1R8PA

Hpv-16 e2c solution structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
81
Chain Sequence
MTPIVHLKGDANTLKCLRYRFKKHCTLYTAVSSTWHWTGHNVKHKSAIVTLTYDSEWQRDQFLSQVKIPKTITVSTGFMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein E2
publication title Solution structure of the HPV-16 E2 DNA binding domain, a transcriptional regulator with a dimeric beta-barrel fold
pubmed doi rcsb
source organism Human papillomavirus type 16
molecule tags Transcription
total genus 10
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r8pA00
2QFJA 3DLLQ 1K73T 1U6FA 2JVRA 2DISA 3HI9A 4TU8A 1S72S 3CCUS 2M9KA 2ADCA 2X1BA 5LXYA 4YUDA 2ZJPQ 3RW6A 2X1AA 1WEYA 3G96A 1N52B 1M5PC 3CPWR 2ZJRQ 2D9PA 2MJUA 2DGSA 2DB1A 1YJWS 1PGZA 4EGLA 3IWNC 3R1HA 2RU3A 2CQIA 2DNZA 2VOPA 1U6BA 1D9AA 3U1MA 2EVZA 2JX2A 1VQPS 2LXUA 3MURP 1N54B 1X5PA 2FC8A 5D77A 2Q79A 1SJQA 1U2FA 1U1PA 2SXLA 2MZ1A 4CIOA 4V19X 1U1LA 2N3LA 2MKCA 2FY1A 1X5OA 5JVGQ 4CH0S 2RUGA 2YTCA 5ITHA 2VODA 3ZZZA 2HZCA 1OWXA 2AYMA 1WG5A 3VAGA 3OW2R 2CPZA 3THTA 4WFNQ 1WF1A 2G1DA 1X4CA 4WIIA 2M8DB 4W92B 1FJ7A 2MGZB 3SXLA 2ZJQQ 1VC6A 2KHCA 4WFBQ 3CUNA 2DNQA 2MKKA 4RU2A 2MJNA 2KXHA 1D8ZA 1WHYA 5CXTA 1UFWA 4OZ1A 2YH1A 4PR6A 2E5HA 2CQ2A 3VALA 2OTJS 2K8GA 2XS5A 5GAHU 1XN9A 1S79A 1R8PA 1JJHA 2CQCA 1WELA 3UD4P 3SMZA 2DNLA 3I55S 2E5IA 2RS2A 2LYVA 2YKAA 2I2YA 1YI2S 2KG0A 1CVJA 5IM0B 4J5OA 2XS7A 1VC5A 3P3DA 2CPDA 2F9DA 2ERRA 3UWTA 5LSLA 1X4EA 2DNOA 2HGMA 5LJ5Y 1Q82T 1VBYA 2LCWA 1HA1A 2MSSA 1QVGR 2RT3A 2M7SA 2CQBA 4M5DB 4OZ0A 3H2UB 4ZKAA 3MUMP 2LA6A 1H2TZ 4UY8T 3EGZA 2MKSA 2DH8A 2O3DA 2L41A 2D3OR 2MGZA 4FXVA 1VQMS 1VQLS 1X0FA 1RKJA 2DHXA 2DO4A 1SJ4P 2K3KA 1VQ8S 2MSTA 5MLCV 5DM7Q 1FO1A 1YTYA 1O0PA 2DGUA 1RK8A 1WI6A 2D9OA 5GAGU 3EX7B 2CQ0A 1JMTA 2MXYA 3CCMS 2FHOB 3CCQS 2AYBA 1KC8T 2M2BA 1X5TA 2XNQA 2UP1A 2QEXS 1DHMA 5DDPC 1M90T 2L08A 5IQQA 3R1LA 1WF2A 1VQOS 4YB1P 3P49B 5IFMA 1X4AA 4A8XA 5IM0A 1M5OC 4C7QA 3LQVA 2AYGA 2OSRA 2N7CA 3CD6S 2CPJA 2CPHA 3S7RA 1YIJS 1X4HA 1M5KC 5EN1A 3UD3P 2MZJA 3CCVS 2NZ4A 1H2VZ 4BS2A 2DNYA 2KXNB 4UQTA 4LJMA 4F25A 2CPEA 1WHWA 3Q2SC 5D78A 3BO3A 3MOJB 2XS2A 3VAJA 1YJNS 1WF0A 3FEXB 3HHNB 1KOHA 1VQ6S 3CMAS 3PIPQ 3K0JA 2KN4A 2MQOA 1F9FA 2ADBA 2DHSA 2BOPA 3MI7X 1FJCA 1WG4A 4CH1A 2CQ4A 1W2BR 1URNA 3FEYB 1KQSR 2DNNA 1QVFR 3G6ES 2V94A 5JVHQ 5CYJA 1YWXA 2JVOA 4IUFA 2MZTA 2PEHA 2X1GA 1X4DA 3TP2A 4QQBA 3NMRA 3B4DA 5CA5A 1G2EA 1DBDA 3NNCA 1FNXH 2DHGA 3J7ZT 2YWKA 3EGNA 2DGWA 3CCJS 1ZH5A 2YH0A 4C0OC 1HL6A 2DIVA 1QM9A 2DNPA 5GAEU 1P27B 2CQ1A 2VOOA 1WEZA 2MQMA 2DNGA 2HVZA 3CCES 3NS5A 3TYTA 1U1QA 2N3OA 2M88A 3VAHA 1VQ7S 1FJEB 2JWNA 2G0CA 3PIOQ 4PRFA 4W90B 2M8HA 4QPTA 2A3JA 2QA4S 2LXIA 3U1LA 3UE2A 2KM8C 1WEXA 2E5JA 2MQLA 1L3KA 4LMZA 2F9JA 2DH9A 3J7YU 3Q2TC 3MXHP 1R8HA 1WWHA 5GVQA 2RQCA 4TU7A 5GADU 1A9NB 2X1FA 3G9CA 2XNRA 5LSOA 2KH9A 3VAFA 2DITA 1N88A 4Y00A 4WFAQ 3S01A 3N9UC 2HGNA 2JRSA 2MQNA 1U1MA 5LJ3Y 3DXBA 1WHVA 3G71S 2LEAA 1FXLA 2OJ3A 2CQHA 3V4MA 2E5GA 3BO4A 5HO4A 2MZRA 3NNHA 3BO2A 3BEGB 2M4MA 3P5TL 2DH7A 1VQ5S 3VAIA 3NS6A 4WF9Q 2DHAA 5LXRA 1Q81T 4C4WA 3NNAA 2GHPA 2B0GA 3P6YC 1KD1T 3S8SA 2MQPA 1UP1A 2CPXA 2OTLS 2VONA 2KYXA 1WG1A 1HD0A 1WI8A 4TU9A 3UCUP 2KU7A 1U1OA 2WBRA 3UCGA 3SDEB 1U1RA 1IQTA 1X4BA 4FXWA 3VAKA 2MZSA 2F3JA 4IOAQ 5BJRA 2GO9A 3CC7S 5DDRC 1VQNS 2I38A 4ED5A 4PKDB 1FT8A 2HGLA 2CQGA 2J0QD 2DNHA 2MPUA 3MD1A 1UAWA 2RS8A 3IRWP 3S6EA 3MUVP 1UW4A 5DDQC 3G8SA 2DGOA 2MHNA 3LPYA 2DIUA 1FHTA 3RW7A 3R27A 2DGXA 2MY8A 3ULHA 4TLQA 2LKZA 3I56S 4Y0FA 2FC9A 5FJ4A 4LIRA 3JB9k 1DZ5A 2KRBA 2DGQA 1HD1A 2MYFA 3MUTP 1NJIT 1Q7YT 2MKIA 4WKRA 2KT5A 4Z2XA 3MDFA 1OIAA 2FPHX 1WHXA 1U1NA 4CQ1A 5DM6Q 1A7GE 2LMIA 2DGVA 1Q86T 2KFYA 2DNRA 2U2FA 3H2VE 1M1KT 2CQDA 2XSFA 1VQ9S 4IO9Q 2PE8A 2DNKA 4IOCQ 3CMES 4WCEQ 1H2UX 4F02A 2XB2D 3CTRA 4ERDA 2MMYA 1ZZFA 2CPFA 3MD3A 3SDEA 3G4SS 2AYEA 3CC4S 2OSQA 3ZZYA 2M70A 2G4BA 2L9WA 3BS9A 2MY7A 2MKHA 1VQKS 2CPYA 1SJRA 1ZZNA 1K8AT 1B7FA 2RQ4A 3UCZP 2LECA 4P6QA 2AD9A 1YHQS 1AUDA 2BZ2A 2MKJA 3US5A 5HL7Q 1DRZA 1YITS 1OPIA 1X5SA 2KG1A 3G8TA 2LEBA 1VBXA 2KVIA 2CPIA 5DDOC 2EK6A 2J0SD 2CJKA 2OIHA 1JJ4A 2KRRA 3D2WA 1H6KX 2J76E 1U1KA 2DGTA 2DO0A 3CC2S 1X4GA 2DNMA 2RRBA 4QU7A 2HYIB 1BY9A 2KI2A 2E44A 2N82B 2CQ3A 2DK2A 2MQQA 1SJ3P 1K9MT 1JJ2R 1SXLA 2CQPA 3B4MA 1SJFA 1OO0B 2KM8B 2LA4A 3VAMA 1M5VC 2KXFA 2M0GB 1VBZA 2RVJA 3VF0B 2RRAA 2M52A 1NU4A 4YOEA 3L3CA 1KOOA 2MZQA 3CCSS 2EK1A 2NLWA 5DETA 4QU6A 4U67Q 1PO6A 2MB0B 2J8AA 5GMKa 3CXCR 1WTBA 2LQ5A 1P1TA 2RNEA 1NO8A 1N8RT 3TO8A 3CCLS 1YJ9S 3CCRS 3THPA 1VQ4S 1X4FA 2U1AA 5H1SV 1VC0A 4F26A 3CULA 3CF5Q
chains in the Genus database with same CATH superfamily
5J1NA 3DLBA 3HSJA 3CCUS 5LXYA 2ZJPQ 5C42B 3HT3A 2X1AA 2K06A 4PXEA 3GCXP 4UOGA 2ILZA 4ZVEA 5KG7A 3W5YA 4DL3A 1NK7A 2EVZA 2JX2A 5E3QA 4G3IA 2J9DA 3CO0P 4DN9A 4K4XA 2JJ4D 3AAWB 1RKIA 2FYXA 1QSLA 1NK4A 2V8HA 3LALA 4FP9A 4HH0A 2EKNA 4YMEA 3MEKA 3N6MA 3DLEB 4W92B 2ZJQQ 1X9WA 2V67A 4G65A 2BQUA 4RU2A 4GKKF 4FNHA 3UDCA 4LFBF 5CH7B 1HQUB 2KTQA 1WC5A 2CQ2A 1U02A 2F1FA 3R2DJ 1XIQA 1S79A 3RB3A 1AW0A 3CJ5A 5ETRA 3UD4P 1VRQC 3R6LB 4B9NA 3U02A 2E5IA 1V5VA 2ZEJA 2W24A 4C98A 2F9DA 1ZYQA 2EBGA 4M5IA 3CDBA 2Y1JA 2C2EA 4YB7A 2I8EA 1LWEA 3EZ5A 3GSIA 4F36A 4NCGA 3LGNA 2IBOA 2WB4A 1F5BA 4N8OA 1GMWA 4MKVA 3I4PA 4WTOB 1UWBB 1S0OA 5D3GB 4DZ6A 4ZPBA 2AJ2A 4IFVB 5K8PA 5DDPC 3TVZA 2VD3A 1UVNA 1MMNA 4J9UE 1UZDA 1T05A 3J7YI 2CPJA 3PYEA 2H48B 4KRWA 3M05A 2WONA 1NKBA 4IQXA 1HYSA 2YKMB 3H7HB 4NLSA 4F0MA 1JIHA 5A8KB 5F8NA 1T9VA 1GMUA 2Q3PA 1RAHB 2C2NA 3VV2B 1AXQA 2ZZTA 3IBCB 2B4OA 1GMWD 1SJ1A 5J2NA 4GC7A 2APOA 4PZVA 2VOOA 4K4YA 1IVZA 1FF2A 3NS5A 5A2QY 2VQFJ 4OJ3A 4FKYA 4P74A 1FJEB 4W90B 4UZBA 2R8JA 5KFYA 2VB6A 3QGIA 1NCLA 3IG1B 3L95X 2E1PA 1WWHA 3MMCB 2OPSA 3VAFA 2QN6B 2Z0GA 4I64A 1TAQA 2WAQD 3DXBA 2V68A 3M8PB 2CQHA 5HO4A 1EETB 5DQIA 1KHWA 4JI5F 4P75A 1YK9A 3VGSA 4B3MF 3UCUP 2JLFA 1S77D 3POTA 4JOUA 3IMQJ 4RUBA 5BJRA 2RHQB 4LFAJ 1BC6A 1RT5B 2G2ZA 1IJFB 1RCOB 4KQZA 2CDRB 5KFAA 1UTAA 3R27A 5FJ4A 1IR2A 3JB9k 2XG8A 3TJ8A 4DSJA 2FJAB 2HFSA 3CDWA 4I69A 2U2FA 4ZPTR 1U8SA 5GAGI 5DG9A 4RW6A 4IOCQ 5B09A 4F02A 3EPIA 5KT5A 4LF8F 2DY1A 1VYAA 4XIUA 2CJ9A 2B51A 1SL1A 1URRA 3L7PA 4A8KA 3CJ4A 4PCQA 2IC3B 2ZZNA 4AD6A 3G2XA 1F5AA 2OEMA 3PVXA 4F3OA 1VRUA 2DT9A 5D0RA 2GHWA 1S5ZA 4ZJLA 1TP7A 3MEGA 1U1KA 3VR1A 2GVDA 1U0HB 1RTJA 3M30B 3SSQA 2DNMA 2RRBA 2B6AB 3TI0A 1A0OB 1JJ2R 5IV3A 3B4MA 4OHWA 3VZIA 2DCLA 1CBKA 5EUHA 3IGNA 9RUBA 1NU4A 3FCWA 3E2EA 3BH6B 3L3CA 3IGVA 2J8AA 2GAHC 1RLCL 1JLQA 5DQHA 3DOLB 4Y2KA 3THPA 1X4FA 2OGUA 3QAEA 1R0CB 4LRBA 3DLLQ 2EFGA 4TU8A 2EFPA 2M9KA 3D1OA 3R5BA 5F0UA 1ZM4A 1HNWF 2D9PA 5F9LA 2W4PA 2IFXA 2PI4A 2CQIA 2DNZA 2DJWA 4PXBA 1Q53A 1Y5NB 2HNZA 3GWCA 2HIQA 5D77A 2RDDA 2ZH2A 2FUG9 5LMNF 2RUGA 1Y3KA 2VODA 4UQGA 1OWXA 1BMQB 5M2RA 5BYQA 3HFZB 3OW2R 2JHEA 4J9OA 4OV6A 3TVYA 1LWCA 3GG0A 2KHCA 4TYBA 2MKKA 3J81j 1VQSA 4MKBA 4CWBA 1S1VB 4X64F 1N36F 1K44A 1T3OA 2V50A 5GAHU 1APSA 4FNIA 4LFBJ 1MSWD 5DGAA 2IJRA 5IM0B 3X1LB 4QW8A 3IP0A 3V2UC 4KFBA 2GC8A 2DRAA 2BOAA 3UFCX 2Y1RI 4PG4A 1S9EB 2LA6A 1Z1ZA 1YJ7A 4WWSA 1PCAA 3MAQA 2I9SA 4ECXA 1E6YB 3IR5B 1SUQA 4ZVTB 3I4HX 4DR4F 4XDCA 3BPDA 1IN0A 4OYOA 4M5NA 2QMUB 2BXJA 3AD7C 1SC6A 2OH2A 1Y4ZB 1Y7PA 2XNQA 2P5VA 1KR4A 1EQMA 2CVEA 1X4HA 1CPZA 4GVLA 1LWFA 2OMLA 3CCVS 4FDFA 3NOGA 3DOKB 1H2VZ 4OX9F 3FNNA 1WHWA 2JFKA 4DV2J 2ZHOA 3M2RA 2EXUA 3BO3A 1GXTA 3MOJB 5I42B 3OLAA 1XEZA 2RU9A 2EG1A 1TV6A 1J5OB 2ADBA 4FF2A 4EK2A 5J2PA 1XNQJ 1WKKA 4KKOB 2BQRA 4OJ1A 5FDLA 5E0OA 3MZIA 4QIWD 2WW8A 4CLSA 3BKUA 3J7ZT 4DR5F 5LM7E 1HBUB 2OD4A 4DV5F 2XQCA 5E5NA 3IFEA 3SQOP 3CSKA 3M6VA 1XNRF 1EKRA 2JWNA 1ROFA 3OHBA 1TL1B 4QPTA 4QWBA 4WP9A 2XMTA 3TZYA 3WC0A 1QUVA 2E9ZA 4JB8B 3U1LA 2E5JA 3I0RA 3CE8A 4KHPJ 2ROGA 3Q2TC 3MXHP 5GADU 5KFIA 3MF5A 4OX8A 2WVFA 4QPXA 2KYZA 3QPIA 3ZZRA 2XYHB 2HGNA 1Y11A 4DV6J 3QMQA 2GW8A 1S0NA 4ECVA 3Q8SB 5A6WA 5A0YB 1WUUA 1Q81T 1TKZA 1JX4A 1MROB 4KO0A 2KZMA 1M0SA 1MG7A 1XBWA 4ICLB 2FDNA 1Z2ZA 1PYTA 4NMLA 1QUPA 3IBWA 1RT7A 3EMTA 5A6PA 4QWCA 3CJKA 1W26A 4ECYA 3KG4A 3T19A 4LREA 2H4WB 3HVTA 5I3UB 3DKDA 4DQQA 2DR7A 2DGOA 4Z7CA 2A10A 3QFWA 4LIRA 2KRBA 2GVZA 5CAAA 2VZ9A 1OSCA 5KG0A 1WHXA 3SEOA 4DL2A 3T5KA 5KFQA 3PW2A 5HAOA 1OSDA 2WVEA 1H98A 2HK3A 4AFFA 3BGRB 1NHKL 3FRYA 3AA9A 3EE3A 2VBZA 2XTJP 2DR9A 3UN2A 3GPAA 4PEOA 4PG6A 4DR3J 4ZVFA 1RWUA 2DXFA 1FRIA 3CCZA 2RKIB 5RUBA 2LEBA 2XZDB 5KG2A 3VTIA 4WFXA 4CM2A 3F73A 1T03A 3PO4A 2NUUG 2HS4A 3LUYA 2DK2A 3C8YA 1NKCA 1JNZB 2VFRA 3VF0B 2M52A 3FBCA 1U2CA 2EK1A 3X3UA 3SCKE 4DR7F 3JAMU 3KLIA 2U1AA 5F8JA 3JAMY 2HHPA 3W9JA 1WC1A 3T9ZA 1OY8A 2DISA 4FVCA 1GAOA 4FBUA 1ZOTA 1QE1B 3H20A 1FKOA 2QZ8A 2QLFB 3TRGA 4B3RJ 2MJUA 1N48A 2ZVSA 3HFVA 1X9SA 4Q45A 2LP4A 3RRKA 2LXUA 2N4DA 4Y65A 3BJYA 2YWGA 5B0GA 4X4SA 4USVA 4C9DA 3PCOB 1U1LA 2CZ9A 3DXSX 3QNWB 1FDAA 3U1NA 3K8WA 4MYUA 1EZZB 3MMBA 3ET6B 1FK9B 1BUXA 4N5SA 3OSNA 3SXLA 1W25A 2W4CA 1LW0B 1CSJA 3OQ2A 4ENOA 2W25A 3MTKA 2X51A 3PJXA 2PMWA 1S1UB 2VC0A 1M5SA 1FRLA 3DLGB 4LF9F 2P6TA 3BV8A 3TA2A 5HVGA 2J6TA 2BKOA 2AMCB 1YI2S 2CWKA 1QVGR 5T7LB 5KFPA 1S6OA 1C1CA 1UVLA 2E1MC 3Q8YA 2BJDA 1L3UA 5LMUF 2MKYA 4N77A 4Y28C 3SSSA 2VA2A 5GAEI 4EBEA 2GAGC 1IBLF 3W2VA 4DQPA 5DM7Q 4DR4J 2OFGX 2B3TB 2MXYA 3MM8A 3NGSA 2VQEF 2E5LF 4DX6A 2EBEA 1GH8A 1AB8A 3KNAA 2N7CA 3FDSA 3S7RA 2NR0A 1H72C 1O5JA 1RISA 2NZ4A 3K5OA 5ETPA 4TY8A 1RJJA 5D78A 4OYPA 1I3OB 1F3VA 4S0MA 3A8JA 3JSYA 4J9NA 2DR8A 2KN4A 5KT2A 2XBPA 3M8ZA 2D1CA 1DARA 1HMVA 5KG4A 3IRXA 4XK8C 4ZLJA 1KQSR 2JEJA 2V94A 4NLVA 4OYMA 2VBYA 3PX4A 4H54A 3RAMA 2DRBA 4M5LA 4CO4A 4JYAF 5IC4B 3V4IB 3DLKB 1U6ZA 2HK2A 2RQMA 4DR5J 3CCES 2QTWA 1U1QA 2Z56B 5E33A 3PIOQ 4LQ9A 3QSYB 2C22A 3W8PA 4R0JA 3A13A 3UPFA 3D0IE 3PW5A 3QGHA 4UUWA 3JSMB 4JI3F 3NAHA 4K8RA 2ZH6A 3LP2A 4ZCIA 3E51A 4ZN1A 2OAUA 4P2MA 5F3TA 1NJWA 5KFZA 4AT1B 1NB7A 3NRBA 2XWYA 1VQ5S 3NS6A 3QJLA 1RU2A 3UNYA 4CLUA 3D9BA 3MM6A 4X4OA 2YWHA 4ZJQA 2KYXA 1EARA 1U1RA 4ZHRA 1KSPA 5J1EB 3EZUA 1NK6A 2B5JA 4JV5F 2XY5A 3M32B 1UW4A 1FJGJ 4N56A 2ZKTA 2YKNA 4Y0FA 3OFFA 2MYFA 4K4TA 3DN9A 3MDFA 1VRTB 3ISNC 2N4CA 2JLEA 2KJVA 5LT5A 3IS9B 4DL4A 2XMVA 3D7SB 1U45A 5DRKA 3KLFA 1XC9A 2PE8A 4YY3J 4FS1A 4WCEQ 4K4SA 4ERDA 5CQGA 1ZZFA 2NPIA 1FTCA 4JI0F 5DZ7A 3LP0A 2L9WA 1GQEA 4HDGA 3G8QA 1NEEA 1RAAB 4AE5A 1JXLA 1X5SA 3MR3A 1VBXA 3UN3A 3M7VA 2QX0A 3GIJA 1KHVA 1RT2B 3MMAB 3SCLE 4DWIA 2E44A 1VMBA 1TQLA 4OHZA 5KFTA 2CQPA 2D7SA 1CS4A 4Q2MA 1VBZA 4USWA 4NYOA 2F8MA 1V3SA 4ZVHA 5F8IA 4CLKA 1GXLA 4W4MA 4DLEA 4FS2A 1JJCB 2ATCB 3SZ2A 2XMWA 2W1BA 4HH1A 2QFJA 3I31A 4DR7J 1MU2A 1X9MA 4YUDA 5AXKA 2ZOGA 4TQRA 3MEEB 4A8SA 3JYTB 1SVDA 4USUA 3V6DB 2Q43A 3MM5B 3MECB 3AFGA 2DB1A 1SKUB 2KT3A 3BB5A 3MR2A 2EC0A 1N54B 3KUEA 1PILA 4DU7A 2Q79A 3DNCA 1U2FA 4CIOA 5EDWA 2MKCA 1QDUB 4WJBA 4X84A 3NCPA 1SC3B 3HF5A 3DYAA 2VBWA 5B0BA 1FVSA 1VISA 2ZNZA 1IJEB 2HQFA 4NLQA 2MGZB 4EEYA 3JQJA 1BGXT 1RWWB 2JEGA 4DV4F 4DUZF 4WXWA 4DV0J 1XN9A 1UFKA 3MCMA 4NCBA 1HNIA 2DEIA 5GMEA 1I51B 2DEJA 1RT4A 3QLHB 5G4DA 1WC3A 3C16B 2RB7A 1VC5A 3OBIA 3UD5A 4A48A 3H0PA 4IFYA 4RUCA 2RAQA 1NJYA 4DCPB 3M8QB 4UY8T 2D3OR 4I6AA 4A8QA 4H4KA 2ZOFA 1VQMS 4RUAA 1B3TA 3KG1A 2IRXA 1SKWA 5LMUJ 2V8VA 3HULA 4RW8A 1P8GA 3GV5B 5GAGU 1TZ0A 1JMTA 1RT6B 4NCAA 2PFDA 3IM8A 2BACA 5SUHA 3FEZA 4C7QA 1FKPB 1T02A 3BZQA 2CPHA 4QWDA 3PHEA 1YIJS 2E5LJ 2HQGA 4MIBA 3G6YA 4KTQA 4ZPCA 4RBVA 1ITPA 1S9GA 1KFSA 4GKJJ 4Q44A 4DX7A 3M2UA 1L3TA 2V9KA 1LKZA 2AJ4A 1KVIA 1F9FA 3W8GA 4Y34A 2DNNA 4NZ6A 4JI8F 3W1YC 1QAIA 1ULRA 3TNVA 4DPUA 2KO1A 4J7CA 3PRDA 4ED2A 1NH8A 5IXUA 3QT5A 3CCJS 1RTHB 2DIVA 3IN5A 3KLEB 1B0PA 4QR0A 5EWEA 1GFWB 1NLKL 4Y3CA 2KDOA 2M88A 2CXEA 1UW9A 2W8KA 4LFCJ 1ZAVA 1IKVA 1O51A 1L3KA 4LMZA 2K3IA 4CDIA 2BVZA 4C11A 4K7QA 2PMHA 4CP5A 2JL9A 4YHHJ 3OL9A 2R3VA 5DG8A 3QQCD 3UO0A 3UVJB 5K8OA 3DM2A 1IKXB 1FXLA 3HHDA 3QWUA 2EG2A 4X62J 2V4JA 1L3VA 3BO2A 4MKAA 1I94F 1NDKA 1KEKA 3ETOA 1KTVA 2VL1A 3W9HA 3FRZA 3W62A 1WG1A 3EDRB 3DI6B 1KRPA 1F3FA 4IOAQ 1RTZA 1VQNS 4OYZA 1MMDA 2HGLA 1FA0A 4OL8A 2HHHF 3RW7A 3H5SA 3EWGA 2OO4A 4CT9A 2WCXA 2XMUA 1FNOA 3CVKA 4HKQA 1VJWA 2GMHA 4Y2AA 2CQDA 1VQ9S 3ISND 3KK2B 3CTRA 4OYXA 2O66A 4HHUA 2BUNA 2FJXA 1XWLA 1ZA2B 1C0UB 1RYRA 4GVBA 1C1BB 1SJRA 1EIYB 3NWRA 5K5MA 1RTDA 3KKFA 1Q0NA 3EZOA 2IDLA 2BZ2A 2XSJB 4F4ZA 3ZZUA 2XO7A 2HURA 1IR1A 3P96A 4JI6F 1CULB 2AX1A 4B17A 1QJHA 3WQPA 1X4GA 3CB4A 4JUZA 3JSBA 4KY3A 2UUBF 5C2GA 3OT9A 1UPMB 1SXLA 1RWOB 5L9XA 4IRDA 3GTYX 4O3QA 2YY3A 3CCSS 3M8WA 5KFXA 2MB0B 5G0RB 4MFBB 4NLYA 2LDYA 4TQSA 1F9EB 3OTOJ 2HLTA 1V3ZA 3VQSA 4NLXA 2V8GA 1AROP 5ETMA 2V6AA 3KUGA 1BLUA 3ZZPA 2F4FA 2IM3A 1M5PC 2B7CB 1NXIA 3R1HA 4U7CA 2E1AA 2UUAJ 2LQJA 3N0VA 2H5JB 1KONA 1G7CB 2HS3A 4V19X 3PNIA 3KLHA 4MK7A 4MK8A 2BABA 3QGPA 5JJBA 3MPUB 3TVKA 2HBQB 3BBBA 3TUJC 1RBAA 2G1DA 1NPRA 1BQNA 2GGPB 2ZDOA 4XPEA 4MAKA 2MJNA 2XMKA 4P2SA 3GR0A 1BE4A 3WIUA 3M9OB 2XGQA 5C24B 1UL3A 2QG9B 4OZLA 3M6UA 1SQGA 3V81B 4CRJA 3TEGA 3Q23A 2ZWPA 1FE0A 1D0EA 3KJQB 2JEFA 4DS5A 1AT1B 4PQUB 2QJ3A 4NA2A 4N47A 1T9WA 3DCAA 5J2MB 2QT7A 3TEHB 2J6SA 2DRDA 1WDTA 2A1BA 1CJTA 4IG0A 5I3QA 1X0FA 1LK7A 3OR2A 3OD2A 2QSFA 2BE7D 1A6LA 3PRBA 1YTYA 4UOHA 1WI6A 1AUSL 3JTOA 1MWZA 2UU9F 2ALZA 2UP1A 2M5YA 3R1LA 1WF2A 3AXKA 2FJWA 2QA2A 1M5OC 4DSFA 1NZ8A 3W66A 4NXMJ 4DSLA 4BHQA 2BYCA 2ZC4A 2E7WA 2VKRA 2DNYA 2IM0A 3A3PB 5KFMA 1NRKA 3CMAS 2HVIA 4DUYF 3MEDB 2UVRA 2UV8G 3EPGA 1SC1B 3QIPA 1N6QB 5CYJA 3M9NB 4OX6A 1UWAA 1MWYA 5HMWA 2FVSA 2ALYB 1IBMJ 5KFUA 3CIZA 1FRMA 1P27B 2J5AA 1RB0A 2XGPA 1JLGB 3GYXB 1FFSB 3TAMB 1JQGA 2CVIA 4NEYA 1EP4B 3CT9A 1SV5A 3UE2A 3SFUA 1WEXA 2CG4A 3NXZA 1F9HA 3GG1A 5KOWA 3JQKA 2GCFA 3MPDA 2BANB 4RNMA 1A9NB 3HX9A 3RBXA 3M1VA 1EKSA 3JTPA 4F04B 1JWWA 4CLFA 3N9UC 2P6SA 4ZPVR 3OFHA 4DFJA 4CLWA 5LOQA 1KN6A 1DQ9A 4ZLLA 2L3MA 4ZVOB 1YKWA 3PYFA 5C2CA 2M4MA 4FYDA 3VAIA 3HZGA 1LQ9A 3OR1B 3CJTA 2GHPA 4E8UA 1DTTA 2OTLS 3BBFA 3CNQP 1WC0A 3WZ0A 1Q7LB 1V3RA 3NY0A 2GO9A 2HMIB 3MCSA 2I38A 2IAJA 1FT8A 3EGVA 3KHHA 2UXBJ 3KLGA 1HHSA 2P9EA 4LF5J 4P71A 4RX6A 1HD1A 2HHHJ 2VG7B 4Q7AA 3IC1A 2BM0A 2VDHA 3ENVA 4G1QB 4OHVA 1N33F 2QRRA 3N4WA 5B7WA 2CJQA 1XQIA 1S76D 3SDEA 1IKYB 4O3OA 2C28A 2G4BA 3C6TB 3PV8A 3E01A 1VQKS 4ER8A 1GEHA 2FLOA 2D3ZA 3GONA 3HT0A 1ZETA 4L75A 2J0WA 4DV1F 3OSPA 3US5A 1N56A 3G8TA 2Q1LA 1G6BA 2FY8A 3KJFB 2EK6A 4X4RA 2HHSA 1JLEA 1JJ4A 3ELHA 5HI7A 3N6NA 2QMXA 2K7KA 4RW9B 2R7UA 2DO0A 2Y0SD 3T1YF 2V2KA 2MQQA 4DSIA 3EXYA 2YXLA 1CC8A 2B9EA 3QWPA 3C15A 3ZFVA 3KK1A 4RNOA 4ETXA 4K4UA 1R6VA 4IYQA 3CXCR 2ASDA 1FRHA 3TO8A 3CCLS 1DY3A 3CCRS 1YVFA 4RW7B 2DPIA 2CZVC 4QBUA 2OP5A 2ZBCA 2JVRA 2ROEA 4QZVB 3PW0A 5C25A 4LF4J 3RU0A 2HHUA 3CPWR 1FD8A 4N41A 3MM9A 2NXJA 3MURP 1E6VA 3AT1B 4ZPAA 2FB0A 3PKMA 1NSKL 2QL5B 2MZ1A 3BF4A 4AL7A 2R2UA 1NBEB 3LAMA 2EFNA 5H9FJ 2DVIA 1S6PA 1HPZB 1XK8A 3THTA 1S6UA 3PRVA 1VOMA 2M8DB 2Q6CA 1EQ0A 4BWMA 4K50A 2DNQA 5C42A 2HSEB 2AZ1A 3SQGB 3FUYA 1UFWA 2NUHA 4OZ1A 3BQ1A 3EVOA 2IMOA 1S1XB 1S57A 4BBYA 5KG6A 3NP5A 4PXCA 5ETSA 2VPWB 2BE2B 2LQ9A 1RCXB 4J5OA 4A8WA 2HGMA 3AJ2A 2AJQA 5F8GA 4KHRA 2XC9A 4IH6A 1FKAF 2HNDB 2EI5A 4L3KA 2NPFA 4AL5A 3DLEA 3OV7A 4EMDA 3CDEA 4P10A 2DR5A 1RKJA 1IBKF 1QSYA 2DHXA 5JXSA 5L1LA 4B3TF 5BYRA 1HQUA 3B82A 3EX7B 3RRHA 2XMJA 3GZ7A 3K5PA 3PJWA 4NA3A 4ZIVA 1H3DA 4HI1A 3CWJA 3H5UA 4YB1P 3LQVA 3CJ0A 3AD9C 3UD3P 4ETZA 1ZS6A 3GJQB 2W9BB 4BS2A 1B70B 2DYAA 3D6MB 4WKYA 4WTYA 3H4DA 4ECQA 2I5JB 4PPZA 2ZH9A 5F0WA 2NSCA 3W2WB 2HHXA 3KG0A 5D15A 1UWBA 5D3GA 1RT3B 5JVHQ 1X31C 3AJ1A 1X60A 4CTAB 4IFVA 2MZTA 4P2XA 2HHTA 3NAIA 1N5QA 2VICA 4WU2A 1Z4UA 1ZH5A 2UXDF 3UDVA 1T8EA 3H98A 2FLNA 3T1HF 1V9OA 1RHMB 1WORA 4O0IA 3TYTA 4DR2J 3I6PA 3HCXA 1IWGA 3MCNA 2YKMA 4FXDA 5KFNA 2GFFA 4Q0BB 1HIYA 4C3LA 7FDRA 5A8KA 2A2CA 2G9OA 2P9CA 3GIMA 3T5LA 2IIHA 4O4GB 1K0TA 1O8BA 5CD4A 2HHVA 3DDIA 3C3LA 3SV3A 5KFLA 4K0KF 2QIFA 2D3O1 1IWAA 3GU0A 3P5TL 2FZKB 2BKNA 1HNZF 4TLRA 1N5SA 2MQPA 4U7UD 2XHWA 1LOUA 1HW9A 4L73A 1U1OA 6FD1A 5KFOA 3HSZA 1VLOA 3HKWA 4JI7F 3IG1A 3TUPA 3E8OA 3GYNA 1KLMB 2J0QD 4E0DA 2MPUA 4JI4J 3MMCA 3I0SB 4Y2CA 1X7VA 3RUBL 3I56S 1BXNA 2YBVA 4IH7A 3M8PA 1UA1A 3LP1B 3KJVB 1EETA 5AE2A 1KKHA 2FPHX 4U8VA 3H4BA 1A7GE 1Y5IB 2KFYA 2HIYA 4B08A 2F5GA 1CQNA 2FHJA 2DKOB 2Z8QA 1AYEA 1PYOB 3G4SS 3NOCA 3CC4S 2ZBRA 3RAQA 8ATCB 1RT5A 1K8AT 1Q8LA 3HKZD 3J80Y 3PM9A 1QTNB 4P6QA 2AGPA 3DGVA 3MAAB 2CJKA 1UMJA 2FGCA 4ILLA 1J27A 3ZTRA 4USJC 1L5UA 3M9MB 4KGZB 1YG0A 2UZAA 2W4DA 4AUKA 2CDQA 2Y8YA 2WZ1A 2NXEA 1PO6A 4NI2B 4M94A 5T41A 2ZH3A 3V6JA 3M8RA 2PDAA 2IC3A 4F26A 2J7UA 5L1JA 2FHJD 4I68A 2ZZMA 3B6BA 2X1BA 5D0HA 1F2HA 2ZJRQ 3TARA 5KTQA 2IYIA 2LXFA 3IWXA 1U0HA 3M30A 4FVMA 2B6AA 4CO1A 4NPOA 2VOPA 4OFZA 2J0XA 4UW2A 2N7YA 4P9SA 1HHTP 4AXIA 4Q5VA 1NK5A 2HZCA 3DOLA 1WG5A 2CPZA 2ZVIA 3OVBA 1Y5LB 2DHHA 3RGIA 1TR0A 3FQKA 4J9MA 2V5HG 1N0UA 3TZWA 4C2MA 3GJTB 4J91A 2GQ2A 1S4FA 2UXCF 4JI1J 5EHHA 1R8PA 5I4MA 1D9FA 3A8EA 1WJ9A 2I2YA 4QJVA 3ZNJ1 2DCUB 4C8OA 1HR0F 3DLHA 3OHAA 1T9YA 2C1EB 1H7WA 3GJSB 1KP6A 4TVAB 3WDOA 4IH5A 4BDPA 4I0WA 3MUMP 1OMSA 5IS2A 2MKSA 3CMQA 2DH8A 1U24A 2L41A 2J6UA 1MMLA 3UI3A 2DO4A 2NXUA 4U6PA 5THWA 1S1VA 4O3RA 2GJIA 1O0PA 4DL7A 2OHDA 5E2QA 4I6YA 4ITSA 2Y9HA 4B3TJ 4J37A 2W2MP 2F65A 4WYWA 5IQQA 2W9CB 3HVWA 5IM0A 4ED0A 5HP1B 1IKWB 2OSRA 3EYZA 4LF7F 1VHIA 1PG5B 3RRGA 4P7TA 1R31A 1RP5A 4Q43A 1S9EA 3GFZA 1KNZA 3Q2SC 4IDKB 5KAKA 1E6YA 3PR4A 2R8GA 3TOQA 3MI7X 4PYDA 2EEYA 1R8AA 5HMZA 1N34J 3G6ES 4GC6A 3BYPA 3WC2A 4CI0B 2X1GA 4UZCA 4DLGA 3R7BB 3RBDA 3AB2B 1DTQB 1T7PA 5IT4A 2DGWA 3DHXA 2WSCC 2HPUA 3IAS9 2CNOB 2UXDJ 4C8YA 4TNOA 3TAPA 1OY9A 4ES2A 3DOKA 2OPRB 3DGPB 1SIZA 5I42A 4EYIB 1VFJA 3OPKA 1HFEL 1J5OA 2Z2LA 2R9LA 5AE3A 2EWHA 3QO9B 4M63A 3G82B 1OY6A 3PZPA 4B9VA 1N88A 4Y00A 1TK8A 4KKOA 4M8LA 2IVMA 3RR7A 1JKHB 4ED1A 5CYQB 5F8MA 2M3DA 4AXJA 3TX0A 1HBUA 5FD1A 3NNHA 2HAFA 5EX0A 1TKDA 2MHEA 1CJVB 5IZHA 1C2PA 4WXOA 3Q86A 1HNZJ 1TL1A 2ROPA 1S10A 2FJBB 1K47A 1T9UA 4FXWA 2CQGA 1QTMA 1KDNA 1S49A 1UAWA 2NQPA 4KJIA 1XMOJ 4OLOA 1UETA 7FD1A 2OUGA 3HJVA 1NB2A 4LBHA 1DZ5A 2KT5A 4ECTA 2HFOA 5K14B 1NUEA 5A0YA 1DLOB 2AGQA 2OPPB 1MROA 2J8SA 4YQWA 3Q8RB 4ICLA 5IV4A 3ZTQA 4MH8A 4J90A 2MMYA 5BR8F 3FKBA 1U4BA 5I3UA 5B0DA 5A76A 1MLAA 5ETOA 2AD9A 2E29A 2MKJA 1C4AA 2KG1A 5CABA 1WKLA 1JK9B 5E7OB 2OEKA 2FHKA 4H4MB 2OIHA 4MIWA 4C8LA 3OL6A 4HYKA 3OTCA 4B3OB 4JI2F 4ZCKA 3B8HA 2HYIB 3PR5B 1CQMA 4HHHA 4DUTA 3ZZ0A 2EKYA 2NREA 3FBFA 1HI8A 3BGRA 2Y3YA 4U67Q 2BX6A 1BQXA 1VI7A 1AZSB 4OZ5A 1TL4A 3CO9A 2QMWA 3JS9A 4NOHA 2ASJA 4J9SA 4WZQA 2BJ3A 2HVDA 2RKIA 4ILRA 1LWXA 4DR6J 3FCHA 3O1LA 2JEIA 1HNXJ 3RB6A 3RG6A 2RU3A 4X4UA 2F4VF 1RQ0A 5D8HB 4ZN3A 1D9DA 1TELA 2XMAA 3AH6A 3EJMA 1RAEB 2SXLA 1FCAA 1R89A 5ITHA 2CJBA 4DX5A 2XLJA 1VJQA 2H5IB 5A8WB 2HRYA 4WFNQ 1VDHA 1HARA 4WIIA 3BBCA 4ZS6A 3FZ2A 4M1KA 1QE1A 8AT1B 2YH1A 1FDBA 2UVWA 5ETNA 1H73A 5A2QU 1NHUA 2WVDA 3PKYA 3F56A 2ACMA 2KG0A 4ECRA 2CPDA 3M6XA 1WOOA 2DNOA 3M8YA 2FLPA 5IQ6A 3H2LA 5KT3A 3FJ2A 3ET6A 1CJKB 3C66A 1FK9A 1R7IA 2CRLA 3PX6A 1XR5A 4IRKA 3DDNA 2QL9B 2B9XA 4DS4A 1LW0A 1B7YB 4J9KA 1G1XA 1S1UA 1BD6A 1FESA 4PXDA 1RAJA 3H25A 4UOCA 1KC8T 3DLGA 5HLFB 3W3SA 2W2QP 4CLLA 3A8KA 2ZNYA 2AQ4A 3G87A 3K7RA 2MZJA 4RO0A 5T7LA 4Q8FA 1RWKB 4LF7J 3LANA 3O2IA 4NEZA 3GJRB 3K5MA 3FEXB 3GV8B 8RUCA 2UVVA 4CH1A 4DG1B 3Q8UA 4KPYA 1U49A 5KFFA 4IUFA 1X4DA 4QQBA 3HM9A 1UEVA 3HHLB 4P2FA 2O5DA 4ED7A 1HL6A 1QM9A 1KBRA 3C46A 2HVZA 3ENWA 2OEJA 3DDKA 1JLBB 3Q83A 2A3JA 4HT7A 5D0EA 2MQLA 4ZPDA 4PAAA 3NL0A 4NLOA 4USMA 5D4LA 5GVQA 1F0XA 2KH9A 4AQYF 2HWTA 1N5TA 5HBMB 1YZ7A 2NS1B 2MTLA 1RABB 1Q8IA 3RBEA 1X8DA 1B99A 4EO8A 1WC6A 2VV5A 4QWEA 3BO4A 5D4NA 3V4IA 3DLKA 2VHGA 3KHRA 3DHWC 2K7JA 3QT6A 3HJFA 2AIRB 1FWPA 4KGMA 3KJNB 4ATNA 3M8SA 3VAKA 2O01C 1SIWB 5E3CA 3FSYA 4J9QA 4MJKA 3UR0A 3TA1A 3JSMA 5HK4A 2LQ8A 2R7VA 3MUVP 2WVBA 1MW7A 2MHNA 1EJ7L 2BKPA 4X2BA 1NSQA 1YSJA 5A8RB 3OVSA 1RT1B 1F60B 5EGYA 4WKRA 2XCAA 2GA7A 4ECUA 5DM6Q 2LMIA 2DGVA 3NGRA 4ZOSA 3PJ9A 3QT7A 1S1WB 2C3UA 4LSLB 2K1RB 1TL3B 3D1HA 5FLXU 1WD6A 4HL9A 1YJUA 4CYUB 3P4UB 2XB2D 4NXNF 2XY7A 1XJWB 5FLXY 1N32F 2QLJB 1WSRA 3BS9A 1ZTWA 3MCOA 5BR8J 3EGWB 2FGOA 5J1EA 3OFGA 3MR5A 2FIUA 3M32A 3OJUA 1SCJB 4ECWA 4EO6A 4GKKJ 2FVRA 2CNLB 2J0SD 2XI3A 4B02A 2VASA 2KFNA 1VRTA 3O8WA 3SCJE 3IS9A 1GX6A 2V2VA 1BY9A 4ZCMA 2N82B 4R8UB 2COLA 3PYDA 3CD5A 1HQEB 3RAXA 4YOEA 1PYSB 2R8KA 1J5EF 1FRKA 5DETA 1NSAA 5GMKa 1DQ8A 1NO8A 2OLWA 1PKUA 4X65F 5KT7A 3OVAA 3I9V9 3E3XA 4DV7F 4PYAA 1FWLA 3OXFA 3R5JB 2ZUGA 2DGSA 2R42A 2C3PA 5ETVA 3M2VB 4ZP7A 1RT2A 3MMAA 3HSDA 1GT8A 1D9AA 1Q5YA 3G86A 4PWDB 4DZDA 4B9TA 1R0AB 4ZVUB 1SJQA 4ANEA 2R2SA 1S1TB 4C8ZA 1SH2A 1RTIB 1KQFB 1NJXA 1CC7A 3KK3B 4ES1A 2AP6A 3QAUA 2C3MA 3MEEA 4RNNA 3JYTA 1MWQA 1WHYA 3L9ZA 1AFJA 3V6DA 1HBMB 3PG9A 3HMJG 3MM5A 4EZ6A 2E5HA 3MECA 5AT1B 4RNHA 1UPPA 3VVTA 4KGXB 2FVPA 2EFOA 2XS7A 2PGCA 4YB5A 3R7SB 2AEMA 1U2RA 4ED3A 2VF3A 2JOQA 2QV6A 4DV3F 2RH3A 2MGZA 5EX3A 2ABYA 2RE1A 1RXOB 3T6JA 1FO1A 1TKXB 3IM9A 4ANCA 3DRYA 5KFRA 3CCQS 2AYBA 2AJ0A 4ID5B 3LGMA 2ASYA 2LEPA 2ZOMA 1KVJA 3QLHA 3C16A 4JI5J 5GADI 5EN1A 4YR3A 4I7FB 4RPFA 1HHQA 2KT2A 2KFZA 4B3MJ 1WOPA 1RI7A 4BLGA 2CAJA 1GK8A 5KFBA 3M8QA 4QIEA 4BC7A 1KOHA 3PTWA 1Q4RA 4WBFA 3D54A 4N7TA 3KHLA 4USTA 1HBNB 5IC6B 1AFIA 1RT6A 3BGFA 2GV1A 3JXOA 4CNZA 3NMRA 3W61A 1G2EA 4FYVB 1QAJA 3Q24A 2QSWA 2J9DE 1FKPA 5H9EK 4FKXA 1WKJA 1VQ7S 3DRPB 4LF8J 4X66F 4BWJA 2RF2B 1C4CA 3GLJA 3BQ2A 5M2UA 1R8HA 3HO1A 3H40A 2DITA 4WFAQ 3C19A 4R5PB 1Q1KA 1LW2B 3DRSB 3ILJA 3ISZA 4B9LA 2F63A 5CCLA 1RTHA 4HTJA 3CJ2A 3KLEA 2ZM6F 2FLLA 2ASLA 1OPZA 1FFGB 3DOMB 4OI4A 4WFZA 3S8SA 5IT0A 4ZLNA 2P8IA 1TKTB 1R8BA 4ZITA 4TU9A 5HQLA 3D68A 4F3QA 4ED5A 3V5RA 2DNHA 4QYRA 1Z2LA 2HWIA 3IRWP 5K8MA 3NGUA 3UVJA 3IAM9 3KTQA 1BQMB 2MY8A 3A3NB 4TLQA 4OI6A 4FPRA 1HNWJ 1IKXA 4A8FA 2DGQA 3KDOA 1CJUB 3NBPB 2GIRA 4EYHB 1F2GA 1RHJB 2DNKA 2FZGB 3MPWA 5LMNJ 1JXEA 1UFLA 2VDIA 3DI6A 4NRUA 4FF1A 2CJAA 5H9EJ 3UNGC 2HNYB 2XM3A 3T5JA 5DS7A 1UVJA 3D4JA 4CO5A 3HP6A 4X64J 1N36J 3IR6B 3NGTA 2E1RA 3W60A 2O1PA 2EPIA 1FI4A 2KRRA 3D2WA 3M6WA 2G0IA 2H51B 2DGTA 1L3SA 4DCJB 3O5TB 4LVOP 4URGA 2GNKA 5AXNA 3OXLA 3HVAA 2KXFA 3KK2A 3BPSP 4Y2IA 2V9WA 2YNGB 5B0FA 1KOOA 5DO2A 3BQ0A 2FVQA 2LQ5A 1N8RT 1HBOB 3DFEA 1J5EJ 1C0UA 1VQ4S 1C1BA 5GMDA 2B7BB 4FYYB 4LFAF 3V6HA 2FJVA 5L39A 4DX8H 1GTHA 3Q0AA 2XSJA 4K5SA 4U9RA 1WDDA 3CEDA 3MOZA 2B4VA 2FJDB 4DF8A 4DSKA 3SCIE 1CULA 1TL7B 3NCRA 4TY9A 4B3SF 1YGYA 1JLCB 4ED4A 4O3NA 1RACB 4YEAA 1X5PA 3T6BA 2D74B 3BSAA 3W63A 3TX8A 2O67A 4USHA 2QE5A 3NMAA 4OX9J 2XWXA 5G0RA 4MFBA 2VH7A 4K2XA 4DF4A 1T0TV 5T14A 4F8RA 1DQAA 4CCHA 1HI0P 2C2RA 3AOBA 2ZD1B 2W2PP 2YNIB 2XLIA 1D8ZA 5CXTA 2HQ3A 4PR6A 2HG4A 1WELA 3TQ1A 4CNYA 4DV5J 2VPXB 2BRKA 1K1SA 2NXNA 2PD1A 1CVJA 1WSVA 2YX7A 4PWUA 1XNRJ 1ZAXA 5B0EA 4I4BA 3D0GE 3OUYB 1EB0A 4M5DB 4OZ0A 3AD8C 4DMZA 3WX4A 4DPXA 3EGZA 2GGPA 1Q78A 4CLPA 1OJ4A 2IVFB 3LGHA 1WOSA 4FYXB 2KVQE 4ZIWA 3G6VA 5KFVA 1EX8A 2KZZA 3GR1A 4RR5A 5C24A 3J7Z5 2HFNA 2EC2A 1SQFA 2LU2A 4RZRA 2QEXS 4CO3A 2VG5B 3V81A 1NMEB 2L08A 4PWWA 3ZTSA 4N76A 3FK4A 1VQOS 4MTPA 2P2CB 1X4AA 5IOLA 4IO1A 3CD6S 3D66A 4PQUA 3QGGA 3FC9A 2VG6B 2YNFB 3C14B 3DMJB 1JLFB 4FN5A 2RHSB 5J2MA 1S6QB 3ITHB 3BSNA 1SKRA 4ILMA 2DHSA 2YX1A 1W2BR 2E9TA 4KB7A 3MFHA 4ZVRB 4LF2A 3LWMA 3R5GA 3B4DA 2AWZA 4OYWA 1GMVA 2BJEA 2AV5A 3KHGA 3C6UB 3OL8A 2E7VA 1FE4A 2WOMB 1WEZA 2WVCA 2H9ZA 3DRRB 5JUMA 5J2QB 3P8BB 5KT6A 2G0CA 1KFDA 3MM7B 4LUBA 1TUGB 1BWEA 4KGKA 2QA4S 2YNHB 2KM8C 5L38A 2Q66A 1YRTA 4X66J 4C97A 3J7YU 3MEDA 1XERA 1QAYA 5DQGA 2G0JA 2RQCA 1S7HA 1S97A 1EAYC 1YRXA 1TVRB 3R8YA 2BDPA 1N6QA 1N0VC 3O6QA 1IUJA 5B08A 1U1MA 5HSPA 5LJ3Y 3G71S 4X4NA 1S7IA 2E5GA 2E9RX 3HVRA 3ETMA 4O0NA 4I2QB 5LSRA 3GFXA 5HROB 1JLGA 5CYMB 3FQLA 1KD1T 3K5LA 3TAMA 2ZM6J 4LRAA 3UQSA 2GMJA 1KQGB 1EP4A 2IRYA 3FFIB 4DV2F 2F3JA 2IVYA 4QOTA 4JBCA 4NLUA 3L4BC 3GIKA 2BANA 4Y2MA 2FZCB 4LBPA 5CCMA 2DGXA 1HNVB 1RAIB 2FC9A 4C6AA 1NH7A 1XNQF 2V34A 1V6HA 2DNRA 1N5YB 2ZFHA 3OR1A 3TUZC 3KOAA 5BXIA 2G2YA 4KV8B 4K2JA 2K2PA 1R27B 4O44B 3MD3A 3OTEA 2FD2A 2HMIA 2WHOA 1RHKB 4KHPF 1B7FA 2ZH7A 4KHMA 2OKQA 3QSIA 4F2RA 4RW4B 2V4RA 5E3PA 2W7AA 3IA0A 1Y10A 3N5FA 5K8NA 2VG7A 2BR0A 4F4XA 5HQMA 2YKPA 4DV6F 5ETQA 4LF9J 3D6FB 1FEEA 1CG2A 3CJ8A 1YLXA 3IO1A 2CQ3A 4ELVA 4G1QA 2GQCA 3VAMA 1M5VC 1UEKA 3HFKA 1GXUA 2M0GB 3IR7B 2BQ3A 2RRAA 4JV2A 1RA6A 4YR2A 1IKYA 4HHJA 3C6TA 4IQMA 3BKTA 3BKFA 3EXCX 1VC0A 3EVWA 1FNMA 1WC4A 3HI9A 1S72S 1IBLJ 1TFYA 3GV7B 2F40A 4NMXA 2POKA 4DPOA 3QRRA 1YBUA 4ZVPB 4RW9A 3IWNC 2DBBA 2CUYA 2VQEJ 4OLPA 1ZPWX 1U6BA 5KFCA 3KLVA 4B3SJ 3DLJA 1JLAB 2VPYB 2IPOB 5D6GA 4CH0S 3W5ZA 1NNDA 3VAGA 3AA8A 4RW7A 4M5HA 3CCWA 6FDRA 4TXSA 3PACA 4C48A 1VC6A 4DPYA 3NGKA 1YBTA 4DR3F 1RYSA 4ECZA 2UVUA 2K8GA 3GB0A 3WHIA 1RUSA 4JYAJ 4YP3A 1ZTTA 5LL6d 1TU0B 4QIGA 2RILA 2LVWA 1B0VA 2YWWA 4KSEB 5LSLA 5JMNA 1X4EA 2NZCA 1T9XA 1RADB 3CJQA 4ZMMA 1SH3A 3GFHA 4I2PB 1HPZA 1TUWA 2PEBA 1RWVB 3CDUA 3L09A 1FFWB 4WFYA 4JI3J 2J7WA 2VFSA 4NLWA 1SI9A 3F0NA 3BGUA 1SJ4P 4M5GA 3SQGA 4LF1A 2IYGA 4OZNA 4ZJOA 7AT1B 1JB0C 2D9OA 1ZM3A 2FHOB 2AJ1A 4B3RF 2M2BA 1S1XA 4KGVB 2QO3A 2HS0A 4XPCA 4IG3B 2VFVA 2BE2A 4NZ7A 4AL6A 2ATLA 2Y1IA 2EW9A 1I1GA 2XEXA 4U8YA 5E3RA 2HNDA 2BMBA 3SBMA 4UOFA 4DL6A 1YJNS 1UKUA 1QLNA 3HHNB 1VQ6S 2QYCA 4HACB 1B4SA 4UTGA 2MQOA 4JV5J 2L48A 2CQ4A 1URNA 1KQKA 3ENQA 3TAQA 4IR1A 3A12A 1NK8A 5CA5A 2OPQB 3QYYA 3TJAA 2ZE2B 4LRFA 2N3OA 3VAHA 2W9BA 4ED8A 4OZJA 2WW4A 4JI0J 2OELA 4DSEA 4XAKA 2I5JA 2B8QA 1FRJA 5L1IA 1TMMA 2BJ1A 3W2WA 4QCLA 2X1FA 2Z30B 2XNRA 1RT3A 3KMSA 2RDIA 3NKYA 4CTAA 2XZTB 5KFJA 2HKEA 3THVA 2HBRB 2CKWA 4D3GA 4HT5A 4L3NA 1GTEA 3NNAA 3ZTPA 2JH3A 2ILYA 1UP1A 4O3SA 2C3OA 3EVMA 3V6KA 2QC3A 3UN5A 2R7XA 1NM2A 4Q0BA 1YQHA 2ZHAA 4USKA 3CC7S 2FTRA 2GX8A 4H4OB 4OYBA 4O4GA 3MD1A 3QATA 5I3PA 4WE1B 3S6EA 5DDQC 1FHTA 3ULHA 3CD7A 3HDSA 4LSNB 3FBBA 5M2PA 1Q79A 4YDDB 2VFTA 2CA9A 2X7IA 4PUOB 4NA1A 2CG8A 3LTOA 1REVB 2MQ8A 1FDDA 5B0CA 1HWKA 3NS7B 4ZLPA 1C0TB 2QLWA 1KLMA 4J9VA 1OYDA 4M5KA 3I0SA 2ZWOA 3L7UA 4WP8A 3GSDA 4ANDA 1DRZA 4DV4J 4DUZJ 1F5CA 1QD1A 2E7XA 2AHOB 3LP1A 3KJVA 4Y6IA 4F4WA 4F2SA 2KI2A 1SJ3P 4CO0A 2RSQA 2P9GA 2HHQA 1SJFA 1OO0B 2XYGB 2RD5C 1U09A 2A2DA 1XR7A 4HI2A 1Y3JA 1N4LA 4QIVA 3K89A 5KFHA 1S9FA 1YJ9S 3FMWA 4ZK7M 5H1SV 1FX2A 1P9QC 1U6FA 2PA8D 3DU5A 3T1AA 2ZITA 1MN7A 1FJGF 1NK9A 4QR1A 3MAAA 1Y0HA 2V0NA 2YVSA 2RJZA 2HVHA 2ZH8A 3MWBA 2B4PA 4FBTA 2C42A 3B54A 1RAGB 3U1MA 4F7VA 1U7LA 2IM2A 1U1PA 3T5HA 2N3LA 4YY3F 2OD6A 3KFWX 3I96A 4UY85 4NI2A 4OZ2A 3KWMA 1LWEB 5KG3A 3QJPA 4NCGB 1M1HA 4O4RA 1CLFA 2E1CA 2CYYA 1HW8A 4FZVA 1UVIA 4JI8J 2VKZG 4L72B 3I5CA 5CHCB 1AA1B 4L74A 3H90A 1JJHA 3D1QA 4RL1A 2AKWB 5HATA 1T05B 4MK9A 3PO5A 2Z2ZA 3UWTA 3U27A 2XMMA 4LRDA 2WONB 3NGDA 1XMQF 4LR7A 3ENAA 1RSCA 1HYSB 3K58A 1H2TZ 2BW2A 2HFVA 4LF6F 3UR3C 1Y00A 4FXVA 4V1Ak 4WYLA 2CQ0A 3EM1A 3G6XA 3BDEA 2JNJA 5J2NB 3ICLA 1I94J 1G3OA 4R25A 1WACA 4OMFG 1HWUA 3ZNUA 2JZ5A 4GO7X 4LQ3A 1W7WA 4G1IA 2B56A 3RBZA 1TUVA 2CPEA 2LLZA 2H54B 1FERA 1R6YA 2KL8A 1T3NA 3AOAA 3K0JA 4LSZB 3JQMA 5C7PA 4OQJA 2OPSB 5KFDA 4DXLA 2HAIA 4DFMA 5FIIA 1YX2A 3I82A 4DV0F 2ZDPA 3GQCA 2YH0A 1ICEB 3QZ7A 2W9CA 3LOUA 5GAEU 5HP1A 2A6MA 1IKWA 3TQEA 4OX7A 2XZWA 3HSGA 1RU1A 2VA3A 4V19J 4TKTA 4WK1A 4ES3A 3PEHA 1FTRA 3QT8A 1NKEA 4IDKA 3VQTA 2LXIA 2PO4A 3TR5A 3POTB 4L76A 1LK5A 1MN9A 5HVHA 2AEFA 3CD0A 4K5RA 2VC1A 3R9LA 4QR2A 2CJXB 1N5VA 4JI6J 2W8LA 1WHVA 1DTQA 2IJFA 2EFVA 2UUBJ 4RBUA 3BM7A 2DH7A 2AX0A 5LXRA 2B8PA 1H0HB 2PI5A 4RW6B 1X0PA 2B43A 1Q95G 4G1PA 4O23A 4DCOB 2HQCA 2OPRA 3DGPA 1VGYA 3GP9A 4GKJF 1R3NA 4M5JA 2BJ7A 3MR6A 1PSDA 3WIVA 1UZHA 5KFSA 4C0BA 1OQ3A 3FVYA 3SYZA 2CWXA 3QO9A 3G82A 2WSFC 1GX5A 2LKZA 4KC5A 1VRUB 4C3KA 1JKHA 3MUTP 5CYQA 1MNEA 4OZ3A 4H4KC 2PT0A 2WK4A 4CM0A 4P72A 3MEGB 4NYPA 2GVDB 4DN0A 1I6JA 1RTJB 3HHLC 1CJVA 2J7KA 1M1KT 4IO9Q 2A6OA 2XULA 4WU3A 1J2VA 4P7VA 2D69A 4LFCF 1JLQB 2M70A 1R0BG 2YPYA 4R0EA 2CPYA 4A8MP 3OJSA 4ZCLA 3NWGA 1S48A 3FCVA 4YHHF 1PAEX 3M4XA 1OPIA 1SH0A 4ELTA 4OJGA 2XHCA 2ZH1A 2NCKL 3LH2S 5HJXA 5K14A 1YJTA 4IR9A 4X62F 4C8KA 4QU7A 1F6TA 1S12A 2HNZB 3Q8QB 1DLOA 2OPPA 2KM8B 1PAUB 1PC4A 2QLXA 5IWAF 2KKHA 2Q6BA 1RWXB 3TA0A 3IXQA 2Z57B 2NLWA 4QU6A 1P1TA 4BCAA 4ZP8A 1ACMB 3SFGA 3TW0A 3WX8A 3KYLA 3UCZP 5L8RC 1REGX 4U7UK 3ADAC 4EWTA 1LWCB 3QFHA 4Z7YA 4H4MA 2FJEB 1PJ6A 4F0KA 2BRLA 2UU9J 2Z2YB 4B3OA 1PGZA 2VIHA 4FF3A 4ZVSB 5EWFA 2NSBA 3U7JA 3GYGA 4N8NA 2H5EA 6AT1B 2FQQB 3F44A 2FY1A 2JFDA 4KFBB 3VWSA 2YTCA 1DFDA 4X4QA 2KHDA 1AZSA 4ZDNA 3R3TA 2BV3A 4DUYJ 1X4CA 5E3AA 1SUQB 3W64A 1OYEA 2Y1LB 1ZM2A 3KXDA 1FVQA 2YX4A 3D6TB 2YKQA 2CNNB 2LDIA 2OTJS 3K59A 3VALA 3N6LA 4RWWA 5KFGA 3Q89A 3BR9A 4QWAA 3TJ9A 2AW0A 3I55S 3WBZA 2RS2A 3LA0A 2VUGA 2LYVA 3BYRA 1ZA1B 3VZHA 3OLBA 1VCTA 4YDXA 2RQKA 1LWFB 1HA1A 2QA4G 2MSSA 4DQRA 2ZBPA 1NZAA 5A8WA 2AJFE 3M2RB 2I6WA 1XMQJ 2DTJA 4QIFA 3QBCA 5HANA 3ZTOA 4C8MA 3OTOF 1TV6B 4L6V3 3J81U 4OIXA 4EU0A 4PPDA 2K3KA 2W2NP 3N01A 4LF6J 3J81Y 3H59A 4OI2A 2C2OB 5J2PB 4NE9C 3VHQA 4CLZA 5FDLB 1HKAA 1X5TA 1RGVA 2XO6A 2PFFB 3P49B 2UUAF 5AXMA 5D4PA 1QAXA 4RBTA 1LV5A 3P45B 2GHVC 3W65A 2HZVA 3H5YA 2KXNB 4UQTA 1CJKA 2RRNA 2PIIA 2B9YA 4W98A 3VAJA 3GFYA 1S4EA 3GIRA 3EICA 1WF0A 4DPWA 3H5XA 3PIPQ 3I0RB 2ZUAA 4LRCA 3FEYB 1QVFR 2VJUA 1YWXA 2L9DA 3CCTA 4DFKA 1Q5VA 5HLFA 3NNCA 2L9NA 3KNGA 3TUIC 5L9NA 1N33J 4J9LA 1RZMA 2MQMA 3LPEA 3H8YA 2HBZB 1TKZB 3KDNA 2IRUA 4IOBA 4KO0B 4WK3A 4PRFA 1HI1A 2LFVA 3J80U 3RB4A 2CNKB 1RT7B 1NDPA 3CJKB 2XYPB 4F3MA 3CDAA 1GNKA 3HVTB 3QJJA 4DG1A 4DV1J 3Q22A 3S01A 4DL5A 1U0SA 1UEUA 4EFAC 1HQ2A 2GVZB 2CFXA 3PW7A 4WPAA 3HHLA 3HPOA 4JV0A 3V4MA 2MLZA 1XTZA 1RHRB 3UDLA 3T1YJ 2MEWA 4D3HA 4Z37A 5KOXA 4WF9Q 2DHAA 4ZVGA 2B0GA 1PJ5A 4FPIA 5DGBA 3K17A 4NXMF 1JLBA 3TANA 1ZAWA 1HD0A 1WI8A 2IMWP 3N28A 2KU7A 5D0GA 3UCGA 1IQTA 3RYLA 1LFPA 3ILOA 4MMOA 2HW3A 5DDRC 3PY8A 3EUNA 2WSEC 4C0HA 3D5MA 4DBQA 3BR8A 5HBMA 2D41A 1YRUA 2VJVA 3JSRA 1T03B 1CEZA 1KS2A 1PC5A 4CQ1A 1IBMF 3T3FA 2JC1A 2ZKUA 1Q86T 1BWVA 1Q16B 1QY7A 2DXDA 1VBKA 1NK0A 4CLYA 4OHXA 1H2UX 3HHLD 2RUSA 4YS2A 3ZZYA 5BYSA 3SV4A 2IDEA 2R7TA 2PC6A 3KLIB 1H38A 1SPBP 3VGVA 1FDNA 3HXMA 3NG8A 4DQIA 4K59A 3GCWP 2NXCA 2LECA 2AF6A 3D3BJ 5A8RA 1RT1A 2CPIA 5DDOC 1FKOB 3J7AN 4B9SA 2C2MB 3K57A 4JV1A 2J76E 3BSCA 1ELOA 2GS8A 4OI0A 4DFPA 5L1KA 1OS5A 1K9MT 2YWFA 4F4KA 1S1WA 2H4YB 3DC2A 4EUVA 4LSLA 1SBRA 2K1RA 4PG7A 1TL3A 2RVJA 4M95A 3ONQA 2MLYA 2YQ0A 4CYUA 1NJZA 1NDLA 5HQ8A 1F1BB 2IY5B 4USIA 3ILLA 3MMBB 5IWAJ 4GMKA 4NLRA 1D3WA 3CULA 5KT4A 3CF5Q 4X4PA 1P9YA 4IKAA 1IBKJ 1UA0A 2UXBF 1K73T 2UV8A 4EBCA 2QFIA 1ZM9A 4F4YA 2ADCA 4CH7A 1Q8BA 1RE1B 4LF5F 4FYWB 1DAXA 1WEYA 3G96A 4J9PA 1D09B 2C2DA 1YJWS 4EZ9A 2V8DA 4R8UA 4LR8A 4OI3A 2FC8A 4J9RA 4CZCA 2ZC3A 1HQEA 2CZ4A 3FMBA 3FSXA 5JVGQ 1LNQA 4UUXA 3QRPA 3N79A 4LBIA 3ZZZA 1IQZA 1C1CB 4YFUA 2AYMA 3KUHA 3MMJA 3ZO7A 2DD8S 2B9WA 3CUNA 3W2VB 2KXHA 3RTVA 5HMYA 1DURA 3IBFB 2XS5A 3M2VA 2R7RA 3MM8B 3SMZA 4PWDA 5CD4H 4F4AA 2EFQA 4ZA1A 3T1HJ 1R0AA 4ZP9A 2PN6A 3OXGA 1VBYA 1S1TA 2XCPA 2RT3A 1RTIA 4TY8B 4LIWA 3KK3A 2O3DA 4PG8A 1VQLS 4YN3B 1HMVB 2RDJA 3D67A 3LWLA 3C2PA 3IRXB 5MLCV 1HBMA 4LF4F 2ZHBA 1RK8A 4K0KJ 4XTTA 1VR6A 1KVKA 1VK8A 1TAUA 2H3EB 1DHMA 5F8LA 2VFUA 1M90T 3HD1A 5IFMA 4A8XA 2AYGA 2V69A 2PA3A 3FBEA 1FWKA 1R43A 2G1HA 3ILIA 5KG1A 4F25A 4OJHA 4JI7J 5AE1A 2IBKA 1VIOA 1FXRA 1U47A 1BHNA 1M1GA 4DDFA 3LP2B 1S59A 1RBOB 2R8HA 1TKXA 3OTBA 3VCDA 2X3DA 4DHVA 4ID5A 3MGJA 2AGOA 4RWXA 3LF0A 1FNXH 2WTFA 2XY6A 4C0OC 4ALZA 4ECSA 4I7FA 4G6VB 3D3CJ 3MM6B 1YZ6A 2M8HA 5DLGA 2BW7A 4F50A 2J9CA 5F41A 3VGUA 4KAIA 4ZHRB 3P5BP 2F9JA 3W7BA 3R2CJ 2JSXA 4DPTA 3N5BA 1TL5A 3CJ3A 4A46A 2B5JB 4OV1A 4KYZA 1HBNA 4PQAA 1IBCB 5LSOA 2YKNB 2NYIA 2MQNA 3R97A 4DEZA 2LEAA 3R5CA 5F8HA 2V4QA 4WIQA 1VS3A 5AXLA 1NSPA 4XDDA 4C4WA 4P52A 3J7A1 3KLFB 3DRPA 2RF2A 2OFHX 4I1TA 3LP0B 4HVZA 1P1LA 1KLNA 2KJWA 4MIAA 3LPYA 2G13A 4YR0A 4R5PA 1LW2A 4CLTA 2KB2A 3DRSA 1Q7YT 2MKIA 4Z2XA 2UUTA 2GMLA 1OIAA 3OTDA 4GRSA 2UUCF 3BSOA 3NLCA 4CO2A 3HZEA 3DOMA 5HMXA 1CS4B 1IM4A 3CMES 3T9NA 1TKTA 2AT1B 4DR2F 1T94A 5C5JA 4NLTA 1PJ7A 2OSQA 3BGOP 1H74A 1RDRA 3MTJA 4A8YA 1ZZNA 3CJRA 2W7OA 4QYZK 1MU2B 4E2FB 1BQMA 2WB1D 4YB6A 1YITS 4KE5A 3K5NA 4B9UA 2UXCJ 4MT1A 1CJUA 2Z58B 3NBPA 3SSRA 1H6KX 3CC2S 2R2TA 1S99A 5D4OA 1HR0J 2LA4A 1LEOA 3NEKA 3O44A 4DQSA 3Q8PB 5DZ6A 3R5AA 2HNYA 1T95A 3DYAB 1DJ0A 3TZZA 4I67A 2W2OP 4JI4F 3RW6A 1N52B 4ZVQB 2BJ8A 3BGLA 4X4TA 4EGLA 3T41A 4HR2A 1HNIB 3HHEA 1U25A 3PYGA 1K0VA 1RT4B 5CZXA 2HZAA 3RJMB 2F7VA 1S0MA 4C8NA 3AXMA 2YNGA 3S1TA 1X5OA 5AJ3F 5H9FK 2W01A 2YPZA 2ACYA 2BBEA 1ZBTA 4MYTA 4IFYB 1HBOA 1M5HA 4NASA 4RLEA 1FJ7A 4EI2A 4ED6A 1RHUB 3VGTA 1SKSA 4RW8B 4WP3A 4DR1F 1TL7A 1JLCA 1VQYA 1QSSA 3KMQA 4RNFA 2WBMA 3OL7A 2ZH4A 4QYZJ 4K4WA 3SIPB 2MLXA 3BN4A 4NX9A 5F3ZA 3P3DA 2ERRA 4O3PA 4UF4A 4I56A 3BH7B 2I0XA 2R7WA 2C3YA 1TFWA 2D3UA 2M7SA 2CQBA 3TZXA 1S9GB 1T9TA 1NPKA 3PEJA 2HWHA 3M2UB 5IT9U 3JTNA 4UT4A 2GJ2A 5IT9Y 1RBLA 5F9NA 2AEJA 2ZD1A 3AB4B 2HLUA 2YNIA 3PFOA 3BREA 5DG7A 2A18A 3AQPA 3UDEA 3CCMS 1H7XA 3W9IA 1SC4B 4KH1B 5E41A 3QIDA 2V2QA 4NWBA 3HHKA 5ETLA 2MDAA 2GZOA 2H65B 3EDQB 2HBYB 1YBAA 1M5KC 1PIEA 2HEKA 3DRXA 3OUYA 4F67A 1XMBA 4M5DA 1LXJA 2DXEA 4URQU 1WNEA 1V5IB 1IKVB 4PG5A 4NLDA 3CJSA 4C11B 1FJCA 2F8EX 4ID8A 2C2KB 4NL5A 2R2RA 2JVOA 2DR6A 3DM2B 2GIFA 2RMLA 1JXVA 3K8VA 3TP2A 2HRUA 1G4CA 2W7PA 4JI1F 1IR0A 2VG5A 2DHGA 3EGNA 1NPPA 2V4JB 3LO3A 4KT0C 2VG6A 2YNFA 4IRCA 3C14A 3DMJA 3MPVA 4ZPWR 1JLFA 1OQ6A 3RB0A 3VVUA 2UUWA 1S6QA 3ITHA 4CT8A 3CGIA 4TU7A 1IXKA 2PMZD 3G9CA 4TN2A 5ETTA 3I5AA 1I5OB 2QA1A 2I1RA 2VPZB 1RWMB 2IA6A 2V2ZA 2JRSA 4Q8EA 3D0HE 1VLYA 4JI2J 1W2IA 3C6UA 1R8CA 2CJYB 2MZRA 5L46A 4NZ0A 3BEGB 2F8HA 2WOMA 5DJBA 3DRRA 5J2QA 3P6YC 2IJNA 5GAHI 2VBXA 3SI8A 2HVEA 1EHWA 3K2YA 3MM7A 4NLGA 2QL7B 2HHWA 2WBRA 2YNHA 2AZ3A 4WZMA 3RR8A 2HQIA 1HWLA 4PKDB 4GVBB 1RWNB 1RAOA 4LT6A 4RUHA 2RS8A 3R6GB 5SZTA 1RTDB 3F41A 3G8SA 1TVRA 2DIUA 1N34F 9ATCB 1NJIT 3ZXWA 3I32A 5KFWA 2F4VJ 1FD2A 1U1NA 4I2QA 4RKUC 3AJDA 5HROA 3H2VE 5CYMA 4F0HA 2XSFA 2UUCJ 2IA0A 2X3GA 4ZP6A 4B9MA 2ZBIA 2CPFA 3FFIA 4Q2LA 3DU6A 2MY7A 2C2ZB 3RZAA 2JDJA 1SL0A 4I6WA 1YHQS 2VU5A 1UJ4A 1HNVA 1UCNA 3Q8VA 3QZ8A 4DL0C 4DU8A 1S0VA 3BN7A 2R4FA 4OYAA 3FZBA 1D8YA 1RAFB 2QGFB 1K1QA 1N5YA 4KH0B 4KV8A 1P6TA 3H42A 4O44A 3KLHB 2MZQA 1U48A 2RNEA 4NYZA 2HFZA 3GILA 2HFUA 4NLPA 2CIMA 1BQNB 4RW4A 2BE9B 3W5XA 2XI2A 1XMOF 1Y9OA 1TTHB 5MAOA 2HRTA 1RA7A 2Y0BB 5HJYA 1KWMA 2YKOA 4QW9A 3A3OB 4KIAA 1SL2A 1VQPS 4DOZA 3I5BA 4KR0B 3PFEA 1WTFA 3AODA 1U8WA 2LU1A 5AJ3J 4C3MA 1ZPVA 1WF1A 1CJTB 4IG0B 1UVKA 1HLWA 4KPCA 3D28A 4WFBQ 2W9AA 4DJBA 3MAHA 3OR2B 2XLKA 2Z2MA 4HEA9 3NCQA 1UJ5A 1IM6A 2CQCA 2ZBQA 1HWIA 4K4VA 4DR1J 2DNLA 4KBIA 2YKAA 2YWEA 3HLUA 3CIMA 1JLAA 1Q82T 2BJ9A 5LJ5Y 2LCWA 1SB6A 3I9ZA 1UJ6A 3HD2A 4FF4A 1KTQA 2YQ3A 3H2UB 4ZKAA 2R7SA 3AQOA 3HK2A 3A1YG 1VQ8S 2MSTA 3UW1A 1TK0A 4AQYJ 3PX0A 2DGUA 4DR6F 5KG5A 3QIPB 3FGVA 3LW5C 1HNXF 4P73A 4DI6A 2OI2A 4M5MA 5KFKA 4A8OA 4GO5X 4K4ZA 5EWGA 4BC9A 3PHTA 3LAKA 2NYHA 2AU0A 4I2PA 2YQ1A 4LJMA 2XS2A 1SV5B 1FXDA 2V8PA 3BDPA 5KFEA 4OYIA 2LQBA 2BOPA 1UVMA 1WG4A 1PBUA 5J1PA 2V63A 3M1VB 4XO0A 4A4JA 1FX4A 2BA9A 4ELUA 3R5DA 2PEHA 1TMJA 1NHVA 4HDHA 4IG3A 1DBDA 3ZZTA 3A8IA 3B78A 2ZH5A 2BM1A 2YWKA 1VHFA 4U95A 2DNPA 2VQFF 1LFWA 1TK5A 2CQ1A 2DNGA 2IHR1 2A0FB 5ETKA 1B64A 4MKYA 1DTTB 4NXNJ 1N32J 2OMOA 3OFEA 2GIQA 4X4VA 2WRMA 2FVCA 4HACA 2DH9A 3AOCA 1D1UA 2IAJB 5B0AA 3KLGB 4HTIA 2J9EA 5U47A 3AY0A 2PSZA 4EBDA 2OJ3A 2OPQA 3GIIA 3ZZOA 2IM1A 4LVNP 3R7NB 2ZE2A 1NDCA 4JP8A 2R7OA 1O6XA 3MHYA 1YJRA 2CPXA 4A47A 2VONA 1VIXA 3PXGa 3SDEB 1X4BA 2RIJA 2MZSA 5HVFA 4RU9A 1FRXA 2R7QA 3E01B 4X65J 3L7OA 3IWLA 2DY9A 3CW2C 3MR7A 4DV7J 4PABA 3MPYA 2FHMA 4HLBA 4U96A 4AYBD 5K20B 3A4TA 1JLEB 2E66A 4E98A 4NRTA 2GQQA 5K9FA 4TYAA 4URSA 5HN0A 1YDLA 1B0TA 3FSIA 2BEFA 5CZVA 2GO8A 3C15B 3KK1B 2B4UA 3MFIA 1HWJA 2AYEA 1Q8KA 2Z4PA 2MKHA 2DPJA 4H4OA 2GJFA 1JNRB 1U26A 3ZC4A 4WE1A 2RQ4A 2QLBB 3QRQA 1LXNA 5ADZA 1AUDA 1VK3A 1SQEA 5HL7Q 2R8IA 3GE9A 4OHYA 1NAQA 5C25B 4LSNA 2KVIA 2JLGA 1T11A 2G2OA 2QYGA 1YJVA 2CADA 4PUOA 4RJVA 2H1YA 3TWZA 3I87A 3MM9B 3PW4A 1FEHA 1E6VB 1REVA 1XR6A 2JC0A 1RHQB 4LR9A 3O3LA 3AHPA 5DLFA 2HQDA 1WTBA 2Y8WA 1RLDA 4DV3J 1RWPB 1S6PB 4OI1A 1PBAA 1C0TA 3GMGA 3PDNA 3D6HB
chains in the Genus database with same CATH topology
5KT7A 5L8RC 3OVAA 4U7UK 5J1NA 3DLBA 2HLTA 3I9V9 4EWTA 1V3ZA 3VQSA 3E3XA 1LWCB 4NLXA 3CCUS 4DV7F 2V8GA 5LXYA 1AROP 2ZJPQ 5C42B 3HT3A 2X1AA 1BLUA 3OXFA 3ZZPA 4PXEA 2IM3A 4H4MA 1M5PC 2FJEB 2B7CB 2ZUGA 2BRLA 2DGSA 2ILZA 4ZVEA 2C3PA 1PGZA 5KG7A 4B3OA 4DL3A 3R1HA 4U7CA 3M2VB 1NK7A 4FF3A 4ZP7A 1RT2A 3MMAA 5EWFA 2NSBA 3U7JA 1GT8A 1D9AA 3G86A 2EVZA 2E1AA 4N8NA 4PWDB 2JX2A 2H5EA 2LQJA 3N0VA 5E3QA 4G3IA 4B9TA 2J9DA 1R0AB 4DN9A 4K4XA 2JJ4D 3AAWB 1KONA 1G7CB 1SJQA 2R2SA 2HS3A 1RKIA 4V19X 3PNIA 3F44A 2FY1A 3KLHA 2JFDA 4KFBB 4MK7A 4MK8A 2BABA 1S1TB 3QGPA 3VWSA 4C8ZA 2YTCA 5JJBA 1QSLA 1DFDA 4X4QA 1SH2A 3TVKA 1NK4A 2V8HA 3LALA 1RTIB 2KHDA 4FP9A 4ZDNA 4HH0A 4YMEA 3MEKA 3R3TA 1KQFB 1CC7A 3TUJC 1NJXA 3KK3B 3N6MA 3DLEB 4ES1A 2G1DA 2BV3A 1X4CA 2AP6A 4W92B 1BQNA 2GGPB 5E3AA 3QAUA 2ZJQQ 1X9WA 1SUQB 2ZDOA 4XPEA 4MAKA 2BQUA 1ZM2A 1FVQA 4RU2A 2C3MA 3MEEA 2MJNA 2XMKA 4RNNA 4GKKF 4FNHA 2YX4A 4P2SA 3JYTA 3GR0A 3UDCA 4LFBF 1WHYA 1AFJA 2YKQA 5CH7B 3V6DA 1HBMB 1HQUB 3HMJG 3MM5A 2KTQA 3M9OB 4EZ6A 2E5HA 2CQ2A 2LDIA 3MECA 2XGQA 2F1FA 3K59A 3VALA 2OTJS 3N6LA 5C24B 4RWWA 4RNHA 1S79A 5KFGA 3RB3A 1UL3A 3BR9A 1AW0A 4OZLA 3CJ5A 4QWAA 3UD4P 3M6UA 2FVPA 2AW0A 3V81B 3I55S 4B9NA 3WBZA 3U02A 3Q23A 2E5IA 2RS2A 2VUGA 2LYVA 1FE0A 2EFOA 2XS7A 2W24A 1D0EA 3VZHA 4C98A 2JEFA 3OLBA 2F9DA 4DS5A 2PGCA 4PQUB 4YDXA 2RQKA 1LWFB 4YB5A 1HA1A 4NA2A 2MSSA 2QA4G 2EBGA 1ZYQA 4DQRA 4N47A 3CDBA 2Y1JA 3DCAA 2C2EA 4YB7A 1U2RA 4ED3A 2I8EA 1LWEA 1NZAA 3EZ5A 2JOQA 2QV6A 5J2MB 5A8WA 4NCGA 2QT7A 2AJFE 3M2RB 4DV3F 2RH3A 2DTJA 4QIFA 2J6SA 3LGNA 2IBOA 2WB4A 1F5BA 2A1BA 4IG0A 2MGZA 5EX3A 4N8OA 4C8MA 5I3QA 3OTOF 2ABYA 1TV6B 1X0FA 4L6V3 2RE1A 3I4PA 1LK7A 4OIXA 4EU0A 4PPDA 2K3KA 3N01A 3OR2A 3T6JA 2QSFA 3J81Y 1A6LA 3H59A 3PRBA 4OI2A 1FO1A 1YTYA 1UWBB 1S0OA 5D3GB 1TKXB 5J2PB 4ZPBA 1WI6A 3JTOA 1MWZA 3DRYA 5FDLB 5KFRA 3CCQS 2AYBA 4IFVB 2UU9F 2AJ0A 2ALZA 4ID5B 3LGMA 1X5TA 1RGVA 5K8PA 2UP1A 2ASYA 2LEPA 5DDPC 2PFFB 3TVZA 2VD3A 2M5YA 2ZOMA 1KVJA 1UVNA 1MMNA 3QLHA 3R1LA 1WF2A 2FJWA 1T05A 3P49B 2QA2A 2UUAF 3J7YI 1M5OC 5AXMA 2CPJA 4DSFA 4KRWA 5D4PA 5GADI 5EN1A 4YR3A 1QAXA 3M05A 4RBTA 4I7FB 1LV5A 4DSLA 2WONA 2GHVC 4BHQA 2KT2A 1NKBA 2BYCA 2ZC4A 3H5YA 2E7WA 2KFZA 2VKRA 4IQXA 2DNYA 1RI7A 4UQTA 2KXNB 2IM0A 1HYSA 2YKMB 2RRNA 5KFBA 2PIIA 4NLSA 3M8QA 2B9YA 3VAJA 3GFYA 4QIEA 1WF0A 4BC7A 1KOHA 5KFMA 3H5XA 1NRKA 3CMAS 1Q4RA 3PIPQ 1JIHA 3I0RB 2HVIA 4DUYF 5A8KB 5F8NA 3MEDB 2UVRA 2Q3PA 2UV8G 3D54A 3KHLA 3EPGA 3FEYB 1HBNB 1AFIA 1QVFR 3QIPA 1N6QB 1AXQA 5CYJA 1YWXA 2L9DA 3M9NB 1RT6A 4OX6A 3BGFA 2GV1A 1MWYA 2B4OA 3CCTA 4CNZA 4DFKA 3NMRA 5HMWA 5HLFA 1G2EA 3NNCA 1SJ1A 2FVSA 2L9NA 3KNGA 1QAJA 3Q24A 5J2NA 2ADCA 4GC7A 2QSWA 5KFUA 2APOA 2J9DE 3CIZA 3TUIC 1FKPA 5L9NA 1FRMA 1P27B 4J9LA 2J5AA 2VOOA 4K4YA 2MQMA 2XGPA 1JLGB 3H8YA 3GYXB 1FF2A 3NS5A 1TKZB 5A2QY 2IRUA 4IOBA 4KO0B 3TAMB 4OJ3A 1VQ7S 1FJEB 4WK3A 3DRPB 4PRFA 1HI1A 4W90B 2CVIA 4X66F 4BWJA 2RF2B 3RB4A 2R8JA 5KFYA 1RT7B 1EP4B 2VB6A 3CT9A 3QGIA 1SV5A 1C4CA 3UE2A 3SFUA 1WEXA 2CG4A 3CJKB 3GG1A 3IG1B 5KOWA 3BQ2A 3L95X 4F3MA 2GCFA 3CDAA 5M2UA 1R8HA 2BANB 1GNKA 1WWHA 3HVTB 3QJJA 4DG1A 4RNMA 1A9NB 3HX9A 3MMCB 2OPSA 3HO1A 3VAFA 3H40A 3Q22A 2DITA 3M1VA 2Z0GA 4I64A 4WFAQ 3S01A 3JTPA 4DL5A 4R5PB 1JWWA 1TAQA 1Q1KA 1UEUA 4EFAC 2WAQD 2P6SA 3N9UC 3OFHA 1LW2B 4ZPVR 4DFJA 3DXBA 2CFXA 3DRSB 3ISZA 4B9LA 3PW7A 3HHLA 3M8PB 3HPOA 2CQHA 4JV0A 1KN6A 1DQ9A 3V4MA 1XTZA 1RTHA 5CCLA 1EETB 4HTJA 3UDLA 5HO4A 2L3MA 3CJ2A 4D3HA 2M4MA 3KLEA 5DQIA 4Z37A 2ZM6F 2ASLA 5KOXA 2FLLA 4FYDA 3VAIA 3HZGA 4WF9Q 1LQ9A 1OPZA 1KHWA 2DHAA 3OR1B 4ZVGA 2GHPA 2B0GA 4E8UA 4JI5F 4OI4A 4WFZA 3S8SA 5IT0A 5DGBA 1DTTA 4NXMF 1JLBA 3TANA 1ZAWA 1TKTB 2OTLS 1R8BA 1HD0A 1WI8A 3WZ0A 2IMWP 4B3MF 4TU9A 1Q7LB 3N28A 2KU7A 3UCUP 3UCGA 1V3RA 1IQTA 2JLFA 1S77D 3POTA 4JOUA 3RYLA 1LFPA 4MMOA 5BJRA 2GO9A 2HW3A 5DDRC 2HMIB 3MCSA 2I38A 3PY8A 3EUNA 4F3QA 4ED5A 2IAJA 3V5RA 1FT8A 1BC6A 3KHHA 1RT5B 3KLGA 2DNHA 4QYRA 2WSEC 1Z2LA 2HWIA 3IRWP 5K8MA 1IJFB 4KQZA 5KFAA 1HHSA 2P9EA 4C0HA 3D5MA 3IAM9 3KTQA 1BQMB 2MY8A 3R27A 4DBQA 4TLQA 4OI6A 4FPRA 3BR8A 5HBMA 1IKXA 4A8FA 5FJ4A 3JB9k 2D41A 4RX6A 2DGQA 1HD1A 1YRUA 2VG7B 4Q7AA 2XG8A 3JSRA 1T03B 3NBPB 2GIRA 4EYHB 1CEZA 1KS2A 4DSJA 3IC1A 2BM0A 2FJAB 1PC5A 3CDWA 4I69A 1F2GA 3ENVA 4CQ1A 1IBMF 3T3FA 2JC1A 2ZKUA 1Q86T 2U2FA 1Q16B 1QY7A 4ZPTR 4G1QB 1U8SA 4OHVA 5GAGI 1N33F 2QRRA 3N4WA 5B7WA 1NK0A 5DG9A 2DNKA 4RW6A 2CJQA 4IOCQ 3MPWA 4OHXA 5B09A 1H2UX 4F02A 3EPIA 3HHLD 1JXEA 5KT5A 1UFLA 4LF8F 1S76D 3SDEA 1IKYB 4O3OA 4XIUA 2C28A 2CJ9A 3DI6A 4NRUA 3ZZYA 5BYSA 2B51A 3SV4A 1URRA 1SL1A 4FF1A 2CJAA 2G4BA 3C6TB 5H9EJ 3PV8A 2R7TA 3UNGC 3L7PA 4A8KA 3E01A 2PC6A 3KLIB 2HNYB 1H38A