  5D63 A;  4ZA3 B;  4JP0 A;  3HAL A;  1JT3 A;  4DEP A;  3OJM A;  3S8K A;  2D1Z A;  1TTU A;  1DZD A;  2QN4 A;  3HN1 A;  4GAF A;  3ILA A;  3BAD A;  3CA0 A;  21BI A;  3AZW A;  2J3P A;  3NJ5 A;  1JT4 A;  4GAI A;  1RG8 A;  3TC2 A;  1S0D A;  1FMM S;  3ZXG A;  2P23 A;  2KH2 A;  5JMC A;  2NYY A;  1DQG A;  3FUQ A;  1I1E A;  3EF2 A;  5G00 A;  1CVS A;  3IM6 A;  2FGF A;  3ZXD A;  1SR4 C;  4KEJ A;  4MZF B;  4D0Z A;  3FJC A;  4USP A;  1Q04 A;  4I37 A;  3FJH A;  1Z4S A;  1S0F A;  3OBR A;  3A21 A;  4I4U A;  4G6M A;  4QD2 B;  1ILR 1;  1HIB A;  2P39 A;  1L2H A;  2Y9X E;  1G9B A;  1D0H A;  1WBA A;  3RTI B;  1IRP A;  1QQL A;  2NM1 A;  4ISQ A;  4LO1 C;  1T4Q A;  2ZR1 B;  4I6I A;  1FWU A;  3BAH A;  4I0Y A;  1XG6 A;  5BP5 C;  4QKS A;  3Q7Y A;  2I1B A;  1HWN B;  2E4M C;  2ZQO A;  4JPZ A;  1J0S A;  1PZZ A;  5BXT A;  3CA6 A;  1FN0 A;  1G9C A;  2LIE A;  2VXT I;  4ZGR B;  1JTC A;  2AFG A;  2XOA A;  3WIN A;  4HA2 A;  5F8Y A;  4LO2 C;  1G9D A;  1BFF A;  1P63 A;  1YXW A;  4D0T A;  4UY4 A;  1IIL A;  2MIB A;  1IJT A;  4OWJ A;  1S0E A;  1BFG A;  3HSM A;  5FNX A;  1II4 A;  2Z49 A;  4I8M A;  1HWO B;  4I4Q A;  1AVW B;  3ZC8 A;  2FDB M;  2F2F A;  3O4B A;  1AVX B;  1AVU A;  4A7K A;  3FJA A;  4ZFU B;  1GGP B;  5FNW A;  3BA5 A;  1DIW A;  1PC8 B;  2GZB A;  3RMY A;  3NBN A;  1ISV A;  1G82 A;  3SNV A;  1Q1U A;  1N4K A;  3VEQ A;  3BX1 C;  2D44 A;  2HWA A;  3N7K A;  3RTJ B;  4I4R A;  3UJ0 A;  1V6X A;  4CJM A;  4OWL A;  1Z2V A;  1JLY A;  2ESU A;  5BOW A;  4DEN A;  1EV2 A;  2AXM A;  3FFZ A;  2D20 A;  1RZO B;  4GP3 A;  1ONK B;  4Z8S B;  5FZU A;  4WBC A;  4F83 A;  3LTQ A;  4HR6 C;  2Q9X A;  3N7M A;  4LO3 C;  4KC3 A;  5I1B A;  4Q9P A;  4HJJ A;  3O3Q A;  4DCK C;  5BQU A;  3BRD A;  3CAH A;  4H75 A;  4JKX B;  3A23 A;  2NTD A;  1AF9 A;  3N7J A;  1A8D A;  3AH1 A;  3OJV A;  4IZX A;  1HCE A;  4J23 B;  4XFU A;  4P0J A;  4EB2 B;  2RG9 B;  8I1B A;  2RST A;  4G1R A;  1BLD A;  1IHK A;  3CRH A;  4P0K A;  2KLL A;  1K5U A;  5F8W A;  3CA5 A;  4ZFW B;  2L5X A;  4GP0 A;  3AJ6 A;  3HBW A;  3AH4 A;  1R8O A;  3AJ5 A;  3BAQ A;  3NBD A;  3FJ8 A;  1SR4 A;  5D62 A;  3E8L C;  3VWC A;  1K5V A;  4ZOT A;  3P6J A;  3AKH A;  1HWM B;  3UD9 A;  1S0L A;  3PUB A;  4EKX B;  2NVH A;  2HW9 A;  4USO A;  2KI4 A;  3VSZ A;  1JLX A;  1TWM A;  4F34 A;  1V6U A;  3PME A;  3T8S A;  3C9Z A;  3UDA A;  3VUO A;  1M16 A;  4FVV A;  3FUO A;  3H6Q A;  3A07 A;  3PG0 A;  4I96 A;  2X2T A;  1BLA A;  1HWP B;  4JQ0 A;  4R6U B;  3VT0 A;  3FJE A;  3BAG A;  3FJJ A;  2WRY A;  4G9M A;  4FGF A;  3BTA A;  2YUG A;  7I1B A;  3BRG C;  4QC4 A;  4ISR A;  3BA7 A;  1ISZ A;  1TFM B;  4OEG A;  1V6W A;  4YOL A;  1RML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...