1R8PA

Hpv-16 e2c solution structure
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
81
structure length
81
Chain Sequence
b'MTPIVHLKGDANTLKCLRYRFKKHCTLYTAVSSTWHWTGHNVKHKSAIVTLTYDSEWQRDQFLSQVKIPKTITVSTGFMSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein E2
publication title Solution structure of the HPV-16 E2 DNA binding domain, a transcriptional regulator with a dimeric beta-barrel fold
pubmed doi rcsb
source organism Human papillomavirus type 16
molecule tags Transcription
total genus 10
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00511 PPV_E2_C E2 (early) protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1r8pA00
2MXYA 1VQ6S 3NNAA 3UCZP 2MPUA 5LJ5Y 5DM6Q 1R8HA 2CPDA 2LA4A 1U1KA 3RW6A 4C4WA 2HGLA 4FXWA 2N82B 1FJEB 2M4MA 1WHYA 3D2WA 3L3CA 1X4EA 1SJ3P 1WWHA 2DNQA 1JJ2R 1JMTA 2Q79A 1KOOA 2NZ4A 1JJHA 1WI8A 1D9AA 3Q2TC 2RRBA 4ZKAA 1R8PA 4CQ1A 2MSSA 3ZZYA 1KQSR 5IFMA 2DGWA 3CCJS 4WFNQ 2DNRA 3H2UB 5GADU 1DZ5A 3UCGA 3CCVS 5IM0A 1IQTA 1X5PA 3LQVA 2O3DA 2CQDA 3MOJB 2CPZA 4WFAQ 2LEAA 3S8SA 2KG1A 2XS2A 2J8AA 3P49B 4P6QA 2KG0A 1FNXH 4OZ0A 1VBYA 2SXLA 3S7RA 2KH9A 2FY1A 1A7GE 1U6BA 1VC5A 1K8AT 2DNGA 3BO3A 1X4BA 2KT5A 1O0PA 3I55S 1ZZNA 1SJFA 3CD6S 1VQMS 1X5OA 2M7SA 2DO4A 2OTJS 3G9CA 2AYBA 3OW2R 1KC8T 2DHXA 1M1KT 3BS9A 1VQKS 1YJNS 1H2VZ 2MQQA 1SJQA 5DDOC 2CQHA 4YUDA 3G8TA 2ADCA 4IO9Q 2MY8A 1YIJS 2MJNA 1VQ8S 4W90B 2UP1A 2DH9A 2LMIA 2LYVA 2CPHA 2PEHA 3SXLA 3CCLS 1UP1A 2KRRA 2EK1A 2JX2A 2JWNA 3R1HA 2M8HA 3R27A 2XS5A 2JVOA 2J0SD 1X4FA 2ADBA 1F9FA 3G4SS 3UE2A 2D9PA 3HHNB 1K73T 2DISA 1N52B 3CULA 2OSQA 3U1LA 4C7QA 2RQ4A 3MUVP 4YOEA 4Y0FA 3S01A 2RNEA 1OO0B 2DNKA 3VAGA 1U1MA 2MKIA 3VF0B 2KM8B 2CPYA 4IOCQ 1OIAA 2RVJA 1X4GA 1X4HA 4QQBA 2M2BA 3H2VE 3S6EA 3MXHP 2LXUA 2YKAA 2VODA 2DGVA 1AUDA 5LSLA 3CC7S 4F02A 2BOPA 1YJ9S 2OSRA 2D9OA 5LJ3Y 1WHVA 4TU7A 2DGXA 4F25A 2DNNA 1X4AA 3PIPQ 2JRSA 1FJCA 3DXBA 2N7CA 4TU9A 3EGNA 2AYEA 2DGSA 3Q2SC 5GAHU 3BO2A 2QFJA 2LQ5A 2CPJA 4PR6A 3NNHA 2FC8A 2DHAA 2MZJA 1U1NA 3MD3A 3CUNA 2KXNB 2K8GA 1PO6A 1UW4A 2M0GB 2XSFA 3RW7A 1H2TZ 1L3KA 2K3KA 1YITS 2CQBA 2EVZA 2X1GA 4CH0S 3G6ES 2M70A 3SDEA 2HYIB 1HD0A 1U1OA 3MI7X 1B7FA 3B4DA 2AYMA 1WF2A 3CCES 1BY9A 1WHWA 2U1AA 2CPXA 2DK2A 3NS6A 1WF1A 2GHPA 1G2EA 1U1RA 3HI9A 3P6YC 5LXRA 3UWTA 1HA1A 3MURP 1YHQS 1M90T 2LA6A 3VALA 4M5DB 2ZJRQ 2MKKA 1SXLA 3IRWP 1W2BR 1X4CA 3CCSS 1WF0A 1Q81T 2LEBA 2X1BA 5LXYA 1VBXA 2E5HA 1N8RT 2MZ1A 2X1AA 2MKSA 2M88A 2XS7A 4WFBQ 1VQ4S 2MJUA 2CPEA 4LJMA 1S79A 3UD4P 1WG1A 4CIOA 2N3LA 5D77A 2MGZA 1X5TA 1A9NB 1VQPS 4WF9Q 4IUFA 2KFYA 4QPTA 3CMAS 1ZZFA 2DNLA 5JVGQ 1WI6A 2MQLA 2EK6A 2L9WA 2FHOB 3BO4A 1P27B 1VC0A 2N3OA 4WKRA 2ZJPQ 2XNQA 1U2FA 3CXCR 2DGTA 4TU8A 1U1QA 5LSOA 2VOOA 2A3JA 2HGNA 2DNHA 1X0FA 4RU2A 4LMZA 4LIRA 3B4MA 5D78A 3UCUP 1YI2S 2DO0A 4CH1A 2KU7A 2KYXA 2MHNA 3V4MA 3VAKA 1M5VC 4J5OA 1FJ7A 2CPIA 1WELA 1U1LA 1RKJA 1ZH5A 3SDEB 2J0QD 3NNCA 3CCUS 1FHTA 1VC6A 3G8SA 1PGZA 2B0GA 2QA4S 1Q86T 1M5KC 5IM0B 2CQ4A 3P3DA 2DNYA 2I38A 1NU4A 1QVFR 2XNRA 2V94A 2MZTA 4FXVA 1U1PA 2MQMA 3G96A 2LECA 2L08A 2KM8C 1Q7YT 2E5JA 5DM7Q 1WEZA 2KRBA 2MKHA 3TYTA 1OPIA 2M8DB 1URNA 3FEXB 1UAWA 3EGZA 2RQCA 3TP2A 4PRFA 4C0OC 2MB0B 1UFWA 2MZSA 5GVQA 2DNPA 5HO4A 2KN4A 2XB2D 3NS5A 3CCMS 1WG5A 2GO9A 3VAMA 2M52A 2RS2A 3CCQS 2DNOA 1FT8A 2MKCA 2OIHA 2OTLS 2MMYA 1N54B 1YTYA 1WG4A 2CQGA 1H6KX 1SJ4P 2YH1A 4ED5A 2U2FA 2DIUA 2DGQA 2MQPA 3CCRS 2RRAA 2D3OR 3P5TL 2YH0A 5JVHQ 2MZQA 4U67Q 5EN1A 2ZJQQ 2G4BA 2YTCA 3CTRA 2DGUA 2FPHX 4UQTA 2RT3A 2AYGA 2X1FA 3EX7B 5DETA 2PE8A 1YJWS 2KI2A 1DRZA 1QVGR 4QU7A 1DBDA 5ITHA 1VQ9S 2DITA 3MUMP 3LPYA 2DH7A 3UD3P 5CA5A 2CQIA 4QU6A 2JVRA 1S72S 1NJIT 1WTBA 3J7ZT 4UY8T 1VQOS 1SJRA 3CC4S 4IOAQ 1HL6A 2WBRA 5FJ4A 2VONA 5GMKa 3VAFA 2KHCA 4ERDA 2F3JA 3NMRA 2FC9A 3THPA 2DHSA 2LCWA 4V19X 3R1LA 2DHGA 4EGLA 2RU3A 2MY7A 2DH8A 5BJRA 2G0CA 2KXHA 2MSTA 3US5A 3K0JA 1RK8A 2MQNA 4F26A 5GAEU 3G71S 3CC2S 5H1SV 4PKDB 2AD9A 2HGMA 2HVZA 2MYFA 2DNZA 1H2UX 1XN9A 1JJ4A 3CMES 2CJKA 2KVIA 5GAGU 3U1MA 2DGOA 1Q82T 2QEXS 1D8ZA 2G1DA 2M9KA 2YWKA 1X5SA 1NO8A 2RUGA 1X4DA 4A8XA 1N88A 2HZCA 3TO8A 5MLCV 3PIOQ 1VQ5S 5HL7Q 2CQPA 2CQ1A 2ERRA 1CVJA 2MQOA 1YWXA 3MD1A 5DDPC 5CXTA 1FO1A 3IWNC 2CQ0A 2DIVA 3DLLQ 4Z2XA 3CF5Q 4BS2A 1VBZA 3I56S 2F9JA 3BEGB 4Y00A 3MDFA 3VAHA 1DHMA 1VQLS 2VOPA 4WCEQ 1P1TA 1M5OC 2CQ2A 3J7YU 2I2YA 1U6FA 3VAJA 2E44A 2L41A 5DDRC 2DNMA 3SMZA 2CPFA 2RS8A 1KD1T 4OZ1A 2CQ3A 2BZ2A 1M5PC 2J76E 2NLWA 1VQ7S 1VQNS 3JB9k 2LKZA 1FXLA 4W92B 5IQQA 1QM9A 3THTA 3VAIA 2DB1A 1WEXA 2E5GA 1HD1A 1KOHA 2F9DA 3N9UC 2MZRA 2KXFA 3ULHA 1K9MT 3FEYB 1OWXA 2OJ3A 2CQCA 1WEYA 4TLQA 3ZZZA 2E5IA 1WHXA 4YB1P 5CYJA 5DDQC 2MKJA 3MUTP 3CPWR 2LXIA 2MGZB 4WIIA
chains in the Genus database with same CATH superfamily
4RW4A 4KGVB 3PX4A 1R8HA 2LA4A 1HI0P 3PKMA 2XO6A 4M5KA 4O3RA 4YHHJ 3GIIA 4JYAF 4U8YA 1D9AA 1SBRA 1YJRA 1KLNA 3C46A 4P2MA 1HMVA 3TR5A 3ZO7A 4IRCA 4DPYA 1ZAVA 2WZ1A 2PI4A 1A7GE 3LWMA 2GMHA 5C42A 2B8QA 1KP6A 2KT5A 1YRUA 1Q8LA 1PJ7A 3G82A 1EETA 2HVHA 1G7CB 4JI4F 1HWUA 3KHHA 1UCNA 4O0IA 4CO2A 4FYVB 4ZVRB 2ZZNA 3CD5A 2CJ9A 2MJNA 4ED1A 4JUZA 5A2QY 3TUIC 3TNVA 5HQ8A 2GS8A 3B6BA 3WIUA 3WC2A 2JX2A 3I9V9 1OSDA 2BUNA 2V4JB 4EZ9A 5KG2A 2QSWA 4EBCA 3JSYA 3CULA 2CRLA 4YOEA 4XIUA 2VC0A 5KFWA 3PG9A 2UZAA 3VAGA 1XBWA 2FVRA 3I82A 1TK0A 1RWOB 3GONA 1QAIA 1I3OB 1FKAF 3PKYA 3I0SB 1KS2A 2YKAA 2JEIA 5LSLA 4F02A 4IFYA 3TUJC 2KDOA 5CHCB 4UOCA 4F50A 6FD1A 2XYPB 4PZVA 3D66A 3DRRA 1T02A 3WX8A 2B4VA 4ES2A 4WTYA 3HHEA 2C3PA 2EVZA 3G6ES 3PZPA 1HD0A 1B7FA 2EC2A 4KHPF 2E66A 2U1AA 1RU1A 5KFSA 5F8GA 2HFOA 4J7CA 4OI2A 3SYZA 2FLOA 3MEGB 4IH5A 3JYTA 3H4BA 3QPIA 1M90T 1HBMB 3DLGB 1JIHA 4JI8J 2E7VA 1NSAA 4MT1A 3HK2A 1CC7A 3DLEB 4JI7J 3FNNA 3BKTA 2LEBA 5CQGA 2MZ1A 4CLTA 5DRKA 1AROP 4EEYA 2OPPB 1KLMB 3CD0A 1S9GB 4ELUA 1FKOB 1CS4B 5KFOA 3U7JA 4LF6J 2YKMA 1HNXF 3UPFA 4K59A 2RUSA 3FSYA 4C8LA 2P8IA 2H51B 1U1QA 1R0AB 1UJ6A 1SC6A 3B4MA 5D78A 3R7SB 1RAAB 1UPMB 3M1VA 2WSFC 3HSGA 2HHVA 2JEGA 2GVDB 4ANDA 1KBRA 3I31A 5CYQB 2ROEA 2VZ9A 5C5JA 3ENQA 2QA4S 1M5KC 3MR5A 2CQ4A 3AJDA 2V94A 4FXVA 3DFEA 3KLFA 1HYSA 2VG5A 2DKOB 2VPWB 3KK3B 2F5GA 3R9LA 5HBMB 3J7AN 4ECVA 4DI6A 1OQ6A 1YJTA 2YH1A 4ED5A 4Q0BB 4K0KF 4Q8EA 1PBUA 3CVKA 2XLIA 2R2RA 3FFIB 4QWBA 3EVMA 4LRAA 2IYIA 1UZDA 5DETA 2ALYB 2K1RB 2AZ3A 3IG1A 3MPVA 2DH7A 1LEOA 4HL9A 1D9FA 4H4MA 4LF5F 3FRYA 1L3VA 4ENOA 2FZGB 1NJIT 3H2LA 4AYBD 2Z56B 5EWEA 1J2VA 3RB3A 2BW7A 2JLGA 3NY0A 2P9GA 2FJDB 4FN5A 1RB0A 3R5CA 4P72A 1DARA 1D0EA 3RRKA 4QWEA 4DL3A 3CMES 4MYTA 1WORA 1RWWB 2IVYA 1DJ0A 4IKAA 2F4FA 4C6AA 1BLUA 4Z2XA 3EJMA 3C15A 3PCOB 2GW8A 2ZBPA 4OX9F 5D0GA 1LFWA 2YPZA 1N33F 4Z7YA 2NR0A 2E29A 3FGVA 4IG0A 2C1EB 3N01A 5DZ6A 4ZLJA 1QM9A 3PM9A 1KOHA 1B0PA 2KXFA 1WKJA 1S57A 3D6FB 4PG4A 2R7WA 1TMJA 3R5DA 1NAQA 2UU9J 2CJQA 2HBZB 2PDAA 4H4KA 3Q8YA 1NJYA 2QJ3A 3ILIA 1JLCB 3TX8A 2BW2A 4RW7B 4ECUA 1ZTWA 1JMTA 1PC4A 3DDKA 3QT7A 2VKZG 4F8RA 4ZP7A 4RNNA 1UWBA 1T9TA 3MFHA 1UWAA 3W3SA 3EGVA 3P49B 4HR2A 1VGYA 3C3LA 1OJ4A 5J2QB 3GZ7A 3W66A 4ZIVA 3UO0A 4NMXA 1ZBTA 3NAHA 3I55S 2ZD1B 4I1TA 3HFKA 2B6AA 3NAIA 1T9XA 3KLHB 2B5JB 2Z4PA 2R7OA 3OXLA 5ETSA 1RU2A 2FZCB 3FKBA 1YIJS 4DX5A 3HCXA 2LYVA 4N41A 2P2CB 4QR1A 2KRRA 1TAQA 1N34J 3DCAA 2M8HA 4DF8A 1FRHA 3OFFA 2G2ZA 5CYMB 3MUVP 3W61A 3CIMA 1S1TB 5LMUF 2YY3A 1R31A 3VF0B 2Q6CA 2B9XA 2ATLA 3QT8A 4QQBA 4DUTA 3F41A 4OHVA 2ZH4A 1VRQC 1MMLA 3DRSA 5CH7B 2B3TB 3HZGA 2QG9B 1KQFB 1FKPA 1JKHB 4CP5A 3QGPA 5LJ3Y 1BHNA 1K1QA 1CBKA 3G6VA 3TX0A 4HEA9 1QE1A 4RUHA 3GR0A 1UETA 1HARA 1H2TZ 3A3PB 2H4YB 4DV3J 4HH0A 5T7LB 4X4NA 3LP0B 3B4DA 2HHWA 2FLPA 4B9SA 2MLYA 1SXLA 4JI1J 2UXDJ 2X1BA 2R8KA 4ZPAA 2B4UA 3EPGA 4BC7A 2MGZA 4MIBA 3QIPA 4OYMA 4P7TA 3EE3A 4QCLA 1TUGB 3MM8B 3A12A 4X4SA 4QWDA 2OMOA 3D7SB 1MU2A 4WKRA 2Y1IA 3OQ2A 3CXCR 1G6BA 5LSOA 1S1WB 1X0FA 4F4AA 2DO0A 2AEFA 5D0HA 1C0UB 4ECYA 2J5AA 1BWVA 3HPOA 4IR9A 1FNOA 3CSKA 1FVQA 4WYLA 2EKNA 3P4UB 2IRYA 4O4GB 1NK7A 2K7JA 1Q7YT 2H1YA 2DXDA 1WEZA 2KRBA 3KDOA 3W5YA 1ACMB 1HKAA 1AFIA 3R5JB 3W5ZA 1WDTA 3R7BB 4CH7A 2Y0BB 3I5CA 2RS2A 2MKCA 4K4VA 1HNWF 1UW9A 3DOKA 1LFPA 2HS4A 3GSIA 1UVJA 2FD2A 3Q89A 3W2WB 4J37A 2X1FA 4L3NA 5KFFA 1VDHA 3CGIA 4LIWA 5RUBA 2GNKA 3DOLB 1JQGA 4QW8A 1RTIB 1SH2A 3LPYA 2BANA 5FLXU 4DL6A 4X65F 2AWZA 1FDAA 2GO8A 5FDLA 2XG8A 1WTBA 1IKYA 5BYQA 2XO7A 3JSMB 1JXVA 2WBRA 2Z0GA 4WXWA 2VONA 3VAFA 4V19X 1F5AA 2DHGA 3TVYA 1Y9OA 2AV5A 2MY7A 1YJ7A 2FUG9 4NI2A 3K0JA 3UFCX 5IQ6A 3QRRA 2DNZA 3ET6B 1LOUA 1RBLA 2KVIA 3BJYA 3BPDA 2F63A 4DV0J 2RUGA 1KN6A 4ES1A 2AMCB 3EICA 2ERRA 4B9VA 4AXIA 5BR8J 2Y8YA 4URQU 3EM1A 3DHWC 4Y00A 4PPDA 3S1TA 2HHSA 2J9DE 4OLPA 3DXSX 4EWTA 1C0TB 4G65A 4I6WA 2VHGA 5KT4A 4F4YA 4BWJA 3VAIA 1DAXA 3BR8A 3CJRA 2OAUA 3ICLA 2RF2B 4LFCF 3HM9A 2PFDA 2AQ4A 5B0BA 4DR1F 1ZM9A 2V4JA 1UA1A 3LPEA 1T3OA 3EDRB 2L48A 4XAKA 2WSCC 3NKYA 5A8KB 1HHQA 1FJEB 2OHDA 3R3TA 2YQ1A 4OYWA 1WOSA 4NA2A 2N4DA 1F2GA 5B0GA 4HLBA 4ZS6A 1XTZA 4O4RA 3I0SA 1KQSR 2V69A 3W5XA 1CJVB 1JLEB 2KO1A 2KG0A 1G3OA 3BN7A 3ZZTA 1U6BA 1K8AT 1CC8A 1S0MA 3ELHA 3HJFA 4M8LA 4YR2A 3M2RB 5L9NA 4ZJQA 2OFHX 1VYAA 3BBCA 3BS9A 3D0IE 3M9NB 2QLJB 1SKSA 4P2XA 1SQEA 2QV6A 3KLGB 2UP1A 3UR0A 3MEGA 3OBIA 1DTTB 1HBMA 3DLGA 5CZVA 4QWAA 4P74A 2VV5A 1SL1A 3JTNA 2VBYA 4NXNF 3DLEA 3CJ2A 3OFEA 2ACYA 3T5LA 3V81B 4OMFG 4OQJA 4KFBB 1QD1A 3LOUA 2OPPA 1KLMA 2V9KA 2KM8B 5I3QA 1FKOA 1NSPA 4DU8A 2UUAF 1CS4A 4A46A 3M05A 3V6HA 3C2PA 4L73A 2R7UA 3KLEB 3AD7C 3C8YA 4KGKA 4CLZA 4MK9A 3LGNA 2VD3A 4NYOA 5ADZA 2HS3A 4EFAC 1S4EA 3DGPB 4A8YA 4FNHA 2IJRA 4A8OA 5HMZA 3BDPA 1R0AA 2CPJA 1U1NA 4Y65A 1ZOTA 2C3YA 4KGXB 1XNQF 2BE9B 2DVIA 3UNYA 3MAAB 2GVDA 4B3RJ 2XMVA 5IOLA 5CYQA 3MI7X 1UEKA 2ZC4A 5SUHA 1WF2A 3GV8B 1SC3B 3HI9A 4HT5A 4YN3B 4CLYA 5K8MA 2GAHC 2C28A 2VFRA 4ZCKA 4PG6A 4C8OA 2ZBRA 2MKKA 2AJ0A 4P73A 2GQCA 5IWAJ 1K47A 4RPFA 3KK3A 5HBMA 4IOBA 4ZVFA 3AB4B 2YNGB 1K0TA 4J9UE 4Q0BA 4B9LA 4DR3J 3FFIA 3OTBA 4P7VA 1WI6A 3OUYB 2BQRA 2EK6A 2FHOB 2K1RA 4QYZJ 3AA8A 1PG5B 3VVTA 3UVJB 1LXNA 2XULA 4PCQA 3OTCA 2XTJP 3DRPB 3GCXP 4G6VB 3LA0A 5A6PA 2PC6A 5IT0A 1JX4A 3KMQA 3DDNA 4IH7A 2VIHA 4DL7A 2A6MA 1GT8A 1CJUB 4D3GA 1GXUA 1XWLA 3KHGA 1NHUA 5IT9Y 4UOGA 1APSA 2ZUGA 4UQGA 2ZH6A 2E9ZA 4ILRA 1IKXB 1N5TA 3TYTA 5HQMA 3AB2B 1FCAA 5J1EB 3ITHA 5D6GA 1RE1B 4DFKA 4ILMA 3UNGC 8RUCA 1LQ9A 3OXGA 4NWBA 3WDOA 3ONQA 3CJ3A 5DLFA 2C22A 3CDBA 2XHCA 5J2MB 2HVIA 4CRJA 2VQEF 1QVGR 3UD3P 2BE2B 5CA5A 1SJ1A 2QSFA 2CQIA 3TUZC 3KK2B 3R5BA 1Q79A 2VQFF 4NA1A 1ZM2A 1UEUA 4LBIA 4CLFA 3K5PA 5CABA 4ZPTR 4K4SA 1YBAA 3KWMA 4EGLA 1JLCA 5F3TA 4RW7A 4Q43A 2MSTA 1RT3B 1JLAA 2FB0A 4ZP6A 2JEFA 2GFFA 4LRBA 4USKA 1XMOJ 3BSCA 1L3UA 3SEOA 1F3VA 3NEKA 4KBIA 3V6KA 4U9RA 2FLNA 4F67A 1TV6B 5J2QA 3W62A 1HPZB 2HZCA 3QGIA 5C24B 1ZPWX 3MD1A 3IWNC 3CF5Q 3MDFA 2VOPA 3KLHA 2B5JA 5DO2A 4RBVA 1IBMF 1M5PC 2BZ2A 4OHZA 3M9OB 4NCAA 1VQNS 2BJ9A 1KDNA 1R27B 3QSIA 2LKZA 5B08A 3BKUA 2RRNA 1B99A 2E5GA 1VLYA 1OWXA 3QAEA 3H7HB 1WEYA 2KYZA 4LRFA 4PXBA 3L7UA 4DQIA 3MUTP 1TKXB 4EBDA 2YKPA 4DV2F 3RZAA 2PSZA 1U1KA 1NHKL 3RW6A 1S1TA 2ZHBA 4LFAF 1X4EA 4DXLA 3F0NA 3PX0A 3PY8A 3UI3A 5ETVA 3R5GA 2MSSA 3CDEA 2O3DA 2CQDA 1JKHA 2V34A 3GILA 5KFHA 1C2PA 3KXDA 3VV2B 3BO3A 2K2PA 4M63A 2ASLA 1KR4A 1ZZNA 1CULB 4WU2A 1MG7A 3MPYA 2LQBA 4ED2A 3E8OA 1IKVB 1H2VZ 5T7LA 3CJQA 4K2XA 2O1PA 3LP0A 1QJHA 1GTEA 3AQPA 4AL7A 2F4VF 5DGBA 2RJZA 5H9FK 4ECXA 3T6JA 2VA3A 2DISA 2RQ4A 3KNGA 2EFPA 1RWUA 4A48A 2KJVA 2CJBA 2DD8S 3J80Y 1S0NA 2QMWA 2ZH8A 3MM8A 4UZCA 1AUDA 3M6WA 2D9OA 2GAGC 1EIYB 4FVMA 1S1WA 1FJGF 4OX8A 4PG8A 4HH1A 4C8YA 3F73A 2Q66A 2HFSA 4ID8A 1C0UA 3IR5B 1YJVA 1H0HB 3QGGA 1F9HA 2AX1A 4DQPA 2WONB 2ZE2A 2UUCJ 1UZHA 2GHPA 1G2EA 1JLGB 3M8QB 2V63A 4O4GA 3UWTA 4F3OA 3GIMA 1TL1B 3LTOA 5SZTA 4DV7F 3BF4A 4KO0B 4ER8A 4LJMA 4WK1A 3SCIE 2A1BA 1VQPS 4P10A 3V5RA 4WF9Q 4HI2A 4XPCA 2KFYA 2DNLA 2QX0A 1RZMA 1P27B 3DOLA 1C4CA 1T9VA 3EZOA 4UOHA 1RTIA 4NXMJ 2M5YA 2RAQA 1F3FA 4LMZA 4B3SF 4OYOA 4Y2CA 2FHJD 2KT3A 4PAAA 3JSMA 2E5LF 4LF7J 4USMA 3GFHA 3G86A 4KGMA 2DY1A 3DHXA 4EO6A 5IM0B 4LF4J 1S1XB 3ZTQA 2C2RA 2BDPA 1NU4A 1J5EF 3MMBB 2ZBQA 4Z7CA 3ET6A 2J7KA 3AY0A 2I9SA 3ZTSA 1Z2LA 3LP2B 5HO4A 2ZVIA 1FK9B 4CWBA 1HNZF 2IM1A 1TFYA 5F9NA 3CCRS 2W2NP 2V6AA 1J5OA 4AD6A 2ZJQQ 1RBOB 1HR0J 1N48A 3PO4A 1C0TA 3MCOA 2PE8A 4QU7A 4Y2AA 2Z2LA 2CKWA 1KWMA 5ETKA 5DQGA 5I42B 2LXFA 3K5NA 3IGNA 2O66A 3KLIB 2RF2A 3A8JA 3KUHA 3E01A 4XDCA 3NMRA 3AOCA 3AH6A 2DHSA 4JV2A 2UXCF 5A8KA 3T1YF 2XEXA 3FMWA 3DLHA 2VJVA 3NLCA 1RDRA 1S7IA 5GAGU 3KJQB 1CJVA 1R6VA 1O51A 2QEXS 1RUSA 1DURA 3FDSA 3W7BA 1NO8A 1JLEA 4NE9C 2ZOGA 4DV6F 6FDRA 1TK8A 1YWXA 3MMJA 3LGMA 4CNZA 1FO1A 3DLLQ 1S76D 4HHUA 4J9KA 3ZNUA 3M2RA 3ILLA 3CD7A 2WVDA 2GHVC 2UUTA 3SMZA 4JI3F 1JWWA 3KJVB 3DNCA 3KLGA 2FYXA 3GR1A 3D1QA 2MQ8A 4OI4A 4DV5F 3TEHB 1LNQA 5LMNF 2MKJA 1NBEB 3PJXA 3MPDA 1T3NA 3H90A 2Z2YB 1YSJA 3V81A 2H5IB 4FXWA 2N82B 4KFBA 2M4MA 1WHYA 2XLKA 4F4KA 5GMDA 4ZLPA 5D4PA 5LOQA 4ZITA 3KLEA 3UCGA 1S0OA 2KG1A 3H20A 2QT7A 2VL1A 2SXLA 3FUYA 3DGPA 4DR2J 1IR2A 2DPIA 1VQMS 4KHMA 3MAAA 4QR0A 4BBYA 2O67A 4QOTA 2R7RA 1NLKL 2CQHA 2VBXA 4WE1B 4X4RA 1UTAA 2PEHA 2XZWA 2IMOA 2XZTB 3ILOA 2ZBIA 2GVZB 3D6TB 5E3AA 2ADBA 2D9PA 4CT8A 3MPWA 1IJEB 4CO4A 4KHPJ 1VK8A 2YNGA 1MN9A 2CIMA 1VR6A 4OZNA 4IOCQ 2HQCA 2B4OA 4PG5A 2VKRA 2GJ2A 5AE1A 2JHEA 4WFYA 4QR2A 1SCJB 3OUYA 2VB6A 3M2VB 1BE4A 1H73A 4JI6F 3UVJA 3VGTA 4AL6A 1FJCA 2BJ8A 3UN2A 3W8GA 3DRPA 2OD6A 2AGOA 2DHAA 4O23A 3PEJA 2YWHA 4DUYF 3U27A 2E1PA 3QATA 4TY8B 1CJUA 3ZTRA 3MM6B 4OZLA 2DEJA 2AYMA 4UUWA 1R43A 2CPXA 4K7QA 3P6YC 2I0XA 1RJJA 3SSRA 3KNAA 2CWKA 2FHJA 3C6UB 3TQEA 3VALA 1IKXA 4MIWA 4NASA 4A8QA 5GAHI 3M8YA 1SC1B 1U6ZA 3OT9A 4TKTA 5J1EA 2XS7A 1REVA 1S79A 3UR3C 5HSPA 4NLOA 3UD4P 3BQ0A 1X5TA 2HIQA 1I6JA 5DQHA 4OHWA 4KY3A 1ZM4A 3QO9B 5J2MA 3SV3A 4QPXA 5A8WB 1T8EA 4L72B 4FYWB 2BE2A 3G2XA 3VGUA 3KK2A 2VFSA 4K0KJ 5KFUA 2JC0A 4Y28C 1S6QB 1RACB 3RAXA 4DUZJ 2QMXA 1ZS6A 3G8SA 3NBPA 3GJRB 4X2BA 1GQEA 3SQGB 1RT3A 2CAJA 5AT1B 3VCDA 1X0PA 1FTCA 4U96A 2MKHA 3HSJA 1L3SA 1QAYA 2GJFA 2MZSA 2DNPA 3Q0AA 2XB2D 5J1PA 1TV6A 2B43A 4EBEA 4PWUA 3JSRA 1HPZA 3N79A 3BYRA 4HDHA 3I0RB 5C24A 2ZEJA 1HHTP 5A2QU 2DJWA 2L9NA 2JC1A 4HHHA 3CTRA 2FPHX 4UQTA 3OHAA 5KFMA 2LFVA 5KOWA 1JXLA 5FIIA 3HVRA 2QLFB 2MEWA 3EVOA 3EPIA 2BKNA 5LM7E 4IOAQ 3QQCD 3GP9A 4WKYA 1T9WA 3LGHA 1H7WA 4OX9J 1TKXA 1TUWA 2RMLA 5F3ZA 3RYLA 4UY85 2LCWA 3PV8A 2W7PA 3DYAB 4DF4A 4OV1A 4ZIWA 1TL4A 3EVWA 1U25A 3NWRA 5H1SV 2ZZMA 2JL9A 2ZH9A 1XN9A 1P8GA 2I1RA 1Q82T 3OR1A 1IBCB 5G4DA 1DQAA 4DCJB 3AA9A 4K8RA 1IKWB 3ENWA 2RHQB 1CULA 1S4FA 2V2QA 2W9CB 1U6FA 5K8OA 2PI5A 2HRYA 4O3QA 3I6PA 5G0RB 5H9EK 1Q16B 4DN0A 3NCPA 1NK5A 1RTHB 2ABYA 4RNMA 3QZ7A 3M32B 3U1NA 4F36A 2E1AA 3ULHA 5K20B 1Z4UA 3T6BA 2OJ3A 1T9UA 2FJAB 3AT1B 2CPDA 1BC6A 5KG6A 2J7WA 1VJQA 2PN6A 1F9EB 3D54A 4YY3J 2HSEB 1RA6A 2HQIA 4AE5A 1SL0A 4MTPA 2IJFA 3JQJA 4NLXA 2R8HA 2VUGA 1Y5NB 2HQFA 4RWXA 3K5LA 2BJDA 3GIJA 2JEJA 5JMNA 2ZFHA 4K50A 2HS0A 4I64A 2WSEC 1RAHB 5KG0A 4LBPA 1U8SA 2ZC3A 2BA9A 5L1IA 3CDAA 1S9EB 2CZVC 2R2TA 3B54A 4Q7AA 1HQEB 1KVJA 1GNKA 3QFWA 1AUSL 2WONA 3KKFA 3MR7A 1JLGA 3M8QA 1X7VA 4FPIA 3HP6A 1TL1A 2LQ8A 4KKOB 4Y2MA 2ZWOA 5A76A 1NKBA 2XSJB 1UKUA 1UA0A 4I67A 4C7QA 3AJ2A 2YKQA 4KO0A 2RH3A 3TI0A 4N5SA 2M3DA 3IM9A 2CPYA 3UDLA 2HBQB 2VODA 1PYOB 2DGVA 3CC7S 2NS1B 3PJWA 4WZMA 4WWSA 1X4AA 4DMZA 3PIPQ 2JRSA 3ZZRA 5E41A 1Y3JA 5GAHU 3BO2A 3OL6A 1JLQB 4FF4A 3NNHA 1EKRA 2K06A 2MKYA 2EC0A 4URSA 2CUYA 5BYRA 2JFDA 4P75A 1L3KA 3BYPA 3HSDA 1YITS 3QJLA 2D3UA 3OL7A 5KFCA 1BY9A 1WHWA 2ROGA 1W2IA 2QYGA 1SQGA 1S1XA 2RSQA 2ZH5A 2HWIA 5M2PA 2XI2A 4M5IA 2VU5A 4GKJF 5I4MA 2Z30B 1MW7A 2X1AA 2IRXA 5A6WA 3LP2A 3QFHA 2CNLB 1N32J 2OPRB 3BQ2A 1FK9A 1TK5A 1YRTA 1V5IB 3OD2A 2XYGB 2ALZA 4TQRA 2N3LA 5KFGA 1A9NB 2DRAA 4QPTA 4XO0A 2YQ0A 5AXNA 1CQMA 3EUNA 3H8YA 3UN5A 2V2ZA 1T94A 2ZHAA 4NRTA 4I6AA 3N6NA 5I42A 4E98A 5KFJA 1YI2S 4LR9A 2NPIA 3KLIA 5L1LA 2HHUA 1M5VC 5KG4A 2CPIA 3FK4A 2IAJB 3IBWA 5D3GB 2J0QD 5F8HA 1Z2ZA 1WSVA 5LL6d 4ZJLA 5KAKA 1RT7A 1IWAA 4DL4A 4RUAA 2VF3A 2B7BB 3H98A 1FERA 4DEZA 1UAWA 2ZH2A 1V9OA 2MB0B 1QLNA 3NS5A 3VAMA 1CJTB 2G2YA 2DNOA 1SVDA 1TKZB 3EXYA 4ZPCA 1WG4A 1M5SA 2Z8QA 1NK6A 5F8MA 2D3OR 4E0DA 4LQ3A 5ETRA 2DGUA 4YR3A 4DX8H 3PW0A 3DRYA 3W63A 3KJVA 2YQ3A 2BM0A 3MUMP 4X4OA 2BRLA 1CLFA 5K14B 1Q8IA 2R9LA 3ZZ0A 4NLRA 3BGOP 1RABB 2QA4G 1U24A 2D69A 3RR8A 3FZ2A 2G0CA 4DPUA 3FQKA 3US5A 2BBEA 3W64A 2FJVA 1G4CA 4LFCJ 5B09A 3HULA 3U1MA 3H42A 4G1QB 2YWKA 1X5SA 3PFOA 4JI7F 3MCNA 1PKUA 3M8ZA 3PTWA 5MLCV 2FHKA 1KFSA 5D8HB 2HK2A 8AT1B 3W2VB 3OTOF 4H4KC 2JH3A 2HAFA 2A0FB 1IN0A 1RAJA 1YKWA 4E8UA 3W9IA 1Q1KA 2ZDPA 4MFBB 1U7LA 1IJFB 5B0DA 1YBTA 4WE1A 1FXLA 2GQ2A 4CLSA 2DB1A 3IWXA 3AD8C 1RTDB 2H5JB 2HWHA 4YQWA 4TLQA 2GVZA 2QA1A 2X3GA 3PEHA 1RCXB 1WC0A 4ZN3A 4ZVHA 3HD2A 3LO3A 3PW2A 1VK3A 3DI6B 1PAUB 5D4NA 4UT4A 5KT3A 4CQ1A 2Q1LA 2XBPA 4WFNQ 1NDCA 4NXNJ 3D5MA 4KC5A 3I5AA 1C1BB 3M2VA 2DPJA 2J8AA 4BLGA 3PX6A 4ANCA 2HAIA 2DNGA 3J81j 1O0PA 2UUAJ 2L3MA 3CJKB 1SJFA 3GQCA 3ZZPA 2ZM6J 4TY8A 1M1KT 4Q2MA 1YJNS 2I5JB 3MM6A 4PQUB 3MEEB 3QLHB 3PXGa 2OEMA 2LMIA 3A8EA 2KZZA 2OKQA 3NS7B 3C6UA 4ED0A 2I8EA 2UVRA 5EGYA 2C2DA 2XS5A 1XNQJ 1FEHA 3U1LA 4Y0FA 3S01A 3QRPA 1U1MA 2MKIA 1YX2A 4PQAA 4HT7A 3H5YA 1GEHA 4C9DA 2XMUA 3QO9A 2BMBA 4TU7A 2DGXA 4Y3CA 3FSIA 2C3MA 2AYEA 5A8WA 2V8GA 3O5TB 1T0TV 2MZJA 2EWHA 3DM2B 3MD3A 2K8GA 3F56A 1UW4A 2M0GB 2XSFA 4PUOB 2CQBA 1ITPA 1S6QA 4KYZA 2HYIB 1I94F 3NS6A 4U7UK 3D1OA 1P1LA 3SQGA 1N36F 4DDFA 3QJPA 4M5DB 4TN2A 2JNJA 3DU6A 3IRWP 3KUEA 4I69A 1OY8A 1PYSB 3QNWB 2NZCA 1F60B 5E5NA 2HQ3A 3RG6A 1FX2A 3I0RA 1N5SA 1M1GA 2GHWA 4IO1A 5LSRA 4LF9F 2R42A 2EFQA 2PGCA 3O3LA 3BM7A 2MQLA 4DCPB 1K1SA 3AD9C 3CJTA 2H3EB 2IVFB 2HZAA 4TYAA 2VPZB 3T9ZA 4RU2A 4IG3B 3ZFVA 3IGVA 2FVCA 1KTQA 3W60A 2MHNA 1R0CB 1E6VB 5I3UB 1U1LA 4ECRA 1JB0C 4OI3A 1AT1B 1YVFA 2VQEJ 5K8PA 1RTJA 2OI2A 3NGTA 3H25A 4S0MA 2FDNA 1MROB 1WTFA 4HI1A 4WP8A 2OP5A 4KJIA 3MAQA 4O3NA 2M8DB 3MMCB 1OYEA 3EGZA 3TP2A 5GVQA 2XLJA 5KTQA 2AZ1A 2C2OB 2OTLS 1L3TA 4DR4F 1B7YB 2E1RA 1IKWA 2U2FA 2RRAA 2PEBA 2IM3A 2YH0A 1YLXA 3LH2S 4U67Q 1QSLA 1X8DA 2VJUA 1V3SA 2W9CA 2ILZA 1YJWS 4JBCA 4ECZA 5G0RA 1BWEA 3SBMA 3M6UA 4MH8A 3CMQA 3M32A 3N5FA 5HI7A 2JVRA 2WB4A 2HG4A 5B7WA 3M7VA 5DG9A 4LSLB 4C3LA 4B9TA 3O44A 5FD1A 5GMKa 2F3JA 4I6YA 4A47A 1WC6A 1IBMJ 4TNOA 4MAKA 3K57A 4F3MA 5KFPA 1RK8A 5D0EA 1N4LA 2HVEA 1EQMA 2H65B 4M5HA 2DGOA 4PXDA 3JAMY 4KIAA 3OXFA 2HK3A 4DV2J 4JI1F 5K8NA 3PIOQ 1AYEA 5ETPA 4WU3A 1KSPA 3ETOA 5D4LA 1UL3A 1PC5A 1T11A 1S9EA 1NB2A 1HQEA 2UVUA 5A0YB 2CJYB 5HMYA 4GVBB 1XMBA 5E3RA 2CJXB 2I6WA 2CQCA 2XY6A 1RHMB 1WHXA 4KKOA 4DOZA 4NPOA 4ED3A 2EFVA 1V3ZA 3CDWA 1PILA 2XSJA 3GSDA 5L46A 1RAIB 2DCLA 4EK2A 5DM6Q 2CA9A 1UVIA 1YG0A 3ENVA 1U45A 3BGRB 3FBEA 3K59A 3GJTB 2UVVA 2IIHA 3A8IA 3GLJA 1WSRA 1KOOA 5JUMA 1JJHA 3KLVA 2F4VJ 1FXRA 1REGX 3VHQA 3OJUA 1CSJA 2DCUB 1VQSA 3PYEA 1RWKB 4WFAQ 2FVSA 4P6QA 1IVZA 2DTJA 4ZCLA 1FE0A 3Q8VA 5IT9U 1JLQA 1X4BA 1CG2A 2RKIB 1HWIA 3GTYX 2OMLA 2JFKA 2W9BB 4V19J 3Q23A 3MHYA 3G9CA 1SH3A 2PFFB 5DDOC 4R0EA 2ZZTA 1S6UA 1HWLA 4YUDA 4IO9Q 2B51A 3K89A 1NSQA 3CCLS 1FJGJ 4O3OA 2B7CB 2DR5A 4JV5J 3NCQA 2JWNA 3KG4A 2H54B 3ISZA 1LWXA 1RT4B 1OO0B 2OGUA 3E2EA 2P9EA 3PRDA 1P6TA 4HTJA 2HIYA 1QAXA 3UDVA 3GV7B 1TKDA 2BJ3A 1ZM3A 2QTWA 1QTNB 4ZVTB 3L7PA 4RR5A 2HHTA 4DV7J 4DR5F 2YNFA 3DXBA 3LALA 3P5BP 1WC1A 1GMWD 4B08A 2V50A 4L74A 1Y5IB 5BR8F 1FI4A 2IAJA 2GJIA 5D3GA 4MIAA 5HANA 4H54A 2HHHF 3CCES 1DTQB 1NXIA 4I2PB 1RHKB 3GWCA 1RT6B 9ATCB 4B3SJ 2XMTA 3CCSS 3THVA 3MECB 4B9MA 2E5LJ 1NSKL 1CJTA 2NXUA 1TKZA 4CO3A 2NXJA 2GIFA 2WB1D 2CXEA 4YFUA 5DGAA 2BXJA 1S9FA 5E33A 1VQYA 4PXCA 1J5EJ 3A3OB 1XMQJ 1OS5A 2WW4A 2CG8A 2D3O1 1AW0A 2FLLA 2NXEA 1RTZA 2ZUAA 1FFGB 2IPOB 3RAQA 4FKYA 1HNZJ 2RHSB 3CO9A 1WKLA 5J2NB 3D3BJ 3UCUP 2QLBB 5K14A 5IC4B 5CD4A 2KU7A 4XPEA 5T14A 3HD1A 1HW8A 1JLFB 4LRDA 4F3QA 4N8NA 3K58A 3M6XA 1RBAA 1WKKA 2YNHB 4IRKA 1HHSA 3P3DA 2DNYA 3AJ1A 3ADAC 4I56A 2E5JA 1RWPB 1URNA 2HWTA 2XI3A 5BYSA 4DSKA 2LVWA 2BYCA 5K9FA 5EUHA 4G1QA 2GO9A 1IM6A 4RW9A 1N54B 1H6KX 3J81U 2UXCJ 4PEOA 3T1YJ 2LLZA 3ZC4A 4CLUA 3W2VA 3MMAA 4QIEA 3R2DJ 3M8RA 1NDPA 5KFQA 4DG1B 3BGFA 4MFBA 2DITA 1SUQB 2CADA 4DV6J 3GIRA 3WHIA 5HMWA 3CEDA 5KT6A 1RTDA 1FA0A 4DU7A 4JB8B 2JZ5A 1HL6A 1H38A 4K4TA 5FJ4A 2KHCA 1PCAA 1TELA 4JI3J 2CG4A 5CD4H 2RU3A 3TA1A 4PYDA 4DL5A 4CDIA 2W01A 3DI6A 4ECQA 2FTRA 1GAOA 3RU0A 4NA3A 5LMNJ 3C6TB 1X9SA 1RAEB 1FTRA 1VQ5S 3H5XA 1ZAXA 2APOA 3F44A 1GX5A 4F4WA 3Q8SB 3CJKA 4R8UB 1DHMA 2I2YA 4D3HA 4ZVQB 2BKPA 4DQQA 2P9CA 1RADB 2I5JA 4PQUA 2HBYB 2X7IA 4O44B 3I9ZA 3MEEA 1A6LA 3JB9k 3QLHA 4X4QA 3H4DA 5IQQA 4IDKB 3THTA 4WXOA 2HHPA 3KMSA 3ILJA 1K9MT 5IV4A 5KFIA 3EDQB 4RUCA 3TJAA 1T03B 4WIIA 3FCVA 4FYDA 5LJ5Y 1EP4A 1ZAWA 1WWHA 1JJ2R 4GKKF 1HQUB 4ZKAA 1R8PA 4JOUA 3CCJS 5JJBA 1EHWA 3HVTB 5L1KA 4ED6A 1U0HA 3L4BC 2XYHB 1X5PA 3IAS9 3S8SA 2NSBA 3CWJA 4OZ0A 2NSCA 2ZBCA 2FY1A 4A8KA 3MR3A 5J1NA 4GVLA 4M5LA 3MGJA 3DM2A 3LANA 3CD6S 1I51B 1X5OA 2CFXA 2M7SA 4PUOA 2HNZB 4NLVA 2MQQA 4XK8C 3T5KA 4JI6J 1GMWA 1E6YB 2CPHA 5F9LA 4BHQA 3TAPA 4M5DA 1FX4A 1NZ8A 4DUYJ 5F8LA 1RAGB 1VFJA 3MR6A 2XMJA 2CDQA 1ZYQA 4MKBA 3NWGA 3DGVA 1RWNB 3CCZA 4LF1A 3K2YA 4RUBA 3OHBA 2AJQA 1OIAA 1EB0A 1X4GA 3SCLE 4X84A 3H2VE 3EGWB 4C8MA 3H5SA 1XMOF 2HQGA 1RWVB 2DT9A 4J9SA 3D9BA 2UVWA 1DQ8A 3RGIA 3TAMB 2DGSA 1VJWA 1S1VB 4DSFA 4DZDA 3CUNA 1TKTB 3IC1A 4IG3A 3GV5B 4N77A 2H48B 2AJ4A 4DL2A 3I32A 5DQIA 3CJ5A 1E6VA 4DV1F 5I3UA 1DY3A 4CH0S 1KFDA 1NJXA 1GK8A 3ENAA 3HHLC 1MROA 4PYAA 4LR8A 1HBOB 1NDLA 1IWGA 4HYKA 3MMCA 4MK8A 4K4UA 4LFBJ 4QWCA 2O01C 3IA0A 3N6LA 3BR9A 1URRA 1RT2B 3QBCA 4IFVA 2VFTA 4MKVA 4GO5X 2ZH1A 5F8JA 4KHRA 4IG0B 5KFAA 2GC8A 2HW3A 3HVWA 1ZZFA 2XCPA 3D3CJ 2Y9HA 4J9PA 3GYXB 2L9WA 3GPAA 2LP4A 3K5MA 5CCMA 2XNQA 3WBZA 2ZKTA 4NX9A 2WRMA 3HKZD 5E0OA 2VOOA 1JNRB 2VA2A 1VI7A 2FY8A 5CCLA 5HLFB 1C1CB 1CEZA 2DXFA 2KYXA 4X64F 4LSLA 2HNYB 2BE7D 2LDYA 4QIFA 3SDEB 3SSSA 3OVSA 1YJUA 2XMWA 4QYZK 4LQ9A 1VC6A 4M1KA 2F40A 4EMDA 2I38A 4G1IA 2NXCA 2HURA 1U1PA 1NPPA 3KTQA 5DM7Q 2ZOFA 4IYQA 1S48A 1PSDA 3M8PB 1CPZA 3HO1A 2RQCA 1N6QB 4K4ZA 2V8DA 2KZMA 1NH7A 1IR0A 1FRKA 2M52A 3CCQS 1F5BA 2NXNA 1YTYA 1KONA 4FYYB 1SJ4P 2KVQE 1WC4A 3PYFA 3P5TL 4C0HA 1T9YA 1HBUB 4DQRA 3T5HA 2RT3A 2AYGA 1N5VA 5DS7A 4CM0A 4LBHA 3UDEA 5A0YA 4GVBA 1VQOS 5E3PA 1UMJA 3A8KA 4M5MA 4YB7A 3MR2A 4URGA 4OZ2A 4EZ6A 4AQYJ 4NLYA 5ETMA 3R1LA 2WBMA 2KL8A 3PRBA 3BGRA 4YS2A 1U8WA 1GH8A 1WD6A 2DRDA 5ETLA 4WJBA 4CCHA 4F26A 2AEMA 4Q5VA 2V8VA 2UUCF 2AD9A 1Y7PA 4JI0J 4DFJA 5HROB 9RUBA 1D8ZA 3VZIA 3WIVA 3MZIA 4JI5F 2FJXA 3Q8RB 5C25B 2EG1A 3LUYA 2LQ9A 4FP9A 3TZZA 5CXTA 2F8EX 2E9RX 2RKIA 4ZP8A 3TJ9A 2W9BA 1VQLS 1P1TA 1FRIA 2WVEA 5GAEI 3K8VA 1FD8A 1S9GA 1WDDA 2NLWA 2HEKA 4C8KA 5DJBA 3TANA 3PR5B 2BX6A 5EHHA 3O6QA 2VASA 4JP8A 2YWFA 2XMMA 3CPWR 2MGZB 4J9RA 2MXYA 2EI5A 2R4FA 2E1CA 1RT4A 1EQ0A 2DR9A 3J7YI 3D2WA 1N5QA 2J6UA 1HI1A 2Q79A 3CNQP 5C2CA 4LF4F 2NREA 1IM4A 2DNRA 5HJYA 3H2UB 3K5OA 1VISA 3MCSA 4J9MA 3CJ8A 3D6HB 5HJXA 2XS2A 1HBNB 2GGPB 4TYBA 2BOAA 4X62F 1S6PB 3MM5B 3BZQA 3N0VA 4RL1A 1PIEA 3FCHA 1FESA 4R0JA 1P9YA 3GFZA 2OTJS 2DHXA 1BQMB 4DPTA 2FGOA 1HR0F 3BH7B 1DTQA 4OI1A 3PHTA 3D1HA 1T05B 4I2PA 4FNIA 1EJ7L 1RT6A 2FZKB 1UP1A 2C42A 2ZH3A 1X4FA 1CJKB 1F9FA 5HQLA 3DOKB 3MECA 1R7IA 5E3CA 4DFMA 2AU0A 3AXMA 2ILYA 1TUVA 2KTQA 5F8NA 3FJ2A 3OLBA 5DG8A 4TQSA 2JSXA 3TZXA 2J0WA 5HVGA 1PBAA 4GKJJ 4OHXA 4B3MF 2YKOA 4ALZA 3FVYA 2W24A 1IKYB 2CWXA 2DHHA 3KOAA 4USJC 1TL5A 2OD4A 4HHJA 3W9HA 2B8PA 4O3PA 5J2NA 1PO6A 5D4OA 4NI2B 2W1BA 1UJ5A 2FJWA 3J7A1 1JLFA 2C2MB 2X1GA 1MWZA 2EKYA 2ASDA 2DBBA 2E7WA 3CT9A 4NYPA 1WF1A 1Z1ZA 2YNHA 5DZ7A 1TFWA 4L6V3 4RX6A 2G0IA 2NCKL 4XDDA 4HACB 1VBXA 2AIRB 2D3ZA 4FBUA 2MKSA 2IFXA 2CPEA 4DZ6A 4LF8J 4ZPDA 4ZVSB 4WK3A 2R3VA 3T41A 1H72C 4RBTA 3HLUA 4IUFA 5U47A 3LAMA 5JVGQ 3OSPA 4J9LA 4OLOA 1IBLJ 1GX6A 4X66F 4LSNB 1MWQA 4DG1A 1X31C 2ZJPQ 1SUQA 1TQLA 1XERA 2HLUA 2JJ4D 3I96A 4LIRA 2GCFA 1OMSA 1F1BB 2XC9A 3PW4A 1UVLA 4DR2F 2Y0SD 1UVMA 4ZCMA 2W2MP 2OH2A 2XMAA 3IFEA 2ZDOA 4DSLA 1YQHA 5ETQA 3CW2C 4RW8B 4YR0A 2ZD1A 1RHUB 1RGVA 2JLFA 1QVFR 3G96A 4AXJA 3RJMB 1RLCL 1OPIA 3P45B 5IV3A 1XNRF 4R25A 4USUA 3C6TA 2KN4A 3CCMS 3BREA 4RLEA 4YDXA 1NEEA 1RHJB 2DRBA 2QO3A 2Q3PA 1TMMA 2MQPA 2DGQA 4OYPA 1KNZA 3G6XA 1KEKA 5CYMA 4R8UA 3GJQB 1TP7A 2IM0A 5ITHA 4O44A 3FRZA 2RDDA 1EARA 1M0SA 4IDKA 1HNIB 3UDCA 3N6MA 3J7ZT 4UY8T 3OTOJ 5KT2A 2BVZA 4GC7A 1T03A 4B02A 4M95A 4CZCA 4JI2F 1RYSA 2Z2MA 2RDJA 3VQTA 5GAEU 3CC2S 1HQUA 1RYRA 2MYFA 2Y1LB 4X4UA 3HVTA 2BJ7A 2VDIA 3JTPA 5KFRA 4OYZA 3TVZA 1NKCA 4WPAA 2EFGA 1N88A 4OYIA 1CVJA 2XGQA 1SKRA 3FZBA 4LR7A 4BS2A 1SH0A 4ZLNA 3EZUA 2UV8G 4ITSA 4K2JA 2YKNB 7FDRA 1EKSA 3JQMA 1KTVA 3J7YU 3I87A 2HNZA 1OY6A 3NGRA 3HMJG 3M30B 1FE4A 1E6YA 2F9DA 3IR7B 3N9UC 2MZRA 4EYIB 3FEYB 1TAUA 4EO8A 1BMQB 3MM7B 2J6TA 3ZZOA 3M8WA 1B70B 2D41A 1VQ6S 2B9YA 2MPUA 5B0CA 1NJZA 4C4WA 1QUVA 3RB6A 3PW5A 5B0EA 4DUZF 3ZXWA 1Y00A 4F2SA 2C2KB 2B9WA 1D3WA 2EFNA 1IBKF 1RT5B 4RWWA 2RRBA 4Q44A 1SB6A 4Y6IA 4DPXA 4P2SA 1DZ5A 4RKUC 5D0RA 3K17A 2XY5A 3TAMA 2B56A 1VRUB 2UUBF 3BKFA 3FMBA 1S1VA 3GMGA 2LU1A 3SQOP 2FJBB 1SC4B 2FQQB 4J90A 1TKTA 4TXSA 4HKQA 1HW9A 5KOXA 2P6TA 2QL7B 3BH6B 3OW2R 1VQKS 2FVQA 1SKWA 4EUVA 1SJQA 1D1UA 1HFEL 3G8TA 4U6PA 2BEFA 4HVZA 2R7TA 1J27A 3W2WA 3ITHB 3EXCX 1U49A 2Y1RI 4O0NA 1S1UB 3D68A 1HBOA 3AAWB 1DQ9A 4OX6A 1S97A 1QY7A 3IBCB 4QBUA 1I94J 4DSIA 1RT2A 2H5EA 4NLTA 2DNKA 4WP9A 1TL7B 1N36J 3T1HF 5KFEA 1TTHB 3TEGA 1YJ9S 3UD5A 3TQ1A 2FVPA 2K7KA 3RTVA 2Y8WA 2N7CA 2HQDA 3SV4A 2F1FA 4CO0A 3R5AA 1VLOA 2NPFA 2W7OA 5HLFA 5E3QA 4LF9J 1C1CA 3PYGA 3QRQA 3P8BB 4UW2A 1JLAB 2HNYA 4DR7F 4ICLB 3TAQA 2M70A 3SDEA 2YBVA 5J2PB 2HNDB 3EMTA 2LA6A 2WCXA 2ZJRQ 1VRTB 3CCTA 4KRWA 1NK8A 1Q81T 3M8PA 4C11B 1N6QA 2M88A 1BXNA 5HMXA 2YX1A 1YBUA 3GYNA 4CIOA 1FRMA 2XWXA 3HT0A 3TRGA 3OL9A 4H4OB 1OY9A 4OZ3A 1HBUA 3CMAS 5I3PA 4YY3F 4TLRA 1UPPA 1VC0A 1F6TA 2LU2A 2E9TA 2DGTA 4DR4J 1Q5YA 1W25A 2X3DA 2LQJA 4CNYA 1U2CA 4JYAJ 1U2RA 2VH7A 3KUGA 1RT1B 4C8ZA 1XJWB 4DHVA 4LSZB 2EW9A 1RSCA 2LECA 4DS5A 2QIFA 3FEXB 5HROA 4XTTA 2J8SA 4DR6F 3VVUA 1UFWA 3K7RA 2AX0A 4OI0A 1DTTA 5C25A 2V8PA 4JI4J 4EU0A 5JVHQ 1AZSB 5EN1A 4J91A 4J9QA 3B8HA 1WJ9A 1H3DA 1YK9A 3OVBA 5B0FA 3G87A 4DX7A 3IS9B 1R8AA 5EWFA 1R8CA 5KFKA 2ZKUA 2HVDA 3D28A 3Q86A 2PIIA 2W25A 4A8FA 2PA3A 1RI7A 1V3RA 4ZHRB 1NUEA 3QZ8A 2J7UA 3PR4A 5ETTA 2MQNA 3LP1B 4B3TF 2A18A 2YWWA 1AA1B 5HK4A 1HBNA 2GGPA 3X3UA 1X4DA 4USTA 4QIWD 1S6PA 3TO8A 3QT5A 5HL7Q 3MM5A 3RUBL 3QSYB 2CZ4A 4ED7A 1N32F 1VBZA 2ZE2B 3OVAA 2QLWA 4OX7A 2KFNA 3VGSA 1M5OC 1BQMA 3MF5A 2DXEA 3IXQA 2YX4A 4F04B 1S7HA 2RS8A 4AT1B 2BQ3A 4OZ5A 2IY5B 1O5JA 4W92B 2W2OP 1T05A 2VG7B 4RNFA 3ZZZA 5CYJA 1CJKA 4C98A 4A8WA 3BN4A 5E2QA 4USVA 4IQXA 3UCZP 1RAFB 3HHLB 4NZ0A 2W4DA 1F2HA 3ISNC 3HFVA 5IXUA 1HNXJ 1MMNA 4YDDB 2HMIB 1NZAA 2MDAA 3QWUA 1HWKA 2IM2A 1IQTA 5M2RA 3LQVA 3PYDA 1HNVB 1FNXH 3EWGA 2KH9A 2FHMA 4ETXA 4UTGA 3C19A 3EZ5A 3QJJA 2C3OA 2V9WA 2Z57B 3ZNJ1 4ILLA 1RA7A 4USWA 2DR6A 4Y34A 4DR5J 3OFHA 5GADI 1VQ8S 3BGUA 3AFGA 1WOOA 1UJ4A 2DH9A 3DLJA 4B9UA 2HRUA 1XIQA 4ZPVR 3C16B 4HACA 1K73T 2H4WB 1J5OB 2OSQA 1F5CA 2HHHJ 4DPWA 4FDFA 4KR0B 1Q8BA 4PWDB 4NLUA 5BXIA 2R7VA 3H5UA 1H74A 1YDLA 3BSNA 2LEPA 2M2BA 4K4WA 3S6EA 1BD6A 3GFXA 1FNMA 1WHVA 4LSNA 4OL8A 4LF5J 3TJ8A 3SCJE 3E01B 4F2RA 2ATCB 2GA7A 2QFJA 2ZNZA 3OV7A 3RRHA 4ZN1A 1PYTA 4F4ZA 1FDNA 2K3KA 2IA6A 4WYWA 2ROPA 2EXUA 1WUUA 3BGLA 5K5MA 3Q24A 2KJWA 3JAMU 2W2PP 4RW8A 4IQMA 4DQSA 4MKAA 4ZJOA 2W8LA 3CJSA 5LXRA 3QWPA 1YHQS 2A2CA 3HFZB 1Q7LB 4C3MA 3CJ0A 4M5JA 2Z58B 1UFKA 4ZVPB 2YWGA 3L09A 2NUHA 2O5DA 2MJUA 4ELTA 4EYHB 5KFXA 1B3TA 1U09A 3BBFA 4Q2LA 4OJGA 2AGQA 3R6LB 2F7VA 1N33J 3V6DB 3J7Z5 1K0VA 1NB7A 2R8JA 1B64A 3SFUA 4WBFA 3HHKA 4NCGB 2N3OA 3I5BA 4PG7A 2DNHA 4C48A 4FKXA 4KPYA 1HNIA 5AJ3F 1NK9A 4RZRA 3C66A 3KHLA 3ZTPA 3VAKA 7AT1B 4J5OA 3BB5A 1EZZB 1RKJA 3MAHA 2BQUA 2ZM6F 4KSEB 2J9DA 2F8MA 3GCWP 1IKVA 5F8IA 1U4BA 4MK7A 4B17A 4X4PA 1TR0A 4PRFA 4USHA 1IR1A 1A0OB 3NG8A 3H40A 2OIHA 3POTB 3TZYA 3MTJA 1T7PA 1H98A 2J6SA 2YKNA 2YTCA 2HZVA 1VHIA 3RBEA 3C14B 1DRZA 1VIOA 1GXLA 3Q83A 4YMEA 3D0HE 3M30A 5KG3A 5KFZA 3GE9A 4QU6A 1AFJA 2E1MC 1SJRA 3MM7A 3PVXA 4ETZA 3M8SA 3CIZA 3DN9A 4FF1A 5LMUJ 3THPA 4QYRA 1LV5A 4NZ6A 4DPOA 5BJRA 4AUKA 2NYHA 1QDUB 4LUBA 1VIXA 2HGMA 1RT5A 2XMKA 1H2UX 1GTHA 1KVIA 4LRCA 1T95A 4K4XA 2RB7A 2M9KA 2AJFE 1GMUA 4DFPA 2PD1A 2IYGA 3VR1A 4F4XA 2CQPA 1VRUA 2OEJA 1LW0B 2VFVA 3I56S 4GKKJ 2BABA 1UFLA 3FSXA 2KB2A 5DDRC 3GFYA 1R8BA 2CPFA 1HLWA 4LT6A 1VQ7S 3AQOA 2C2EA 1RLDA 4WP3A 3HHLD 1BUXA 1TL3B 3P96A 2WVBA 1REVB 1S1UA 2HBRB 3GG0A 3KG0A 4ECSA 1NRKA 3RAMA 4C0BA 2LXIA 4OV6A 3UW1A 4DBQA 1MN7A 4PPZA 4OJHA 1TL7A 1V5VA 2AW0A 2NZ4A 5HVFA 1YRXA 5AXLA 4I2QB 2R2SA 2DGWA 1UEVA 4G1PA 5GADU 4ELVA 4RU9A 5IM0A 3PO5A 3MOJB 1TU0B 1PJ6A 1LWFB 1VBYA 3MMBA 3T1AA 1NMEB 2HFVA 1NDKA 2UXBF 2AJ2A 2QZ8A 1SIZA 3FCWA 3NBPB 4DV4F 2HFZA 3K8WA 3GJSB 3IRXB 3I4HX 1OSCA 2AYBA 4X4VA 3HDSA 2IBOA 3A4TA 4Q8FA 3W1YC 3AOBA 4ICLA 2IBKA 3KHRA 1SQFA 1NJWA 4JV1A 5J2PA 2CZ9A 2HNDA 4YHHF 4YB5A 1R3NA 1VRTA 3R97A 1RQ0A 3IAM9 2J0SD 2CYYA 2AP6A 1R0BG 4C11A 1HNWJ 4DV1J 5KFVA 4K4YA 4KAIA 3MEDB 3NCRA 1TVRB 2WVCA 4H4OA 1X4HA 1U48A 3OJSA 3RRGA 1LWCB 1FVSA 5GAGI 1XK8A 2R8GA 2BOPA 4NLSA 2N4CA 4X65J 3AODA 5HP1B 2BJEA 3EGNA 1SPBP 2A2DA 4DLEA 2J9EA 2LQ5A 1IXKA 3KDNA 4WIQA 3BSOA 3PRVA 3BBBA 2RE1A 1RKIA 4FF2A 1D09B 1RP5A 1RHRB 1VHFA 4JV0A 1RT1A 1LW2B 3OR1B 5EWGA 3MURP 2V68A 3SIPB 1Q8KA 4A8SA 1W2BR 2CDRB 1X4CA 4QIVA 4X64J 1FD2A 2E5HA 2W9AA 1N8RT 2R7XA 2D74B 5L39A 2NYIA 1DLOB 3FBBA 3N5BA 4UUXA 1OQ3A 1SIWB 3RBXA 2RU9A 4ZMMA 3IP0A 2CNNB 5D77A 2JOQA 2J9CA 1AZSA 3QIDA 3SI8A 3J81Y 2XQCA 1QSYA 3T9NA 4I7FB 1LXJA 1JXEA 3R2CJ 1ELOA 2VG6B 2YVSA 4KQZA 2HKEA 3BO4A 4L3KA 2IHR1 2VPXB 2VBWA 3IS9A 3V4IB 3QMQA 3VQSA 1FRJA 4DR1J 3TZWA 1PJ5A 1WOPA 4DWIA 4ID5B 4JI8F 3FQLA 4IH6A 3OTEA 3V4MA 4QIGA 2OFGX 4NEZA 3DDIA 4AFFA 1ZH5A 4ZHRA 4FBTA 1N0UA 3E3XA 1NK4A 3V2UC 2G2OA 2AEJA 1Q86T 1XR5A 1Y0HA 1KKHA 4C97A 1JJCB 2QN6B 1FRXA 3A1YG 4LF6F 2FIUA 3LP1A 1NPRA 3NL0A 1RWMB 4U95A 4JV5F 5L38A 1WG5A 4KT0C 1FT8A 4MYUA 2MMYA 1HQ2A 4Z37A 5KFBA 1S6OA 2V2KA 1R89A 3HHDA 1VMBA 3OL8A 3GIKA 4M94A 5KT5A 5AE2A 3NOGA 4JI5J 1U02A 4YP3A 3KG1A 1QAJA 3X1LB 5HAOA 2VG7A 1ZA2B 1YZ7A 5EX0A 3LAKA 3BQ1A 2IC3B 4CLKA 3CC4S 4BWMA 2VC1A 2CVIA 1I1GA 4V1Ak 2KT2A 3HHLA 4L76A 3WX4A 3QT6A 4Y2KA 3SFGA 4CYUB 2BV3A 2ASJA 1FFSB 1OPZA 4PKDB 4ZPWR 1IUJA 2HMIA 2CJAA 2CJKA 5GMEA 5HATA 2WW8A 4ZDNA 3ETMA 4KB7A 2YNIB 1HNVA 3MWBA 1D8YA 1ZPVA 4U7UD 1RCOB 3CE8A 4WFXA 5D15A 2F9JA 4NLPA 3OTDA 1XEZA 2PMZD 2XY7A 3VAJA 2L41A 5ETOA 1XMQF 3MOZA 2PT0A 4X62J 1XC9A 2OEKA 2AGPA 3DOMB 1JLBB 4OHYA 4GRSA 4N8OA 1NK0A 2AKWB 2CNOB 1LK5A 4ANEA 2E5IA 3C16A 3KJFB 2PA8D 1Y10A 2VFUA 4ES3A 2F65A 5THWA 2R2UA 4ECTA 4O3SA 1SV5B 4PWDA 2X51A 1KQGB 4ZVUB 1U47A 1S99A 3CDUA 1FDBA 1ZETA 2EEYA 3NGDA 2VICA 2XM3A 1HI8A 2MHEA 3VGVA 3GB0A 2Z2ZA 4RNOA 3BPSP 5LT5A 4DS4A 3UN3A 2DEIA 4KV8B 5L9XA 4N56A 5H9FJ 4QW9A 4NLGA 2QL5B 2DO4A 2ZH7A 1RT7B 2C2NA 2UU9F 4B3MJ 1VBKA 1SI9A 1N0VC 2RQMA 1QSSA 2OO4A 4ZVEA 3NGUA 1QTMA 1KVKA 5F0UA 2EK1A 1M1HA 3R1HA 3RR7A 3AXKA 3NGSA 3R27A 2JVOA 2G0JA 3HHNB 5CAAA 3GU0A 2F8HA 3T5JA 2RNEA 5FLXY 1WACA 2Q43A 2IA0A 2OPQB 3V6DA 3KFWX 4ZK7M 2KKHA 3DYAA 4N76A 2G13A 3M9MB 4NCGA 4TY9A 2VQFJ 3Q2SC 1W26A 1U0SA 4PR6A 2FC8A 1N34F 2PO4A 4NLWA 1TZ0A 3HVAA 4OJ3A 1FWPA 4X66J 4CLLA 5L8RC 4B3OB 3OFGA 2WOMB 4USIA 1S49A 2W2QP 2DK2A 1RXOB 2YXLA 1U1RA 2VPYB 3GG1A 5A8RB 1VCTA 4AL5A 3BSAA 1B0TA 1LWEB 4P52A 3I4PA 3M2UB 4ZLLA 1RTHA 2QL9B 1KRPA 4R5PB 3JQKA 3POTA 3SSQA 3T3FA 4RW6B 3LWLA 2GZOA 4BC9A 1HIYA 4DV3F 3IM8A 4NCBA 5HVHA 1XNRJ 2BJ1A 3C14A 3D0GE 4ZPBA 4PABA 7FD1A 4ECWA 2RDIA 4CTAB 1KQKA 2HGNA 3DLKB 5ETNA 3IWLA 2XWYA 2UXDF 6AT1B 1FJ7A 2WTFA 5F41A 4LFAJ 3NNCA 3CCUS 4LF2A 1PGZA 2B0GA 1XQIA 3DMJB 2OELA 1H7XA 3A13A 1Q95G 4BDPA 2XNRA 3Q8PB 2L9DA 2L08A 4CT9A 4WZQA 4NEYA 2A10A 1IQZA 2VBZA 3IN5A 4UZBA 3U02A 4DCOB 3G8QA 4JI2J 3NMAA 1EAYC 3TVKA 1X9WA 2OPSB 2HFUA 1X60A 4CI0B 2CQGA 4IRDA 5KFTA 1LW0A 2ACMA 5CZXA 2P6SA 2AJ1A 2IMWP 2MZQA 4M5GA 3MM9B 1XR7A 2G4BA 3NXZA 4KTQA 2KI2A 1FDDA 1NKEA 3L95X 2QMUB 3JTOA 1UVKA 1AB8A 3Q8QB 3D6MB 1MWYA 1ROFA 1TL3A 1S72S 3KK1B 3WQPA 4KGZB 4ERDA 2WAQD 2IRUA 2XCAA 4PXEA 2R7QA 2EPIA 5AXKA 3GYGA 4OIXA 3CCWA 3W8PA 4I2QA 1JJ4A 1N5YB 3NP5A 5EDWA 2Q6BA 1HWJA 3DC2A 2H9ZA 4A8XA 1LWFA 4J9NA 4DLGA 1LK7A 4LFBF 1P9QC 1BGXT 3G6YA 4L75A 2RILA 4RO0A 2CQ0A 3QGHA 1M5HA 4G3IA 3BEGB 3TOQA 5IZHA 1IBKJ 3R7NB 4N7TA 4NYZA 2WVFA 3IRXA 4WCEQ 2OPRA 1Q78A 4GO7X 3R6GB 2CQ2A 1QUPA 1WC3A 2Y1JA 2R7SA 3H59A 2DNMA 1S5ZA 1KD1T 5KFLA 2OLWA 4OZJA 3FC9A 4A8MP 2UUBJ 4ZCIA 4PWWA 1HD1A 4DJBA 2LDIA 4YB1P 3OPKA 2QA2A 5DDQC 2BACA 3HF5A 4K5SA 2QFIA 1RHQB 4NRUA 4DV0F 3KYLA 3E51A 1BQNB 3MEDA 1TVRA 4WFZA 1SJ3P 2DNQA 4NLQA 4KH1B 4CO5A 3OLAA 4F7VA 3Q2TC 3ZZYA 2MLZA 1LWCA 4YEAA 2GV1A 3CCVS 5HP1A 1Q5VA 3S7RA 2AHOB 3HKWA 5L1JA 1RWXB 3HSZA 1RTJB 1FWKA 1RAOA 3OR2B 3T1HJ 1NPKA 2QYCA 5JXSA 2HHQA 1KC8T 2KFZA 2DR7A 1Y4ZB 2Y3YA 3RBZA 1Y3KA 2MY8A 1LW2A 4W90B 4C3KA 1R6YA 3SXLA 4E2FB 4U7CA 1FF2A 3VZHA 4DR7J 3PJ9A 4RW4B 4ZP9A 1DLOA 4DL0C 2C3UA 3DU5A 4AQYF 4UF4A 2NQPA 4RJVA 4FS2A 3NGKA 3MXHP 1HMVB 2LXUA 4I7FA 1UVNA 2VG6A 4IR1A 4FF3A 3ZTOA 2DNNA 4JI0F 4TU9A 2ZHOA 2GIQA 5C42B 3V4IA 3O2IA 5MAOA 1W7WA 3G82B 4C2MA 1EETB 2KXNB 2V4RA 4ID5A 3MTKA 4ZOSA 2G1HA 2WHOA 2IDLA 2D1CA 1S0VA 4UOFA 4I0WA 3NOCA 3Q8UA 1MMDA 1U26A 4LVOP 1K44A 4OYAA 1WF0A 5F0WA 3H0PA 4M5NA 3PHEA 1KHVA 3J80U 3L9ZA 1WG1A 5M2UA 2KHDA 3R8YA 4Y2IA 5KFNA 3PNIA 4BCAA 4B3RF 4EI2A 4IFYB 4J9VA 4DR6J 4W98A 1PAEX 1JNZB 5E7OB 5B0AA 2P5VA 5IS2A 1U2FA 1GFWB 2BRKA 2A3JA 4DV5J 1C1BA 3DRRB 5HN0A 4CH1A 1EX8A 2IC3A 1B4SA 2IJNA 4OYBA 4CLWA 5IWAF 4OI6A 1WELA 4FYXB 1S77D 2R8IA 3RBDA 3QYYA 1VS3A 4DR3F 4CYUA 3JYTB 4NZ7A 3ISND 5KG1A 2MZTA 1LKZA 2WK4A 1ZA1B 3IBFB 4C0OC 3D4JA 2YNIA 5KT7A 3SZ2A 2HLTA 4NMLA 3FBFA 2VDHA 4YB6A 3AHPA 1V6HA 3TWZA 3WZ0A 2AT1B 3EYZA 4B3TJ 2YKMB 4CLPA 2EBGA 5KFYA 2V67A 1MSWD 4ZVGA 4HDGA 1VQ9S 5KFDA 2FGCA 2W4CA 3DOMA 1JLBA 1GMVA 4FPRA 4ED4A 4OYXA 4DSEA 4J9OA 3M1VB 2C2ZB 3CB4A 4W4MA 3HXMA 5EX3A 3DKDA 1YZ6A 1ULRA 4CM2A 2BM1A 3SCKE 1WNEA 2DH8A 2NUUG 2KXHA 1SV5A 4KPCA 2YNFB 1Q4RA 3AOAA 3MCMA 2HVZA 3KLFB 1NHVA 1ZTTA 1HYSB 2VG5B 3BV8A 3TARA 2GMLA 2YPYA 2DR8A 3LW5C 2V5HG 5H9EJ 3IMQJ 2B4PA 1CQNA 3V6JA 2XZDB 1O6XA 3DRXA 3NRBA 4LF8F 4KV8A 3UQSA 3OSNA 3VAHA 4C8NA 4I4BA 1O8BA 2E7XA 2W7AA 1S12A 4OZ1A 3IG1B 2QC3A 4F0KA 2PMWA 4RNHA 1IBLF 1ICEB 1FXDA 3WC0A 2ZOMA 3HT3A 3B78A 4H4MB 2IDEA 3BDEA 3VWSA 3T19A 5AE3A 3HX9A 1OYDA 3NNAA 4NL5A 2HGLA 2JLEA 3O8WA 3L3CA 4GMKA 2OPQA 3KJNB 1WI8A 3FBCA 2PMHA 5IFMA 5T41A 3M6VA 2EBEA 2CPZA 2LEAA 2V2VA 3A3NB 3DLBA 4DSJA 5AXMA 3TUPA 3N4WA 2CVEA 1VC5A 4HTIA 2N7YA 5KG7A 1AXQA 4X4TA 3C15B 4FS1A 2RQKA 3VTIA 4B3OA 2WOMA 2ADCA 4F0HA 3PFEA 4FXDA 3W9JA 5A8RA 4RW9B 1LWEA 4TVAB 1WC5A 3M2UA 1SKUB 3G4SS 3UE2A 2ZVSA 1N52B 2W4PA 2D7SA 3MMAB 3W65A 4MKYA 4R5PA 3HJVA 4RW6A 4KH0B 3JXOA 2RVJA 4LREA 3CJ4A 1Y5LB 3RB4A 5KG5A 1UWBB 2OSRA 2DYAA 3MFIA 4F25A 4ATNA 4A4JA 1L5UA 2ZNYA 4CTAA 2W8KA 2YX7A 2EFOA 2MTLA 3MEKA 3DLKA 2QGFB 3M4XA 2B6AB 3RW7A 1I5OB 2ASYA 3TA2A 2HHXA 1BQXA 2G9OA 3Q22A 3CO0P 1NNDA 1U1OA 4DX6A 4OFZA 5DG7A 3JSBA 3DMJA 5IT4A 1HA1A 1G1XA 5AJ3J 1N56A 2V8HA 4MMOA 5LXYA 1NM2A 4P9SA 4WFBQ 1VQ4S 2OPSA 5IC6B 4F0MA 1KHWA 2GIRA 4Q45A 3MPUB 5DLGA 4MJKA 1D9DA 4P2FA 2DY9A 3D67A 3MM9A 4I68A 3DRSB 2FJEB 2K3IA 1FKPB 2IVMA 4GC6A 2RD5C 4DN9A 4TU8A 2V0NA 2GMJA 1XR6A 1QE1B 2HPUA 4NLDA 1EP4B 3KK1A 2HFNA 4ZVOB 4CO1A 1Y11A 4KE5A 1FEEA 2MLXA 1FFWB 3L7OA 1FWLA 1FHTA 3PACA 3LF0A 8ATCB 2EG2A 3O1LA 3TW0A 3PW7A 1U0HB 2QE5A 3N28A 3PDNA 4LVNP 2J0XA 2MQMA 2KM8C 2XGPA 4RBUA 1N5YA 3JS9A 1B0VA 4FZVA 1Q0NA 4NXMF 4OJ1A 1NH8A 4P71A 2QLXA 1DFDA 2DIUA 1NCLA 2AF6A 2YWEA 3QIPB 3IR6B 1X9MA 4U8VA 1MLAA 3EX7B 4LF7F 2A6OA 4QJVA 1S59A 1MU2B 1DBDA 1F0XA 2ZWPA 2POKA 2OUGA 4B9NA 4ZA1A 1JK9B 3IO1A 5C2GA 5C7PA 2JDJA 2FC9A 1BQNA 2CNKB 2COLA 2UUWA 1YGYA 3G71S 2BKOA 1VOMA 2UV8A 3FEZA 2BR0A 2HRTA 2B9EA 2G1DA 1GXTA 2CQ1A 4QZVB 2MQOA 4FVCA 5DDPC 2DIVA 3QAUA 4N47A 3ZZUA 3OR2A 4ED8A 2QRRA 2ZITA 1MNEA 2E44A 2V4QA 1C4AA 2RIJA 4K5RA 2CQ3A 2J76E 2GX8A 1FRLA 3B82A 2BANB 1SL2A 2GQQA 5FDLB 1WEXA 2UXBJ 4IFVB 2XHWA 3HZEA 4NOHA 4DV4J 1RISA 3TA0A 4WTOB 3RB0A 1Q53A 1S10A
chains in the Genus database with same CATH topology
3PJXA 1T3NA 4RW4A 1YSJA 3PX4A 4FYDA 5LJ5Y 1R8HA 2LA4A 3V81A 1HI0P 3PKMA 3UW1A 4DBQA 4FXWA 2N82B 4KFBA 4PPZA 1EP4A 1ZAWA 2M4MA 1WHYA 2XLKA 4OJHA 4F4KA 1WWHA 4O3RA 3GIIA 4JYAF 1JJ2R 4GKKF 2AW0A 2NZ4A 1HQUB 4ZLPA 1YRXA 5AXLA 4I2QB 1D9AA 1SBRA 1YJRA 4ZKAA 5D4PA 1R8PA 1KLNA 3C46A 4JOUA 2R2SA 2DGWA 1UEVA 1HMVA 3TR5A 3HVTB 5JJBA 3CCJS 3KLEA 5L1KA 4G1PA 5GADU 4ED6A 4ELVA 3UCGA 4IRCA 4RU9A 5IM0A 3PO5A 1X5PA 1S0OA 3IAS9 3MOJB 2KG1A 1ZAVA 2NSBA 3S8SA 3H20A 2QT7A 2VL1A 3CWJA 4OZ0A 1LWFB 2PI4A 2NSCA 1VBYA 2SXLA 3MMBA 2ZBCA 3DGPA 2FY1A 3T1AA 1A7GE 3LWMA 4A8KA 3MR3A 2GMHA 5J1NA 5C42A 2KT5A 2UXBF 3MGJA 1YRUA 1Q8LA 2QZ8A 3DM2A 1SIZA 1EETA 3LANA 4A8YA 2HVHA 1G7CB 3NBPB 3CD6S 4JI4F 4DV4F 2DPIA 2HFZA 1VQMS 3K8WA 1HWUA 1X5OA 3IRXB 2CFXA 2M7SA 3I4HX 3KHHA 1OSCA 2AYBA 4PUOA 4X4VA 4KHMA 3HDSA 2HNZB 4QR0A 2IBOA 4BBYA 2O67A 4Q8FA 4NLVA 4QOTA 2R7RA 4ICLA 2MQQA 4XK8C 3T5KA 2IBKA 4O0IA 3KHRA 4CO2A 2CQHA 2ZZNA 1NJWA 4JV1A 2VBXA 3CD5A 4WE1B 2CJ9A 5J2PA 2MJNA 4ED1A 4JUZA 4X4RA 2HNDA 5A2QY 3TUIC 3TNVA 5HQ8A 1E6YB 4YHHF 2CPHA 2PEHA 4YB5A 5F9LA 2XZWA 1R3NA 4BHQA 3TAPA 2IMOA 4M5DA 3WC2A 1VRTA 2JX2A 1RQ0A 2ZBIA 3IAM9 5F8LA 3I9V9 1VFJA 1OSDA 5E3AA 2J0SD 2CYYA 2BUNA 2AP6A 2ADBA 3MR6A 2V4JB 2D9PA 4EZ9A 4CT8A 5KG2A 4C11A 2QSWA 2XMJA 2CDQA 4EBCA 1ZYQA 3JSYA 3CULA 5KFVA 4MKBA 2CRLA 4YOEA 3MPWA 4XIUA 1IJEB 3NWGA 4CO4A 4K4YA 2VC0A 4KAIA 1VK8A 5KFWA 2UZAA 2YNGA 3MEDB 3NCRA 3VAGA 1XBWA 1TVRB 3I82A 3CCZA 2CIMA 3K2YA 2FVRA 4OZNA 3OHBA 1TK0A 2AJQA 4IOCQ 1QAIA 1OIAA 2B4OA 1X4GA 4PG5A 4H4OA 1X4HA 3SCLE 1U48A 3PKYA 1FKAF 4X84A 3OJSA 2VKRA 3I0SB 1KS2A 3RRGA 3H2VE 2GJ2A 3EGWB 5AE1A 4C8MA 1LWCB 1FVSA 2JHEA 2YKAA 3H5SA 5GAGI 1XK8A 4QR2A 4WFYA 2JEIA 5LSLA 4F02A 2R8GA 2BOPA 3OUYA 4IFYA 1XMOF 2VB6A 4NLSA 2KDOA 3TUJC 3M2VB 2N4CA 5CHCB 4UOCA 5HP1B 2DT9A 4JI6F 2BJEA 4F50A 4J9SA 4AL6A 1FJCA 2UVWA 1DQ8A 6FD1A 3TAMB 3EGNA 2A2DA 2DGSA 3DRPA 2OD6A 2J9EA 1VJWA 4DLEA 2AGOA 1S1VB 2LQ5A 1IXKA 4DSFA 2DHAA 4O23A 3BSOA 3CUNA 1TKTB 3PEJA 3IC1A 3DRRA 4IG3A 3GV5B 4N77A 2YWHA 4DUYF 1T02A 2RE1A 3U27A 1RKIA 2AJ4A 2B4VA 4ES2A 4DL2A 4TY8B 4WTYA 4FF2A 3I32A 5DQIA 3HHEA 3CJ5A 1RP5A 1E6VA 4DV1F 5I3UA 2C3PA 2EVZA 3MM6B 4OZLA 4CH0S 3G6ES 1KFDA 3PZPA 1HD0A 1NJXA 1B7FA 2AYMA 1VHFA 4UUWA 4KHPF 1R43A 2E66A 2U1AA 2CPXA 5KFSA 5F8GA 4JV0A 2HFOA 1RT1A 1LW2B 3HHLC 3P6YC 4OI2A 3SYZA 2I0XA 3OR1B 2FLOA 1RJJA 3SSRA 3MEGB 3KNAA 1MROA 4IH5A 5EWGA 3JYTA 3H4BA 2FHJA 3QPIA 3MURP 1HBMB 1M90T 3C6UB 3DLGB 3VALA 1JIHA 1IKXA 1HBOB 4A8SA 1W2BR 4MIWA 3HK2A 1CC7A 4A8QA 1X4CA 3DLEB 4QIVA 3FNNA 5GAHI 4HYKA 2LEBA 3MMCA 1U6ZA 4MK8A 4K4UA 5CQGA 1FD2A 2E5HA 2W9AA 1N8RT 2MZ1A 5DRKA 4TKTA 5J1EA 4QWCA 2O01C 3IA0A 2XS7A 2R7XA 3N6LA 2D74B 5L39A 2NYIA 1DLOB 1REVA 3BR9A 1URRA 1AROP 1RT2B 3N5BA 4IFVA 4UUXA 1S79A 2VFTA 3UR3C 1OQ3A 4EEYA 1SIWB 2RU9A 4NLOA 4ZMMA 2OPPB 4GO5X 1KLMB 3UD4P 3CD0A 1S9GB 4ELUA 1FKOB 2ZH1A 5F8JA 4KHRA 5D77A 3BQ0A 2JOQA 1X5TA 4IG0B 2J9CA 3QIDA 2HIQA 5KFAA 5KFOA 3SI8A 2GC8A 3J81Y 1QSYA 3U7JA 2HW3A 1I6JA 3HVWA 3T9NA 5DQHA 4I7FB 1ZZFA 4OHWA 2YKMA 2XCPA 1LXJA 1JXEA 1ELOA 1ZM4A 2VG6B 1HNXF 2YVSA 3QO9B 3UPFA 4KQZA 4J9PA 3GYXB 2L9WA 5J2MA 3BO4A 4K59A 3SV3A 2IHR1 2VPXB 3K5MA 3FSYA 5CCMA 4C8LA 2XNQA 3WBZA 2VBWA 4QPXA 2ZKTA 4NX9A 2WRMA 3HKZD 3IS9A 5E0OA 1JNRB 5A8WB 1U1QA 3V4IB 1VI7A 1T8EA 2VA2A 2VOOA 3QMQA 1UJ6A 4L72B 2BE2A 3VQSA 1R0AB 1FRJA 1SC6A 3KK2A 2VFSA 5KFUA 5CCLA 3B4MA 5HLFB 5D78A 4DWIA 4ID5B 4JI8F 1C1CB 2JC0A 3FQLA 1CEZA 3M1VA 4IH6A 2KYXA 4X64F 2WSFC 3OTEA 3V4MA 4QIGA 2OFGX 4Y28C 2HHVA 4LSLA 2HNYB 2JEGA 1S6QB 2LDYA 4AFFA 1ZH5A 4QIFA 4ZHRA 3SDEB 3SSSA 3RAXA 3I31A 1N0UA 3E3XA 3OVSA 4FBTA 1NK4A 5CYQB 2QMXA 3V2UC 1YJUA 2XMWA 4LQ9A 1VC6A 4M1KA 3G8SA 2ROEA 2VZ9A 3NBPA 5C5JA 3ENQA 2QA4S 1XR5A 1Q86T 4X2BA 1M5KC 1Y0HA 2F40A 3MR5A 1GQEA 2CQ4A 3SQGB 1RT3A 2I38A 4G1IA 4C97A 1FRXA 2V94A 3A1YG 4FXVA 1U1PA 3VCDA 1X0PA 4LF6F 1FTCA 2FIUA 3DFEA 3LP1A 3KLFA 5DM7Q 3KTQA 2MKHA 1HYSA 2ZOFA 2VG5A 4IYQA 1S48A 1L3SA 1PSDA 3NL0A 3M8PB 1CPZA 3HO1A 2VPWB 2RQCA 1N6QB 1QAYA 4K4ZA 2V8DA 3KK3B 4JV5F 2MZSA 5HBMB 2DNPA 3Q0AA 1NH7A 2XB2D 2KZMA 5L38A 1IR0A 1WG5A 5J1PA 1FRKA 4ECVA 2M52A 1TV6A 4KT0C 2B43A 3CCQS 1F5BA 1FT8A 4EBEA 4PWUA 3JSRA 1HPZA 3N79A 4MYUA 4HDHA 2MMYA 4Z37A 1YTYA 1KONA 1OQ6A 3I0RB 5C24A 5KFBA 1S6OA 1SJ4P 1YJTA 2YH1A 4ED5A 2V2KA 4Q0BB 4K0KF 4Q8EA 1HHTP 3P5TL 4C0HA 1R89A 2DJWA 1VMBA 3CVKA 3HHDA 2L9NA 2XLIA 3OL8A 2JC1A 2R2RA 1HBUB 3FFIB 4QWBA 3GIKA 3CTRA 2FPHX 4UQTA 3OHAA 4DQRA 3T5HA 2RT3A 2AYGA 4M94A 2IYIA 1N5VA 5KFMA 5DETA 5DS7A 5KOWA 5KT5A 2K1RB 1JXLA 5AE2A 5FIIA 3IG1A 3HVRA 3MPVA 2DH7A 5A0YA 4YP3A 3KG1A 1QAJA 3X1LB 2VG7A 4HL9A 1D9FA 4H4MA 4LF5F 3FRYA 1L3VA 5EX0A 1NJIT 3EPIA 3LAKA