1R8PA

Hpv-16 e2c solution structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
81
Chain Sequence
MTPIVHLKGDANTLKCLRYRFKKHCTLYTAVSSTWHWTGHNVKHKSAIVTLTYDSEWQRDQFLSQVKIPKTITVSTGFMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the HPV-16 E2 DNA binding domain, a transcriptional regulator with a dimeric beta-barrel fold
pubmed doi rcsb
source organism Human papillomavirus type 16
molecule tags Transcription
molecule keywords Regulatory protein E2
total genus 10
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r8pA00
2KT5A 2OSRA 2J76E 4P6QA 1UW4A 5JVHQ 1VQMS 2CPDA 3CF5Q 1RKJA 2MYFA 4F25A 4WFNQ 3P6YC 2MZRA 1NJIT 2DH8A 1H2UX 1WF2A 2HGLA 2DGQA 3CCSS 3G6ES 1M1KT 2FHOB 2RVJA 2CQ1A 5LSOA 2MKKA 3L3CA 2ZJPQ 1VQOS 2DNMA 2HGNA 4UY8T 2MY8A 1H2TZ 3G8SA 4TU9A 2MKJA 2DB1A 3UE2A 3G4SS 1Q81T 2V94A 2CQGA 2YWKA 4PR6A 3CCMS 1ZZNA 2J0SD 5GAHU 1WI8A 2CPHA 1QVGR 3FEXB 2M52A 3UD3P 1KOOA 2HVZA 1WG1A 4UQTA 3DLLQ 5GMKa 3MUTP 1NU4A 2DNHA 2AD9A 2M8HA 1U1MA 2LCWA 2KM8B 5DETA 2J0QD 3U1MA 1UFWA 2VOPA 1L3KA 1UP1A 2VOOA 5IM0A 2XB2D 1Q86T 3UCUP 1YHQS 4Y0FA 2CPIA 2QEXS 2DH9A 3MUMP 3G96A 3VAFA 1X4DA 5JVGQ 4EGLA 3MI7X 2KHCA 3TO8A 2MQNA 2G4BA 2NZ4A 4IO9Q 4IOCQ 2G1DA 2DIUA 2JX2A 3NNHA 1DBDA 2DNGA 1SJ4P 1WTBA 5EN1A 1WWHA 1JJ2R 2E44A 1N88A 2FPHX 3BO4A 1VC6A 1M5KC 2LXIA 5CA5A 1U6FA 3CD6S 3VF0B 5LXYA 2CQIA 1A9NB 2X1AA 2UP1A 2CQPA 3MD1A 2MZSA 2X1FA 1H6KX 1FJCA 1U1NA 1N8RT 3TYTA 1X4FA 2OSQA 3CPWR 3H2VE 4YUDA 3UCZP 5LXRA 3VAGA 1K8AT 4C7QA 2M2BA 2MQQA 2CPJA 4QPTA 5IFMA 2HGMA 3P3DA 5DM7Q 5DM6Q 3HHNB 2KH9A 5LJ3Y 4QU6A 2JVRA 1SJQA 4W92B 5LSLA 3NMRA 2DK2A 2ZJQQ 2DHSA 2XSFA 5GVQA 4V19X 3EGZA 3HI9A 2MHNA 3RW7A 2RQCA 2LEAA 1WG5A 5MLCV 1U6BA 1VQ5S 1KC8T 2AYMA 4FXVA 3THPA 2MJNA 2XS7A 2M70A 2N3LA 2D9OA 3UWTA 2DGXA 3SXLA 3MDFA 3CXCR 3J7ZT 1FJEB 2L08A 2ZJRQ 2DGWA 3D2WA 1FHTA 3MUVP 1D8ZA 2KG0A 1N52B 2OIHA 3CCRS 3CCES 2LYVA 5BJRA 2DISA 1WF1A 3OW2R 2XNRA 2CQBA 3U1LA 1YIJS 2RRAA 4U67Q 2VONA 4FXWA 1DZ5A 4IOAQ 4LIRA 3S7RA 3NS6A 3CCJS 1WHXA 1YJNS 2RUGA 1YTYA 2JRSA 3CCUS 1UAWA 1HL6A 2MKSA 3FEYB 2CQ3A 2AYEA 1VQ9S 3SDEA 2B0GA 1KOHA 1WEYA 3IRWP 1VQKS 1QVFR 4PRFA 2XS5A 2QFJA 2DNKA 1Q82T 3ZZZA 3NNCA 2MQPA 1WELA 1YWXA 2DNRA 4PKDB 5DDPC 3SMZA 1S72S 4C4WA 1U1LA 2G0CA 2CQDA 2DIVA 5FJ4A 2F9DA 4QQBA 2ADCA 2O3DA 1XN9A 2MSTA 1X5TA 1OIAA 2CJKA 2NLWA 1FT8A 2KI2A 3JB9k 3VAJA 2YH1A 1IQTA 1M90T 3CUNA 1X4BA 4CIOA 2I2YA 3S6EA 4YB1P 2VODA 2DGUA 2CPYA 2XNQA 2DGVA 3PIOQ 4WCEQ 2MGZB 1YJ9S 1G2EA 1KQSR 3CTRA 3LPYA 1YITS 1OWXA 3Q2TC 3CC4S 2F9JA 1WEZA 2L9WA 2CQ4A 1U1OA 2DITA 1DRZA 2Q79A 2DO0A 2DHXA 3J7YU 1H2VZ 1ZZFA 2MPUA 3RW6A 2MKCA 4TU7A 3UCGA 3G8TA 3BO3A 2J8AA 1VQ4S 2EK6A 2M88A 5CYJA 2RS8A 1X5OA 2ERRA 1VQ6S 2MZQA 1D9AA 2MSSA 2XS2A 1PO6A 2RNEA 2K8GA 4WFAQ 2MQLA 2FC9A 1A7GE 1X4HA 5HO4A 2MZJA 1HD1A 3B4DA 2MKIA 2DGSA 5GAGU 1BY9A 1FXLA 5CXTA 2DGOA 1U2FA 2MY7A 2HYIB 2X1BA 2DNPA 4W90B 1Q7YT 2AYBA 1X4CA 1VBXA 2LA4A 1X5PA 1URNA 2L41A 2YTCA 2M7SA 1WHYA 1VQNS 4WFBQ 3MD3A 3MURP 3MOJB 2CQCA 3VAHA 3CC2S 1JJ4A 1AUDA 2RRBA 2BOPA 1OPIA 2HZCA 1B7FA 2MKHA 3VALA 3B4MA 2LKZA 4YOEA 3R1HA 4OZ0A 2LXUA 2E5JA 2LEBA 1SJFA 4J5OA 3TP2A 1F9FA 3CMES 3IWNC 2BZ2A 1FNXH 2N7CA 2LA6A 1CVJA 1M5OC 2X1GA 2GHPA 3LQVA 5D78A 2A3JA 3CULA 2JVOA 2KN4A 1VBYA 3THTA 2KXFA 1WEXA 1R8HA 2KXHA 3H2UB 2I38A 2DH7A 2MMYA 4ZKAA 2KM8C 1P1TA 4CQ1A 2N82B 3BO2A 2RS2A 1X0FA 1SJ3P 1M5VC 2MQMA 1U1QA 2CPFA 1DHMA 2WBRA 1SXLA 2RQ4A 1X4AA 4CH0S 3N9UC 1YJWS 3CCLS 1PGZA 5GADU 2KRRA 2ADBA 1U1RA 1P27B 4Z2XA 2RU3A 4RU2A 1JJHA 2CQ0A 2PE8A 3SDEB 1WI6A 2KYXA 5HL7Q 3R1LA 2CPZA 3CCQS 4M5DB 3I55S 2GO9A 2CPEA 3I56S 3NS5A 2N3OA 4ED5A 2K3KA 2EK1A 2FC8A 1FO1A 1K73T 5GAEU 1WHWA 1VC0A 3P49B 3ZZYA 2DO4A 3G9CA 4WF9Q 2M9KA 3MXHP 2KRBA 5H1SV 4A8XA 2D9PA 3US5A 2CQHA 5D77A 3VAIA 1VC5A 2RT3A 2KG1A 2YH0A 2QA4S 1JMTA 1VQLS 4ERDA 2KVIA 1X4GA 2LQ5A 4IUFA 1HA1A 2U1AA 2M4MA 3VAMA 1VQ7S 5LJ5Y 3S01A 1SJRA 1KD1T 1VQ8S 1ZH5A 3VAKA 2DHGA 3BEGB 4LJMA 2DNQA 1U1KA 2YKAA 2JWNA 2KXNB 3CMAS 3P5TL 4OZ1A 2KFYA 3BS9A 2CQ2A 2MJUA 4TU8A 3UD4P 2M8DB 2OJ3A 5DDRC 1O0PA 1NO8A 2DHAA 2E5HA 4WIIA 2MGZA 2M0GB 5DDQC 2CPXA 3CCVS 2MXYA 2FY1A 1W2BR 1X4EA 2OTJS 3V4MA 3CC7S 1WF0A 2E5IA 2MQOA 1N54B 3DXBA 2LMIA 2OTLS 1WHVA 3PIPQ 3ULHA 3EX7B 4F26A 1YI2S 3G71S 2AYGA 2F3JA 1K9MT 2DNZA 4LMZA 1OO0B 1S79A 3EGNA 2DGTA 5ITHA 1HD0A 3S8SA 5DDOC 1U1PA 4BS2A 3NNAA 2LECA 1M5PC 2MZTA 2PEHA 4WKRA 2DNLA 2U2FA 1FJ7A 4CH1A 1WG4A 2DNNA 2KU7A 1R8PA 2DNYA 2DNOA 4C0OC 3R27A 1QM9A 4TLQA 1X5SA 2SXLA 1VBZA 5IQQA 2E5GA 2MB0B 1RK8A 2MZ1A 2D3OR 2EVZA 3Q2SC 4Y00A 1VQPS 3K0JA 4F02A 4QU7A 5IM0B
chains in the Genus database with same CATH superfamily
2OSRA 2J76E 1UW4A 2CNLB 2EBEA 4FVMA 4QR0A 3RG6A 1F5BA 3ISND 3L7OA 4YMEA 1IBLF 5D6GA 2J9DE 2RILA 1H3DA 3GV7B 4MKBA 1VQMS 1AB8A 2B5JB 2MYFA 4UY85 4WFNQ 1YKWA 3P6YC 3M2VA 2MKYA 3D1HA 5J1PA 4B9VA 1S1XB 1VR6A 2DGQA 2F7VA 2HPUA 4FYYB 4AQYF 3DXSX 2YWWA 2RVJA 4BDPA 2CA9A 4GVBB 4OQJA 1TUVA 1VK8A 5LSOA 5LSRA 4NYPA 5F8GA 2N4DA 4V1Ak 3P96A 5KFDA 2ZJPQ 2B9EA 2Y1RI 2W4CA 5HQMA 5J2NA 1VQOS 1H74A 2HGNA 2HNYB 3H2LA 3PG9A 1YJ7A 4YR3A 3GYGA 3G8SA 4PYAA 3UN3A 5HBMA 4X4SA 1N5YA 1JKHB 1HHSA 2OLWA 1NNDA 1TL7A 1VDHA 4ICLA 3HT3A 5KFVA 3RR7A 3QGGA 4J91A 1RE1B 2ABYA 4WPAA 3WIUA 5C2CA 4C8YA 2FHJA 4B3OA 3FCHA 3OHAA 2M52A 3UD3P 2XM3A 4DWIA 1A6LA 1RHQB 4QZVB 1RAIB 5IOLA 2FTRA 3LOUA 4YR2A 4M8LA 4TLRA 1HBOB 3DLLQ 4QYRA 2HFOA 3OUYB 4ED8A 3OR2B 1LWEB 3D6MB 2M8HA 2AD9A 2QO3A 1U1MA 2ZZTA 3UD5A 2HFZA 2LCWA 3C6TA 1TKXA 3GWCA 4NA3A 1QUVA 1SL1A 2H65B 4WU3A 5J2PA 1JLAA 4OZ5A 1TAQA 5B0EA 4DFKA 1V3ZA 3IGVA 1UFWA 2VOPA 1L3KA 2VOOA 3GV8B 2ZWOA 3MMAB 3B82A 4RW9A 4NXMF 2E1PA 2H3EB 1H98A 2CJQA 3QZ7A 3N6LA 4CLZA 4I7FA 6FD1A 5KFJA 2CPIA 2VFVA 3DLEA 5JXSA 4I2QB 5KT2A 2AQ4A 4DV4F 2V0NA 4M5IA 2CG4A 1OQ6A 3ILJA 3K5PA 1X4DA 4YB6A 3MI7X 2KHCA 5ETLA 4H54A 2R7OA 2NZ4A 3R5DA 3HDSA 3GSDA 2UXCJ 4JI2J 3V6DB 3SSQA 4I68A 5D3GA 4KV8A 5IXUA 3T1AA 2ZH6A 4Y2IA 1TQLA 3HSZA 1T9UA 2DNGA 4XDCA 3G86A 3AJ2A 5B09A 4DUTA 3P5BP 5J1EA 5CYQB 4DLGA 3MM9A 1RWXB 4NRUA 4ED2A 5KT7A 4K7QA 3W3SA 2Z57B 2ZEJA 4YEAA 2B7CB 1VI7A 1FK9B 1NKCA 3LPEA 1U6FA 4F8RA 1DARA 1HBNB 1IKWA 1FWPA 1IKVB 1A9NB 1F3FA 1S6UA 1RHUB 4HVZA 4LSNB 4Q0BB 1QE1B 1X60A 1HQUA 2ILZA 4LR8A 4EZ6A 1H6KX 5BYQA 2BKOA 3MM6A 4R5PA 1N8RT 4YR0A 1N0UA 1SH2A 3TYTA 1QAYA 4EMDA 1IWGA 1X4FA 4EBCA 2HURA 4XAKA 2G1HA 2VA3A 1LW2B 3EVMA 3M9OB 3UCZP 3ZTSA 4CO4A 2ZH1A 3VAGA 3WX4A 3AQOA 2J6UA 1I1GA 1OMSA 2H1YA 1PKUA 4C7QA 2YXLA 3K5MA 2FQQB 1IUJA 2HNDB 2HAFA 3FCVA 2M2BA 2MQQA 4P2MA 3O5TB 3KNAA 2CZVC 2ROGA 3JS9A 4OYMA 2CPJA 5THWA 3F73A 4JI1F 4ELVA 5IFMA 3PO5A 3M9MB 1SPBP 3PVXA 5LJ3Y 3JQMA 2DCLA 4GO7X 2OPSA 3HSDA 3TA1A 2VB6A 4JUZA 2HWTA 2YY3A 1R27B 2DK2A 2XLKA 2PFFB 2Y9HA 3M30B 1WC5A 2BRKA 2MLYA 3MF5A 2DPJA 4ZCLA 1RT7A 3MWBA 5KFTA 3LP1B 4M63A 3V6DA 1VMBA 1WG5A 5MLCV 5CZVA 1NK5A 2ZNYA 5T14A 3OUYA 3I87A 5IT9Y 3OJSA 3IG1B 1GXUA 1LW0B 3C6UB 1SC4B 1IQZA 1R0BG 1RAGB 1EKSA 2V8HA 3TJAA 2N3LA 1ZBTA 2D9OA 2DGXA 4R8UB 4ECRA 1CEZA 4LF5J 2F8EX 1WTFA 1Y5NB 2P6TA 4I6YA 2L08A 1QAXA 5C25A 4G1QB 4C0HA 1KONA 3R7NB 1XQIA 3D2WA 2ZBIA 1RKIA 1N52B 2OIHA 2DTJA 5GADI 5F0WA 3CCRS 2BM1A 2UXBF 1C0UA 2GMLA 1DQ8A 3BSAA 3NWGA 5B0CA 4YY3J 4DFMA 2DISA 1S6PB 2ROPA 1YGYA 2XNRA 2HEKA 1VQYA 2VF3A 5BR8F 3O1LA 4DR4F 3W63A 1S1TB 4JI6J 4PEOA 5JMNA 4U67Q 3WX8A 5EGYA 4FZVA 4FXWA 5CYMA 4DHVA 1HQ2A 1DZ5A 3R2DJ 2XBPA 3ISNC 9RUBA 2E5LF 2ZD1A 3P45B 3NMAA 4P2FA 4EFAC 5KFGA 1GXLA 1KVKA 4NMLA 1S6OA 1WHXA 8AT1B 5KTQA 2NXUA 4ILMA 2RUGA 2HQFA 1NB7A 1RA6A 2ZE2A 2Z2MA 3CO9A 2JRSA 4C97A 2DVIA 1MWQA 1UAWA 3LP2B 1KDNA 2YBVA 1LFPA 3DM2B 4NE9C 5EX0A 3TUZC 3FSIA 2MKSA 4AQYJ 3FEYB 2Z2YB 4JYAF 1AFIA 3MAAA 2IVYA 2AYEA 2XMJA 1BC6A 2XZDB 2W4PA 3SDEA 1FTCA 1Q95G 1ULRA 1CBKA 1KOHA 1R8AA 3IMQJ 1QVFR 4PRFA 5T41A 3FGVA 4RW9B 1N36J 3WHIA 2ZM6F 2HWIA 3J81U 3RUBL 4QR1A 1H7XA 3MTKA 4CNZA 5EWFA 3NNCA 3M8PA 4P9SA 3J81Y 4MFBB 1RUSA 2JH3A 2BXJA 1YWXA 2RUSA 3OFHA 5F8MA 1Q8KA 3OVSA 2DNRA 2VKRA 2YQ1A 4Q2LA 3BM7A 4PKDB 3M9NB 4PWWA 3SMZA 2YWEA 5DQHA 4C4WA 2V8DA 4U9RA 1FFWB 2CQDA 3GU0A 3HHEA 4QQBA 2F4VF 2ZUGA 2UUAJ 2R7VA 1APSA 4HI1A 3CEDA 3K5OA 3V81B 1N36F 2F4FA 2LDIA 3B54A 1OIAA 3T19A 4YB7A 1B3TA 3D1OA 2CJKA 3HHKA 3W2VA 3WBZA 4CRJA 1JLEA 2EFPA 1FT8A 1TL5A 1UVKA 4CLKA 4DPYA 3OVBA 4XPEA 2LXFA 2Q66A 3MMCB 3NLCA 5D4PA 2CJBA 2DY1A 5J2NB 1U47A 4JI0J 2QA2A 5C5JA 3FBEA 2QL9B 1HMVB 1N5VA 3EJMA 3QYYA 3VVUA 2WZ1A 6AT1B 4K59A 4EZ9A 3ZO7A 5JJBA 5CCMA 4WCEQ 1CQMA 4RNNA 4E0DA 4B9UA 2K3IA 1KQSR 3NCPA 4NLDA 3OLBA 4EBDA 3M2UA 4F0MA 1S76D 3VV2B 4HEA9 2EFOA 3PRVA 4W4MA 2OD4A 3Q2TC 4CP5A 3KHLA 2JDJA 2IY5B 1UW9A 3LO3A 4EK2A 1RBOB 2FJBB 3DRYA 5A8RB 1IBKF 2JZ5A 1TTHB 4OHYA 1FKPA 3OTOF 3W1YC 4QYZJ 2HWHA 1O6XA 3N28A 1EB0A 1RHMB 1NH7A 2IDEA 2CJYB 3HF5A 3PJWA 3M8PB 4HH0A 2P9CA 4O23A 2W9BA 2BKPA 3OXGA 4X4RA 1W26A 3E3XA 3QGHA 3RB0A 5F8IA 1RTDA 4O3RA 4DUYJ 2MKCA 4L76A 1YJVA 2E1MC 4I1TA 4YY3F 3G8TA 1KN6A 3HVRA 2HFNA 4LUBA 1NSPA 1D1UA 2XYHB 1VRTA 1TUWA 3V4IA 2AKWB 2CJAA 5C25B 4KFBA 2GHWA 1SJ1A 1RYRA 4K4TA 3JAMU 2BVZA 1T9TA 2WVEA 1S48A 4C3MA 4B3TJ 3RAMA 1UVMA 1S0OA 3DCAA 4ZOSA 4DCJB 3L4BC 5HQ8A 4X4PA 2A1BA 1C0UB 5KFIA 2W9CA 4I69A 3KNGA 3W2WA 4O4RA 4WYLA 4DQSA 2K8GA 4KKOA 1X4HA 1CJUA 1VJQA 2NCKL 2MZJA 4H4MA 3F44A 3I5CA 3B4DA 3MM7A 4K50A 1UETA 2DGSA 3UNGC 3KK3A 2QN6B 4CO0A 1FNOA 2JC0A 5HI7A 3S1TA 1VIOA 1GTEA 3R7BB 5KG7A 1Q7YT 1T02A 4UZBA 5IZHA 2PDAA 4PG5A 2APOA 3QIPB 4HHHA 3M8ZA 3NEKA 2FGOA 1F5CA 5A76A 4WFBQ 2HS0A 4NYOA 2H54B 3M8RA 3MOJB 3VAHA 4B3TF 2LQJA 5KT6A 4IQMA 4DV2F 2H9ZA 1QSSA 1N32J 3ZC4A 1HBUA 5F3TA 2FHKA 2OPRA 3W8PA 5EDWA 2YKMB 4PWUA 3IXQA 1NB2A 2BJ3A 4N77A 1OPIA 4PG4A 5C7PA 2BOPA 2F40A 4CCHA 3KJVB 2MKHA 3HX9A 1B7FA 1DURA 1RADB 5KFBA 1SCJB 2V8PA 2LKZA 5LMNJ 1T95A 3HVTB 4DZ6A 1RU1A 5EWEA 1CJUB 2NSBA 4OZ0A 5AXNA 1UWBA 2EC2A 2XHCA 2LQ9A 1T9XA 5U47A 2PMZD 5KT3A 5K14B 4PAAA 4AE5A 3NGDA 2LEBA 5HQLA 4ETXA 3UR0A 4LFCJ 4N41A 2VKZG 4Q8FA 3TP2A 3CMES 4DPXA 2OHDA 2J9DA 3HXMA 4JB8B 5BYRA 3CWJA 3GJRB 1K1SA 2IYGA 4ITSA 2Y3YA 5L1LA 4P75A 4P2SA 1JLQA 2FLNA 2R7QA 4IFVB 3GQCA 2GHPA 2NZCA 2ZNZA 3RU0A 3PYDA 3DU6A 4ZVQB 1YBAA 5AJ3F 1FCAA 3MFIA 4OI3A 4P73A 1RU2A 1CSJA 3EGVA 2FYXA 2KXFA 3GJSB 1WEXA 2VFRA 2DR9A 4RR5A 4WJBA 2RIJA 1HQEA 2Z8QA 5G0RA 4WP3A 4OFZA 1KLMA 4ZKAA 1F2GA 3GFZA 3EDQB 3I31A 4CLWA 2RKIA 1U0SA 4O3QA 1VRUA 4ZP7A 4F4KA 1DHMA 4DR3J 4B9MA 1UWBB 2GV1A 1OQ3A 1GAOA 2WBRA 2WHOA 3ZZRA 5I42A 2JEGA 1WC3A 3BGUA 2C2ZB 5IV4A 1EP4A 3CCLS 1ICEB 5GADU 3RBEA 3TZWA 3C66A 5KOXA 3OQ2A 3G6XA 1U1RA 1RXOB 1RTIB 2Y0SD 3M32B 4Y3CA 4I7FB 4XK8C 5A8KB 3LALA 2J6TA 3DLKB 3G8QA 4ES2A 2KYXA 3OL8A 3R1LA 1PAEX 2QMWA 1F3VA 2VPYB 2E7XA 2CPEA 2PGCA 3B6BA 3OPKA 4QBUA 4K8RA 3Q89A 3D3CJ 1I5OB 2VDIA 5BYSA 1KS2A 4FBTA 2C2NA 2W2PP 1S0VA 3LA0A 3TUIC 2CWXA 2ALYB 4B17A 4CO5A 5L46A 2FZGB 1K0TA 1LWEA 1T9VA 2BJ9A 4DV3J 4JI1J 3QSIA 5DLGA 4K0KJ 5L8RC 4JI5F 3PRDA 3TX8A 1WUUA 2XEXA 3PV8A 3ZZYA 3VVTA 2FLPA 2QZ8A 2KRBA 5LM7E 5LMUJ 3PW4A 3DDNA 1RSCA 4QWCA 1EZZB 1SKUB 2F1FA 2HBYB 1BWVA 3IP0A 3R6LB 4DPTA 5D77A 1KSPA 3I96A 2KKHA 2WSCC 4RWXA 9ATCB 2RSQA 1NJXA 4LRCA 4ERDA 4IOBA 4NA1A 2R9LA 2XCPA 1BXNA 2IRXA 1XNRF 2LQ5A 3DYAB 3SCLE 4HHJA 2CAJA 4PXDA 3HMJG 5C24A 1FF2A 3DRXA 5LOQA 3ISZA 5LJ5Y 1VQ8S 3G82B 2DHGA 3RAXA 1VIXA 3GFHA 2BMBA 1RLCL 3GTYX 5C42B 3DLJA 1HNZJ 3KOAA 3DRRB 4WKYA 2AW0A 3LP1A 2HMIA 3T5LA 4KH0B 2HHHF 5HMXA 1AFJA 1S99A 3M2UB 1Q1KA 3SCJE 1DQAA 3CMAS 3AT1B 1IR1A 1R43A 4OZ1A 4GC7A 2NXJA 1RTIA 3JSMB 5F8NA 2CQ2A 2JNJA 4NLOA 3W5ZA 2W2QP 4N7TA 3CDUA 2ZH9A 2WOMB 1ITPA 2IM2A 3I0RA 1XMOF 1G7CB 5KFXA 3N5FA 3HSJA 1QDUB 2VPXB 5G0RB 1M5HA 4LSZB 3KHHA 1NO8A 2EW9A 2E5HA 4WIIA 1PJ6A 2CXEA 3CJ4A 1GQEA 4ZPBA 1P9YA 3DOMA 4DR2F 3KXDA 1GX6A 1AA1B 2O66A 2RHSB 3DFEA 4RPFA 3PW0A 1KKHA 4Y28C 3NAIA 4X65J 4LIWA 5K9FA 1E6YB 3CC7S 4F3OA 3NY0A 4KPYA 2B6AB 3FCWA 5KFZA 4EI2A 4QWDA 4DFPA 2JSXA 4LT6A 4ZCIA 3HSGA 3DRSA 2OO4A 1EP4B 3RB4A 2EKYA 2E7WA 5ETNA 4LRFA 5A0YA 3TVZA 3ULHA 2ZE2B 3BB5A 5L38A 3EX7B 1Z2ZA 5HLFA 4N47A 1FDAA 1DTTA 3BH7B 4F26A 5BR8J 1RTHA 1YI2S 2FY8A 2GIQA 2C3YA 3SCKE 2KZMA 2XZTB 2VH7A 3FFIB 3RB6A 2C2DA 2NREA 3GE9A 5ITHA 3S8SA 1VHIA 2GJ2A 4BS2A 3Q83A 5DS7A 1UZDA 2ZZMA 1RABB 3EDRB 4EBEA 4YFUA 2HHXA 2IJRA 4WKRA 4GO5X 1N34J 1FJ7A 1OSCA 1BQNA 5ETVA 3GIKA 2VFSA 5I42B 2R3VA 4JV2A 2R8GA 3TEGA 3OLAA 3RTVA 3DRRA 4MMOA 3K5LA 1RWVB 4OYWA 4TLQA 1S1VB 2SXLA 2NUHA 4X84A 2P9GA 4RUCA 1WDDA 4IFVA 1WORA 2D3OR 3KJNB 2IC3A 1NPRA 1VQPS 4CWBA 4DV0F 2JHEA 3EYZA 3LP0A 5IM0B 1NK7A 1RAAB 3A8JA 3LAKA 2KT5A 3B78A 3R8YA 4P6QA 2BACA 5KFPA 5JVHQ 3CD7A 1J27A 4LQ9A 1S97A 3AJDA 4JI8F 2CPDA 1N48A 3E2EA 4DJBA 4F25A 3JAMY 4ES3A 1C1BB 4OX8A 4DPUA 4RUHA 1U25A 3TRGA 1VRUB 1ZTWA 2HRTA 5CYMB 5KFOA 2YNHA 4MJKA 4ED7A 2HHSA 5CAAA 2P5VA 3DMJA 2MKKA 2IHR1 4RW6A 2HS4A 2ZOFA 4NPOA 4RZRA 4X64F 3Q8QB 2VUGA 3QJPA 1WC4A 3IBWA 4USKA 4WYWA 3X3UA 5J1EB 3GSIA 1KP6A 3H59A 1GMUA 3KWMA 3CJSA 3VQSA 4RLEA 1FFSB 4FPIA 4DBQA 4TU9A 1FTRA 1LW0A 1NHVA 3HCXA 4CTAA 2C28A 2AGOA 4RKUC 3MECA 3CJ5A 3OR1B 3MPUB 2LFVA 2V94A 3ITHB 1TFYA 2BRLA 4CLUA 5E3PA 1QAIA 4G1QA 2J0SD 5GAHU 1HNIB 2GQ2A 2ZVSA 3CMQA 3GR0A 5E5NA 4C8MA 4MYUA 3TOQA 1NBEB 4A8OA 5IC6B 1L5UA 3M30A 1KOOA 1HQUB 4F3MA 5F8HA 4C2MA 1NSQA 1AZSB 2A2DA 3EUNA 1WG1A 3I9V9 3QAUA 2RD5C 4IYQA 3KLHB 3MR5A 4ED4A 5GMKa 1RT3A 4J9PA 4Q43A 1GT8A 4DUZF 2ZHBA 1I6JA 2DNHA 2J0XA 4RW8B 1RT6A 1S1UB 5HVFA 2KM8B 1TKZB 5DRKA 4DV1F 2QA4G 3U1MA 2OGUA 3ETMA 2OUGA 1UVIA 4C8KA 1XERA 3BGLA 2YNGB 4OYXA 1BMQB 4KFBB 4L6V3 1IJEB 4J9RA 3AY0A 2BUNA 5L9XA 2F4VJ 5IM0A 4KQZA 4UUXA 2BW2A 3UCUP 1CJTB 1RWKB 4QWBA 5DGBA 1RTHB 2V69A 3BR9A 4WU2A 3KMQA 1B64A 2H5JB 5DZ7A 3G96A 4DSKA 2FVSA 1TZ0A 1SV5A 2D41A 4EGLA 2W9BB 3I0SB 2MTLA 1RTDB 5F3ZA 4I0WA 4LFCF 3ZTRA 2I5JB 3ENWA 1DLOB 1U2RA 3TAMB 5IWAJ 1N6QB 3DLHA 1ACMB 1R6YA 1E6VA 2I8EA 2NXEA 3NXZA 4N8NA 4URSA 3TQEA 3V4IB 1FWLA 3KLIA 4Z7CA 2D3O1 2XYGB 3A3NB 4M5GA 5EN1A 2JEFA 3GG0A 6FDRA 2EPIA 2HNYA 3HHLD 1N88A 2PI4A 3FBBA 3MTJA 3BO4A 3TUPA 4OI6A 1NZ8A 4EWTA 5CA5A 1ZAWA 2R8KA 4D3GA 2H5IB 3ZZOA 4QYZK 1QJHA 2CKWA 3OT9A 1F2HA 2E9RX 3L7PA 1NRKA 1XK8A 4KHMA 2WOMA 3TA2A 3AD7C 2IDLA 3PJXA 2CQIA 3JSBA 5A8RA 2UVVA 1H73A 4AL5A 4CLTA 4KGZB 2R7RA 3V2UC 3DN9A 4IRKA 2X1FA 3R97A 1EARA 2D3UA 3CJRA 4P7VA 2VG5A 3IRXB 4H4KC 2HBRB 1U1NA 2GFFA 5IS2A 2X7IA 2OSQA 4OZNA 3CPWR 1REVA 4J9OA 3H2VE 3KG1A 3PR5B 2OEMA 5D8HB 4YUDA 1N5QA 5C42A 1S4EA 4FNIA 5A6PA 1AW0A 5JUMA 1HWLA 1TL1A 1K8AT 2VASA 2D3ZA 1NKEA 3HP6A 4A8QA 4WZMA 3EPGA 2FIUA 3BGFA 1UKUA 3R5BA 1JNZB 3L9ZA 4QPTA 4TKTA 3K89A 5D4NA 5E3RA 1MU2B 3MM5B 4RUAA 2HGMA 5DM6Q 4OJ1A 3N0VA 3MAAB 2AJQA 3CNQP 4M1KA 1KFDA 2KH9A 4ELTA 1U7LA 4LSLB 3EWGA 3OXFA 4KKOB 4QU6A 1SJQA 2L3MA 3PTWA 4OHZA 4W92B 5E3QA 1S1XA 2XY7A 2XULA 3H7HB 5GVQA 3BBCA 4HT5A 4KRWA 4V19X 4G1PA 3HI9A 2HNZB 2MHNA 2RQCA 4YN3B 1DTQA 4JV0A 4F0KA 1QD1A 1KC8T 3KLIB 2W24A 1XBWA 3OTBA 4N8OA 4J9MA 5B0GA 3T5HA 5H9EJ 1U4BA 4ZA1A 1V5VA 3THPA 2MJNA 2B9YA 5HBMB 4IG3B 1PJ5A 2CJXB 2M70A 4RO0A 4DCPB 2PA3A 5HJXA 3UWTA 3R5AA 1UEKA 1CQNA 2G2OA 2J5AA 2YNFB 4I2PA 3SXLA 3J7ZT 3CXCR 5B0DA 4C8LA 5K20B 2ZH8A 2ZJRQ 1GNKA 1Y5LB 4X4NA 5KT4A 1T11A 2HKEA 4QW8A 2R8JA 1OS5A 3MUVP 2BJEA 3MEDB 1LOUA 4K2JA 5KFQA 4OI1A 1FKPB 1CJTA 3GCWP 3OTCA 1R89A 4LF9J 1OYEA 4DU8A 4F4ZA 5KOWA 4DV2J 4I67A 1N32F 3ZZ0A 4OHVA 5FDLB 5BJRA 4F4WA 4NX9A 4OYOA 3ZZTA 3FZ2A 4A8MP 1D09B 1OY8A 2CQBA 3U1LA 7FDRA 4FDFA 1KBRA 1Q5YA 2AP6A 3G2XA 3MAHA 4MAKA 2WCXA 3I4HX 3CDBA 3CO0P 2EFVA 4O3OA 1E6VB 2KM8C 4UQGA 1RT7B 1YJTA 2VBXA 3CCJS 4K4YA 4ECYA 3P4UB 5HSPA 1YJNS 1Y7PA 2DRDA 2HNDA 2MHEA 2RF2B 4GMKA 4ZPDA 5ETOA 1XMQF 3OL9A 1BQXA 3PYFA 1HL6A 1UPPA 4UTGA 1GX5A 2JLGA 2HVIA 2HHTA 1P8GA 1Q78A 5FD1A 3WZ0A 1YRTA 3GJTB 1F5AA 2NSCA 4Y34A 3ET6B 4QW9A 1VQ9S 3IRWP 1WEYA 3BSNA 3NGSA 3QAEA 3BSOA 1MMLA 3GONA 4J9NA 1RWMB 4LVOP 1S9GB 1C1CA 2Y1IA 3W9JA 1V3SA 5AT1B 1HBMA 1QE1A 3FQLA 4FKXA 4KY3A 3U27A 4ED3A 3PNIA 5E0OA 4DR7J 1OY6A 2MQPA 3VR1A 4PG7A 2VDHA 4C8NA 2BJ1A 5M2RA 1U48A 1Q53A 2L9NA 4ECVA 3EXCX 1U8WA 4OLPA 2DR6A 1RHKB 2GJFA 4U7CA 2IRYA 2BQUA 5AXKA 2RJZA 2AX1A 1LWCA 2RRNA 4NLRA 4ZN3A 2UUTA 3HFKA 5FJ4A 1UPMB 4JV1A 1L3VA 2KHDA 2WBMA 1U0HB 2BJDA 4Y6IA 2LDYA 3AXKA 2LQ8A 2GHVC 4NLQA 3SEOA 1I3OB 1JXEA 4USIA 3A8EA 4USUA 2MSTA 1X5TA 1FKOA 2YKMA 2Z56B 3LH2S 4NLYA 4DDFA 1KLNA 4CLPA 4U95A 2NLWA 2V4JA 5FIIA 4QIWD 2Q1LA 3TX0A 4ZVTB 3VAJA 3GP9A 3J81j 1UA0A 1VRTB 2HSEB 3BYRA 3UFCX 3M2RB 1WC6A 3DRPA 3CUNA 1M90T 4Q0BA 4CIOA 1JLFA 2HW3A 1RHJB 1DTQB 2BA9A 2QYGA 3IAM9 1Q8LA 3H5XA 2AMCB 1FE4A 1JK9B 2CPYA 2DGVA 2MGZB 2W9CB 1RAHB 2YX7A 5KFNA 1PIEA 3VAFA 4HTIA 2UU9J 3PXGa 1M1HA 1FA0A 1X0PA 3CTRA 4J90A 2I9SA 3SQOP 3UR3C 5A8WA 3CC4S 3PYGA 3LWMA 4ANCA 3SSRA 1IBKJ 4H4MB 2UV8G 2CG8A 4F3QA 1KTVA 2IA0A 3ZXWA 2P8IA 3B8HA 1U1OA 4RBUA 1Q8IA 4CM2A 3OXLA 4OZJA 2QV6A 2B9WA 2E1RA 4MIWA 2XMWA 2Q79A 1KQFB 5HLFB 4AUKA 2UUAF 4M94A 2DHXA 2FJDB 4NEZA 4UOGA 1U49A 2QLJB 1H2VZ 3MMJA 1ZZFA 2KDOA 2MPUA 3C6TB 5KFYA 4TU7A 1VS3A 1SI9A 5C2GA 2R7WA 2XQCA 3FK4A 3O6QA 1TL4A 2E29A 3IM9A 1CULB 4P71A 5DO2A 3AD8C 3BH6B 1CS4B 5L9NA 4L72B 2Y1LB 2G0JA 1TL3B 2OPQA 1Y4ZB 4O4GA 5DJBA 2RS8A 5CYJA 1HNZF 1HYSB 1ZM9A 4F7VA 2B4PA 2UU9F 3M8QA 4IH5A 1VQ6S 2MZQA 4XDDA 1D9AA 4IG3A 5GAGI 2ZKUA 3AHPA 2PMWA 3J7AN 2BM0A 3ENQA 1DTTB 4ZP8A 1Y3KA 3KJVA 4ILRA 4YDDB 4LSLA 2RNEA 2B4UA 4WFAQ 1VHFA 5HANA 2MQLA 5F8LA 5F0UA 3SV3A 3IWLA 3KG4A 4Q8EA 2OPPA 3FQKA 3R5CA 3RGIA 2QE5A 2QTWA 2MKIA 2Z2LA 1FVQA 1BY9A 5GAGU 1FXLA 5CXTA 2DGOA 4ECWA 3T1YF 2A6OA 2ATLA 2ZDOA 2VODA 3T5JA 4WXOA 3J80Y 4B3SJ 2C2MB 3V6JA 4KIAA 2BANB 1R8BA 1X4CA 2JLEA 2BQ3A 1WOSA 2AYBA 4JV5J 2V6AA 5L1IA 1X5PA 2RMLA 3M2VB 3I9ZA 4QWEA 4X4UA 2BOAA 1Q79A 2H48B 4IDKA 3ENVA 3Q8RB 3GIRA 1T03B 1VRQC 3N5BA 4KGVB 2FJWA 2W01A 2XWYA 4JI0F 3IO1A 3MD3A 4HACA 2BQRA 2CQCA 3H5UA 1IWAA 4O0IA 2V67A 3E01A 4DS5A 4HYKA 4LFBJ 2E66A 3O2IA 1TKDA 1AUDA 4O44B 5ETSA 4NLXA 3ILOA 5E3AA 5AJ3J 1UVJA 3AXMA 3VALA 4DF8A 1CC7A 3N01A 4B9SA 3QJLA 4DQIA 2AJ4A 1EETA 2DEIA 3NAHA 4BCAA 2B3TB 3NGTA 3R1HA 4DX5A 2B8QA 4UOFA 2LXUA 4Q5VA 3THVA 1GMVA 1BQMA 2BE7D 2CUYA 2OEKA 2VHGA 2HZAA 3W64A 2FLLA 1SJFA 5KFLA 4GVBA 4PWDB 1K47A 3ILIA 2QMXA 3LANA 3M6UA 3O3LA 2UUCF 1TKTB 1AT1B 2E7VA 2QA1A 1WSRA 2EXUA 5A0YB 2FHJD 1SUQB 2AZ3A 1EIYB 3PX4A 1ZYQA 2UVRA 3BN4A 1RT6B 3H90A 2YNFA 4I2PB 2XLIA 1MW7A 1W7WA 3CDAA 5D78A 3C14B 2HQCA 2W2OP 4TXSA 1KWMA 1FNMA 2NYIA 1HHTP 2KN4A 4OMFG 3I0RB 1VBYA 2OD6A 3NOGA 2HIYA 3W65A 2WONB 4A8FA 1DFDA 1RISA 2VG6B 2KXHA 4R25A 2RQKA 3MEEA 4ENOA 2KFZA 5DQIA 3NOCA 2ZBCA 2I38A 2M5YA 2DH7A 3GYXB 4GVLA 1RAEB 2MEWA 4GKJJ 1SJ3P 4G3IA 5CD4H 4IG0A 5KFSA 4KC5A 2DRBA 1S1WB 2CPFA 3JSRA 1PBUA 2B43A 1NCLA 3CGIA 3I6PA 3Q86A 4RW8A 3LGHA 4UOHA 2XMAA 4PPZA 3Q22A 2XY6A 1QY7A 1SXLA 5CH7B 2QRRA 2AZ1A 2VPZB 3MR2A 2E9ZA 2YKQA 5HP1B 4C8ZA 1TL3A 4O4GB 1RT5B 1LXJA 3ONQA 4X4TA 3DKDA 3IR5B 2XSJA 4DX7A 3HM9A 2DEJA 2KRRA 2MQ8A 1O5JA 5A6WA 1MN9A 4YP3A 3KK2A 1JWWA 4KPCA 4Y2CA 3BKFA 3G6YA 3EZUA 3FZBA 3MEGA 4CYUA 3PHTA 3M8SA 3BJYA 3T3FA 5DLFA 3CE8A 4ICLB 1WI6A 2YQ0A 5J2MB 3KFWX 1Z1ZA 3IR7B 3G82A 3HKZD 4M5JA 4M5DB 4MK8A 3I55S 1HR0J 2HQ3A 2EKNA 2XWXA 1VGYA 4DU7A 3NCRA 4LREA 4ED5A 1CS4A 5H9FJ 2K3KA 2IA6A 5CD4A 2FJXA 1KTQA 2VG7A 3DC2A 2XLJA 1N0VC 1FX4A 3T6BA 3QRRA 2UXCF 4YQWA 3KUEA 3V6HA 3P49B 3POTB 3BREA 1T05A 2ASYA 3G9CA 3OJUA 2AV5A 4WF9Q 4QPXA 2G13A 3A3OB 3PDNA 1FXDA 2FVPA 1Y00A 5H1SV 3MXHP 5T7LA 2D9PA 1VC5A 1VJWA 1JQGA 5D0RA 4DQRA 2OPRB 1XEZA 2Q6BA 1MMDA 2BE2B 2VFUA 4PXCA 1TV6A 4NYZA 3N6MA 5B0FA 1NH8A 2BV3A 3M7VA 1FKAF 4FYXB 1XC9A 2HVDA 2M4MA 4ID5B 4N56A 1TVRB 3HZEA 2VJVA 5FLXU 2D1CA 1KD1T 5HAOA 1S77D 3BF4A 3HHLB 4LJMA 2DNQA 1R0AA 4URQU 1UJ5A 1F1BB 3FKBA 2W1BA 4PG8A 2KXNB 1FI4A 3W5YA 4TYBA 3T1HJ 2ZFHA 2NR0A 1JX4A 1TP7A 5IC4B 1MROA 3P5TL 1UEUA 1S57A 1XR7A 3D0HE 4IFYB 1SKSA 3BS9A 4USMA 4DR6J 3A3PB 3DGPB 1NK6A 2HRYA 4ZVPB 3TW0A 2CZ9A 5GAEI 3ELHA 3HHDA 5E3CA 2FZCB 2DY9A 3QFHA 2M8DB 3GIMA 1IBMJ 2F8HA 5E7OB 2OJ3A 3QZ8A 3A4TA 1FFGB 3BGRA 4RNMA 5IT4A 1KLMB 3VGTA 3BQ0A 4YB5A 1JLBB 1UZHA 2BW7A 2M0GB 3L7UA 5DDQC 5KFFA 2V2ZA 1RI7A 4X4QA 4QWAA 3FDSA 3MM8A 4F04B 1X31C 2ZC3A 3CCVS 1RAOA 3QJJA 2B9XA 2DYAA 5D15A 5K8NA 2VQEJ 4X62J 1RACB 1W25A 1WF0A 2NXCA 3KLGA 5HP1A 1WKLA 4TY8B 2MQOA 1AXQA 2GIRA 4DV1J 1X9WA 4ZVGA 4P10A 4W98A 2LMIA 4MKVA 3PIPQ 3O8WA 2CYYA 1MMNA 4CO3A 1QTNB 3PO4A 4LF4F 3DHXA 2CFXA 1QSYA 4CDIA 1WD6A 4ZMMA 5F9NA 4FBUA 1VOMA 4ELUA 3ETOA 5F9LA 2RB7A 3GJQB 4WXWA 1OO0B 3EGNA 4ZPTR 5DG8A 2ZH5A 3Q23A 1PYSB 1VLYA 2DGTA 3KHGA 2OPPB 2YNIB 4OJGA 5DDOC 4DL4A 1UFKA 3A12A 2C3MA 2LECA 3HVTA 1SQGA 4P52A 1V9OA 5H9EK 2WONA 3JQJA 3WQPA 2J7UA 2IAJB 2EBGA 1WG4A 1S9GA 2DNNA 1PAUB 4NLPA 2KU7A 2AF6A 3JQKA 1R8PA 4CLFA 3LGMA 3K7RA 5ETRA 4C0OC 1R31A 2CZ4A 4D3HA 1O8BA 1X5SA 2HAIA 2DXFA 5GMDA 3TVYA 3KK2B 4C48A 3GB0A 4DL5A 2PD1A 4TQSA 1RK8A 2PSZA 1LXNA 2MZ1A 1Y11A 3K8VA 1S0NA 5J2MA 1S6QB 3K0JA 3JXOA 3MM7B 1XWLA 4NZ0A 3K5NA 3GZ7A 1IKWB 1N5TA 4J37A 2FHMA 2BR0A 4K4UA 1U2CA 1YX2A 4NCGB 1O51A 4M5NA 1J5EJ 1F60B 2WVBA 2CVEA 1FRIA 2MZRA 5DGAA 4KB7A 1NJIT 4JI3J 1TKXB 3PRBA 3KMSA 2V50A 4JI5J 4J9QA 3TZZA 1HLWA 2FHOB 2IVMA 4K4VA 5KG4A 4KSEB 3RRHA 1YRXA 2WVDA 3L3CA 1G6BA 2DHHA 4FXDA 3D4JA 1HWUA 3K2YA 2Q6CA 2FVCA 3QGPA 1H2TZ 3DNCA 2HLTA 1H0HB 2Y0BB 3JTNA 2MKJA 1NDKA 1NXIA 4K2XA 4DN9A 2AIRB 1B0PA 2RDDA 3G4SS 2W7OA 2A18A 3M8WA 2CQGA 2YWKA 2YWGA 4WTOB 3CCMS 2KB2A 1ZZNA 3KK1B 1WI8A 1BD6A 2CPHA 2C3OA 2V2KA 3QSYB 2UXDF 3FEXB 1XTZA 4YHHF 3D0GE 4B3SF 2DRAA 2W2MP 3BGRB 4DUZJ 3OSPA 4WFYA 3D9BA 3CCTA 3KDOA 4LF1A 4LF6F 1FRXA 3H20A 1JLCB 2VIHA 1NU4A 1Q8BA 3HULA 4QIVA 3DDKA 4RL1A 4ZHRB 2J0QD 2Z30B 3R3TA 1KEKA 1UP1A 4ECQA 4WK1A 4OV6A 4AYBD 2VQFJ 3GR1A 4NA2A 3EMTA 2BABA 3EVWA 2ZITA 4WE1B 4ANDA 3I5AA 1EKRA 3W9IA 2H4WB 2XB2D 3AOBA 2K1RA 4NEYA 1YHQS 1Q86T 3A8IA 4Y0FA 2QEXS 3M05A 4Q2MA 2DH9A 2XMMA 2NPIA 4MYTA 2KVQE 4OYAA 4USJC 1T9WA 5LL6d 4DI6A 3MUMP 2HK2A 1NZAA 1KRPA 2V63A 5KFWA 3TO8A 1SC3B 1X9MA 2PA8D 2MQNA 5C24B 2IJFA 2AU0A 2HHUA 4IO9Q 1TFWA 4IOCQ 1RT2B 2VBZA 2XY5A 5CCLA 1N33F 4LF5F 4CI0B 1TR0A 3PHEA 1H72C 3GG1A 2G1DA 4OJHA 3CD5A 4BHQA 1R0AB 3NNHA 3D67A 4CH7A 1DBDA 2V2QA 4RW4B 2OELA 1C4AA 5HROB 1SJ4P 2QC3A 3LUYA 4PZVA 1T0TV 1WWHA 3H40A 1JJ2R 2M3DA 2AJFE 2E44A 2W8LA 1YG0A 4ZIVA 4DR5J 1VC6A 1B99A 1S1UA 1M5KC 1RT1A 4OIXA 1U24A 1F0XA 1NM2A 3AODA 2V68A 4LRAA 1HI8A 4JI4F 2R7XA 4NLUA 3VF0B 2B7BB 2R2TA 2HHPA 4E2FB 3KLEA 2R8HA 4EU0A 2X1AA 4IH6A 3CCZA 3MR3A 2UP1A 4MIAA 5FDLA 4PQUB 2CQPA 2J9EA 2MZSA 2HFVA 4PCQA 3VZHA 1FJCA 3KLFA 2GA7A 4B08A 1SC1B 4ECUA 2A10A 1YRUA 4OZLA 1I94F 4FF2A 1PJ7A 3PKMA 1UWAA 2RQMA 1L3SA 1I94J 2ZD1B 3LGNA 3DRPB 2RAQA 4BC7A 2WRMA 3TR5A 4C8OA 2QJ3A 3H8YA 1UVNA 4OYPA 1BE4A 3W7BA 2J6SA 2BE9B 1OSDA 3BN7A 3GYNA 4H4OA 4RX6A 2YNGA 3UDEA 1S12A 4XO0A 3BBBA 2QG9B 3MPDA 5HMZA 1T3NA 4B3RJ 5KFCA 3QT7A 3W5XA 2IBKA 1CC8A 3P3DA 5DM7Q 2K1RB 3AH6A 1UVLA 4OX9F 5LMNF 4GKKJ 4AD6A 3BQ2A 4JI4J 2JVRA 4C3LA 1SKRA 1QTMA 2EI5A 4WIQA 1YVFA 4MKAA 1ELOA 3NMRA 5L1KA 1C1CB 2DHSA 2K7KA 3OFFA 4OI4A 5KT5A 3EGZA 1L3UA 2HQDA 3MEEB 1WC1A 1WC0A 1HMVA 2GX8A 1P9QC 2V4QA 1HIYA 1FRLA 4AL6A 2EG2A 3O44A 3HVWA 4Z7YA 4AL7A 3QO9B 2A2CA 2LP4A 4FXVA 3H25A 1A0OB 3N6NA 4YS2A 3Q24A 3TUJC 2CNNB 1HNWJ 1HHQA 4NLWA 1R3NA 5I3UA 4TY8A 1JLQB 4JI2F 3WDOA 4V19J 1IVZA 3PYEA 1CPZA 2XZWA 3I82A 4ZP9A 3KK1A 4OI0A 3QWUA 2DGWA 2PEBA 1LFWA 3CT9A 1XMQJ 3PCOB 3VCDA 3V81A 1UMJA 1D8ZA 2OKQA 2KG0A 2XSJB 1L3TA 3CCES 2ACYA 2W8KA 5CHCB 4HI2A 1EETB 3ZNUA 4I64A 2RRAA 2E9TA 1S1WA 2ZDPA 1MWZA 5J2PB 3DOKB 3OHBA 4FYDA 5I4MA 5ETKA 2GW8A 3TJ8A 2R42A 2CADA 1FE0A 1YSJA 3DI6A 3DRSB 5D4LA 4ZN1A 2OPQB 2HBQB 4J7CA 2GNKA 4DN0A 3BKUA 3C3LA 2D7SA 2VL1A 1ZPVA 1NDPA 3DLEB 2HIQA 3FFIA 4FF3A 5H9FK 2CQ3A 2K2PA 2C2KB 2B0GA 5F8JA 1VQKS 4RNOA 1EAYC 1HBNA 3MMAA 1YDLA 2XYPB 2XS5A 4WE1A 4HDGA 2BJ8A 5I3PA 1RTJB 2IJNA 3ZZZA 3VHQA 3ILLA 2HFSA 4OJ3A 2KTQA 1GH8A 3BSCA 3KK3B 1G1XA 4K5RA 3MCMA 2ZH7A 4HTJA 4PWDA 1HNXF 2PI5A 5HMYA 1SC6A 1TKTA 2B56A 3TI0A 2ZOMA 3OR2A 3M8YA 4F4XA 2YWFA 1NJZA 4KGMA 4U7UK 2DR5A 5DDPC 1S1TA 4ZP6A 4KGXB 4ZVUB 1PYTA 2IMOA 1JJCB 2G0CA 2YX1A 3D5MA 4FPRA 5D0HA 3DU5A 1K44A 2VFTA 2DIVA 3A8KA 2F9DA 4OX6A 2ADCA 2HK3A 1F9HA 2HMIB 2ZOGA 3JYTA 2NUUG 4XPCA 2WK4A 1XN9A 3E01B 4NZ7A 5L39A 1PSDA 4NMXA 3CJ8A 5GAHI 2Z58B 1SL0A 4LF8F 2AEMA 2HVHA 4C9DA 3HJVA 4ID8A 1C4CA 1QUPA 4X66F 1SKWA 3JB9k 2BX6A 2MDAA 3MAQA 4DSEA 2VZ9A 3CB4A 5KFMA 3MCSA 2ZC4A 2UVWA 1X4BA 4DOZA 3C15B 4H4KA 2Q3PA 3S6EA 3CJ2A 3NRBA 2XNQA 3MZIA 4TQRA 1YJ9S 2FJEB 4OYZA 4ZLNA 1D9FA 1TMJA 1MU2A 1ZPWX 1G2EA 3IA0A 4JI6F 3QIDA 5KG1A 8RUCA 3ZZUA 3LPYA 2OI2A 1OWXA 3PR4A 1YITS 1KQKA 2F9JA 2R8IA 1UA1A 1X7VA 3F0NA 1SIZA 1RT4A 1S7IA 1SVDA 4KO0A 5IQ6A 2XHWA 5LMUF 2B4VA 2YX4A 2DCUB 2C2EA 3MM5A 3DGVA 2V8GA 3QT5A 4KH1B 4RW7B 2OMOA 1HBOA 2W4DA 3R9LA 1GMWD 2FLOA 2GJIA 4DR4J 5J1NA 1FD2A 4HDHA 1IBLJ 2AJ2A 1XMOJ 3W66A 2V4JB 4MIBA 3UCGA 4OYBA 3C6UA 1VQ4S 3C16B 1TU0B 2OFGX 4RWWA 3M2RA 4OHWA 5E2QA 4DV5F 1KHVA 4WP8A 3KYLA 1RP5A 1T94A 5G4DA 2HG4A 2GVZA 1Q16B 2JEJA 1X5OA 4ER8A 3EZOA 1REGX 4ECSA 2Q43A 1N33J 2MSSA 4JBCA 2BE2A 4NI2A 1QAJA 1WOOA 4M5HA 2Y8YA 4OHXA 1CJKA 4FKYA 4CT8A 1TMMA 3D7SB 1FVSA 2HQIA 3DGPA 1GMWA 3IS9A 3EXYA 4F2SA 3RBDA 2XGQA 2LEPA 2JEIA 4DEZA 4I6AA 2MY7A 1TK8A 4USWA 4ZVSB 2BEFA 2GQCA 1JLFB 4UF4A 1RLDA 3KJQB 1FESA 1VBXA 4LFAF 1KVIA 2AHOB 3NG8A 2ASJA 1URNA 3TARA 2M7SA 1WHYA 3A1YG 3PW7A 2XTJP 2QSFA 1ZM4A 5I3UB 3AA9A 1OJ4A 2QLXA 1Y5IB 1P6TA 3SQGA 3DMJB 1B70B 4X62F 2X3DA 3MR6A 2DT9A 2V9KA 4QIEA 2UVUA 1IM4A 1NPKA 1JJ4A 4EEYA 1XNQF 4DG1A 3NBPB 4HR2A 1JXLA 1WKKA 2RRBA 4F4AA 4JOUA 4CTAB 3KLFB 2JLFA 2GGPB 3GLJA 1YJRA 1FD8A 3KG0A 4IO1A 4TN2A 5KG0A 1MSWD 3B4MA 1BHNA 4O3PA 4ZLJA 3CCWA 1HI1A 2E1AA 1XR6A 4OLOA 1KR4A 2EWHA 4TYAA 1DJ0A 2UUCJ 3W62A 4J5OA 2VQFF 4I6WA 1N56A 1BLUA 2L48A 2WTFA 4CZCA 3Q8VA 1B7YB 2BKNA 1FNXH 5HMWA 3KUHA 4RJVA 2WVFA 4HL9A 3Q8PB 3T1HF 4M5KA 2LA6A 1HFEL 2CVIA 3C46A 1M5OC 3HFZB 3D28A 1E6YA 3LQVA 2PC6A 5DZ6A 1SQEA 2A3JA 3OV7A 4CO1A 3IN5A 3LP0B 3DOLB 4DV7J 1RAFB 2XGPA 3PW2A 1X9SA 1R8HA 2F65A 5SUHA 3NGUA 4RNFA 3H2UB 4PYDA 1V5IB 2V2VA 3DYAA 3VZIA 3KDNA 5KFUA 2R7SA 3AOCA 2MMYA 2AJ1A 1RBAA 3IBFB 4Y2MA 1P1TA 4EUVA 5KFHA 2N82B 1Y0HA 4OX7A 3BO2A 2RS2A 3CDWA 3V5RA 1X0FA 4JI8J 4B3MJ 5AXMA 1JLCA 2MQMA 1CLFA 3LAMA 2DR8A 5MAOA 2XI3A 3N79A 1PBAA 3H5SA 4KGKA 3K59A 4DL6A 1N4LA 1ZM2A 3T9NA 2HZVA 3T9ZA 3MHYA 5A8WB 3H98A 4X4VA 1S9FA 2B51A 4DL7A 1GTHA 2GVZB 4EO8A 2VU5A 5EUHA 4KHRA 4WK3A 1PGZA 1RHRB 4YHHJ 5LT5A 2IBOA 1S1VA 1WKJA 2ZHOA 5DQGA 2ADBA 1P27B 3P8BB 5J2QA 4O44A 2RU3A 2X3GA 4ZCMA 1JJHA 4RU2A 3RYLA 2PE8A 4LRDA 5EX3A 1PG5B 5AE2A 5ETTA 1TVRA 5HL7Q 3CCQS 1SV5B 2O1PA 4J9KA 2R2UA 3IBCB 4DL2A 4RUBA 3G87A 2EFNA 2ZBQA 1NMEB 1NPPA 3GFYA 1CG2A 4C0BA 5GMEA 4ZLLA 2EG1A 3F41A 2VG6A 4CLSA 4RW7A 2XC9A 2UXDJ 1RWOB 1Y3JA 1D0EA 2AJ0A 1FJGF 1C0TB 2IM1A 1PYOB 1FRMA 3U1NA 2FC8A 1AYEA 4UOCA 2OEJA 1FO1A 3LP2A 1KHWA 3D6FB 5GAEU 3NGKA 3I4PA 1K73T 2P2CB 3H0PA 1Y10A 5IWAF 4CLYA 1N5YB 3BR8A 3Q0AA 1VC0A 2VPWB 5E41A 4F50A 2AGQA 2J8SA 4JV5F 4OL8A 1NJWA 3US5A 1RA7A 3WC0A 1IR0A 2RT3A 1RWNB 4LR7A 4X65F 2KG1A 1DY3A 1JMTA 4LR9A 2QA4S 3HZGA 4DG1B 1PC4A 1FRHA 2KVIA 4NI2B 3SSSA 4CO2A 4M95A 3KUGA 1FRKA 4OZ3A 4IUFA 4DUYF 2VV5A 1HWJA 4LFBF 4A48A 5HN0A 1S10A 4ZVHA 4X4OA 3I5BA 1HA1A 2U1AA 2CRLA 3VAMA 1VQ7S 1J5EF 2HLUA 4KHPJ 2B8PA 4F36A 3S01A 1ZH5A 1FEEA 1REVB 2ZH4A 1NK0A 1RCOB 3VAKA 1RCXB 3BEGB 4L75A 3C8YA 4A8SA 7AT1B 1VQSA 3UDVA 3M6WA 4HACB 5CABA 1T8EA 3OVAA 1R6VA 4DS4A 4QJVA 3GV5B 4LF2A 1J5OA 2I1RA 2FDNA 1BWEA 2C3UA 3W2VB 1SH3A 5J2QB 3PFEA 1OYDA 4IH7A 4TU8A 2IIHA 3HK2A 3UD4P 3J80U 4LF4J 2W2NP 2KT3A 4AXIA 3AFGA 1BQMB 4NZ6A 4ZVFA 1NK4A 4NXMJ 1IM6A 1MWYA 4NLVA 1O0PA 5DDRC 2AGPA 4K0KF 2DHAA 4DV4J 3AQPA 1U6ZA 2CNOB 3OTOJ 2RU9A 2MGZA 4FS1A 3QWPA 2OH2A 1KQGB 2GMHA 4DFJA 1NJYA 3OBIA 4Q44A 3J7A1 1HW8A 1X4EA 4AT1B 3JTPA 3V4MA 5B7WA 3IM8A 2OTJS 2H51B 3LTOA 3TAMA 3TZXA 4GKKF 1S6QA 2E5IA 4JI7F 3K17A 4J9VA 2XMTA 4DSLA 5CQGA 1VCTA 3E8OA 4KE5A 1WHVA 1Z2LA 3KLEB 2QIFA 5IV3A 4N76A 3G71S 3OR1A 5A8KA 3TQ1A 1K9MT 1LV5A 4PXBA 1WNEA 4LMZA 3MCOA 1S79A 4ZPWR 1NK8A 2IFXA 1TK5A 1LK7A 1RTZA 1S6PA 1HD0A 2JL9A 3NNAA 4WFZA 5AXLA 1M5PC 4TVAB 4LF7F 3D3BJ 2DNLA 2UV8A 1NHUA 4NLSA 5ETPA 1NUEA 1RT3B 4C11B 4XIUA 2DNYA 2VG7B 3SFGA 2GIFA 2VICA 1NK9A 1K1QA 3R27A 2RKIB 4RU9A 3CIMA 3FMBA 5IQQA 4B3RF 4ZDNA 2E5GA 3W61A 1RYSA 4PUOB 4DR5F 3KKFA 1D8YA 3KLGB 4M5MA 4DV6F 3R7SB 3LWLA 4QU7A 2W7PA 2YVSA 3R2CJ 1VFJA 3I32A 4NOHA 4ZS6A 3HHLC 4ZJQA 2I6WA 3DLGB 7FD1A 4QCLA 3CF5Q 4WP9A 1RKJA 1VK3A 2C2RA 3EICA 2OPSB 4ETZA 2DH8A 1OPZA 1H2UX 2BYCA 4K4XA 1WF2A 2HGLA 1FDNA 3CCSS 3G6ES 1M1KT 2FD2A 3HHLA 3L09A 3TAPA 2CQ1A 1ROFA 4HT7A 1BQNB 3VQTA 2J7KA 2KO1A 4ZJOA 2DNMA 2QYCA 4NCAA 1YLXA 4KT0C 2JFKA 5DG7A 3AOAA 4DV6J 2MY8A 4OZ2A 3T5KA 4UY8T 1MROB 1AUSL 3KTQA 4IR1A 2DB1A 3GCXP 2GGPA 3UE2A 1SBRA 2J7WA 1Q81T 2POKA 1FKOB 4PR6A 2WSEC 1IKXA 1NDLA 5HATA 2XO6A 3FRZA 2V9WA 4U96A 2EFQA 2I5JA 3NP5A 4B9LA 3TVKA 3FC9A 3RBZA 1C2PA 3VGUA 4L74A 1QVGR 2DR7A 4DR6F 2HVZA 3PFOA 4PQUA 4L3NA 1RBLA 4NRTA 4DV5J 3HVAA 1TV6B 4UQTA 5KFAA 2QL5B 1TK0A 1RWPB 4ED0A 3FVYA 3HKWA 3MUTP 4IG0B 3QMQA 2K7JA 2GO8A 5F41A 1JLGB 4HH1A 3MM9B 4F2RA 2GZOA 4YDXA 3M1VB 2MLXA 4C3KA 3DOKA 5DETA 4ZITA 3KHRA 2CNKB 4ATNA 2L9DA 4H4OB 3T6JA 3W60A 2AT1B 1S49A 2C22A 1EX8A 2VQEF 4NLTA 4Q7AA 2PO4A 1F9EB 2LU1A 1RT4B 3AD9C 2DXEA 5E33A 4ECTA 2NQPA 3IAS9 4ALZA 1FDBA 1QLNA 4USVA 3LW5C 3QT6A 4P7TA 4DR7F 5JVGQ 1M0SA 2BDPA 3R6GB 2G4BA 3MCNA 2P6SA 3SIPB 2FJAB 3PM9A 4DL3A 4B3OB 4FVCA 2ZBRA 4DX8H 4Y65A 1LK5A 4DZDA 2GMJA 4C11A 4HLBA 2DIUA 2CWKA 2JX2A 3BDEA 2VBWA 2EC0A 5D0GA 2KL8A 4G1IA 2G9OA 1WTBA 1KNZA 2H4YB 1VYAA 2N7YA 5K5MA 3POTA 2FPHX 1XNQJ 1WDTA 4NASA 2LXIA 3NKYA 4ZHRA 1LWCB 2YKOA 3D6TB 4LVNP 3TA0A 5AE1A 2DPIA 1FWKA 2BBEA 1HNVB 4Y2AA 3JSMA 3QRPA 1HWKA 3CJTA 3D0IE 3MEDA 3CD6S 4WBFA 5LXYA 1V3RA 3AB4B 2E5LJ 1H7WA 2Z0GA 3UPFA 4MFBA 3MD1A 1U45A 1H38A 2FJVA 2KJVA 1MG7A 3U02A 2VC1A 4GC6A 4A8WA 4S0MA 4WFXA 3UI3A 3BZQA 3IFEA 4DPOA 4FS2A 1D9DA 2HHHJ 3WC2A 1SL2A 4HKQA 2UUBF 2FB0A 1M1GA 4ZVEA 1IBCB 2VC0A 5B0BA 1RT2A 3ZTQA 1DLOA 3JTOA 5LXRA 2W9AA 1G3OA 1N6QA 2HBZB 3UNYA 3SZ2A 2EFGA 3QNWB 4ZK7M 2UXBJ 1N5SA 1XR5A 1EQ0A 1J2VA 1LQ9A 5EWGA 3D1QA 3JYTB 4MH8A 3GIIA 3GILA 3SI8A 4O3SA 3SFUA 3D54A 3HHNB 4ZVRB 2AX0A 3HJFA 3W8GA 3K8WA 1UJ6A 3TEHB 4JI7J 4EYIB 4BBYA 5LSLA 2GAHC 1HNVA 2WVCA 4DQQA 1S9EA 2JOQA 3OFEA 4OV1A 2ZJQQ 3ADAC 1T7PA 2XSFA 3BBFA 1FJGJ 4MKYA 2W7AA 3MMCA 4FYWB 3KJFB 3K58A 1AROP 3DI6B 3CIZA 3NL0A 1HQEB 3RW7A 4AXJA 1RB0A 2LEAA 2GVDA 3HD2A 3C15A 1U6BA 4QIFA 1ZA2B 1VQ5S 1G4CA 2AYMA 5HJYA 2ZM6J 4RW4A 5HROA 2IYIA 3ZNJ1 3DM2A 4KHPF 2OAUA 3BPDA 3NS7B 2PIIA 2ZKTA 2XS7A 3QRQA 2YKNB 4EO6A 3MDFA 1FJEB 3A13A 3QQCD 2NXNA 1LNQA 4E8UA 1GFWB 2VD3A 1XIQA 3D66A 4ZPAA 2E1CA 2C42A 3UN5A 1FHTA 2V34A 2LYVA 3HO1A 4PABA 1JB0C 1VBKA 5KAKA 1WF1A 1ZOTA 2R4FA 3E51A 3MPYA 3MR7A 3CJKA 4A4JA 3OW2R 1HWIA 2VG5B 4DSFA 1YIJS 1U8SA 1LEOA 5KG6A 4N5SA 1ZTTA 1RGVA 1S9EB 3BYPA 3FJ2A 2VONA 3M1VA 1IR2A 4Z37A 2YNHB 4AFFA 5FLXY 4J9SA 4IOAQ 4LIRA 3S7RA 1AZSA 3NS6A 3KLHA 3AJ1A 4ZIWA 3OD2A 4DV7F 1MLAA 4ZVOB 2KFNA 1YTYA 3CCUS 1SH0A 4ECZA 5M2UA 2R7UA 3J7Z5 3IG1A 2QLWA 1Q4RA 1TKZA 2LU2A 1RAJA 1FERA 2XMVA 3MECB 4ZJLA 3SV4A 4K5SA 2NPFA 3MEGB 1UJ4A 1IKXB 1DAXA 3DOLA 1S0MA 1R0CB 2PMHA 2G2YA 2ZHAA 2QFJA 2KT2A 3FBCA 1WACA 2DNKA 2OP5A 2AEJA 1Q82T 3EM1A 4QR2A 4PPDA 3LF0A 4Y2KA 3C2PA 2ZVIA 3GMGA 4WZQA 2ZH2A 1WELA 1YK9A 4X64J 3MGJA 2GQQA 5I3QA 3BPSP 5HVGA 1K0VA 1FX2A 1UL3A 2GC8A 5K8PA 4RBVA 4ES1A 1NEEA 1S72S 3CSKA 4TNOA 4FF4A 1U1LA 4DR2J 1URRA 2IRUA 4KJIA 3SYZA 2IMWP 1T05B 3GIJA 1PILA 2ZH3A 3MPWA 2WSFC 2ROEA 2GS8A 2O3DA 4E98A 3DLGA 1PCAA 2IVFB 3W2WB 3NBPA 3ITHA 2FZKB 2N4CA 4KTQA 1RT1B 4CLLA 4I56A 3C14A 1U09A 2D69A 2MLZA 2C2OB 1WSVA 3D68A 3MMBB 2JJ4D 5DG9A 2KI2A 2FVQA 2IM0A 2YH1A 1LWFA 1IKYB 3VGVA 1IKVA 1IQTA 4WTYA 4FNHA 3EZ5A 3PEJA 4PXEA 3FEZA 3QLHA 4DXLA 2RH3A 2I2YA 3RAQA 2GVDB 2HVEA 4J9UE 4F67A 8ATCB 4YB1P 3D6HB 3MM6B 4R5PB 2DGUA 2WW4A 4KAIA 1JLGA 1JLBA 1MN7A 3T41A 3TZYA 3PIOQ 4NCBA 2QLBB 4CT9A 1DQ9A 1HPZA 1FRJA 5M2PA 4OX9J 2P9EA 1GK8A 1ZA1B 2QX0A 1R7IA 3ENAA 3R5JB 4IRDA 3AB2B 2CJ9A 4KYZA 1FK9A 4MK9A 4DCOB 1B0VA 1B4SA 2RDJA 1WEZA 5IT9U 1FDDA 2L9WA 3FNNA 2CQ4A 2PFDA 2QT7A 3Q8YA 2DITA 1UFLA 4G6VB 4ZCKA 2ZBPA 1DRZA 1KFSA 2DO0A 3K57A 3MPVA 4HHUA 3CJKB 3J7YU 2QSWA 3BV8A 4USHA 4A8KA 1ZETA 1FXRA 2KJWA 4B9NA 3RW6A 4K4SA 1JLEB 1Q7LB 3UO0A 3DOMB 3EVOA 3RJMB 2VA2A 3BO3A 1JXVA 2J8AA 2KYZA 3DHWC 3SCIE 3WIVA 3OL6A 3EPIA 3ICLA 4UT4A 4LBPA 4ED6A 3V6KA 2EK6A 4EYHB 4B9TA 3ZZPA 2F63A 4A47A 4KBIA 2M88A 3AA8A 1SIWB 1T3OA 1HNXJ 5ETQA 1SUQA 2XMUA 3RBXA 4X66J 2ERRA 3X1LB 2HHQA 2IPOB 1NLKL 3M6VA 1JIHA 3W9HA 1HARA 2QFIA 4DL0C 2XG8A 3DLBA 1ZS6A 4BWMA 3G6VA 2XS2A 1JNRB 4GKJF 1PO6A 1ZAVA 2D74B 2GCFA 4PQAA 4DMZA 3VGSA 3R5GA 5T7LB 2FC9A 1A7GE 3CW2C 5KFRA 5L1JA 5HO4A 4NXNF 1NDCA 1HD1A 3UQSA 3PKYA 2R2SA 1U02A 2YPZA 4FYVB 3QPIA 1HBMB 2DKOB 2V5HG 2WB1D 2YQ3A 3MEKA 4LBHA 1U2FA 4NCGA 2CDRB 2HYIB 2X1BA 2NS1B 5KFEA 2DNPA 2ZZNA 3BGOP 2YKPA 1ZAXA 1PC5A 3RRKA 2LA4A 2J9CA 4L3KA 1FEHA 1UEVA 3HFVA 4CNYA 2L41A 2YTCA 3Q8SB 4R8UA 1VQNS 2BJ7A 5D4OA 4BC9A 2K06A 2DJWA 3UW1A 4F0HA 4PUOA 1CJVB 2QL7B 3MURP 2HFUA 2LLZA 2V8VA 3J7YI 4W90B 4ILLA 3OSNA 4LF7J 3CC2S 4DQPA 1UCNA 1YZ7A 3CVKA 4KO0B 1RQ0A 2B4OA 1ZM3A 3M32A 3JSYA 1WJ9A 3HPOA 3H4DA 2ASDA 2R7TA 1Q0NA 1EJ7L 1F6TA 1JKHA 3IRXA 2HZCA 2B5JA 4ZPVR 3PJ9A 4IKAA 4ZPCA 4PG6A 1D3WA 2F5GA 4USTA 1S4FA 2NYHA 4LBIA 5HVHA 2E5JA 1XMBA 2AWZA 1HNWF 1TL1B 3U7JA 2ASLA 2F8MA 4U6PA 1F9FA 2RHQB 3VWSA 1P1LA 3IWNC 2BZ2A 2VBYA 1HYSA 3OFGA 3CJ0A 1YBUA 3IC1A 3TNVA 2N7CA 2YKNA 2UUBJ 3DLKA 1CVJA 1XNRJ 2X1GA 1UTAA 4LF8J 3QGIA 4DF4A 3HD1A 4M5DA 3T1YJ 5KFKA 3MFHA 3CULA 2JVOA 2CDQA 3UVJA 4GRSA 1GEHA 4BWJA 3UDLA 2PN6A 1IKYA 2PT0A 3THTA 5K8OA 3OL7A 2Y1JA 2IAJA 2HNZA 1IJFB 4G65A 4O3NA 4Q45A 3PEHA 1Z4UA 2KZZA 4UUWA 1KVJA 1X8DA 1YBTA 2ILYA 2Z2ZA 4JYAJ 2DBBA 4CQ1A 5K8MA 1TUGB 3QO9A 5IT0A 4IRCA 4LF9F 1M5VC 3FRYA 2YNIA 3MM8B 1U1QA 1RWUA 3L95X 4QIGA 4ZLPA 4DX6A 4DSIA 2G0IA 2RE1A 2X51A 2GAGC 2RQ4A 2WW8A 4DPWA 4DR3F 1X4AA 2J0WA 3N9UC 1SQFA 4CH0S 1YJWS 3QT8A 2HHVA 2EEYA 3TJ9A 1LKZA 1CJVA 2IM3A 3RZAA 1EQMA 1IBMF 1S7HA 2V4RA 3M8QB 4K4ZA 1HPZB 3N4WA 4A46A 4URGA 1YZ6A 1W2IA 1BGXT 1HBUB 3FBFA 4LRBA 4Z2XA 3ET6A 2A6MA 2CQ0A 1S59A 2ZWPA 3FSYA 2XI2A 4QOTA 2LQBA 3SDEB 3CJ3A 3KLVA 4ID5A 3RB3A 3H4BA 1TELA 2CPZA 4ANEA 3PX6A 2GO9A 1LWFB 1MNEA 2QLFB 3I56S 3NS5A 2N3OA 4P72A 4LSNA 4MTPA 5K14A 4DR1F 3H5YA 3M6XA 4NXNJ 2JFDA 1BUXA 2EK1A 1XJWB 1RJJA 2BANA 3CDEA 5CZXA 5AE3A 2A0FB 2FGCA 3F56A 3UDCA 3CJQA 5B08A 1WOPA 2OMLA 3BKTA 4IFYA 1GXTA 3IGNA 4OI2A 2HS3A 3Q8UA 4P2XA 2XO7A 4DV3F 1WHWA 3TAQA 4M5LA 2DO4A 5CYQA 2DXDA 3QBCA 2FVRA 2M9KA 4LFAJ 4NLGA 4O0NA 4RW6B 3PZPA 4A8XA 2ZUAA 2WB4A 2CQHA 3H42A 3HT0A 3VAIA 1RTJA 4IR9A 2YH0A 2YPYA 4LQ3A 4R0EA 1VQLS 3QFWA 4B3MF 2WAQD 4F4YA 4FN5A 4U8YA 1X4GA 2UUWA 4C98A 3MMBA 2W25A 1VLOA 3I0SA 4C6AA 3ZTOA 1RZMA 4MT1A 1HNIA 2C3PA 3EGWB 1Y9OA 4CM0A 1SJRA 3EE3A 3BDPA 1RWWB 3C16A 4IDKB 1T03A 1LW2A 4UZCA 4DR1J 5D3GB 2JC1A 2YKAA 5RUBA 1U1KA 2JWNA 1R8CA 1NAQA 4DV0J 4RBTA 1U0HA 2O5DA 4YOEA 1RT5A 5EHHA 2FUG9 1NKBA 1N34F 1Q5VA 1RDRA 3NCQA 3DDIA 2COLA 4WWSA 2O67A 3FMWA 3BQ1A 2CIMA 5D0EA 3QIPA 4KR0B 1JLAB 2ATCB 2O01C 4I2QA 4L73A 4JP8A 2KFYA 1VISA 4OYIA 4R0JA 2MJUA 2AEFA 2I0XA 3IS9B 3ZTPA 5SZTA 4I4BA 3TANA 4FF1A 3OTDA 2XCAA 1S5ZA 3HLUA 3QLHB 4A8YA 2ACMA 1U26A 2H5EA 1V6HA 3SBMA 1M5SA 2ALZA 2OFHX 4KV8B 1SB6A 1HKAA 4ECXA 4K4WA 2CPXA 4ED1A 2MXYA 1IXKA 5ETMA 2G2ZA 4TY9A 2FY1A 1W2BR 3OTEA 4FP9A 2Y8WA 1CULA 1HR0F 4XTTA 2QMUB 3PX0A 1TAUA 5B0AA 5KG2A 2IC3B 4JI3F 1QSLA 3FSXA 4J9LA 1N54B 1B0TA 2C1EB 3DXBA 2OTLS 4NL5A 2RF2A 4NWBA 1NHKL 5A2QY 4IQXA 1CJKB 2AYGA 3IWXA 2F3JA 2YWHA 3MOZA 5A2QU 2DNZA 3CD0A 4CYUB 5KG3A 3RR8A 2LVWA 1C1BA 5KG5A 1U1PA 1YQHA 3PY8A 2Z4PA 3PACA 1T9YA 3UN2A 3PW5A 2MZTA 2PEHA 2UZAA 3FUYA 4MK7A 4RNHA 2U2FA 4B02A 3IR6B 1LWXA 3NGRA 4CH1A 1HI0P 2R2RA 1NSKL 4P74A 2RDIA 3TWZA 1C0TA 4DLEA 2QGFB 3GFXA 1NSAA 2DNOA 4UW2A 5BXIA 2VJUA 3C19A 3AAWB 4BLGA 3RRGA 4DSJA 3M4XA 1QM9A 4U8VA 2HHWA 5ADZA 1VBZA 2DD8S 2HQGA 1HW9A 3VTIA 1J5OB 4U7UD 2MB0B 4LF6J 3GPAA 1IN0A 2XMKA 1OY9A 3SQGB 1TL7B 2HRUA 5HK4A 2EVZA 3ZFVA 1EHWA 4X2BA 2B6AA 3NWRA 3Q2SC 3QATA 4Y00A 4F02A 3UVJB 1I51B 1YJUA
chains in the Genus database with same CATH topology
2OSRA 2J76E 1UW4A 2EBEA 4FVMA 4QR0A 1F5BA 3ISND 3L7OA 4YMEA 1IBLF 5D6GA 2J9DE 2RILA 1H3DA 3GV7B 4MKBA 1VQMS 2B5JB 2MYFA 4UY85 4WFNQ 3P6YC 3M2VA 3D1HA 5J1PA 4B9VA 1S1XB 2DGQA 2F7VA 2HPUA 4AQYF 3DXSX 4BDPA 2RVJA 4OQJA 1TUVA 1VK8A 5LSOA 5LSRA 4NYPA 5F8GA 2N4DA 5J2NA 3P96A 5KFDA 2ZJPQ 1VQOS 2Y1RI 2W4CA 2HGNA 2HNYB 3H2LA 4YR3A 3G8SA 5HBMA 4X4SA 1N5YA 1JKHB 1HHSA 2OLWA 1NNDA 4M95A 4ICLA 3HT3A 3RR7A 5KFVA 3QGGA 2ABYA 4C8YA 2FHJA 4B3OA 3FCHA 3OHAA 2M52A 3UD3P 4DWIA 1A6LA 4QZVB 3DLLQ 2FTRA 3LOUA 4YR2A 4M8LA 4TLRA 1HBOB 4QYRA 2HFOA 3OUYB 4ED8A 3OR2B 1LWEB 2AD9A 2M8HA 2QO3A 1U1MA 2HFZA 2LCWA 3C6TA 1TKXA 3GWCA 4NA3A 1QUVA 1SL1A 4WU3A 5J2PA 1JLAA 4OZ5A 1TAQA 5B0EA 4DFKA 1V3ZA 3IGVA 1UFWA 2VOPA 1L3KA 2VOOA 3GV8B 3MMAB 3B82A 4RW9A 1H98A 2CJQA 3QZ7A 3N6LA 4I7FA 6FD1A 5KFJA 2CPIA 2VFVA 3DLEA 5JXSA 4I2QB 5KT2A 2AQ4A 4DV4F 2V0NA 2DPJA 2CG4A 1OQ6A 3K5PA 1X4DA 4YB6A 3MI7X 2KHCA 4H54A 2R7OA 2NZ4A 3R5DA 3HDSA 3GSDA 3V6DB 3SSQA 4I68A 5D3GA 4KV8A 5IXUA 3T1AA 2ZH6A 4Y2IA 1TQLA 4XDCA 2DNGA 3G86A 3AJ2A 5B09A 5J1EA 5CYQB 4DLGA 3MM9A 4NRUA 4ED2A 5KT7A 3W3SA 4YEAA 1NKCA 2B7CB 1VI7A 1FK9B 1U6FA 4F8RA 1DARA 1HBNB 1IKWA 1A9NB 1IKVB 1S6UA 4HVZA 4LSNB 4Q0BB 1QE1B 1HQUA 2ILZA 4EZ6A 1H6KX 5BYQA 3MM6A 4R5PA 1N8RT 4YR0A 1N0UA 1SH2A 3TYTA 1QAYA 1X4FA 4EBCA 4XAKA 2VA3A 1LW2B 3M9OB 3UCZP 4CO4A 2ZH1A 3VAGA 3WX4A 3AQOA 2J6UA 1I1GA 4C7QA 3K5MA 1IUJA 2HNDB 2M2BA 2MQQA 3KNAA 3O5TB 2CZVC 2ROGA 3F73A 2CPJA 5THWA 4JI1F 4ELVA 5IFMA 3PO5A 3M9MB 3PVXA 5LJ3Y 2DCLA 4GO7X 2OPSA 3TA1A 2VB6A 4JUZA 2HWTA 2YY3A 1R27B 2DK2A 2XLKA 2PFFB 3M30B 2BRKA 3MF5A 4ZCLA 1RT7A 3MWBA 5KFTA 3LP1B 4M63A 3V6DA 1VMBA 1WG5A 5MLCV 5CZVA 1NK5A 2ZNYA 5T14A 3OUYA 3I87A 5IT9Y 3OJSA 3IG1B 1GXUA 1LW0B 3C6UB 1IQZA 2BQ3A 2V8HA 4R8UB 4ECRA 2N3LA 1ZBTA 2D9OA 2DGXA 1CEZA 2F8EX 1WTFA 1Y5NB 2P6TA 4I6YA 2L08A 1QAXA 5C25A 4G1QB 4C0HA 1KONA 3D2WA 2ZBIA 1RKIA 1N52B 2OIHA 2DTJA 5GADI 5F0WA 3CCRS 2BM1A 2UXBF 1C0UA 2GMLA 1DQ8A 3BSAA 3NWGA 5B0CA 4DFMA 2DISA 1S6PB 2ROPA 1YGYA 2XNRA 1VQYA 5BR8F 3O1LA 4DR4F 1S1TB 4U67Q 5EGYA 4FZVA 4FXWA 5CYMA 4DHVA 1DZ5A 2XBPA 3ISNC 2E5LF 2ZD1A 3NMAA 4EFAC 5KFGA 1GXLA 4NMLA 1S6OA 1WHXA 5KTQA 2NXUA 4ILMA 2RUGA 1NB7A 1RA6A 2ZE2A 2Z2MA 3CO9A 2JRSA 4C97A 2DVIA 1UAWA 3LP2B 5EX0A 3DM2B 3TUZC 1LFPA 3FSIA 2MKSA 1AFIA 3FEYB 4JYAF 2IVYA 2AYEA 2XMJA 1BC6A 2W4PA 3SDEA 1FTCA 1R8AA 1KOHA 1ULRA 1QVFR 4PRFA 5T41A 3FGVA 4RW9B 2ZM6F 2HWIA 4QR1A 1H7XA 3MTKA 4CNZA 5EWFA 3NNCA 3M8PA 3J81Y 4MFBB 2JH3A 2BXJA 1YWXA 3OFHA 5F8MA 3OVSA 2DNRA 2VKRA 4Q2LA 3BM7A 4PKDB 3M9NB 3SMZA 2YWEA 5DQHA 4C4WA 2V8DA 4U9RA 2CQDA 3HHEA 4QQBA 2F4VF 2ZUGA 2R7VA 1APSA 4HI1A 3CEDA 3K5OA 3V81B 1N36F 2LDIA 1OIAA 3T19A 4YB7A 2CJKA 3D1OA 3HHKA 3W2VA 3WBZA 1JLEA 2EFPA 1FT8A 1TL5A 1UVKA 3OVBA 4XPEA 2LXFA 2Q66A 3MMCB 3NLCA 5D4PA 2CJBA 5J2NB 1U47A 2QA2A 5C5JA 3QYYA 1HMVB 1N5VA 4K59A 4EZ9A 5JJBA 5CCMA 4WCEQ 1CQMA 4RNNA 4E0DA 4B9UA 2K3IA 1KQSR 3NCPA 4NLDA 3OLBA 4EBDA 3M2UA 1S76D 4HEA9 2EFOA 2OD4A 3Q2TC 3KHLA 2JDJA 3LO3A 2FJBB 1IBKF 3DRYA 5A8RB 2JZ5A 4OHYA 1FKPA 3OTOF 4QYZJ 2HWHA 3N28A 3HF5A 1NH7A 4O23A 3PJWA 4HH0A 3M8PB 2P9CA 2W9BA 3OXGA 4X4RA 3E3XA 3RB0A 3QGHA 1RTDA 5F8IA 4O3RA 2MKCA 1YJVA 2E1MC 4I1TA 4YY3F 3G8TA 1KN6A 3HVRA 2HFNA 4LUBA 1D1UA 3V4IA 1VRTA 2CJAA 5C25B 4KFBA 2GHWA 1SJ1A 1RYRA 4K4TA 2BVZA 1S48A 4C3MA 3RAMA 1UVMA 1S0OA 3DCAA 4ZOSA 2W9CA 5HQ8A 4X4PA 2A1BA 1C0UB 5KFIA 4I69A 3KNGA 3W2WA 4O4RA 4WYLA 4DQSA 2K8GA 4KKOA 1X4HA 2MZJA 4H4MA 3F44A 3I5CA 3B4DA 3MM7A 4K50A 1UETA 2DGSA 3UNGC 3KK3A 4CO0A 1FNOA 2JC0A 5HI7A 3S1TA 1VIOA 1GTEA 1Q7YT 5KG7A 1T02A 5IZHA 2PDAA 4PG5A 2APOA 3QIPB 2FGOA 1F5CA 4WFBQ 2HS0A 4NYOA 3M8RA 3MOJB 3VAHA 4B3TF 5KT6A 4IQMA 4DV2F 2H9ZA 1QSSA 3ZC4A 1HBUA 5F3TA 2FHKA 2OPRA 5EDWA 2YKMB 4PWUA 3IXQA 4N77A 2BOPA 4CCHA 1OPIA 4PG4A 1B7FA 2F40A 3KJVB 2MKHA 3HX9A 1DURA 5KFBA 2LKZA 4YOEA 1T95A 3HVTB 5EWEA 2NSBA 4OZ0A 5AXNA 1UWBA 5KT3A 2PMZD 2LQ9A 5U47A 5K14B 4AE5A 3NGDA 2LEBA 4N41A 4ETXA 3UR0A 2VKZG 4Q8FA 3TP2A 3CMES 2J9DA 3HXMA 5BYRA 3CWJA 1K1SA 2IYGA 4ITSA 5L1LA 4P2SA 1JLQA 2FLNA 2R7QA 4IFVB 3GQCA 2GHPA 2ZNZA 3RU0A 3DU6A 5AJ3F 1YBAA 1FCAA 3MFIA 4OI3A 1CSJA 2KXFA 1WEXA 2VFRA 2DR9A 4WJBA 2RIJA 1HQEA 2Z8QA 5G0RA 4OFZA 1KLMA 4ZKAA 1F2GA 3GFZA 3I31A 2RKIA 4O3QA 1VRUA 4ZP7A 4F4KA 1DHMA 4B9MA 1UWBB 2WHOA 2GV1A 1OQ3A 1GAOA 2WBRA 3ZZRA 5I42A 2JEGA 3BGUA 1EP4A 3CCLS 5GADU 3RBEA 3C66A 5KOXA 3OQ2A 3G6XA 1U1RA 1RTIB 2Y0SD 3M32B 4Y3CA 4I7FB 4XK8C 5A8KB 3LALA 2J6TA 3DLKB 3G8QA 4ES2A 2KYXA 3OL8A 3R1LA 2QMWA 2VPYB 2E7XA 2CPEA 2PGCA 3OPKA 4QBUA 5BYSA 1KS2A 4FBTA 1S0VA 3TUIC 4B17A 4CO5A 1K0TA 1LWEA 5DLGA 5L8RC 4JI5F 3PRDA 3TX8A 2XEXA 3PV8A 3ZZYA 2FLPA 2QZ8A 2KRBA 3PW4A 3DDNA 4QWCA 2F1FA