1R8QA

Full-length arf1-gdp-mg in complex with brefeldin a and a sec7 domain
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
b'GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title Structural snapshots of the mechanism and inhibition of a guanine nucleotide exchange factor
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein transport/exchange factor
total genus 62
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r8qA00
4HDQB 3PUXA 4A9AA 4OL0A 1DAEA 2W2VA 5TV2A 4C2UA 3HU2A 1KJYA 4LRWA 1L8QA 1SVOA 1TQ4A 3QUSA 1IXSB 4UNNA 4R7ZA 1XNJA 2GWHA 2C99A 2X19A 1TADA 3PCRB 1RZ3A 2QTFA 4L9SA 4JLDA 3Q7PA 4TLEA 1N6PA 4ABYA 5SZIA 1W44A 3CONA 2DB3A 2QROA 3EPJA 4FD2A 3O8CA 4CEHB 4ILEA 1ZUHA 2NO7A 3HU1A 2DY1A 2PMDA 2R8RA 4LHYA 4DZZA 1UBEA 2J7PD 2GJ8A 1ZU5A 3OFND 1JXMA 1N3BA 5DGXA 2DWQA 1E2MA 4LJ7A 2OUKA 1EGAA 4GDFA 3UWKA 4OI2A 2BMEA 3FYHA 1RKBA 1G3QA 2VP0A 1NMZA 4ESHA 1T9HA 1P9NA 4KBGA 4DB4A 2CK3A 4DCNA 2OSBA 3ZVNA 3AF2A 2O8DB 2O0KA 4DSUA 1Z3IX 4LX0A 1UEJA 1W0KD 3NKVA 1X8JA 2MSDB 2WBLC 3LW8A 5AUOB 2IYUA 5HE8A 1BH2A 4BQSA 2QGZA 2WJHA 4CRWB 1XTQA 5BW8A 4O2RA 5SZHB 3ETLA 1DELA 3VKWA 5HR5A 1MABB 1G7RA 4V03A 2BKEA 2EWVA 2FSHA 4P4UA 5IHPA 3EX7C 3EA0A 5FBRB 2QM7A 5FL7D 1SXJD 4F93B 2VSXA 2CCGA 2K5UA 1E9BA 5FOXA 3VR5A 5CLQA 3C14C 4L9WA 4V0OA 3TBKA 3B60A 4A1FA 1F2TA 2FSFA 2ZI3A 3A37A 3IO5A 3R8FA 3R9XA 1Y63A 5FUWA 3W5JA 4IOLA 5FBWB 2VSOA 3GFPA 3C4JA 2F9MA 3CH4B 4NYMR 2XXAB 2QE7D 3A4MA 5JHGB 3K9GA 2IHBA 4R2HA 4AY2A 1YR8A 2OLKA 4KXFB 2B92A 1R8SA 3AH8A 3F8TA 3PVSA 1N0WA 1ZD9A 3H4MA 2AFHE 5G53C 4NBSA 2FPMA 3K9NA 1Z83A 4XOIA 1JEDA 3G82C 1TX4B 3W5IA 1E94E 3EIEA 5G40A 4ZO4A 2GKSA 2QN6A 1P3JA 4EJSA 3TRFA 2ZYTX 5EE1A 1NSFA 1OT3A 1OW3B 1X1RA 2H57A 3LBHA 4RSGA 3VR2A 3ZVMA 2R6FA 1B23P 4B33A 3B78A 3DVLA 1G17A 2C9OA 2QAGC 3LA6A 4RCZA 1KO4A 2CVFA 1XEXB 1R0YA 2WWGA 3OIVA 521PA 1CRQA 1DEKA 1W2GA 1KK3A 3ADBA 3FOZA 3LVQE 1VECA 3OEED 4O2LA 4OK3A 4Q00A 3U6KA 3L43A 4HLDA 4LI0A 4LJAA 5L3VA 4WOPA 1E1QD 1H8HD 2FZ4A 3KFXA 5LD2C 1N6LA 1JI0A 1NBMD 2FNAA 4DUGA 4A0GA 2JEOA 2REBA 4DRZA 1NVVR 4X8OA 5FPTA 3RRMA 1X8LA 2IYLD 5SZKB 1WE2A 2XTZA 2O8EA 2ZE7A 2J3EA 4FXPA 3CBQA 8OHMA 1M2OB 3CM0A 1LTQA 3QF4A 5GJCA 4KSBA 1G1MA 4Q1EA 3W9YA 5KHOC 3PUVA 4Q03A 1J70A 1WP9A 2B6HA 2OBMA 2BMFA 3KL4A 4C7OA 2ZQ5A 2R6CA 3WNDA 1Z29A 2GTPA 1N5JA 4ON9A 1E2QA 3KKMA 4AYTA 1SVIA 2QMUA 4HI0E 1A5TA 1TAGA 3IIJA 5D3MA 3Q5DA 2JAQA 3RSLA 4DSOA 1R4AA 5IDVA 2QORA 3CRQA 3GD7A 4JMPA 3TE6A 1XFAA 2GBLA 1N5KA 3KKPA 1ZIOA 3U3JA 1SVKA 2VO1A 3A58B 1JQLB 2ZM5A 3MFYA 1AQUA 1OB2A 4TN1A 4B3BA 3AVPA 4US2R 2IF0A 1XXHB 3R7WA 2REOA 3U61B 1FMLA 5CM9C 5FR1A 1E9SA 2AXNA 5LB2A 4CEJB 1WQ1R 4Q9HA 3WBKA 3AVYA 3I73A 3RYTC 1U81A 3GQBA 3KUCA 4AI6A 4Z54A 2NMVA 4LBWA 4MH0R 1EWRA 1WF3A 4PC1A 1IY0A 3LD9A 2O0JA 1KNQA 4NU0A 1G8YA 1F5NA 4D4KA 5FTJA 1E2NA 3ZH9B 1SXJC 4BUJA 1O87A 3TSWA 2XZLA 3UATA 4FW9A 2ZANA 4WIAA 4Q1FA 1DAGA 1D8TA 4M53A 1E9RA 4G1UC 4UNQA 1VTKA 2ZRFA 5J4YA 2WWXA 5DNYB 2ZS9A 3BH7A 3KJHA 2XNDD 4Q7LA 4EPVA 2WJVA 1AK2A 1TQ6A 4B2IA 4B44A 1YQTA 2IEZA 3B8HA 1SVSA 3HYTA 1JALA 1ZNXA 4UXIA 5H8WA 2PJRA 2EFHB 1PJRA 1HQYE 3CO5A 4WZBE 2XB4A 1CULC 1FNMA 1AS0A 3LAWA 1JEEA 2XEXA 4BGDA 4GBMA 3LLMA 2AN9A 1KKLA 3AF4A 4Q02A 4L8GA 1G8HA 3BFKA 1PVOA 3WNBA 3THWB 3MUFA 4BFTA 1XBTA 4B2LA 5FPSA 4ZPXA 3BD9A 4IDOA 3DKPA 1R5BA 1OYWA 1X1SA 4MDEA 3RS5A 4ITRC 2W6ID 2QRZA 1GRQA 3AF3A 3LW7A 4B74A 2O8BB 2PLRA 1ZP6A 4RJLA 4CEHA 2QNRA 2V8OA 3GEEA 4LPKA 2WV9A 4PPQA 4EAQA 4F4IA 1HEIA 1XTJA 4IKEA 4FIDA 5BQ5A 3T5DA 2VIIA 1N6KA 5C4MA 3WNCA 4MRNA 5DYIA 1JXOA 1XMJA 3PEUA 2BMJA 2EFEB 3CPJB 4U00A 1VYTA 3MD0A 4PSVA 1NIJA 1Z0IA 3BC1A 1SGWA 4WAUA 1W36B 3L0PA 2V6JA 3K1JA 2PEYA 2QG6A 4DT1B 4PTLA 2WJJA 4XTCS 3BIFA 4HB4A 2H1LA 3RRZA 5AUQA 2VLIA 2ZRJA 2IYSA 4IEEA 2IYTA 5A0FA 2JJ2A 1YRAA 2BV3A 4TZ0A 1IN6A 2GZDA 4AG5A 4YLGA 1NF3A 821PA 3B1ZA 3QY0A 2NO6A 3DDCA 4R71A 4UNRA 4LBVA 4JJKA 3W3ZB 4IDHA 3K0CA 3BB4A 2XOKD 1E96A 1GTVA 2J41A 4PHGA 4LOAA 1OIVA 1E4VA 1SZPA 3PUWA 3TGPA 2VP9A 2C95A 3NC1C 1IN8A 3KQHA 3BB1A 3THXB 4DDTA 3KB2A 1G20E 1FMJA 1TF5A 4V02A 4WXPA 3TW4A 1MKYA 2FOLA 1HYQA 1P7CA 2OFWA 2ZJBA 4EJSC 4UNSA 4U7DA 2YKGA 1WCV1 1M74A 2RCNA 5HTKA 3IILA 1D9XA 2BOVA 2IYZA 4TTPA 2V1XA 4XVRA 2FGKA 1HE8B 5B30A 3H84A 2XXAA 1Z06A 2PL3A 3OAAA 1OFHA 3IKJA 5GVRA 3U3KA 4NKRA 1ETUA 4KO8A 2X1VA 2C5LA 5K8TA 1XPOA 3P4YA 5BN3A 2BCJQ 2QGNA 1ZNYA 2IXGA 3U4QA 4AIIA 5CITA 4QFMA 2W6JA 4CYMA 3EWAA 1II9A 4JLPA 3VR4A 4DHEA 2GK6A 2HLDD 5GJBA 2O8CB 1UKVY 1YZTA 2UZ3A 5K8IA 4KFTA 1KJWA 4HSEA 2OHFA 1NI3A 2AK2A 5GVSA 3SQXA 1E2EA 4TMWA 4NHOA 3GMTA 5KSOA 4OHYA 1O3YA 1H65A 2CE2X 4OK6A 1XTKA 2GILA 1DADA 4JLMA 4W7SA 3C41J 3T06B 2ZUDA 4CZ2A 3K0FB 1U2RA 2WVJA 5A5GA 1UBGA 4XJXA 2QTVB 1KK0A 5BN4A 3DMDA 1CKEA 4Q48A 5JWRA 2F43B 1LNZA 1DAIA 1NKSA 1US8B 4IOMA 3ZDQA 5L3SA 2ZXUA 1F3OA 1E2JA 1XJQA 1S2MA 1Z8FA 1T5IA 2ZRDA 3H0KA 4L4UA 4F91B 4C0HA 1OB5A 4DCVA 1KKMA 2Q9AA 4RKFA 1P62B 4TL9A 5FOSA 1T3SA 4DLYA 1FOEB 4JLJA 2OLJA 2NO9A 3I5YA 1OXVA 1TQ2A 4DBLC 1OXUA 5HE9A 3LLUA 4BRUA 1R0ZA 2ZR7A 2A2ZA 1NVVQ 2R65A 4RD0A 2HT6A 1U0JA 2ZJ2A 4C0SA 3MSXA 2V54A 1E79D 4B2PA 5G41A 1TUIA 5KPJA 1E2GA 2VYFA 3MJHA 2LCFA 2JASA 4NONA 3LBNA 3LRPA 4R2IA 3WP0A 2WTUA 1JNYA 3C5CA 3TUIC 3UMRA 2FDCA 2ZRIA 4IVQA 1EFRD 4POAA 1GNQA 1FP6A 4LYJA 4TMZA 4GMXA 2FEOA 3GLGB 2UZIR 3LV8A 3LXXA 3TQFA 1D5CA 1ZD8A 2NPFA 1J90A 4A8JB 2WPDA 1JR6A 4B73A 3BRWD 1Y3AA 2UVQA 1BKDR 2ONKA 1XJ0A 4HLUA 4Q9LA 1T3HA 3FHTA 2YOGA 2ZSFA 1W0JA 1IBRA 4PZYA 1EXMA 2ZPTX 2O5VA 2P65A 2CLSA 4OI1A 5P21A 3ZJYA 5J4VA 4TSFD 4DLXA 1XXHA 5EP3A 2O8FB 3L2OB 1KNXA 4NYJR 3RWMB 4D4JA 1FL9A 1XD2A 4DVGA 2AHOA 1GZSA 3VFDA 1OXTA 1IM2A 3IDQA 3CIOA 4RCYA 1CP2A 2IWHA 1G7TA 4MYCA 3Q7QA 1F60A 2ZETA 4JVSB 5B64A 3EWSA 2C96A 4I4LA 2PCJA 3BORA 3W34A 2CLCX 2CL0X 4MGKR 2ERXA 4BLRA 2FG5A 4LDJA 3EZ6A 1E9DA 2ASEA 1D2NA 1D9ZA 2ZRNA 4GZLA 2ZE6A 3AVVA 3IEUA 2QI9C 2DR3A 1OKKA 4JVNA 4HUQA 1KSHA 3EG5A 3AVXA 3K0SA 4OJQA 1QRAA 3FVQA 1E9FA 3W6NA 4YMTA 2NOAA 4TLDA 3L8ZA 1YZGA 3UG6A 3CKLA 3W6PA 2CMKA 3E5HA 5E7IA 4QL3A 4JL5A 2WIBA 4Z8YA 4ARZB 4DLWA 2ZRLA 3K09C 2ORVA 3QJYA 4LJ8A 1KK1A 5G3ZA 1JECA 1A7JA 1SHKA 5KDDA 2ZJ5A 1LFDB 1M7BA 5F9HA 3FB4A 2YC4C 1OHHA 1KSJA 1UDWA 4M8NE 3KQNA 1K6MA 3HJNA 4Z1MD 1PUIA 4G5GA 3WRYC 3DOEA 2JLQA 4ACBA 2HUPA 2IBMA 4LCBA 4ZIRB 1XZQA 5DO9A 3GJ5A 1DTSA 1BMFD 3THWA 4BEJA 1Z6XA 5JEDA 1K5DA 2QSYA 4FMCB 4OQFA 1XJCA 4BFSA 4Q4AB 4RZ2A 5DIFA 1Q21A 2QUZA 5FBLB 2ZI4A 4JLAA 1Z2CA 1TMKA 1OJLA 4M1KA 3P4XA 4NCKA 4M9QA 1M34E 4BLTA 2Q3FA 1KIMA 3AB3A 3Q3JB 3U60B 5JS8A 1KI2A 3SI7A 1XRJA 4BFWA 4MYUA 2XSZA 2H18A 3OEHA 5FUYA 2JDID 4BLQA 2Q0HA 3UIEA 4ZCMA 2BEJA 1W4BA 5IK2D 1CEEA 3U3MA 4MKIA 1R7RA 4B71A 3DOFA 3HDTA 2F1JA 5C2JB 2HT1A 1GITA 4K8OA 1J2JA 1ZNZA 1WRBA 2Q6TA 4MUBA 1U99A 4LGMA 2GNOA 2OBLA 4JLNA 4KI0A 5EXXA 2ZRBA 2G0NA 4MYTA 3RS3A 4TLCA 3UK6A 2OAP1 2J59A 3BERA 2P6RA 1KHTA 4LWZA 4MQBA 3SBEA 2FN4A 3CH5A 3WHKA 5AJWA 4B43A 1NP6A 3SFVA 3QVVA 3NDBB 2NPIA 4OBEA 5LB4A 2GVZC 4PO8A 1RPZA 1AIPA 4XVQA 2HYDA 5B2ZA 4TYQA 2I1QA 1AS2A 3THXA 2ZRAA 2QP3A 2GCPA 4TYPA 3EIHA 3VKHA 4J0QA 4RD1A 3RLFA 5FFMA 1AKYA 2RHMA 5JJLA 2H7VA 4M1SA 1TU4A 2FJUA 3CB4A 3CNNA 1L4UA 2EVWX 3HWSA 3IQWA 3QXCA 1TU3A 2CNWA 3AV0B 3GLFA 3LVRE 4E07A 2W0SA 1KMHB 1KI3A 4Y0AA 2LKDA 3NXSA 3VU9A 1EWQA 1SHZA 1NN3A 1P9WA 3O47A 4QG7A 1VCNA 5L3QB 3VHLB 3T61A 3EZFA 2VHCA 1ZNWA 1FZQA 4K46A 3X1YA 3ZS8A 2MMGA 5JRJA 1ESMA 4LJYA 1KO1A 2ZE8A 3KB1A 4JVMA 1YZUA 3KQLA 2IS1A 1F6BA 2J0VA 4GOXA 1FW6A 4WZAE 1XWIA 2JIZD 1XZPA 2OAQ1 2DCUA 2E9SA 4NL4H 1QDEA 2AK3A 2QL6A 1UKYA 5A4JA 4BZXA 3LH5A 3C15C 1LS6A 3LQRA 1P2UA 2GJ9A 5TY0A 2WZQA 3E2IA 4QBFA 1VYVA 1ZC3A 3A1WA 2O8CA 2WWHA 3QKSB 1S0UA 1ZYUA 4I1UA 5AJVB 1XMVA 1BIFA 2KWIA 1A82A 2DWOA 4M21A 1COWD 2TMKA 4RD3A 2FF7A 1SVWA 3ECCA 4WVFA 4D80A 4IFBA 2VPPA 2FFBA 4DLSA 1PZNA 3JVUA 2CEAA 2CL7X 3CX7A 2IXEA 3AVOA 4PZLA 2ZU0C 4Q9JA 1J7KA 5KDOA 1X6VA 3SNHA 2OEPA 2OM2A 2GEUA 2GAAA 2WKQA 2F1IA 1XCMA 3FKSA 4HAWA 2IL1A 4PSAA 2KJQA 1RYFA 2C98A 1LB1B 4HDCA 1CR0A 2HXYA 1E0JA 3QKRA 3ZVRA 3B1XA 3AF1A 5FUVA 3FDIA 2ZEJA 4AKEA 2VQSA 2RGNC 1MO6A 1Q44A 2D06A 2GEDA 1TF2A 1ZM4A 1NN0A 2YWGA 1P5ZB 3OESA 2OCYC 3ZYCA 4B75A 2WAXA 2GXUA 4Q1BA 4US1R 1IXZA 4RZXA 3QENA 4V0MA 1TEXA 3AF0A 1KY3A 3TVTA 2J45A 4A8JA 4E22A 4EFNA 2JJ8A 6Q21A 4MGYR 4TL7A 3GFOA 1KI4A 1HA3A 3AP3A 1IJEA 4AD8A 1Z0DA 4UJ5A 1OV4A 4QJ3A 4NYIR 4GFDA 3QBTA 1E2HA 4Q7KA 2FH5B 1D6JA 2YV5A 1NRJB 2A7QA 1E99A 4JT2A 4P4SA 2DPXA 3NWJA 2IS2A 2FFAA 4BRWA 5FI1B 2CDNA 4UNPA 3QNUA 3L0SA 1QHGA 1J8YF 2J0UB 5FPHA 4YDSA 3REGA 1TNDA 1EG7A 3SN6A 1QVAA 3EASA 3K9LA 4NYJQ 2IW3A 1HH4A 2BEKA 3QPUA 2ZI7A 2IK8A 1S1MA 4KVAA 2CLDX 2IA5A 1R5NA 2PX0A 3KXKA 4JBWA 4RD6A 2OFOA 5FTNA 4HAUA 4XWAA 4C9BA 4QOSA 1AQYA 3U7GA 2FMXA 3SU8A 2ZSDA 4RVCA 4QHYA 3AGQA 1YVDA 2QQ0A 4DIEA 4RY2A 1DARA 2Q21A 1GL7A 1ZCAA 5JBQA 2DYKA 3NBFA 3QKUA 4LJ6A 3OIYA 1JR3A 4PHHA 4CT5A 3M1IA 4ARZA 3TNFA 3GLFE 1W4AA 1KO8A 3TUZC 3DMNA 1F2UB 2D62A 3A36A 2F1RA 3VR1A 2YWEA 2YOHA 4HYYA 5E7JA 2HF8A 1VYUA 4CEIB 1G5RA 2CK3D 5KNDA 621PA 1L7VC 1G21E 5DE3A 2YWHA 3GLIA 2IYRA 3F5FA 3C7KA 3UMFA 4FWIB 1XP8A 2OT3B 1OFUX 4X8HA 4XTRA 4Y0VA 1G7CA 5L3RA 1E2PA 1Q57A 1R0WA 5HKKA 2C03A 4UJ3A 4LBYA 2QBYB 2ZAOA 3GLHB 4ZIRA 4WW0A 1MO5A 3VNUA 3I92A 4M1WA 3B6EA 5GJVC 2VF8A 3CF0A 2AX4A 1QG2A 5HPYB 2YNMA 1ZCBA 1DO0A 5D3QA 4Q4AA 1G16A 4PQRA 3SOPA 4CW7A 4F4JA 5FPYA 1MV5A 4KODA 4E03A 3QI2A 1VDZA 2CHQA 2WSMA 2W00A 3IIKA 2HJGA 5FTLA 1XTSA 1RC8A 2DFKB 4XIGS 4KLZA 3WMGA 1BYUA 1ZAKA 3QPWA 4EQ6A 2QMHA 1CRPA 2CHVA 2I1VB 4D4LA 3BJIC 4A36A 4KFRA 4URXR 3EIQA 1G41A 1NN5A 3FMIA 4KLNA 3T34A 3VHXA 3MWYW 2R44A 4QC2A 4JLVA 4PC6A 5DI3B 1DG3A 3IBGA 2WSSA 5LPNA 3GJ8A 4YXWA 1TTTA 3OF5A 3D6TB 2IT1A 3AQ4A 1W1WA 4NP6A 1ZC4A 3BFVA 2Y8EA 5J4HA 3I5XA 1KTVA 4JKIA 3B1WA 2R6DA 2HCBA 4URUR 1N6HA 4UKDA 5JHHB 1WBDA 1U9IC 1G3MA 3IUYA 1J99A 2AL7A 4XSHA 4IDQA 4V0KA 5CB6A 2FFQA 2P6UA 2CCJA 4ZCLA 4KV9A 2XTNA 4BLPA 2BIFA 1Z0FA 1II8A 2P5TB 3ZZTA 3KX2A 4H9GA 2I3BA 1ZU4A 1FQJA 2CCKA 3FTQA 5HZKA 3A1VA 2YYZA 4D0NA 2VF7A 2BBWA 1KMQA 4GP7A 4V0ME 1BYIA 1XMIA 3VQTA 3I61A 2ECKA 4NTZA 3OZXA 4OI4A 1S9HA 1JJVA 1AGPA 2L0XA 4B3FX 4AKIA 2CXXA 5JRZA 2VP5A 4DUGD 3N5CA 1NVWQ 1EK0A 5L3QA 4Q4HB 5FBQB 2RGEA 3ND8A 3GJ7A 2YOFA 3DO6A 3FHOA 2A5YB 3IBYA 4Z51A 2GXAA 1Q3TA 1I2MA 2B21A 2VHQA 3MWJA 2XTMA 4JYCA 1R6BX 3KTAB 4B35A 4MGZR 3PEYA 2PJZA 1JAIA 4B3CA 2OFXA 4DEXA 2HJVA 1SQ5A 2BBTA 1RRFA 3G0HA 3T1QA 4DCTA 2ZI9A 5EXSA 3QKSA 3WP1B 1NLFA 4PAQA 3KFVA 3QXJA 3KKQA 3JZMA 4RD2A 3U7EB 2ODWA 4NCJA 2EW1A 1OH6A 1Q0UA 3WMFA 1QHNA 1Z6TA 5AJXA 4Q21A 5FL3A 2I4IA 4JLKA 2BWJA 1G3RA 4MGIR 3RNLA 5DN6A 4TTQA 3RAPR 1YZLA 3CRW1 1G4UR 3OIWA 1GOTA 2RB4A 3TAUA 4IRUB 1R10A 2OESA 5JSZB 4PQYA 4PQFA 3X1ZA 2XJ9A 3A8TA 4DCUA 3GLIE 4ZKDA 1HT2E 4LY6A 4RFSB 3CX8A 4GPTA 2H17A 3CUEF 1XD9A 4YONB 4TMVA 1KI8A 1RVDA 3HU3A 3THYB 1GL6A 2Z0MA 3BGWA 1W48A 3ICEA 2ZI6A 1FNNA 1LF0A 2HV8A 1MO4A 2V1UA 3NEYA 4P4TA 3IO3A 3BWDD 5EUQB 4JSYA 1TUEA 4LYHA 4DIDA 5E4FA 4Q7JB 3IQXA 4GT1A 1E69A 1Q22A 1WXQA 5DH9A 3OIUA 3W90A 3K70C 2O8DA 3T1TA 4HDOB 3K53A 3ZIAA 5KSZA 3AKYA 2B8TA 3W3AA 5EE5B 4QM6A 1WA5A 4XD7A 2ORIA 2EWWA 1U94A 2ATVA 5CYPA 1DS6A 3KJIA 1V5WA 1SVLA 1S3SA 5FPKA 2QAGB 4MKFA 5CYOA 1P9RA 5JEEA 1UFQA 1LY1A 1MABA 2C9YA 2QRNA 1KAOA 1QF9A 1YU9A 3BBPA 3C16C 4JZKA 2JJ1A 4B3GA 2P0EA 2ZYUX 4BFUA 4HZUB 1SKYE 3T1OA 1T3LA 1CIPA 1DG1G 2D7CA 4URZR 3U7FB 1YRBA 4LHWA 4JLBA 4YDHB 5ELXA 1CR4A 4MRPA 4PC2A 4QBHA 3TQCA 3W8NA 2OCBA 5KO2A 2NGRA 4OHWA 3X1WA 2X2FA 4KCGA 1UKEA 4QNMA 2QY9A 4FCTA 5LD2B 4NYIQ 2ZREA 3C5HA 1OF1A 3RSOA 5DLQC 2ODBA 4KJZA 2IUSA 3BXZA 3DM9B 2DHRA 2CL6X 4PO9A 4JVLA 2ZUCA 4LHXA 1TPZA 1Q3HA 5J47A 2B8WA 5CIQA 2H8KA 5JZVA 2BC9A 2CJWB 4D25A 1E9CA 3MRSA 2J46A 3B13B 1AZTA 5TDHA 4BZQA 3RRNA 3AUYA 3NHBA 2GCOB 1OIXA 1F2UA 2PT7A 5EP4A 3UANA 2XZPA 1FFHA 4R98A 4NYMQ 5TXGA 4BLOA 2SHKA 3CNOA 3NBYC 3WYGA 3QPVA 3TUJC 4LHZA 5GADl 2VBCA 2WOOA 1DE0A 1T6NA 2Z4SA 5TVKA 1XB2A 1XDBA 3ASZA 4Q01A 4W5WA 3KJGA 2JJ2D 1DOAA 1XEXA 3RC3A 4TMTA 3FMOB 4JBYA 1GIAA 1YR6A 3TKLA 3PFIA 1IXRC 4A2WA 3EPKA 4RKEA 1N6OA 1EFRA 1EFUA 3FGNA 4MUAA 2VEDA 4C3ZA 4CGZA 1E0SA 2OZEA 1FX0B 5EP1A 4OI0A 3SJCA 1OH8A 1G8GA 5KYKA 3Q9LA 3HR7A 1CR2A 4P31A 3KJEA 2IWRA 4DC9A 3QQ5A 3THOA 3I72A 4LV5B 3MMPA 2WWYA 2BBOA 4D26A 3P20A 1D2EA 3I4LA 4H1VA 1UDXA 4TSFA 1IHUA 4YC7A 2GBLC 1KK2A 4LYFA 5HCNA 2ZR0A 1SXJB 4EPWA 2P67A 2F7SA 1WDTA 1E0KA 4EIWA 2JLYA 5KDLA 1XEWY 2P5SA 3QG1A 2YZ2A 3CRMA 4NE2A 4DXAA 4Q19A 1AKEA 1ZINA 3OAAD 4N3NA 3J81k 1NG1A 5EP2A 1Z6GA 3WHLA 1P2SA 2RGCA 421PA 4QGAA 2ZUBA 1NKTA 3P26A 1NG9A 2HEIA 3SQWA 2G6BA 1LV7A 1QHXA 2V6IA 1G291 1RJ9B 1N5LA 1CJVC 3FKQA 4QBIA 4MKHA 5C46F 3QBVA 2W6JD 4HUTA 1I4LD 2J9RA 2JLSA 1RFLA 1YHNA 2ZRMA 1OH7A 4LV8B 4I1OA 1DAHA 3EPHA 1P72A 1NJGA 3KUDA 2KBEA 2Z6VA 1Q12A 2Z83A 2RGAA 1GILA 4QKQA 4ZDIA 4CF7A 3UWOA 4HB0A 1W47A 1CF4A 4HAVA 5BWMA 2G0TA 1GP2A 4ASUA 4OHVA 2BHRA 2ZTSA 4IEIA 4LJ5A 2C2HA 1V43A 1B0UA 4U5XA 4C0QC 4MITA 4CEJA 4FCVA 4TQAA 1GL9B 3E70C 2A78A 2AR7A 2B7CA 2GETA 4PFSA 1G8PA 3Q8XB 4TT3A 4FWTA 5JCPA 4M9SA 4F92B 4P0TA 2DFNA 1X3SA 2RGDA 3EZ7A 3FE2A 4KFSA 4MA4A 4PHFA 1GSIA 4Q4HA 4IOJA 3FFAA 4HLQB 3TW8B 1Z2AA 4JJZA 1C1YA 5FI0B 1T4GA 1HV8A 4OK5A 3A4LA 3U2QA 3RVBA 4QGGA 2IS6A 4ZDJA 1VIYA 1Z08A 3QG5A 2J87A 2W83A 4X8LA 4B34A 2O0HA 1FP7A 1VHLA 3DHWC 1HE1C 4M4SA 4I1SA 2VA8A 5CK5A 1Z0JA 3OE7A 4IHQA 3SFZA 4LPSA 1KGDA 2JDIA 3AKCA 2IUTA 4G5SA 3VTKA 3ONWA 4G5RA 2VP2A 3ZQJA 3IPYA 5JLJA 2X77A 1N0VC 2BKUA 2PCLA 5DI9A 4AURA 4E5UA 1CJTC 3U5ZB 5B57C 3KKNA 3CWZA 2WPDD 3RANA 3TMKA 1GKIA 5EUMA 3NBXX 2ZIAA 1IN7A 3GCGA 4GMDA 5EJEA 3I3SR 5JJKA 3EARA 4AYWA 1W0JD 5FBVB 5F2EA 2GEVA 3AVQA 3GEHA 3TVDA 4B6EA 5JSZA 5M04A 1QVRA 3HPRA 1Z6AA 5CDFA 1QBKC 1UBFA 2V4ZA 2GXQA 3FFBA 3FMPB 1UAAA 2DWPA 3VMFA 4EJSB 5JMTA 2O8BA 5CK4A 3THYA 1E2KA 2XGJA 3Q85A 4IVPA 1H8EA 2V7QA 3QKTA 2D7DA 1KDOA 1MRNA 1P73A 2F1HA 3TIFA 2A3RA 3WMEA 1S3GA 2FWRA 2LKCA 3K0CC 2BM1A 3PJRA 1HT1E 3MJRA 5DYGA 2MSEB 2FSGA 4FMDF 5CJPA 4GOKA 2MMCA 2B7BA 2R62A 2RGXA 2NZ8A 3TK1A 4DT1A 3QIAA 3B1VA 1GWNA 1OKKD 1NY6A 1NIPA 2OBNA 4I1VA 3QOFA 4DSNA 2PMKA 4LHVA 3Q72A 4C0JA 1KI9A 4TQUS 2V55B 1KOFA 2ZYVX 3QXXA 3H86A 1W4RA 4Q1DA 5AJZA 5EE0A 3M0EA 3B85A 1KY2A 2IC5A 4B6FA 1E6CA 1KI6B 2IX3A 1GM5A 4L5BA 4C0AC 1XCPA 3PIRA 1N2CE 2ZR9A 2OXCA 2ZJAA 4HZUA 1OHHD 221PA 1KJZA 3IHWA 2EFDB 5FOTA 2WWWA 2YVUA 1E1RA 4Z8XA 3B5JA 1XEFA 3GJ6A 3N2EA 4YMSA 2YC2C 3HPQA 1VG9B 4HAZA 3U3RA 4C2TA 3B2EA 4C30A 3TSZA 5D3MB 1EFTA 4ZV4A 1VMAA 4YMVA 2BVNA 4A2QA 1VKJA 4KU4A 2W58A 3WRXC 4NCHA 3R20A 4RD4A 1ZUIA 2HDNB 1E4YA 1CTQA 3H2YA 4MRVA 2PZFA 4ERNA 1X86B 1A2BA 4DDVA 4KSCA 1GVNB 2ATXA 3AEZA 3TAHA 1KSGA 2XSZD 1G18A 3OEHD 1GRNA 2XITA 1YZQA 1XXHE 4ACAA 4M1YA 1ZW6A 3IEVA 1P75A 2NZJA 3D3QA 1M7HA 3KZ1E 1N6RA 4IFEA 1W36D 2GCOA 5IT5A 1P2VA 1ZM9A 1ZM2A 4JLOA 2DFLA 1KZGB 1M7GA 4KHZA 3WYFA 3PUZA 3I1FA 4ESVA 4LC0A 2P6NA 3VR3A 1XTRA 2GF9A 2QTHA 4NH0A 3D7MA 2FE4A 1BS1A 2E1RA 1DO2A 2J7PA 4TLBA 3SYKA 1BO6A 3OFNA 2NIPA 3N70A 2CVHA 2VL7A 4PC3A 1S4QA 2NO0A 4URYR 2ZRPA 4LC1A 2XB2A 3D8BA 1XPUA 4MDFA 4TZ6A 2EYQA 4AKGA 2JA1A 1FUKA 5EQTA 3K8YA 1KI1A 1JJ7A 3SBDA 4C0BA 1EESA 1OLOA 3EAQA 3NBZC 5AUNB 1J8MF 1G9XA 3K0FA 1W0KA 2FPLA 4F38A 4QNRA 1E2LA 1U90A 4ZI2A 2F43A 1US8A 2QA5A 1Z0AA 3PXGA 1NMYA 2QPOA 2WMNB 4N1AA 4TMKA 2J5XA 3NDPA 2MSCB 1X8KA 2QEQA 2CNWD 4QBGB 4QRHA 3NVAA 5FL7A 4TL6A 4HLUC 1SXJA 2PLFA 2FSIA 2QPTA 3N2IA 2DFTA 1IOZA 1N5IA 2ZS7A 1AS3A 4TMXA 4LUCA 1JQJC 4AC9A 1OPXA 1NVUQ 2IXFA 5CDFE 4EPYA 3PV0A 4TTRA 3TSOA 3ZQ6A 3ZZUA 1CXZA 2NTYC 4L15A 3Q5EA 1W2HA 3R9IA 4CDGA 4D0GA 2ZVQX 5TARA 3AP2A 4L16A 4D82A 4NPHA 3T1VA 3V4RA 4H1UA 1RJ9A 5J40A 4PR0A 3GLGA 3CR7A 121PA 4BWYA 3LO5A 5TMPA 4HEJA 1G64A 1NNEA 1G3IA 4NCNA 3DL0A 3W8RA 2QE7A 4EPXA 2PZGA 4Q1CA 2QPAA 1YZKA 4TL8A 5F9FA 2GXSA 2XJ4A 3CLVA 2C9CA 3K0AB 3NIBA 2FX3A 2JGNA 1PUJA 4G5OA 1G3UA 3VNVA 1XU4A 1NJFA 2O8FA 1VG8A 3T35A 2OE2A 2XX3A 2QP4A 2IS4A 4XVUA 4Q4JB 1LVGA 4B3XA 1Q1EA 1RRGA 4B48A 1ZM3A 2NO1A 3NC0C 3RS4A 5J4LA 4Q66C 3UKDA 1LW7A 1M6NA 3SJBA 2C77A 5CM8B 3F3YA 4AYXA 3OEEA 4GSYA 2D2EA 5AWFC 2FV8A 4JL6A 1D2MA 3GJ3A 2GDJA 4M1OA 3SZRA 5BXQC 1I4DD 3FKSD 2ZSBA 4GI7A 2EYUA 4HAXA 4KBFA 1MT0A 3GFTA 1E1QA 1H8HA 5FTMA 4QJ4A 4IDPA 1NBMA 2EU8A 4XH9B 1G4AE 2F55A 4FMDB 3FMFA 3PENA 5B58C 4K81B 2QQEA 4KFUA 4XWOA 1XX6A 4MRRA 4PPFA 4YQFA 1S9DA 2OV2A 3KXIA 2FFHA 4V0NA 1ZD1A 1MRSA 3BOSA 5FTKA 4DLUA 5IF9A 3RS0A 3EC1A 4OQXA 1ANKA 1A1VA 2QP9X 2WJYA 1Z28A 1MH1A 2AKYA 3LXRA 3CWQA 3EW9A 1OYYA 3B9PA 3MWKA 1NSTA 5AJYA 1UADA 1W36C 1JB1A 2FZLA 1G7SA 2R9VA 3CPEA 5JECA 4AWXA 4PZZA 2IYXA 5F3WB 4Q7MB 1QZXA 3SR0A 3R9WA 5KOYA 3U4QB 3OHMA 4KAXA 4G0NA 1G8FA 1NN1A 3CRRA 3GJXC 2PEZA 3GJ4A 3P32A 4EFLA 4P3YA 1QHSA 5AR1A 5JJIA 1OXSC 2VTKA 3PEWA 2QU8A 4HZIA 1GAJA 1S96A 2GRJA 4OQMA 3K70D 3UPUA 4YMWA 2IHYA 3I62A 2WICA 2W0MA 4N0EA 1I4TD 4MKGA 1VCIA 1AZSC 3WYAA 4IVRA 2AD5A 2A5GA 1Q1ZA 5H1YA 2KSQA 2QENA 3T12A 5IRCD 1GDDA 1E3MA 1Z22A 4GZMA 5EE9A 721PA 5EZ6B 4M9XA 4A2PA 2H5EA 5E7MA 4EDHA 3CF2A 4FMBB 5DHFA 4QHSA 1FTNA 2KE5A 3D31A 1UKZA 3LQQA 4D0LB 4A15A 1IQPA 1IN4A 3L0IB 1JR3D 2R6AA 1FTSA 3ZZ0A 3C8UA 5FR2A 4JBXA 1EFCA 1W49A 4X8MA 5L3SB 1SXJE 1CJMA 3SS8A 3L8YA 2R2AA 1GRRA 5H68A 1KI6A 4ZKEA 3A1TA 3U6BA 2PX3A 3RC8A 2OXRA 3IGFA 2VP6A 3FWYA 3B82A 4BFZA 3T15A 2Z43A 2YHSA 3IPXA 3W6OA 2WKRA 5L8VA 3AVWA 4W5JA 5ANRB 5HKKD 2XNDA 1GG2A 2A30A 5KNBA 4AKHA 4A82A 2VP4A 1YR7A 1OH5A 3GLGE 2WWIA 4U02A 5G3YA 3L0OA 1E9AA 3ADCA 3A1UA 4G5QA 5FOUA 1DAMA 3CZPA 4V0LA 3KQKA 1E2FA 1ONBA 3WY9A 1P61B 1R8QA 2GVDC 3LY5A 4KYUA 2AWNA 4DLRA 2G9NA 1KMHA 1FQKA 5C18A 5JCZA 1E98A 5J5CA 2N1BA 1KZ7B 1XEWX 2X2EA 3DKVA 2EQBA 3NTUA 2NG1A 3K9HA 5FOWA 4TYWA 2ZJZA 3ZD6A 1M1YE 2WHXA 4TYYA 2IF2A 5FOVA 1CBUA 2J0SA 3TLXA 4B47A 2C78A 3AKDA 4HATA 4DLVA 2HCJB 3KKOA 2KB0A 2GZAA 2W6IA 4PPGA 4C4PA 2JLZA 4PXAA 2JLXA 2GJKA 4DDUA 2PT5A 1JBKA 1XD2B 4JIMA 2GA8A 2ZI5A 3PQCA 2YWFA 5JS7A 1CJKC 1DVRA 2WSSD 4PAOA 1E2IA 4YXWD 1SVMA 4NCIA 4O3MA 3AP1A 4HB2A 2ZRCA 4EPRA 1W5TA 2RGGA 3QE0A 1NLZA 4QXAA 4W5HA 4BE7B 1KSFX 1MOZA 2ZRGA 3AM1A 3B9QA 1SKQA 5EXPA 2G1JA 5JI2E 3AVUA 3REFA 2X8AA 4FINA 5KUTA 2O52A 2W2XA 4QJ5A 1G19A 1NBME 1LF5A 1Q20A 2BJWA 2HYIC 1JR3E 1KAGA 4HUQB 4R9UC 3V00A 1HUQA 1Z07A 1RIFA 4M0LA 4QM7A 1MR3F 4DEYA 1IY2A 4BPBA 2P2LA 4Q1AA 1A2KC 1NY5A 2AWOA 4BASA 3I32A 1L2TA 2F6RA 4LZZA 4WZ6A 1N25A 2IYQA 1ZJ6A 1VCOA 4A8JC 4S35A 1P2TA 1DAKA 5JWOA 2XOKA 3BK7A 2JLVA 4EFMA 2GESA 4DJTA 2VSFA 2ZROA 3EZ9A 2GAOA 2IYWA 4M9ZA 4I99A 4PX9A 1WMSA 5FH9A 3MLEA 1QHHB 3SJZA 2XAUA 4A0HA 2V9PA 3VR6A 4I81A 4DDWA 1XMSA 4BFXA 4GNKA 1XPRA 1SULA 2G1KA 2JCSA 3X2SA 3F0TA 1IJFA 4A0RA 3K09A 3NHAA 1IONA 1G5PA 1OFTA 3SDZA 4JYBA 2ZS8A 4G3XA 1Q1QA 2ODEA 5JFGA 1AGRA 1VCMA 2R6GA 2GF0A 5CLLA 1ZUNB 4LJ4A 4JS0A 4BLSA 2BCGY 4BZPA 1RE0A 3K0AA 2IUUA 3FHCB 4CIDA 2AD1A 1KDRA 1I2DA 2IEYA 3M6AA 1PV4A 4QGFA 2XNSA 3ZLJA 4TYNA 4NMMA 4Q4JA 5DN6D 2WOJA 4WBSA 4EUNA 1DAFA 3A4NA 2HLDA 5K8UA 3RHFA 3SEAA 3U44B 3S1AB 2J0UA 2PZEA 3A1SA 1EX7A 2OCPA 4Q5IA 3LFUA 4JL8A 3DM5A 3UMSA 1P4SA 4IW3B 4KITB 2JLWA 2FPKA 4DLTA 5DSZA 5E95A 4FMCF 1UF9A 5C4GB 1AA9A 2FU5C 4F7WA 1M8PA 3P27A 2QT0A 1N0UA 3NH9A 2ZU6A 3MG9A 3BFXA 3PG5A 5AK0A 3DZ8A 5KTYA 3GP8A 2JATA 1ZBDA 4CEIA 5DISB 3EC2A 4MRSA 3GLFB 1P60A 3H1TA 3LX5A 3MGCA 1KDTA 1U8ZA 4II7A 3VU9B 3SJAA 4IDNA 4LBZA 4URWR 5DHAA 5JWHA 3ZIAD 3CPHA 2QSZA 3RABA 4XD7D 2QBYA 4OJKA 1E79A 3GLHA 5EXTA 5LDDC 3BH6A 1N6NA 1T0HB 4LJ9A 1U0LA 3E1SA 5CB8A 2ZITA 3AVTA 2JJ1D 4UXHA 2BM0A 4PO1A 4BEBA 2AKAB 2ANCA 3MAAC 1AM4D 4M1TA 2EFCB 4PANA 5FUXA 2P3SA 2YINC 1S1CA 2RGBA 2BDTA 1WBBA 2WJGA 4WXRA 4DB2A 1GNPA 1T5LA 2YJTD 3CR8A 3LX8A 4G01B 4GP6A 1W5SA 3P1JA 3AGPA 2QZ4A 4UXJA 1TL7C 4ZCIA 2AFIE 1RYHA 3GJ0A 1Z5ZA 1ZMXA 1HQCA 2OCAA 3PEVA 1ELOA 2J0QA 4M22A 2ZSEA 5DI3A 2EFGA 3U7HB 2JLRA 2IYVA 3BB3A 2N42A 2BJVA 4A92A 2GCNA 1YKSA 2WIAA 4IJMA 4GL2A 4ZI3A 4IOKA 3AKEA 1ZRHA 4RZ3A 5LBIA 2FEMA 2G77B 3ASYA 3X1XA 1OFIA 2QT1A 4DSTA 2D2FA 2IYYA 3B1YA 3CRVA 1U98A 1GFIA 1T91A 2ODNA 4PSKA 2QMEA 2CE7A 2AXPA 3CX6A 5EE3A 2N46A 1K5GA 2A5DA 2ZAMA 3R8CA 1JPNA 3RRYA 1GKUB 2VH5R 3QKRB 1GNRA 1K8RA 4XWKA 1KI7A 2JLUA 2DBYA 3I8XA 1RRPA 3WXMA 1UBCA 3QXSA 3M4YA 2ZSAA 3ADKA 2OO7A 2RH5A 4JKYA 2RAPA 2QMOA 2ZE5A 4D81A 1T0JB 3VKGA 2PH1A 3X1DA 5H70A 5BYJA 3TR0A 3ZS9A 5E3HA 1KO5A 4JT4A 2PBRA 3SYLA 2Q9CA 4O0MA 1T8UA 4OHXA 3SYNA 2W2TA 2ZYWX 3KQUA 1VHTA 3ND9A 4S2EA 1VG1A 2G88A 4Z1MA 2KI5A 3VX3A 4DLZA 4E09A 2J1LA 5BYKA 4N0DA 2CBZA 4BECA 1W46A 3O8DA 3IHLA 1BMFA 4JSTA 3QF7A 3V9PA 1VG0B 3QXHA 1IAQA 2QAJA 1IN5A 1OSNA 5KPDA 1NLYA 2C04A 3QEJA 3DPUA 4TWZA 1ZVQA 4D6PA 1XF9A 1KYIA 5KNCA 2RGNA 1KO7A 3KTAA 1UJ2A 3HYRA 1Z63A 1PLLA 3MWLA 1VPLA 2ERYA 1ZIPA 2Q3MA 4P4SB 2GZHA 4D4MA 1Z6YA 4RFVA 3K70B 1QHIA 3I8SA 2D3WA 3JVVA 4OQLA 5IK2A 4F4CA 1F2TB 1OE0A 1VIAA 3EPLA 2BBSA 5HZHA 1YE8A 1G6OA 1MO3A 3VX4A 4C0KA 4A6XA 5K8LA 1E9EA 2HXSA 2WM9B 2CHGA 3DZDA 3QVUA 5UKDA 1BOFA 4GRAA 4M1MA 1CR1A 1E32A 2WAYA 1KDPA 2WJIA 3EZ2A 4QHTA 3V4FA 1DBSA 3QSYA 3U3OA 4OKSA 2OG2A 3GPLA 1E0AA 3NEJA 2J7KA 3ADDA 2Z5FA 3BS4A 1NMXA 1R5OA 3LDAA 4FI3C 1E2DA 4LSGA 4Q18A 5J4KA 3B7GA 3GEIA 3IIMA 1AN0A 4RFSA 1U8YA 3MCAA 3NG1A 4ASUD 1Z0KA 1UPTA 3SC3A 4A4DA 1JAHA 4Q47A 3GLIB 1WB9A 3GLHE 3ICQB 4TT3D 4C0LA 1W7AA 2FA9A 1DPFA 4TQ9A 4AK9A 2GK7A 4WA7A 1QHHA 2ZJYA 3BE4A 3CNLA 3ZD7A 1JPJA 2F3RA 2ANBA 3BAFA 3BH0A 3QEOA 4A6PA 5BN5A 1RW4A 2FGJA 1OIWA 1TQDA 2G83A 2GJAA 1NL3A 4FN5A 4LYAA 2GHIA 2Z4RA 4EPTA 4FCWA 2RMKA 4Q4LA 3ZGXA 1XD8A 4D2IA 4HB3A 3G5UA 3JZAA 4OQNA 1S8FA 1ESNA 4RZUA 3SE0A 3LWNA 5F98A 2ZVPX 5AUPB 1C4OA 2ONJA 4UQOA 4PPNA 3OE7D 3RS7A 2D74A 2QM8A 2OILA 2VHTA 2RKOA 3TJZA 4YMUA 2NQ2C 4AG6A 4DWJA 1XTIA 2QAGA 5C1BA 2O8EB 2H92A 1G6HA 3ZVLA 2D4HA 4EQ6B 2H16A 2BMDA 1GKYA 2JIZA 3QF4B 5SZJA 4GOJA 2WWFA 5EZ5A 3PUYA 2LWIA 1T8TA 1F48A 4XSGA 1II0A 4C7OB 1FPMA 1CS4C 1QG4A 4EKDA 4B32A 4DCSA 3WBJA 1HY3A 1P6XA 1TF7A 3CZQA 3LNCA 4W9MC 1SKYB 3U44A 3S1AA 1GUAA 1CU1A 4O25A 1NVXQ 2A5JA 1R0XA 1ZM7A 2Q3HA 2F3TA 4HAYA 5CJ2A 1TEVA 1COWA 2RHDA 2VHUA 2WMOB 3O8RA 2VRWA 4TLAA 3EA5A 3L82B 3HP1A 3RDPA 2REXB 4NZYA 5CIWA 1H8ED 2V7QD 5KSYA 4P32A 1Z47A 4URVR 2CJWA 1N6IA 3HR8A 1II8B 1XCGB 4PAMA 4KYIB 1UEIA 4PHTA 4Q9IA 3PITA 4CT4B 1AJEA 1Q1BA 3UXMA 3SHWA 2F9LA 1YR9A 3EXAA 1YZNA 3KXLA 1EFHA 2HF9A 3RS2A 3CF6R 4LV6A 4P33A 3R7WB 4ZDKA 4ZDWA 2G3YA 2ZJOA 4NDZA 2E87A 2A9KA 3LBIA 1RRCA 4HLCA 2KBFA 5KU1A 3DEFA 3KDSE 1U9IA 4LK2A 4OHZA 5KSPA 4M2LA 3SHFA 4DKXA 2XZOA 4B76A 4QGHA 3CW2A 3A6PC 2ZJ8A 1U8AA 1FUUA 1EX6A 1G5TA 4BFYA 4Q9KA 1UM8A 2ORWA 2UKDA 1IY1A 3O8BA 3TH5A 3VAAA 5TB5A 4A0FA 3RWOA 3TR5A 2WKPA 4PC7A 1FX0A 1ODFA 5GJWC 1U0HC 2VHJA 1E1RD 4IXNA 3UG7A 1HTWA 1A4RA 2ZRHA 1LS1A 1PLKA 1CLUA 1R2QA 3NH6A 1C9KA 4MYHA 3FPAA 4B3DA 5JI3E 2A5FA 4OYHA 1CJUC 2GJSA 4BFVA 1W4CA 2V3CC 1L4YA 2Q9BA 1PLJA 5HCIA 3PR1A 4CVNA 3AUXA 4KVGA 1QHYA 4US0R 3K0EA 2ZRKA 3T5GA 1OXXK 2C8VA 1HURA 4IXMA 1YJ5A
chains in the Genus database with same CATH superfamily
5F7ZA 2GZRA 4F1KA 3B5EA 1X87A 1Y7IA 3H5IA 4WK0B 5JDCA 3IULA 2WRZA 3GV0A 1V26A 3H04A 5LDGA 2EP8A 1PBNA 1T5DX 1TQ4A 3DDHA 1T6BY 1NRWA 3SYMA 3LHIA 4UNNA 4L0QA 4NBLA 1CY2A 4F21A 4F6RA 4XUGB 1UJBA 4FZ5A 6YASA 2FUG1 2QTFA 4EMBA 4OLJA 1N6PA 2Z2ZA 4FJ1A 5F2KA 3NOOA 3WWCA 3HY6A 2QL5A 2V5UA 3CHYA 4FD2A 2XKKA 3O8CA 1A3CA 1S3IA 4R9NA 5B7NA 1B76A 1IULA 1SA0A 1SQ6A 1GPDG 1TZ2A 3COZA 4CR7A 1GN8A 1DB3A 1NXTA 1ZU5A 2GJ8A 4U5QA 3U80A 5J2UF 2FPOA 4F3KA 1P2GA 4QPPA 2D1SA 1E2MA 4FGLA 3HO1A 3G2OA 3O21A 2BMEA 3TQTA 2F00A 1RKBA 4XUDA 3KYDB 4LDQA 1TKAA 5H82A 1UJ5A 1C30B 1P9NA 1V5IA 2Z1MA 5ITZB 1P4AA 4UTVA 2M6SA 2RG7A 3V80A 3OZUA 2OSBA 2R97A 2JB9A 3CNQS 3KVVA 1YB2A 3PT9A 3FLEA 4HC4A 4OLFA 1HTBA 3UM9A 3NMUF 2O8DB 4ZHSA 1M6WA 4LX0A 1SKBA 3HHEA 1X8JA 4BNJA 4NXNB 1PTKA 1HE4A 3D4BA 2W8ZA 3LW8A 5KYWB 4P3XA 1NP3A 4BQSA 2B20A 2WJHA 4KAJA 1XMXA 4MQUA 4BTEA 3WLNA 4CRWB 1ZITA 1XTQA 5JYCA 5BW8A 4O2RA 4ZU6X 4YB8A 1MABB 4V03A 4BQOA 3OCVA 2EWVA 2FSHA 3MMNA 1JDVA 1JHAA 3EA0A 5IHPA 5FBRB 1YF3A 2QM7A 4BWVA 3KYCA 5FL7D 4LTDA 3WL3A 4F93B 4YEDA 3T7CA 2VSXA 5G0TA 1AXRA 1Y9DA 3Q7IA 3R5JA 4AJHA 1LEHA 3MM4A 3EVTA 4GOMD 2OHOA 4HYQA 1KEEA 2H6EA 5EC8A 4J1QA 3C14C 2QZ9A 3TWOA 3VH3A 4L9WA 5GM1A 3TBKA 5IJ0A 3P96A 2HB6A 3T41A 1U6JA 5GY7A 5GP1A 1DCMA 3TGLA 3R8FA 5FUWA 4NCAA 1EIZA 3EY9A 2EAUA 3IOCA 4J16C 3VXKA 3C1OA 1JSRA 3C3PA 4CM4A 3LT4A 5J5VA 3D8RA 3V9AA 4GSLA 2VSOA 3FCYA 1W581 4D3YA 4RDCA 3RKSA 1JDSA 2H4WA 3O3MB 4XIYA 3NBUA 2M6RA 3STWA 5JBIA 1ZD4A 4K05A 1YOBA 4B3RB 1GQSA 3DEKA 2YMPA 4HNRA 3MTQA 3A4MA 3MQFA 5KWIA 2PR2A 1L5RA 3JALA 4AY2A 2DH5A 1OX4B 4BVGA 4B7UA 3ZE0B 3OCWA 3PVSA 3JD2A 3O4VA 1Q6YA 3CR3C 3V1TC 2X22A 3I12A 1DKMA 1XZNA 4NBSA 3SR3A 3TNDA 5BQ3A 3NUQA 3H8SA 1UP7A 3O3CA 4Y2UA 1E94E 1IM8A 2GKSA 7REQB 2RK6A 4UVEA 1CDEA 4L50A 3TRFA 2ZYTX 2H57A 3LBHA 4RSGA 4AIRA 1MF7A 1L7XA 2CLEB 3D8TA 3AX6A 5LLTA 4LZPA 5I9BA 3F5SA 5L7YA 1GKKA 1QGZA 4JSRA 2NSDA 1VXOA 3ROXA 1JKFA 1NBIA 3LA6A 3OLXA 4URHA 1XEXB 1R0YA 2WWGA 2XHEA 4MV8A 3BDVA 2GD1O 2C5FA 2HA4A 2YXLA 3LUDA 3FOZA 4FQ8A 4X1OA 1QFZA 3RF6A 5K3FB 3OEED 2DFPA 3G89A 4REQA 3BWCA 4YA6A 4RJTA 5IU6A 3DMPA 4KN9S 3U7RA 1AURA 2IELA 3TFOA 1LJ8A 4IJ6A 4LJAA 3U6KA 4FS3A 1VKZA 1N57A 4LJSA 2J32A 5DT9A 1LU9A 3HSYA 1H8HD 2FZ4A 2PYZA 1WHSA 1NBMD 2FNAA 4DUGA 2WJZB 3M2TA 3GNSA 2V97A 2REBA 4XASA 4X8OA 5FPTA 2DH6A 2FP4B 4NOMA 4U0JA 4MINA 3FPSA 2PWAA 3NXKA 4L6IA 3NBMA 4N3GA 4E3ZA 4FXPA 1JG6A 3RAGA 2WY2D 4Q1EA 1W73A 4Q03A 4C88A 2F8TA 2B6HA 2OBMA 2BMFA 4UTRA 1D2GA 4C7OA 2R6CA 4ARBA 1GUDA 2C5AA 4MCJA 4I66A 1Z29A 4W1QA 4KOEC 2NAPA 4ON9A 4EVSA 1VMEA 4JUIA 4AYTA 2Y2UA 2Y66A 1QWSA 3T95A 1UXJA 3Q5DA 1VL2A 3D6VA 3MCUA 2PWPA 4N01A 5C8YF 3RSLA 3DA8A 2D2VA 1X0XA 1DWPA 1ZSNA 2AOXA 1PNOA 2XT6A 3CRQA 3VZQA 3JCZA 3P5SA 2PBFA 4YGYA 3TLJA 3MINB 3TG2A 4O1MA 1RTTA 2GK3A 3CSUA 3EJ6A 4JU8A 1VRWA 2GBLA 3NAGA 1N5KA 1VBFA 3LRXA 5HRAA 1T2CA 1SVKA 2V74B 3QU2A 5E1MA 3U3JA 2QTBA 4G8BA 4ZVOA 4RO0A 3ZDFA 4AKSA 2PKWA 1B42A 3URKA 1MA0A 3G5MA 4IGIA 1BGXT 4BDTA 4ZYZA 1JQLB 5JMOA 4BU1A 2JGRA 5EWLB 4I3FA 2ZM5A 1AQUA 2BGLA 2GYVA 4PG8A 4QDTA 3AVPA 4PU0A 2CD7A 3QVOA 3E3OA 4MUHA 3AFGA 1L5OA 2HA5A 2FW9A 3CZRA 2WAAA 5AI8A 3WDSA 1GPUA 1BDJA 1K0UA 5CM9C 4ZT7A 5A5DA 3U61B 5AHKA 3RUHA 3WBKA 1OYOA 3EIOA 3I73A 2VRNA 1U81A 3M6LA 1I1OA 3KUCA 4NZMA 4TM7A 5J63A 3HVRA 4LNUA 2D59A 2JJMA 3RVPA 1EWRA 5KYVA 1J06A 4XSVA 1V6CA 2HV9A 3U40A 2HK6A 1SPXA 4J0DA 1O94D 4LWQA 1VJRA 4LMPA 3D2BA 1KJJA 3GDOA 1SXJC 2HMWA 4WH0A 4B6QA 4IZOA 5IAOA 4YDQA 3PB3A 3UATA 4AJEA 1SXIA 4ENTA 4WNYA 2JHPA 5ALOA 2WVGA 3O91A 4UNQA 5SY6A 1VTKA 2JFHA 5J4YA 1N2IA 4BHTA 5DNYB 4DCCA 3OHPA 4Q7LA 2Q29A 3RBVA 4TS9A 2CV1A 2WJVA 1XCOA 2UZ0A 2JFBA 3FSEA 3BGSA 3P9KA 4MV7A 4NDNE 2YWDA 5LYJA 1JALA 3DWEX 3T3IA 4MMZB 1YI8A 4BMVA 1WEKA 3I6BA 4NQRA 1SCNE 3C8ZA 3SEZA 1CY8A 1FNDA 3E8SA 1FNMA 1SU4A 2PX4A 4CIAA 4YUAA 2XEXA 5JAMA 1G5IA 1C7FA 1C41A 4ZRNA 4GYWA 2E4YA 3MVEA 4ZMRA 5KQLA 1XTBA 1NQTA 3ZEAA 3C5EA 1KKLA 5MHTA 3VSCA 4TWJA 4ONEA 4JU9A 2MCFA 4PG4A 3RS8A 3BSYA 2SBTA 2H29A 1AO3A 2PT6A 1IE3A 3MUFA 7MHTA 3ZXXA 4B2LA 4ZPXA 2JIQA 2L18A 2ZTUA 1GG9A 3DKPA 4IDOA 4KE7A 4MVJH 1X1SA 4KQGA 1P1KA 2OAGA 4ITRC 1GRQA 3AF3A 4B74A 5DNUA 2WG2A 4CT0A 1WZCA 2QNRA 2XD9A 3BL6A 3DF7A 4RK5A 1RI3A 1JN0A 1XTJA 2QOEA 3T5DA 2HQBA 1L4NA 1YS6A 3WNCA 5DYWA 5IJXA 4Z0NA 5DSTA 1JEJA 2EBUA 2BMJA 5EERA 4PNEA 4D3FA 1VYTA 3C48A 2HMYB 3PI7A 1ZXLA 1JIQA 4UQPA 4YJDA 1SGWA 2MYPA 4WAUA 5A06A 2PQ6A 4DWVA 5L4LA 4CIYA 4WRRA 4UEQA 4RPJA 2YUIA 2EW2A 3QMMA 1MORA 4UMDA 4ZVPA 2QG6A 4DT1B 4GVXA 3T52A 1UJ6A 1HFWA 3V7FA 1B0PA 4XTCS 1PNRA 2HHCA 1MEEA 5EYPB 4NEGA 2VH1A 3TIGA 3ZE9A 5EPUA 4E21A 1EVJA 4YPFA 5EESA 2AJ8A 4ECEA 5BORA 1J2RA 4IEEA 2MJLA 5JVDA 4V2UA 1V35A 2XMPA 3WMXA 1HDYA 2WP0A 1IN6A 2QLMA 1GLNA 1P7ZA 4MQ6A 1PN3A 4MWCA 5BSTA 3DLBA 1V71A 1YDWA 1V7CA 821PA 1GA6A 1W5BA 3EOBI 5EZYB 2NO6A 5JSFA 2CEKA 1CUIA 1FDUA 3HNRA 4XA8A 1RPTA 1IUNA 3K0CA 1Q5PA 3EB9A 1AOXA 3NNNA 2GDZA 2XQVA 5FXMA 1C0LA 3LX6A 1T1SA 2VFAA 4YN3A 4LOAA 5KVVA 1SZPA 3GYBA 1SUPA 2VZ8A 4L7QA 3TGPA 3ZVKA 4MVJD 1ZGBA 3S7ZA 1UBHS 1CUZA 3L1HA 1PD1A 1KAMA 1PU2A 3KB2A 3OPQA 3P94A 2RDMA 4HMOA 1K8QA 1FMJA 2BHNA 2CYCA 1NASA 3E9YA 3TW4A 3U16A 2BKAA 1WV1A 2FPIA 4QYWA 1L4HA 3WG9A 3A3KA 4CLXA 2YKGA 1ZR2A 1LH0A 4ZU1X 2HOQA 2JD0A 3LE8A 4X62B 5KCZA 1YDHA 1HSZA 4D9FA 2Y9MB 3L4BA 1EVIA 2FMIA 4IHJF 2VSYA 3LUAA 2V1XA 3H2KA 4B6PA 1HE8B 4DA8A 4F2WA 1MGPA 2XXAA 4X65B 3UJNA 2PL3A 3OAAA 1PG2A 2D0OB 3ECAA 3AM4A 4X00A 5GVRA 5D84A 1BX3A 4HHEA 1ZD5A 1CEYA 3OTOB 3OPYA 1TCUA 5CFRA 2JD1A 4PX3A 5DNAA 4EG0A 3UTCA 4MVJM 4IXDA 2BCJQ 2CYAA 1M33A 4EP1A 3QJGA 3TXXA 1ZNYA 4J3JA 4QFMA 1GTZA 2C59A 1JHVA 4M6WB 1QQ6A 3D3EA 4N03A 3VZCA 3T7RA 5KQPA 4JDPA 4LMBA 5EIFA 1W5EA 4LYEA 4HGZA 4NJMB 3M5CA 3Q15C 2O8CB 3A0UA 2UZ3A 3PDCA 1M0EA 3NVDA 2E4XA 4EF4A 3EA4A 4KZPA 3QYAA 2AEFA 4GE3A 5GVSA 4LJKA 1EFPA 4V3BA 1UDCA 1FDTA 2X9NA 2ZJ6A 1H65A 2WUWE 3P9ZA 2HMUA 4L1KA 1K27A 2GN9A 3LKBA 4CCYB 2HGZA 5ED4A 1YFKA 3ZY6A 2ZUDA 1M2NA 3WFIA 1AHNA 4IPTA 1ARZA 3HI4A 4XJXA 2QTVB 1ZSVA 2GUWA 5DNDA 5K6TA 2B4AA 1UBMS 1CKEA 1DFIA 1SC3A 1LNZA 2AUTA 1DAIA 3GX1A 4Q48A 2XMSA 5IJ9B 5LNK1 1Z8FA 3D3WA 1CB7A 1OB5A 1V96A 3D3NA 4WI1A 4KYVA 3ISVA 4F6CA 2QK4A 3STYA 4RKFA 1HDEA 1P62B 2R47A 1M2OA 3UZUA 1FOEB 4KMOA 5FJIA 1IEXA 2OLJA 3H2GA 4QQ8A 4LSMA 3RSGA 3WHIA 1HDOA 3ZQUA 4DCGA 2IIPA 1O0CA 4OP2A 2A2ZA 1MQ8B 5HM6A 2HT6A 2EG5A 5FORA 3RSSA 3RHZA 1EHIA 3MSXA 2XODA 3SQDA 1E79D 3GLKA 2J48A 5B1DA 1E2GA 2VYFA 3GUVA 3KJFA 3ZGVA 3DUFA 2V3WA 3BL8A 4ZVMA 3UMRA 2YFHA 3R44A 1EFRD 4KDFA 1A95A 4POAA 2YTZA 4UHHA 3PFKA 2VPYA 2OV4A 4JUAA 1X70A 4QTYA 1ID1A 3IUSA 1Z4PX 4PGGA 5E6RA 1ZD8A 5TPWA 3EEFA 2W5UA 2NPFA 3NHPA 5CBPA 4A8JB 2YJ5A 2P2YA 4B73A 4B81A 2PA3A 2XYGA 3KC2A 3IUMA 2ONKA 3MT9A 4HLUA 4Q9LA 1PE0A 1AUOA 2ZSFA 1K8XB 3OHSX 4PZYA 3B7PA 4PIMA 2QD3A 1JW9B 4XPZA 1RPNA 2HADA 3LU1A 4UM9B 4R6XA 5AW5A 1VJGA 4N5LA 1M1YB 2G0AA 2IJGX 5G1NA 2WFMA 2PD3A 4QDKA 2GN1A 3PEFA 2O8FB 2EJTA 1FDIA 5B4UA 3SICE 1FL9A 4EW1A 2IZ0A 3DSRA 4I55B 4FBGA 1UWVA 1IM2A 1GYQA 3CIOA 4K86A 4LQLA 4OQ4A 4RCYA 2IVZA 1JJBA 1Y8RA 1G7TA 3EG9B 4MYCA 5EJIA 2IWHA 3DV0A 3EWSA 2IDMA 3GAMA 2PIAA 3DD5A 4LOJA 5DEIA 2DQKA 3NFYA 2CL0X 1GGNA 1YASA 3PYMA 2SKEA 2CJPA 3HYNA 1OI2A 3EZ6A 3QWHA 2ASEA 2GBGA 1D2NA 3A05A 3IJPA 5AOCA 3PVZA 4GZLA 5AOVA 2H1HA 1YXMA 2VC2B 1VMDA 5A4DA 1QIDA 2ZE6A 1YE3A 1FXSA 1L7BA 4P2GA 3AVVA 2HKIA 5JNSA 1O6FA 4P0PB 1JIVA 3FFXA 3WC4A 2IHUA 4JVNA 1KSHA 2QUHA 1K88A 2G71A 3K0SA 5FI5A 4K9MA 1JSXA 1ZRNA 2J5KA 3KLPX 4ZI7F 3WB1A 1MG5A 3L8ZA 1Q0PA 2IOFK 1WSWA 1B14A 4JQOA 5EQFA 4Z8YA 1SXQA 1JG3A 2OHJA 4X95A 4DLPA 1L7NA 2H1WA 3QBEA 3I9OA 4N18A 4HH0A 5G3ZA 3N2ZB 3VPHA 4CUKA 4YUZA 2ACVA 1CYDA 1JEQB 1A7JA 2Q7XA 3JAMA 5TF0A 1RWQA 1ZOOA 4EW3A 1ZG3A 1LFDB 1HDIA 2PRSA 5F9HA 1GFZA 1NBOA 3FB4A 4OU4A 3RRJA 4CCAA 2YC4C 4QDOA 2EW8A 1UDWA 3AQIA 3HKEA 4M8NE 1AXGA 5EJAA 1F8FA 2FMFA 2VNSA 1ZJZA 3FN4A 4G5GA 2R6JA 4JJIA 4BU0A 2JLQA 2CXUA 1R4ZA 2CZQA 3MTAA 4NMHA 3FVTA 4R2XA 4DPMA 1EWVA 4LCBA 4UUAA 4ZIRB 4WN9B 4KIJA 3QEMB 4BEJA 4LVCA 5FO0A 2RE8A 3JXEA 4BFSA 4HXFB 1Q21A 4J4TA 5DCYA 2AJLI 2HL6A 2ZI4A 3O3NB 4J2HA 1PJCA 4RC9A 3V8BA 1RWMA 1L4GA 2O7SA 3ZQ4A 3KS9A 4RULA 2P2NA 5ENVA 4B6JA 2BKLA 1WD5A 5D85A 3RU7A 5KVQA 3WLTA 4YP0A 3WQQA 1CV2A 3O83A 3QWAA 3ONNA 2VNKA 3DE2X 3BD8A 5TSDA 4BLQA 2ZDHA 4BNLA 2NAFA 1CEEA 2FMUA 4EGFA 3GVPA 4NPCA 5ELXA 4B71A 1Y4SA 1Z39A 3GROA 4RDHA 2RHRA 2FG7C 3ZU3A 1GU7A 4CM8A 2HSWA 2H9AA 1Q7EA 3K2QA 3F6RA 2BR4A 4H08A 2G1AA 1GITA 2AE1A 1YTLA 2PUHA 2X9LA 1J2JA 5DW3A 3VTAA 1RYBA 2HFKA 2VDOB 3RK0A 2J30A 4JLNA 4R83A 3LY8A 1H6CA 2P9EA 4TLCA 2X14A 4CKYA 3MWDB 1DGQA 3QK7A 1VE5A 4LWZA 4XVHA 3K3PA 1OU0A 4JI8B 1ODSA 2KX7A 3DTVB 3M7IA 1BXGB 1NP6A 2WJ3A 4BO6A 3OPYI 3WNZA 1ISMA 2NPIA 1IQUA 1JT2A 2I2FA 2W4IA 2XRFA 2Y76A 4M7PA 3FNFA 3AIKA 1AIPA 5ETJA 1LSUA 2IIQA 4FKMA 4P7BA 2OO3A 3CLUD 1V1MA 4XI9A 3THXA 4W5NA 4KHPB 1SUDA 1QCZA 1E5QA 1JQEA 1TA4A 1D1SA 1PT5A 4RD1A 5FFMA 5AD1A 2O5RA 1AKYA 2RHMA 3H65A 2EKQA 1T8SA 1MAHA 3AHGA 3HJUA 4FB5A 2FVYA 3GVIA 1RM5A 4MR7B 4F6LA 2TYSB 2XWQA 3GLFA 2DUNA 4E07A 2IP1A 1XZDA 3O7WA 2FETA 2LKDA 2IRWA 4M76B 1EWQA 1SHZA 1DP4A 3D6UA 1DJQA 4HD8A 1H2HA 1W6UA 1VLLA 4ZQBA 5L3QB 2LBPA 1NM5A 1A1SA 3BCSA 1KVQA 2V4MA 5JRJA 1ESMA 4BMNA 3NQ41 2ZE8A 3OWHA 1PUXA 3M9LA 2J0VA 1X7YA 3QU5A 1DQPA 2OAQ1 5FF9A 2Q28A 4UUBA 2Y4NA 4F2PA 5I48A 1XCLA 4C89A 3ZHCA 5A4JA 1H2WA 2UZ1B 4IVNA 4N6NA 1NQVA 1J8QA 4NOKA 1LS6A 5AICA 3S29A 4BN0A 1K6XA 2IU4A 4AJ9A 2PO7A 1H23A 2RJ3A 3PFNA 5TE9A 4D9JA 1UMBA 1ZC3A 2WTMA 2ROQA 1NDUA 1S0UA 2VUSA 2WWHA 4N82A 4U2FA 3RIMA 4CL8A 1FDSA 4K9OA 5JYEA 1DEHA 2YIVX 1DIRA 3G02A 3ESDA 3GLRA 4LDNA 3EE6A 3N0TA 4FLFA 3V4ZA 4EYSA 1U1GA 2TMKA 5EMMA 5BW5A 1VSQA 1IYZA 5CNKA 5E3IA 2NV0A 3DAHA 4HSGA 4D80A 3ZDCA 3RFUA 4IDFA 3L7YA 1YCDA 1PZNA 2BHLA 3ZGZA 3JVUA 2CEAA 1U2TA 1Q2XA 2EJBA 3BHJA 1X19A 3AUUA 2IXEA 2GFIA 1K5HA 3AVOA 3OC6A 4PZLA 4UZSA 4EM6A 1A27A 1J7KA 1L5ZA 3E48A 3NZEA 2QX8A 2GUGA 3SNHA 4BC0A 3WGMA 2R4UA 2W2OA 1XRMA 3ZR4B 3MXOA 3K32A 4JUCA 2GAAA 3ROZA 4P53A 1K4MA 4WXMA 4B3TB 4ZMSA 2CXPA 5BSKA 1PVDA 1XCMA 4LIPD 1Y3CE 4HAWA 2R00A 1LBTA 4DVJA 4PZCA 1X7ZA 1L4FA 5DNEA 5EIBC 4GW3A 3F47A 6LDHA 3QKRA 3K1TA 1VPVA 2R60A 4NK5A 1JA1A 1VL5A 4QOEA 3EGOA 1E58A 2ZT6A 4M86A 1L4MA 2OWDA 3FDIA 2ZEJA 3M9XA 2QG9A 2WUVA 4L0CA 1Q44A 2ABWA 3BIJA 1TF2A 1ZXBA 3DEZA 4B4KA 1UZLA 1DV1A 3NCHA 2C2YA 2A1IA 3IMCA 2H1OA 4ND2A 3T5BA 1DTWB 4YR7A 3RV3A 3N0VA 3ZYCA 1D6NA 3ELDA 5ES3A 4B75A 2OZVA 3NHUA 4RZXA 1XDUA 3AF0A 3F46A 2J45A 4HYTA 1WCIA 1VJCA 4BKUA 1D09A 4F3RA 1G8KA 4EKEA 3OT4A 3OZIA 4BAGA 3DFZA 2AZXA 1YHYA 3B5IA 4N0QA 1G9TA 5M7EA 3PXDA 2MR5A 3AJ8A 3EDOA 1I5RA 3HYLA 5KOIA 3OZWA 4AD8A 1IUOA 4UJ5A 1OV4A 5CHYA 1DFGA 4BGEA 1NDHA 3MGBA 1EA5A 2YV5A 1UKAA 2ZWOA 3G2NA 1FFWA 3W79A 4KQEA 3HVHA 4FZ3A 3D8UA 4C6SA 1VA4A 3HVUA 5ALHA 3DP9A 4KGXA 3OQBA 4P4SA 3L0CA 1A7AA 4TVOA 1LRKA 4TKUB 1FXWF 2WT9A 3R4VA 2BF4A 5FI1B 4EPWA 5EHIA 4BMOB 1CDDA 1QIEA 4GPAA 3G49A 4JXZA 2MWMA 4I50F 4YDSA 2RHHA 1TNDA 1EG7A 5I6DA 1HH4A 1F2DA 2BEKA 2IW3A 2IK8A 4RCVA 2IA5A 2PX0A 3UKJA 3L1JA 1VE9A 3MWGA 2OFOA 4HAUA 2CXHA 2TMYA 4XWAA 4C9BA 4LNAA 1E18A 4L5YA 2HJRA 3RVOA 1X1DA 4RY0A 2VQ6A 4F1JA 3CLTC 2R8BA 3C7CB 4RY2A 3HDHA 1U2PA 1CVIA 4GKBA 5JBQA 1PR2A 4KTVE 1TK9A 1UBTS 4PHHA 2G8LA 4ARZA 1JSLA 3DO5A 4CLEA 4JQZA 5EJ4A 1XNRB 1JBEA 2GRUA 3RWBA 2W6QA 2X6TA 3NHJA 2H7YA 3DMNA 3OLZA 4GVLA 3KE9A 2YWEA 2PKYX 3H3XA 2DHCA 3A3NA 3SSNA 4WINA 1VYUA 1T9GR 2WSIA 2CK3D 621PA 5G02A 3H7AA 2BZ0A 2Y1DA 4I8IA 2C92A 3UMFA 2FQQA 2OT3B 1JIUA 2GTIA 3OPNA 4H1HA 4BX0A 1E2PA 5ALVA 3IR6A 3I9JA 2RKWA 2I34A 1ESEA 1KF0A 3G59A 4UJ3A 4DQLA 2QBYB 4V2IA 4EECA 4ZYUA 1UFVA 3B1JA 4KJXA 3BF8A 2ICAA 3GRAA 4R1TA 2VF8A 3OC0A 2AX4A 3PPIA 1FMTA 1ZCBA 2YNMA 4RK0A 1ID8A 1DO0A 3WLKX 2E4VA 1USGA 2EP7A 4FE7A 4LJRA 2GPWA 5FPYA 1XRRA 3WNVA 1ZQ9A 1Z68A 1R3UA 1S02A 3IFSA 4Y18A 4R8LA 3HCRA 4QYIB 3GRRA 2J9GA 2DUMA 1Q0SA 3TQIA 4IF4A 3ZN2A 1VSVA 2W4MA 1Y8ZA 2PT9A 1RC0A 1FDRA 1RC8A 5CB4F 2P9YA 1DWUA 1P4HA 1XNHA 2A14A 2JW5A 3OY7A 2VAXA 4WNCA 3WL5A 3QPWA 2HRBA 1OWPA 3KV3O 4DLBA 4LOKA 4K1LA 1OFUA 3B70A 4Z4QA 5B1SA 1JQKA 2I1VB 1CRPA 3KKZA 3UCEA 1GCOA 3BJIC 3IV9A 4KFRA 5F4ZA 1MNQA 4URXR 3MNFA 3ABZA 3F7MA 1U2QA 3DBLA 1GPYA 1PNVA 3NGLA 2H4YA 2Q46A 5DI3B 3PHGA 1ZMTA 2WSSA 2R8XA 5LPNA 1GZ5A 5FTWA 3F1LA 5M3BA 1B2LA 3L5KA 1W85A 3BXGA 5EI5A 4R1SA 1FFBA 4OFXA 5DCWA 3PVCA 1W1WA 1E3DA 3GVHA 4PS0A 4ARVA 1QOPB 1SO8A 4B9AA 4YCBA 1ZC4A 4NBVA 5J4HA 4MR9A 1ZK2A 1KTVA 2C4MA 2G4LA 1CDOA 3UT5B 4O5OA 2QRQA 1VJDA 5JHHB 3RJTA 1WBDA 1FBTA 2QLTA 1J99A 2AL7A 1BHJA 3G2HA 1SHLA 3MLAA 1EFKA 1U9JA 4V0KA 3SM9A 5CB6A 1POWA 2ECPA 5LOVF 4W99A 1R4MB 4ZCLA 3S3TA 3UW3A 3W6ZA 3IBSA 3TBHA 3ZDRA 2XTNA 5B53A 4OB6A 1MB3A 2I55A 3OSUA 5MFPA 1XRSB 3HVJA 1BEUB 2QUAA 3AL3A 4H9GA 3RRBA 5BWOA 1ECJA 1GZVA 2PSJA 5ILQA 4CKEB 1ZU4A 2CCKA 2B36A 2HGSA 4YC7A 5CG2A 2YYZA 4D0NA 3PDIA 3DWFA 3MJDA 4OXQA 3I61A 1PYOA 1RJWA 2Z3ZA 4O29A 1R9MA 4DIFA 4DREA 4X6LA 4CM9D 3OZXA 3QTLA 1S9HA 3M1YA 2Q5EA 4ATNA 1ZLYA 1T4DA 2X3YA 3O31A 1L8XA 2QTRA 4E70A 8GPBA 5KC8A 4AKIA 1C9DB 3N5CA 4Q4HB 4IFTA 5LA6B 4YJ3B 3RT9A 3L6UA 1ULHA 1E63A 4ZYVA 3J7TA 1DAPA 1SU8A 4YO7A 3A28A 3S2FA 3EJWA 4IKPA 2GXAA 4KN8A 3R7DA 1YDFA 4YUYA 2B21A 2VHQA 5DULA 2RI0A 3MWJA 2XTMA 4XJTA 1T5OA 2GX6A 3F3KA 4JYCA 4TXLA 5ALLA 1DLJA 3ETCA 3HYSA 3WYNA 3FYUC 1PGPA 3FPBA 4HQRA 3RO7A 3FPLA 1JAIA 4BVJA 4K9SA 3NYQA 2OFXA 3PLRA 2F67A 2RHBA 4MTLA 4B3CA 2WJPA 3WOHA 1RRFA 3G0HA 3D7NA 3SKYA 4DCTA 3DLPX 4BB5A 2ZI9A 4KXWA 1NLFA 2YUTA 1JAXA 2NXCA 1U3VA 3JZMA 3UEOA 5I7FA 1KZ9A 1W76A 5GOZA 5MGNA 3WMFA 3BKXA 1VM6A 1I5EA 4WBXC 5A3VA 2O54A 1Z6TA 5CTAA 4QUKA 4EVQA 4JLKA 3L9XA 2BWJA 3PC4A 2CB0A 1DBWA 4LOIA 4A0QA 1HL3A 1YZLA 1NAIA 2DKNA 2XV1A 4OBBA 5LQAA 4B4OA 4LG1A 2OOSA 3TAUA 4OJYA 4DE5A 4G24A 1W8IA 2C00A 4PQFA 4C03A 1EUCA 2GEKA 5KYUB 4X45A 2C7RA 4TN5A 2J9YB 3WJ7A 4XM1A 1RVDA 3HU3A 3THYB 2OXEA 2YXNA 2YY7A 2Z0MA 3ONVA 2XZTA 3EHDA 5FEUA 2ONYA 4ZVLA 3VZSA 4IRMA 3WIUA 2FTKE 2XUAA 5K3SA 1LF0A 3PE6A 2BFAA 2CMDA 4G81A 1WUJS 4HDNB 4N65A 1QOZA 1KJ9A 3D1VA 1NMEA 3BWDD 3IO3A 3GZ4A 3F3SA 2V5VA 4RVSA 2PPLA 4DIDA 1NVFA 4YYZA 1HQDA 1OGJA 2MINB 3JQEA 4O2AB 2TMGA 2BI4A 1E69A 1XI2A 1WXQA 4EG6A 4Y2JA 4C08A 4ZYXA 3OIUA 3UV3A 1ZEMA 4J1SA 2G6TA 3VMMA 4E6EA 3VTZA 2DCMA 4ETNA 4DY4A 3AKYA 5KSZA 4KUGA 3FUVA 1EWYA 4RHYA 3DLHA 3RREA 1WA5A 4UTZA 4GLLA 1WAMA 1ZXXA 4GC5A 1ZR4A 5EKUA 5CYPA 1DS6A 1E7YA 3IPAA 1V5WA 2WIDA 3GFGA 1SVLA 3KJIA 1GDHA 4MKFA 3W5AA 4AY5A 4UHCA 5JEEA 3S2IA 2C9YA 2WFLB 2QRNA 1QF9A 4YCAA 3VDXA 4E46A 2I7XA 4PG7A 2II6A 2FQYA 3KT6A 1T4CB 2ADOA 4HZUB 1CIPA 1DG1G 2VWQA 3LUGA 1YRBA 3IJRA 4LHWA 3O9MA 4OF4A 3CISA 1GEEA 3MUEA 1MVLA 4QBHA 2PV0A 5KO2A 3VJLA 4Z4HA 3X1WA 3HDQA 2X2FA 1A8UA 1UKEA 4FBLA 4CLRB 2XGGA 3WFZA 4JUFA 4CQMA 5LD2B 3F8WA 2JHGA 1UQTA 5TLSA 4KL8S 3TLGB 3O84A 4S1OA 3ELWA 3DL7A 1Z75A 4I9NA 4RF3A 1WZEA 4EI7A 2IUSA 2P69A 3BXZA 2YASA 1FUEA 4WY8A 1O4VA 5HDQA 3PXBA 5EHQA 1DSSG 1Y1KE 5A5EA 1NPTO 2WMDA 4UE3S 1VE1A 2YVAA 4ALMA 3RR2A 3D0OA 1PHPA 1T1JA 3FAKA 4P3KA 5CIQA 5KTOA 3COJA 3DDNA 3F3MA 3UK0A 2R68A 3Q0EA 3BMQA 5JZVA 1M6VA 4EHAA 1NQOA 2ZWIA 1QONA 3FYCA 3DF9A 4BZQA 4EY5A 1XAJA 1JU9A 3SPXA 4DMUB 3NHBA 5AVVA 5IUNC 4XGRA 4X1KB 1G66A 4NYMQ 4R16A 3IB3A 2I6GA 1F0PA 3K4PA 1RCTE 2Q1TA 3OZCA 3QPVA 4CQLB 3CV3A 3TUJC 3QU4A 2B7LA 2R85A 1DKNA 1XDBA 3T7DA 3ASZA 3PQ5A 4Q01A 2CHEA 4XB2A 3R6DA 5AQ1A 5K0CA 5JS1A 4E2WA 1KIAA 1WUYA 4XE5A 1KYZA 3UPDA 5HBRA 3R0ZA 1N6OA 1RRMA 3ES9A 5G0WA 3UAVA 3ANSA 4QOJA 2L82A 5LZ8A 3U56A 1T25A 5T64A 2PQ0A 2IOYA 2XHZA 3RUCA 1N9ZA 4BN4A 1ZGHA 2OOKA 2XMDA 3GARA 4KKXB 2W2QA 2OKCA 2H48A 1G8GA 3Q9LA 3VZDA 4JYAB 1GDTA 4Q3NA 3K4HA 2OY0A 3EC7A 3KHKA 3HCWA 4Q4CA 4MUKA 1KR2A 4KWHA 4LV5B 4D26A 4OHFA 3MTBA 3OPMA 1D2EA 1LPSA 3QA9A 4ZZ3A 5BQFA 3URMA 5HCNA 3FOWA 4UDYX 1BVHA 3JY6A 2DQZA 1UC9A 2ES4A 3TW0A 3AI1A 3LWZA 1QO7A 4EIWA 2FN9A 3AOGA 4K6FA 4NS1A 3LBAA 1YRLA 1XEWY 2P5SA 3DCNA 3JR7A 4Q0MA 1KU0A 3CRMA 4DXAA 1N2CA 1TIPA 4ILKA 4N3NA 4QO8A 4BYMA 1OI4A 3HUUA 3ZV7A 3J81k 3OETA 1JJFA 2B78A 4J0CA 2VDNB 4CG2A 3I8OA 1CPYA 4F2GA 2AN5A 2KLHA 2BGKA 3PF9A 4F6RB 2CLLB 3C6QA 5E9WA 4DR2B 1U5BA 1DBVO 2EP5A 3TB6A 1LV7A 4EHHA 2WT8A 1MIHA 1RJ9B 4D46A 4RGVA 4DXDA 1MENA 2XYQA 1N5LA 1T34A 1CJVC 2YH2A 4MKHA 4QBIA 2ZB4A 3QBVA 4ER5A 4DMKA 4HUTA 1MX5A 1SVUA 2J9RA 3H6HA 3OTGA 4DMFA 4EUFA 1ZJWA 3ROFA 1Q7RA 1RAGA 4Q9DA 1OH7A 1U7OA 1HMPA 4K5QA 4LV8B 4I1OA 3VA7A 4MIEA 3CGGA 2KBEA 3O0DA 1Q12A 2Z83A 3U3XA 5LP6B 5FYDA 1MW8X 3A2LA 2R79A 3RANA 2I7TA 3N28A 1PZHA 1R12A 1W47A 4K26A 4MYRA 4N5IX 3TOZA 4IDBA 3TPFA 1O03A 5CH3A 3S6JA 2G0TA 1GP2A 3OSZA 4JR1A 4LE2A 4UAJA 5BWMA 4OHVA 5DRYA 4LJ5A 4K9LA 4BNUA 2Y05A 1WB6A 4CEJA 3LSTA 2I67A 3AY0A 2CNKA 2XCLA 5JRDS 2A78A 1A8SA 1RYNA 3WMWA 3NM4A 2GETA 1CRWG 4TT3A 3N8DA 3OT5A 2J3HA 4NFLA 2ZBRA 2BFCA 2X0RA 3NGMA 4M9SA 5JNTA 2A9JA 4DTCA 3EZ7A 3HI6A 1NUAA 2APJA 2Q41A 3AR9A 4KFSA 2H8GA 5HFJA 5FNVF 1RPJA 4IOJA 2Q45A 3EVZA 4Y2GA 2UZAA 3VC1A 1Z2AA 3R8CA 2OZKA 2WHRA 4NBUA 5TQ0A 3JTEA 2CVQA 3KYCB 4DCOA 3WO1A 5ADUS 3U2QA 1S7CA 3QVLA 4S0XA 5IAJA 4YJ2A 5G2OA 3T3OA 2Q5JA 4AQYB 2FVXA 2W83A 1KPGA 4DV5B 1HDCA 4HCJA 4EGAA 3DG9A 4PV7A 1WDWB 2DUWA 2PX8A 2ZKLA 1KEEB 4XRRA 1HE1C 1I8TA 2VDJA 4I1SA 1BFUA 1Z0JA 4QRIA 2NUTA 2VUUA 5IJ0B 4G0VA 4G5SA 1WKCA 3LKDA 2PKCA 3G0OA 4CNBA 4M49A 1OTXA 5DI9A 1MIOB 4U2GA 1CJTC 3C98A 1N1GA 4D56A 3FPFA 3OD5A 4ZEWA 3ZWQA 5IMSA 1F20A 3W1WA 1TJNA 3JX9A 4II3A 2CC2A 4ZK6A 2IOQA 1Z73A 1SIOA 2ZIAA 3NWPA 3GCGA 2G08A 3FGZA 4GMDA 3I3SR 3WQRA 3EARA 3JALB 3P9SA 4AYWA 2VCYA 1H0RA 1W0JD 1A9SA 4YJGA 5FBVB 5EMJA 5ECDA 3PDHA 3TVDA 4U4AA 5CDFA 2ID8A 3STVA 1Y1SA 2BSQA 4KXYA 5FWXB 2QRGA 3OZBA 3G8CA 4JC4A 3VMFA 4RPLA 4XM2A 3PQ8A 5JMTA 1E2KA 3LBFA 2WILA 3WISA 5F35A 1VSUA 2V7QA 3WLJA 1P4GA 2D7DA 1CUBA 2F1HA 4FFLA 1OFGA 1TIKA 3ZJ4A 5H0IA 1X9GA 1GUFA 1S3GA 4E5PA 5DK6A 2FWRA 4C05A 2LKCA 3MJSA 4YUWA