1R8QA

Full-length arf1-gdp-mg in complex with brefeldin a and a sec7 domain
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural snapshots of the mechanism and inhibition of a guanine nucleotide exchange factor
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein transport/exchange factor
molecule keywords ADP-ribosylation factor 1
total genus 62
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r8qA00
4URVR 5AJYA 2YC4C 1QHNA 2ZRFA 3BWDD 2BBTA 1P9RA 1DAIA 3ECCA 3TQFA 4BFWA 3VR5A 5JJKA 2WJJA 1Q21A 2D7CA 3GLHA 4ARZB 2BC9A 3LBNA 5HCIA 3HU3A 2GWHA 2P3SA 1XD2B 3K09A 2V55B 3T12A 5L3QB 5BYJA 4HUQB 1FQJA 4TMKA 4Q9LA 3SS8A 4P4TA 4DJTA 4FMCB 4CYMA 3VAAA 4DVGA 4TL8A 4DCNA 2HXSA 2PZGA 2F1HA 3X1YA 1KI3A 2GCPA 1ZIPA 2OBLA 2OFXA 3ZVMA 1M1YE 4A6XA 2JLRA 4NTZA 1G8PA 1TPZA 4TLAA 1XTIA 4JJZA 721PA 2EWWA 3ZZUA 2XB4A 2MMCA 1KYIA 4MRPA 3CPEA 3Q5DA 3IEVA 3ZGXA 4M21A 2CMKA 2G0NA 5BYKA 3ZZTA 4Q47A 1EESA 1KI6B 4JLKA 2IK8A 4LJ8A 2XXAB 3W6OA 1Z47A 5KSPA 4C9BA 1XRJA 4UXJA 3M6AA 1P72A 5EQTA 3GFPA 1VG8A 2HLDA 1G291 2W6IA 1T9HA 3ZYCA 4A8JC 2AXPA 4FCWA 1YZTA 1JJVA 1Z07A 4PX9A 2G1KA 2IYLD 4V02A 1L4UA 4D2IA 4PPGA 2CHGA 4LUCA 1YJ5A 5KHOC 4S35A 2QQ0A 3R7WB 1QBKC 1UPTA 1MR3F 1SGWA 3FWYA 2PX0A 3HYRA 1GTVA 4QGAA 1QZXA 3G82C 2BOVA 3AF0A 1J90A 3PUZA 1JR3E 1VYUA 3AF2A 1E9CA 1SVKA 3OF5A 3EPHA 4ESHA 3RSLA 2DHRA 2FU5C 3ZDQA 2OO7A 3L8ZA 4D4LA 1EWRA 1VCOA 2P5SA 3WYFA 2P2LA 1MRSA 1KK1A 4RZXA 2PT7A 5B2ZA 1FUUA 4Q4LA 5LD2C 5FOWA 4PC2A 1Y63A 2F6RA 2QZ4A 3F8TA 1AGRA 3KJHA 3U7EB 1G8HA 2ZQ5A 1IN7A 4IEEA 4Y0VA 2C03A 2WM9B 3AVPA 1BMFA 3ND8A 1G3QA 3EX7C 2ANCA 1D9XA 5DHFA 2J0VA 3C4JA 3K1JA 2Q3HA 4F93B 1XD8A 3BRWD 2EU8A 2KSQA 1R4AA 1OXVA 2WWWA 3W3ZB 3GLFB 2QPTA 2ODWA 1Z0FA 3D8BA 2ZR0A 3B5JA 4NCIA 2ERXA 5AUNB 2O8DA 4MA4A 4RD1A 4M22A 4NYJR 1E1QD 2RH5A 2W58A 4F4CA 3ZIAD 1ZNZA 2PBRA 3GLFE 2QSZA 2WPDD 5HE8A 1OF1A 3S1AA 4R9UC 1D6JA 4V0OA 3AM1A 1XCGB 1I4LD 4DLYA 2ODEA 3VX3A 2Z83A 4V0LA 5JWHA 1A1VA 4EJSC 2XXAA 3CR8A 3EPLA 1DAKA 1CBUA 5BN5A 2A30A 1G6OA 4QBGB 1S1MA 4I1VA 4BGDA 5ANRB 3TKLA 2GJKA 5FBLB 2ORWA 1W5SA 4MKHA 4QJ5A 5BXQC 3G0HA 4B2PA 2QENA 4A0FA 2HLDD 2O0HA 2W6ID 4PPNA 3ZVLA 3DKVA 4OQFA 2OZEA 1ZYUA 4NP6A 4GL2A 2XITA 2WMNB 5CIWA 2MSEB 1DADA 2QMOA 5JBQA 2WBLC 4URWR 1TADA 1AS2A 3CB4A 4PSKA 3MJHA 3QKRA 2HYIC 1AS0A 4IOKA 1UBEA 2D3WA 4NPHA 2ONKA 3B1VA 1P73A 4OK5A 4ITRC 3OEHD 2YINC 2G1JA 4MRSA 2X1VA 4LHZA 4BQSA 1CULC 2ZI7A 2NTYC 3MLEA 4IDNA 2GTPA 5FBRB 4CEHB 3HJNA 3FTQA 2RHMA 1U8AA 4G3XA 3SR0A 2ZJZA 4W7SA 4J0QA 4Z51A 2PZFA 4HAUA 4KLZA 4P4UA 4EFLA 3SEAA 3EARA 2ZPTX 4C7OB 3TIFA 1TF5A 4B71A 1E2JA 3IIMA 1DEKA 2IA5A 2D62A 4TLBA 4EPYA 1Z6XA 1VECA 2REXB 2W6JD 3H84A 4FI3C 2JJ2D 1OPXA 1Z0JA 2QBYB 5C4GB 1XTRA 3P4XA 1ZD1A 1KIMA 3GJ0A 1KNQA 1HQYE 2A5DA 5DI3B 2DR3A 4DSNA 4WBSA 4IDHA 1QHSA 5CB8A 5LD2B 2QT1A 2IBMA 2GK7A 2CVHA 1LS1A 1XCPA 1CS4C 2JGNA 5HR5A 4C3ZA 2RGNC 2ZRLA 3WXMA 1J99A 3GEHA 1CF4A 2J45A 5FL7D 1GWNA 3VHXA 2HDNB 1TTTA 3W5JA 4U00A 5EZ6B 3UKDA 1W4BA 5CM9C 4ABYA 4DEXA 4D0NA 2OCBA 1WA5A 2GESA 3RAPR 1PV4A 2B21A 4KBFA 1TEXA 1TQ2A 4FWTA 4XSGA 3ADCA 3KUDA 2G0TA 3UWOA 3UXMA 1G8FA 3GLIE 3VHLB 1E4VA 3AGPA 4MDFA 5HZHA 3B1YA 4DEYA 3K0EA 2MSDB 3WNDA 4PXAA 1EFRD 1XBTA 2N42A 3L82B 2ZYTX 1RRFA 2BWJA 5TXGA 2IYWA 3K70B 1NY6A 1GL9B 1OH8A 1YE8A 1NLZA 2DFTA 1IN6A 1F48A 3QG1A 3TK1A 1AK2A 3TW4A 5H70A 4LBZA 4EJSB 1Q0UA 5K8UA 5CB6A 3CRVA 1K5GA 2EQBA 2QPOA 1CJKC 3HU2A 4LX0A 3VR4A 4MGZR 2VA8A 4M1MA 1XEWX 2ODBA 3SQWA 4LJ9A 1WE2A 4LI0A 1IY2A 1GNQA 4NYIR 1XP8A 1JB1A 3CF6R 1SHZA 4LJ6A 3E1SA 2WVJA 4KYUA 1P2TA 4BFYA 5KSZA 1ZIOA 5KYKA 1KDTA 2A78A 1T8UA 2TMKA 4K8OA 3FYHA 4LSGA 4C0SA 4DLZA 2QBYA 1IXSB 3N5CA 4DCVA 1FNNA 2ZRCA 4GOKA 5JI2E 4CEJA 1TAGA 4Q4JB 1DAFA 3RSOA 3BE4A 1NRJB 2VQSA 3CLVA 2J9RA 3SFVA 4NH0A 3GJXC 2AKYA 3NWJA 4GZMA 2ORIA 1GG2A 2BJWA 2ZITA 3AVWA 1W2GA 4FMCF 1N6OA 4N3NA 3A1UA 3AVOA 5JEDA 1YR7A 4PTLA 4ESVA 5CJPA 1G64A 4LHYA 4RZ2A 2P65A 1NJGA 4I1UA 3T35A 4TT3A 2C9YA 2J0UB 1S1CA 3K0CA 4EUNA 1PLKA 2CHQA 4U02A 3KQNA 4JT4A 4EFMA 3FOZA 2UVQA 2CE7A 2GXQA 1J8MF 1E1RD 4G5SA 4QRHA 1RRPA 3IUYA 2BCGY 2QTVB 2PJRA 1NIJA 1R10A 3F0TA 4N1AA 4RCZA 3VFDA 1W36C 5AJXA 1VHTA 2VSXA 1GAJA 1BS1A 1L7VC 2ZSBA 4CDGA 2C96A 5L3VA 1ZUHA 5EE0A 3RWOA 5E3HA 4UJ5A 2QPAA 4XSHA 3R9IA 2RGAA 3AVQA 4QJ3A 1E6CA 5BN4A 3SQXA 1KMQA 2EWVA 4HZUA 1XTKA 2FFQA 1UBFA 1Q22A 4N0EA 4BRUA 1W0KD 2QMHA 4URUR 5HTKA 221PA 2ZR7A 3AEZA 1UFQA 4M1SA 2QM7A 4LPKA 4TMWA 4V0KA 4A0RA 5EE5B 1MT0A 5FBWB 3TSZA 3BB1A 4GT1A 4ZDJA 1D5CA 1UDXA 1E9RA 3WRYC 1OHHD 2FSFA 2DPXA 2YZ2A 1DG1G 3CW2A 5G41A 4AIIA 5B64A 1R0WA 1EK0A 1XTJA 4OQMA 4ZO4A 4B6EA 1G7CA 4UNPA 5P21A 1NN3A 2IYTA 2D06A 3P26A 2EFHB 3ZQ6A 1NG1A 2QA5A 3UMRA 4PAMA 4OI4A 5IHPA 3LBHA 2QSYA 1NN1A 3QEJA 3LY5A 4LRWA 3WY9A 1NJFA 2IS4A 3CF0A 2FGJA 2L0XA 4QG7A 1DELA 4URYR 1MV5A 2J46A 5JJLA 4PHFA 1HT2E 2NO7A 2W2XA 4HLQB 1T8TA 1DE0A 1Z08A 2LKDA 3DO6A 3OE7A 4MYCA 2R8RA 5SZJA 2Y8EA 3VTKA 4IJMA 2O8CB 3VU9B 1NNEA 3NDBB 2DFKB 2HCBA 3K0SA 2C9CA 4I1OA 4HEJA 5BQ5A 2H7VA 4Q03A 1SKQA 1RIFA 2G83A 4HLUC 4ZCMA 1G1MA 4IDOA 3QKRB 3RS5A 3TSWA 1VKJA 1GRQA 1N5JA 2WZQA 1GNPA 5AUPB 1ODFA 2WWHA 3C8UA 2ZRAA 4HZIA 1SVOA 3NTUA 3PJRA 1CJVC 4JSYA 1AQUA 2ZUDA 3ASZA 4C0QC 1SHKA 4OI0A 1JR6A 5EXSA 4HUTA 1KI8A 1RVDA 4U5XA 3AF4A 3FGNA 3QBVA 4OL0A 4OHWA 2WKRA 2GEVA 4DDUA 1KK2A 4WW0A 4IFBA 4Q9HA 1XD9A 3WHKA 2Q0HA 1GM5A 4GOXA 3U3JA 5IK2A 4D25A 4RKEA 2JLVA 3FMFA 5G3YA 4KCGA 4BUJA 1C9KA 3EW9A 2VRWA 4LGMA 1DO2A 4B3CA 4JL8A 3FMPB 3UWKA 2IYSA 4ILEA 1T3SA 2QY9A 3PITA 3QF7A 1HE1C 2CHVA 2V3CC 2JLXA 4PANA 3N2IA 4TL9A 3U6BA 3REGA 3T1OA 4D82A 2Z43A 3MWYW 1KY2A 1Q1EA 2HF8A 2F1RA 1E69A 3BB3A 4DHEA 1Z0DA 3FKSD 3KXLA 4M1KA 5TARA 1GDDA 2AXNA 2E1RA 3NVAA 2A2ZA 3OEEA 3QKSA 1Z0IA 3FMOB 4JKYA 1SULA 2GJ8A 4LWZA 1MH1A 4NCNA 4B2LA 4BLPA 5DIFA 4DSUA 2QU8A 1Z2AA 4QHTA 2FH5B 1KI2A 1Z6TA 2ZE6A 3GLHE 1PJRA 3NH9A 3QOFA 3DDCA 3VX4A 3DZ8A 2AWNA 4B3FX 2RHDA 1QF9A 4A36A 1P7CA 4AKHA 4PHTA 3GP8A 2H92A 2DBYA 4NKRA 3C7KA 1HT1E 4EAQA 1GIAA 1N5LA 3A4MA 1G3RA 3UMSA 3QKUA 5KSYA 2HJVA 1N0VC 4E09A 2RGNA 2ZAOA 4UKDA 1G7SA 2VF8A 2V4ZA 3U4QA 3TUJC 5DGXA 1JR3A 4IXNA 3TSOA 1TQ4A 4DB2A 1G8GA 1RW4A 3WMFA 2A5GA 1AIPA 4TYNA 3GLGE 4DLTA 1NVWQ 1P2VA 5L3QA 1KDRA 4MGKR 4QBHA 4OHXA 1BH2A 1LVGA 2VP6A 2NZJA 2XZPA 4M2LA 5J4KA 2ZRGA 3THYB 1W0KA 1Z5ZA 4V03A 1XPOA 3D31A 1ZM2A 4JLNA 3EA0A 3ADKA 2V1UA 2IXFA 1QHXA 1F2TA 4CEHA 2F3RA 1VIAA 4GP6A 2AK2A 2XZOA 3BC1A 4PSVA 1A2BA 3ZVRA 4CT5A 1AGPA 2D2EA 3PFIA 2QRNA 1FZQA 2FX3A 4JIMA 4WZAE 1CP2A 4KSBA 3F5FA 2CXXA 1BYUA 3BFXA 3B2EA 1W0JD 3CX6A 4DKXA 1FP7A 5DH9A 1CR1A 3NBZC 3AGQA 4OHYA 3TUIC 3VKWA 1OIVA 1TMKA 3U44A 1KMHA 2OFWA 5CJ2A 3B9QA 2O8FB 4KFSA 3KXKA 3B9PA 5TV2A 2ZS8A 2JLUA 2X19A 2B92A 3MRSA 1EX7A 2QUZA 3QG5A 2DB3A 2ZR9A 4C0KA 5LB4A 3SJAA 2B7CA 4AI6A 4D80A 5EP2A 1G4AE 3LX5A 4XD7D 2PX3A 3A6PC 1UKYA 4MYUA 4OQNA 3DM5A 4HB2A 3THYA 2KWIA 4L16A 3TH5A 1E2FA 3CH4B 3FMIA 2OXRA 3CX8A 4LV5B 2IL1A 1J2JA 4IOMA 4Q1BA 1BMFD 3DHWC 4LHXA 4ACBA 2YC2C 2ZYUX 3C14C 2WWIA 4MGIR 4DLRA 1S4QA 2GZAA 2OXCA 1II9A 2GBLC 1JI0A 4DT1B 3U7HB 5JRZA 5K8IA 4BEJA 3ZQJA 4LYJA 1XXHA 4Q48A 5B58C 2IEYA 1T3HA 3BJIC 2RGXA 3GEEA 4S2EA 3GJ8A 2FE4A 4Q9IA 4A1FA 4F92B 1HH4A 3R8CA 5JZVA 3NIBA 1F2UB 3ZIAA 1TUIA 1FUKA 2PCJA 5DO9A 3T1QA 4DZZA 1OE0A 4QOSA 2KI5A 4Q1CA 4UQOA 1N6HA 4ZDKA 2XJ4A 4HB3A 4A92A 1YR6A 1N2CE 3MD0A 2N46A 3VQTA 1FW6A 5KDOA 2VHCA 4TYQA 3Q7QA 1CU1A 2ZE5A 4MRVA 4TQ9A 2RGDA 5D3MA 4YONB 3LRPA 5L3RA 4KLNA 1OH6A 3B7GA 3AP3A 3CX7A 3BFVA 5GJCA 2P5TB 3ZD6A 4NZYA 4RSGA 5KPDA 3E5HA 4DLVA 4O0MA 1GVNB 1FTSA 2Z5FA 2ZRMA 1WF3A 5TMPA 5FBQB 1T0HB 2BKEA 4ZDIA 3I3SR 1OH7A 4NONA 1IY1A 3B1ZA 3RHFA 2CJWA 3AVXA 4FCTA 3AVTA 1OXSC 1GKYA 2ZIAA 4Q1FA 3KKNA 1GZSA 2VO1A 3K0FA 4MITA 4DB4A 5JECA 4QM7A 1Q44A 1ZP6A 4Q02A 1IJFA 1JAIA 3EC2A 621PA 1WB9A 3OAAD 5JWRA 1KK3A 4V0ME 4ZV4A 3Q7PA 2WJYA 1NVVQ 5K8TA 2PEYA 3SNHA 1E4YA 2J41A 1ETUA 4LJ5A 4EPTA 1M34E 1TU4A 1EFTA 1WMSA 1IAQA 1R0ZA 5KNCA 4DXAA 4LYFA 4QGFA 3Q72A 5DYGA 1XPRA 4P31A 3L0IB 4DUGD 1D8TA 3A8TA 3MSXA 2HV8A 5GADl 2ZUBA 2C5LA 2IYQA 3TVTA 1LTQA 1LB1B 1XEXA 3KQKA 3OEED 1LNZA 1Z83A 3L2OB 4M0LA 2IUTA 4XWAA 5TVKA 2JASA 2JA1A 1YZNA 4AD8A 5KOYA 2CDNA 1NSTA 3VR3A 2VP4A 1ZRHA 3LLMA 5A0FA 3ZS9A 3KX2A 4FD2A 2GEUA 2ZJ2A 3NHBA 1D2NA 3RVBA 4ZIRB 1VG0B 2VP2A 4RFSB 3K8YA 2OM2A 1WQ1R 2IHBA 2E9SA 1RJ9B 2REOA 5H8WA 4L15A 4Z1MA 3R7WA 1FPMA 1R7RA 4TT3D 1KO5A 4WIAA 3BFKA 2ZS7A 4P0TA 1GRRA 1R5NA 2Q21A 5GVSA 1NBMD 3DZDA 4M1OA 1KDOA 3THXA 1JAHA 1LS6A 5HKKD 3ADBA 3I62A 2ZRBA 2NOAA 4ZCLA 1X8LA 4XH9B 1G21E 2CNWA 3Q5EA 4B43A 4JVSB 2A7QA 4AYXA 2ZSEA 3IGFA 4Q5IA 2OAP1 3AKDA 4KU4A 3SN6A 4OI1A 1HE8B 2XNDA 2YVUA 3DKPA 3MWJA 4M9XA 5CDFA 4KFTA 4B48A 1DAMA 1ZJ6A 3THWB 4BZPA 2G9NA 2W2TA 5B30A 3KL4A 4IOJA 4NBSA 2QAJA 1K6MA 4JBXA 2F9MA 1W4CA 3PEVA 5CK5A 1NLFA 1Z06A 2XTNA 4GMXA 2FDCA 2ZANA 2EW1A 2ZVPX 4KFRA 3T1VA 3LWNA 3LH5A 1NIPA 2W00A 3OIYA 4QHYA 3B78A 1OXTA 1XTQA 1KSGA 3RYTC 3CIOA 4R2IA 2XAUA 3P4YA 1E9EA 3MG9A 1II8B 5FI1B 2VYFA 4RZ3A 4HYYA 3ASYA 4UNNA 3IO5A 4URZR 4BECA 5J4LA 1R8QA 2FPKA 1ZM9A 3ND9A 4M1WA 3U6KA 4JLBA 2ZI5A 4E07A 1NBMA 3C5CA 5E7JA 1M8PA 3PEUA 3JVVA 2UKDA 2ATXA 2ZU0C 2CK3A 3CONA 3HU1A 2FEMA 1FFHA 1ZM3A 2VP0A 3KTAA 3MJRA 4CEIB 1QG2A 1YR9A 2PCLA 5AR1A 1A82A 1NG9A 2MMGA 1R5BA 3D7MA 1E2PA 2F43B 4HATA 4TMXA 4PC1A 3AF1A 1S8FA 4IHQA 2WJGA 2A5YB 2WAYA 2DFLA 2J7KA 1XMIA 2ORVA 2WWYA 2NGRA 4HB4A 4I1SA 5KTYA 3RS0A 2ZRHA 2QMEA 2EFEB 2XTZA 3KKPA 2UZ3A 4TWZA 1NSFA 3BERA 1H65A 1Z8FA 3OFND 2KBEA 1UEJA 4DDWA 1V5WA 3TQCA 5JMTA 4JYCA 2CE2X 4G5GA 1HTWA 5ELXA 3L0OA 1ZCBA 3MWKA 4FIDA 1GKUB 4NYMQ 1O87A 2R6FA 2KE5A 3WRXC 1CR2A 3PR1A 4Q21A 3AV0B 4PO8A 4DIEA 4BWYA 2GZHA 4F91B 1XJ0A 4QM6A 2IYUA 3GJ5A 2OE2A 2FFBA 2IUSA 3SU8A 3OIVA 3WMEA 4NYJQ 4V0NA 2WV9A 4FCVA 5JHHB 1XF9A 1YVDA 5KNBA 4YMVA 4JLPA 4H9GA 4MQBA 3VR2A 1E2QA 2EFCB 3KKMA 4UNQA 5AK0A 4A9AA 4AC9A 2O8EA 1N0WA 2AFIE 2J7PD 3OEHA 2VL7A 2ZREA 5EXPA 2BMJA 2NIPA 3I8XA 1E9AA 2P67A 4A2WA 1D9ZA 1KO1A 1ZINA 4GI7A 1Z0AA 4HZUB 4BLQA 3VNVA 3TW8B 4JLVA 1EGAA 4MRNA 2OHFA 4QNMA 5FPYA 3AVYA 3BOSA 1N6IA 3LLUA 3PUYA 821PA 3I4LA 2BM0A 3HPRA 2LCFA 3IO3A 1QHIA 4P4SB 3VR1A 4JLJA 4C4PA 2QL6A 1E79D 4IVQA 1NP6A 2WJVA 4QBIA 3ZS8A 1MRNA 2RGGA 3FKSA 5IRCD 2F55A 2J87A 2CBZA 1XZPA 4WZBE 1EFHA 3CPJB 1MO6A 3WHLA 5LPNA 1XB2A 1WDTA 1Q57A 2FNAA 2X2EA 3JZMA 1TX4B 5FH9A 2RGBA 3U44B 2P6RA 4M53A 2PLFA 4TSFA 2ZUCA 3E70C 3V4RA 4HDQB 3U7GA 2WPDA 1T0JB 2J5XA 2ZROA 3CRQA 3FVQA 1ZNYA 1AKEA 3NBFA 4ON9A 4EPRA 3HPQA 1OH5A 5TB5A 1VDZA 1G5PA 2P0EA 1E79A 2C95A 5JHGB 2RMKA 3EIQA 4WA7A 2BBOA 4US1R 2I3BA 4HI0E 3R8FA 3AF3A 4CIDA 1U94A 1G19A 2FF7A 2QP4A 2DYKA 2VP9A 1C4OA 2WWFA 1H8HA 2C99A 5FBVB 1COWD 4G1UC 3KUCA 1JJ7A 3TAHA 5KDDA 1NY5A 2WJHA 3RS3A 3SBEA 1YRBA 3EZ9A 1HY3A 4A15A 1W0JA 4RVCA 1HQCA 1NMZA 3KKOA 4TYPA 4OQXA 2VBCA 1KO8A 3LQRA 1Q1QA 5G40A 4ZCIA 2ODNA 2X8AA 4FMDF 2QE7D 3I8SA 4DCTA 4XTCS 2R2AA 4DUGA 1QHHA 2QQEA 3B13B 1P3JA 2QP9X 2R62A 2WWXA 3DEFA 3NC1C 4RD0A 3GLIB 4PC6A 1CEEA 3EIHA 4KBGA 5C18A 5FUXA 1OHHA 2XOKD 1RPZA 2RGCA 1YQTA 4EKDA 2AFHE 1HEIA 1P2UA 4YXWD 5EP3A 4TL6A 4NYMR 2FN4A 1N6RA 1JEDA 3PUVA 4P4SA 2CJWB 1HURA 1A2KC 1Z6GA 2GJAA 2O8BB 5FR2A 3BH6A 1V43A 4PZYA 3N2EA 3OHMA 2V6IA 1E3MA 5C2JB 3U3KA 3AVVA 2AWOA 2PT5A 1KK0A 4O3MA 4D0GA 4B75A 1CIPA 5FL3A 2JEOA 3EZFA 3W9YA 2ZRPA 3TUZC 3QXSA 4QGGA 1XZQA 4XVQA 3CUEF 1VHLA 2JJ2A 4RD4A 1MO3A 3LXRA 3UMFA 1N25A 1IN8A 1W4AA 4MGYR 3SYLA 3FB4A 4JL6A 1W48A 2OCYC 2VHUA 2ZJ5A 2YYZA 5JCPA 4AKIA 3L43A 3QE0A 5IT5A 1QHGA 1JBKA 2GVZC 3KQUA 5AJVB 5J47A 3QENA 5DI3A 1DPFA 2XTMA 1B23P 1Z63A 1JXOA 2FOLA 4TL7A 4JZKA 5HE9A 1GITA 2UZIR 5A5GA 2QMUA 1GP2A 5JCZA 4EDHA 121PA 3MWLA 4HLUA 3QJYA 1IN4A 4LPSA 4B74A 1A5TA 2QG6A 3A1WA 5FPKA 2IEZA 3BBPA 1U98A 4GDFA 3CBQA 1E2HA 4MH0R 4KYIB 4Q4JA 3U7FB 3ZD7A 1YZLA 3O8DA 2ZSAA 1ZAKA 3W6NA 4PQRA 2QORA 3OESA 2BCJQ 1E2IA 4R2HA 3UIEA 3I5YA 4DBLC 2B8TA 2PMKA 4CGZA 1TUEA 1XXHE 4PHGA 1M2OB 2EFGA 4FINA 4JVMA 1OLOA 4PC7A 3Q3JB 1I2DA 4OK3A 1AJEA 3QXCA 2FGKA 3BORA 3B8HA 4DLSA 1NN0A 2JLQA 1FP6A 2H18A 1D2EA 3H4MA 3TMKA 3CH5A 3LXXA 4L8GA 3JVUA 5CLLA 1IONA 1DO0A 1ELOA 1KO4A 3I32A 4X8OA 3QNUA 3B1WA 5K8LA 3W90A 2IF2A 1LF5A 1CJTC 2ZRIA 3X1WA 2FJUA 1R6BX 1G41A 2F3TA 1W7AA 1IN5A 4PQFA 2WIBA 4B44A 1ZVQA 1FX0A 4A8JB 1TF2A 1HUQA 2JCSA 4PPFA 3DM9B 2W83A 4I4LA 1Z6YA 3EWAA 4JSTA 3O8RA 3C41J 2VH5R 3EC1A 3SE0A 4DWJA 5KU1A 5JJIA 4NDZA 3T61A 1IJEA 3GMTA 1CTQA 1WXQA 1XMVA 4X8HA 5G3ZA 5SZKB 3EPKA 1KI7A 4TSFD 2ZE8A 5G53C 2GF9A 2XB2A 2R6GA 4JMPA 5FR1A 2BEJA 2BKUA 6Q21A 1OT3A 4QBFA 1PUJA 1EFRA 3TE6A 3H0KA 4CW7A 5EXTA 2BIFA 3TVDA 1Z2CA 1DAHA 3K9NA 4JBYA 4UXHA 3GLHB 4DRZA 4IVRA 4PPQA 4XIGS 4KV9A 2GK6A 1G18A 4YMWA 3QSYA 3K9GA 4X8LA 3A36A 2W6JA 1QRAA 1QVRA 3SI7A 3B1XA 3WP1B 3K09C 4US2R 3HR7A 4IKEA 1KY3A 4XWOA 4II7A 1II8A 3CRRA 2XX3A 2ZRJA 4C30A 3E2IA 5TY0A 2J0SA 5KUTA 4IOLA 5JLJA 2FSHA 1OXXK 2BEKA 4CT4B 5DHAA 1SQ5A 4AWXA 1LW7A 1R2QA 1US8A 3QXJA 3U60B 4Z8XA 2VSFA 1AZSC 4R71A 4D4JA 3DOEA 5AJWA 1K8RA 1RRGA 3KJEA 3DMDA 1JR3D 3ICQB 3QF4B 1E2LA 2Q9CA 4UNSA 2IWHA 4PAOA 4A2QA 2IF0A 4B3DA 3ADDA 1X6VA 3L0PA 1SZPA 1X1RA 5CLQA 4GZLA 1VYTA 4F4JA 1E0AA 1E2EA 1ZBDA 3D6TB 2WSSD 4DLWA 2NO9A 1MABB 2YJTD 2HJGA 4KAXA 2WKPA 5D3QA 1NMXA 5FPHA 1GSIA 1UBGA 2BDTA 1UAAA 5UKDA 4Q4HA 2YHSA 1AZTA 4W5JA 3U61B 4E22A 5DNYB 1FL9A 1DBSA 1VG1A 1P9WA 3PVSA 1N3BA 4H1VA 1UF9A 2WOOA 3PUXA 3B60A 2SHKA 2OFOA 1KOFA 1KSHA 3I61A 1F2TB 4TQAA 2C04A 3PEYA 4ERNA 1N6LA 3CRW1 4I99A 1COWA 3A37A 4QJ4A 2WAXA 4RJLA 3DOFA 4PZZA 2NG1A 1GNRA 1E9FA 1OW3B 2HYDA 2AHOA 2PMDA 2REBA 1YZKA 3B6EA 1MO5A 2JATA 5GJWC 3MCAA 4P32A 4XWKA 1WCV1 4G5QA 1K5DA 1VCIA 4A0GA 2IXGA 1BYIA 1LFDB 3BGWA 3PUWA 4GOJA 2HT6A 2LWIA 1XJCA 2ZM5A 1C1YA 1VG9B 2O0JA 2VSOA 4L5BA 2W0MA 3ETLA 4BLOA 4AKEA 2Q6TA 2FFHA 2V6JA 1JNYA 2ECKA 4AY2A 1S96A 3ZJYA 1TNDA 3NEYA 4JKIA 4UNRA 3NEJA 4ASUA 2BMFA 3RS7A 4JS0A 4OJKA 2OEPA 2AD1A 5FOVA 3GJ3A 1ZD9A 2CNWD 421PA 4LZZA 3ICEA 1KTVA 1N5IA 2ZE7A 1E99A 2C77A 4LBVA 4R98A 5LDDC 2GJ9A 1S9DA 5EUQB 2ZJ8A 3QPUA 3K0AB 4LJAA 3SYNA 3D3QA 3TAUA 2ZAMA 3SJZA 1CR0A 2BBSA 4C0BA 1W44A 1U8YA 1PLJA 1YKSA 4R7ZA 1GL7A 3QXHA 1RE0A 3GQBA 2JIZA 3KJGA 1BOFA 2Q9BA 4YDSA 5F3WB 2PL3A 3QKSB 4G0NA 4CVNA 5H68A 2A5FA 5BWMA 2Z4SA 3AP1A 4A6PA 4Q7JB 3EASA 4BLTA 2H1LA 3LBIA 3W6PA 2ASEA 3BH7A 2H17A 4QXAA 3O8CA 2V54A 4HDOB 3LDAA 4BFXA 4ZDWA 4HAXA 1XJQA 4AURA 2OG2A 5JS8A 1KSFX 3L8YA 5FUYA 2V1XA 3LW8A 2WMOB 1SXJC 3DPUA 1Y3AA 2D74A 2IS6A 5DYIA 3F3YA 1TF7A 2WICA 3QEOA 1RFLA 1IXZA 1G16A 3GJ7A 3JZAA 4Q1DA 4Q4AA 3VKHA 1KKLA 4KXFB 4GP7A 3KFVA 3UK6A 1YU9A 3LVRE 5CYOA 4P3YA 5CK4A 4CEJB 5FPTA 3CZPA 2CLDX 1OFTA 3GPLA 3EA5A 4BRWA 2R6AA 3KDSE 5E7IA 4JLMA 3B85A 4PSAA 5LBIA 2ZJOA 2DWQA 4AG5A 4OHZA 4TZ6A 2GCOB 3GJ4A 2VHTA 2OUKA 1SXJE 3I92A 4EQ6A 5IF9A 3CF2A 4M8NE 2IC5A 3QY0A 4A82A 1Q20A 5GJVC 2QGNA 1Z29A 1ZU5A 4AYWA 4F4IA 1E1RA 1KNXA 5EJEA 1N6KA 2GDJA 5E95A 2FMXA 4I81A 5J40A 1CXZA 1T6NA 1DARA 521PA 2XGJA 4OQLA 2CK3D 5M04A 1XXHB 5CITA 2JJ1D 1YZGA 4PO1A 2JJ1A 5J4HA 1NKSA 3KB2A 2ZS9A 5FOXA 4Y0AA 1RC8A 1LV7A 4RD6A 4XVRA 3MGCA 2JDID 3UANA 3BS4A 2GAOA 4BLRA 3EIEA 4JLDA 4LJYA 1G20E 4FMBB 3I1FA 4FN5A 2V8OA 4B3XA 1NBME 2C98A 3GJ6A 3U5ZB 1E96A 1HYQA 4RKFA 2OBMA 2Q9AA 3CRMA 3SYKA 1U9IC 5HPYB 4PR0A 2X77A 5B57C 2MSCB 1OFIA 2YWFA 3QVVA 1Z28A 4D6PA 5A4JA 2IS2A 5D3MB 4IDQA 2ZRDA 5DLQC 5IDVA 4JJKA 3RRMA 4PO9A 4Q18A 4LY6A 2BV3A 2ZI6A 3EZ6A 4OYHA 4RFVA 5CDFE 2V7QD 1W49A 3AH8A 5JSZA 1RYHA 3RLFA 2JLZA 4G01B 5C4MA 1P75A 2FEOA 4BPBA 2YWHA 4HLDA 1EX6A 2AD5A 3V9PA 5JS7A 2B7BA 1ZW6A 2G3YA 3QQ5A 4FXPA 4GFDA 3BD9A 5CIQA 4EJSA 2O8EB 5C46F 4ARZA 3PXGA 1N5KA 1D2MA 2FSGA 3AQ4A 3GD7A 3O8BA 1I4TD 4HAWA 1OFUX 2OCPA 4L4UA 2D2FA 1GFIA 3CM0A 1RRCA 4KVAA 1CJMA 2N1BA 2YNMA 3CO5A 3R9WA 1DG3A 3RABA 1S3GA 4HUQA 2RGEA 3MMPA 2RAPA 4PZLA 2QGZA 1WBDA 3MAAC 5DN6A 4NMMA 3EG5A 1W47A 2GETA 1TEVA 3PEWA 2HEIA 3VMFA 4RFSA 3I72A 2PH1A 2XEXA 1E0SA 2OBNA 4MYTA 3RANA 1U90A 4EPWA 1M6NA 1BO6A 2LKCA 1JQJC 4H1UA 1ESMA 4E03A 2Z0MA 2VF7A 5BW8A 3EZ2A 1E32A 4B73A 2VHQA 4RD3A 1P9NA 2E87A 2NZ8A 3HWSA 3U4QB 4TZ0A 1Q3HA 5AUQA 3PV0A 5KPJA 1G5RA 2ZSFA 2QRZA 5FPSA 3THOA 4M1YA 2IYXA 3CNLA 5JSZB 5EP4A 2OCAA 5E7MA 1FMJA 5AUOB 3FE2A 4AK9A 3T5DA 3C5HA 3QUSA 2J0QA 4NCHA 4M9SA 4FWIB 3T1TA 1U99A 3B82A 2GZDA 4HAZA 3QI2A 1WRBA 1FQKA 2IYYA 4GPTA 3RRNA 1XEFA 3T15A 3CNNA 3J81k 3NG1A 1OB2A 4YMSA 4D4MA 2FA9A 4W5WA 3THWA 1JECA 3OAAA 4MUBA 3CNOA 3X1ZA 2AK3A 2CEAA 4Q9KA 1GOTA 3A58B 4TMZA 4AKGA 3QXXA 1XWIA 2WJIA 3EXAA 1S9HA 3BXZA 3M1IA 4LV8B 4HDCA 1US8B 3FFBA 5JRJA 2J0UA 4NYIQ 1L4YA 4CEIA 3C16C 1YZQA 3EZ7A 1NL3A 4YLGA 1OIWA 1QVAA 2ANBA 5FUVA 1UADA 3NHAA 2F43A 2YKGA 1KO7A 4C0JA 2GJSA 4FMDB 4DSOA 3RRZA 2DY1A 3R20A 2O8DB 3REFA 3BB4A 2PJZA 1CJUC 1ONBA 1Z6AA 1QHHB 3HDTA 4Z8YA 2BMDA 3A4LA 2QT0A 5EUMA 2YWEA 4C2TA 2FPMA 2R65A 4KO8A 2XOKA 4G5RA 4A4DA 4WAUA 3TR5A 1X86B 3PIRA 2GA8A 1N6NA 4Q4HB 1U2RA 1P6XA 1SKYB 1YZUA 4OK6A 5J4YA 4BE7B 4TLDA 3LO5A 2IX3A 4DLXA 4C0LA 3FHCB 1VYVA 2QAGA 1EFCA 2EFDB 1AQYA 1U0HC 1IXRC 2BJVA 3K0CC 1OKKD 3T34A 4DCSA 4TMVA 2H57A 5H1YA 1KJWA 4ZI3A 4WOPA 1GILA 2WIAA 3C15C 2AX4A 4Q9JA 4DT1A 2WHXA 1ZC3A 3IBYA 2ZRKA 2NMVA 4L9WA 5FI0B 2OAQ1 1LY1A 2H5EA 1KKMA 1W46A 4YXWA 1Q12A 2C78A 2F1IA 5SZIA 2ZETA 1E2NA 3K70C 1KHTA 5FTKA 3P20A 3WNCA 2Z4RA 3KZ1E 3ZH9B 1T91A 3V00A 4NL4H 2KJQA 5EE1A 4XVUA 3IHLA 1VCNA 1XMSA 1GKIA 3W34A 1OV4A 4QHSA 3IEUA 4B2IA 2QI9C 1VTKA 1X1SA 3QIAA 4ACAA 4HB0A 4EPVA 5FFMA 3SHWA 1KMHB 2DWOA 1YHNA 4Q66C 4BFTA 4BZQA 2A5JA 5FUWA 4CRWB 4Q7LA 2JLWA 4JT2A 5F9FA 2AR7A 4LHVA 1H8HD 2RKOA 1UDWA 3RS4A 2OESA 2F7SA 3X2SA 2ZRNA 1F6BA 1MKYA 1G3IA 1H8EA 1SVSA 3K0AA 2IXEA 4LJ4A 5FOSA 2V9PA 3S1AB 3TNFA 1W5TA 3RC3A 4B34A 8OHMA 1NKTA 4LBWA 1F2UA 1ZC4A 3IQXA 2J59A 1KI4A 4Q00A 2GNOA 5FL7A 4NE2A 1X8JA 4CZ2A 1HA3A 5L8VA 4UXIA 2OILA 1R0YA 2BBWA 2IYZA 5KNDA 2OLKA 2YWGA 2WKQA 2CL6X 3FHOA 5AJZA 1R0XA 1L2TA 1HV8A 1UKZA 4FW9A 2IHYA 3P27A 1QG4A 4DIDA 3IILA 1VMAA 3DMNA 1KDPA 1CLUA 3K9LA 4X8MA 1XU4A 3IDQA 5FTLA 2A9KA 2JDIA 4RCYA 1Z22A 2ZVQX 4PAQA 4D0LB 4WXPA 3T5GA 1NI3A 3WNBA 2R44A 4URXR 3OE7D 4K46A 3G5UA 1R8SA 5DE3A 2R6CA 1CR4A 1XEXB 1G6HA 2EYUA 2ZEJA 4GBMA 4M9ZA 4XJXA 2HT1A 2BHRA 3OIWA 5J4VA 1W4RA 1OYYA 1GUAA 2QAGB 3LD9A 4NU0A 5EXXA 5JWOA 1ZUNB 4EQ6B 2JJ8A 3KKQA 3ZLJA 5FTJA 1A7JA 2C9OA 2NPIA 4A0HA 1OSNA 2FZ4A 1NVXQ 1I2MA 5BN3A 3DL0A 1RJ9A 3IKJA 1F5NA 3X1DA 4M9QA 4MYHA 2Q3FA 1E0JA 4ZPXA 4N0DA 3TGPA 2D7DA 3CPHA 4BFSA 1KZ7B 1XMJA 2ZYWX 2GF0A 1G7RA 1J70A 1CRQA 2CCGA 5E4FA 1DTSA 1IOZA 1KI1A 3K0FB 4JBWA 3NBXX 3Q85A 5AWFC 2WSSA 4IDPA 2OV2A 3LA6A 3QPWA 4DDTA 4WXRA 5L3SA 2G88A 4TYYA 1X3SA 2FFAA 4DSTA 1NN5A 2J3EA 4P33A 1XPUA 4B3BA 5JEEA 4TTQA 2B8WA 4QL3A 3MFYA 3HYTA 4Q1EA 3TR0A 2ZI4A 2F9LA 5EZ5A 3NC0C 3LFUA 4YQFA 5CM8B 2P6NA 2F1JA 2JIZD 4JL5A 1NF3A 4LV6A 1P2SA 1ZD8A 4O2RA 4BFZA 1I4DD 2XSZA 3W3AA 4G5OA 3SDZA 3IBGA 2QEQA 1E1QA 4HAVA 4M1TA 2VLIA 1KZGB 3H1TA 1O3YA 2GCOA 4OHVA 2CCKA 2EYQA 4Z54A 5KO2A 5FTNA 2ONJA 1EWQA 3WYGA 4POAA 4ZIRA 4B33A 2O8BA 2OT3B 1BKDR 4RD2A 4Q7MB 1IBRA 3WP0A 2DWPA 1VPLA 2ERYA 4GRAA 2A3RA 1P62B 2CL0X 5SZHB 1ZM4A 3GEIA 2I4IA 4ZKDA 1S2MA 1IY0A 3AKYA 1E9DA 1GRNA 2B6HA 2O5VA 1S3SA 2WTUA 4KJZA 1UKEA 1M7BA 3NH6A 4B76A 2JAQA 1ANKA 1OIXA 1U8ZA 4PQYA 5EP1A 1XTSA 4WZ6A 4OI2A 3W5IA 3GLGB 5F9HA 2GHIA 1RZ3A 1NLYA 4U7DA 1P5ZB 3NXSA 3CR7A 4MKGA 5DISB 1NMYA 2HXYA 2KBFA 2WSMA 5F98A 2ZJAA 4M4SA 3WBKA 1KI9A 2BMEA 2DCUA 3UG6A 2YV5A 2PLRA 1E94E 3LQQA 4V0MA 4AG6A 5HKKA 4ASUD 4KSCA 4TLEA 4TMTA 5EE3A 1YR8A 5EE9A 2I1QA 1LF0A 2VHJA 4OKSA 2V7QA 2VTKA 4GMDA 2RB4A 4O25A 3LNCA 1FMLA 2QTFA 1JXMA 4QC2A 3GCGA 4EPXA 4OJQA 5GVRA 4IRUB 4B35A 1KJYA 1KAGA 2O8CA 2VIIA 3I73A 1G3UA 1TQ6A 1TU3A 4GSYA 1PVOA 1AM4D 3K70D 1E2KA 3L0SA 3MUFA 1FX0B 4JVNA 4A8JA 3KFXA 4YMUA 1CKEA 1XDBA 1ZU4A 2NO1A 1T4GA 2I1VB 4A2PA 1G9XA 1J8YF 1QHYA 2CLCX 3U3MA 4JLOA 4TLCA 1ESNA 1F60A 3EAQA 4MUAA 1DAEA 3A1SA 1DVRA 4GNKA 3PG5A 4KVGA 1XEWY 4OBEA 1OB5A 5FOUA 3KTAB 3KXIA 4YDHB 1S0UA 1G5TA 3AB3A 2CLSA 1SVWA 4NCJA 3VU9A 4BLSA 1XX6A 1JALA 2ZJBA 4MKIA 4O2LA 4Q7KA 3IHWA 2JLSA 3TJZA 4DC9A 3NDPA 1XCMA 2ZI3A 5HCNA 4DLUA 1ZMXA 3QKTA 4E5UA 1JPJA 2FG5A 4UJ3A 2FSIA 4LOAA 2BM1A 1OXUA 2GVDC 2W0SA 1RYFA 4LYHA 5DSZA 4LC1A 3QVUA 1T3LA 2D4HA 3RS2A 4W9MC 1G7TA 2QN6A 4IEIA 4KODA 1NVUQ 1UEIA 3AKCA 4NHOA 4LJ7A 2EVWX 1VCMA 1JPNA 1UKVY 3X1XA 3A1TA 1Z3IX 4BFUA 2O0KA 4KITB 3VNUA 1AA9A 4LCBA 2GBLA 1MO4A 4F7WA 5F2EA 3AVUA 2H8KA 2VP5A 3Q9LA 1KJZA 3Q8XB 2QAGC 2R9VA 4Q19A 3I5XA 3VR6A 2CL7X 2QM8A 4MKFA 4QNRA 2ZTSA 1T5IA 4F38A 1DOAA 4XTRA 1IM2A 2R6DA 3QF4A 3KQLA 3KB1A 1E2GA 3ZVNA 3LAWA 3TLXA 3RNLA 3SBDA 4B6FA 2AN9A 5DN6D 2DFNA 1JQLB 1SXJA 1TQDA 2QE7A 5DI9A 1U9IA 2XNDD 1ZNXA 1SVIA 1AN0A 4LDJA 3THXB 5C1BA 3QPVA 3VKGA 1M7HA 2ZU6A 1EG7A 2QTHA 2GAAA 4DCUA 2HF9A 4JYBA 4PC3A 2GXSA 1U0JA 1XNJA 1G17A 1GL6A 2C8VA 1PZNA 3OZXA 1P60A 4XD7A 5J5CA 3GLFA 4L9SA 3WBJA 3H86A 1UM8A 1Q3TA 1J7KA 3IIJA 3W8RA 1ZNWA 1AS3A 2NQ2C 4ZI2A 3N70A 1G4UR 4B3GA 3U2QA 2O52A 1DAGA 4D26A 4XOIA 3IPXA 2FPLA 4WVFA 4KI0A 1MABA 2KB0A 4HSEA 4Z1MD 2GXUA 3LV8A 1E2DA 4BZXA 2PEZA 1EXMA 4YMTA 2XZLA 2H16A 1PUIA 3IIKA 3K9HA 3QBTA 5TDHA 1B0UA 1F3OA 3FFAA 4C0HA 4C7OA 2J7PA 1N0UA 2G6BA 3BIFA 3SOPA 4TTPA 4IVPA 1A4RA 4CF7A 3GLIA 2OSBA 1R5OA 2Q3MA 1W36D 4JLAA 4QGHA 3NKVA 2C2HA 1KSJA 5L3SB 2YOGA 1XFAA 4LYAA 1SXJD 1ZCAA 5JI3E 3EWSA 3ZZ0A 1P4SA 1OJLA 2FV8A 2PZEA 3PQCA 5CYPA 4BEBA 4US0R 5KDLA 4PFSA 3FDIA 3RWMB 3V4FA 1YRAA 4PHHA 4ZKEA 3H2YA 1MOZA 2NPFA 3SFZA 4RY2A 5FTMA 2P6UA 3OFNA 3GFOA 2G77B 3CWZA 3UG7A 2GKSA 3A4NA 3LX8A 2AKAB 1II0A 1FNMA 3M0EA 4JVLA 4LBYA 4BASA 4Q4AB 3AKEA 3A1VA 3AUYA 1SXJB 3HR8A 3O47A 3TBKA 1FOEB 1IQPA 4K81B 4NCKA 1M7GA 2W2VA 3AUXA 2O8FA 1U0LA 3UATA 2IS1A 1FTNA 1W36B 1IHUA 1XD2A 3CWQA 3CKLA 1OKKA 1U81A 2HUPA 1Z0KA 1PLLA 4QFMA 1VIYA 2YOHA 3FHTA 1UBCA 3SZRA 4TN1A 2FWRA 2IYVA 3AP2A 4TTRA 1M74A 2RCNA 4MRRA 2WOJA 2AL7A 1AKYA 3IPYA 5LB2A 2GRJA 3SC3A 5GJBA 3RRYA 2GEDA 2IYRA 1SVLA 1KGDA 2ZI9A 2J1LA 1OFHA 2X2FA 1UJ2A 1OYWA 4TYWA 2XJ9A 3ONWA 4EFNA 3K53A 4C0AC 4D4KA 1W1WA 1E98A 1ZM7A 2ATVA 3BAFA 4EIWA 1NVVR 4DDVA 3BK7A 3WYAA 1KAOA 4YC7A 3NBYC 3SHFA 3CZQA 3FKQA 1G3MA 1E0KA 2BVNA 2Z6VA 3KQHA 3IQWA 1SKYE 2K5UA 2OLJA 3U3RA 2GXAA 1CRPA 1SVMA 4KHZA 2IT1A 4HLCA 1QDEA 2IUUA 5KSOA 3R9XA 2ZJYA 4Q1AA 3WMGA 1EFUA 2CCJA 4MDEA 4LK2A 4C2UA 5HZKA 1RKBA 4IW3B 2GILA 3P32A 5JFGA 3EPJA 1KI6A 3HP1A 1ZUIA 2QNRA 3FPAA 1E2MA 3OIUA 2YOFA 2VEDA 1L8QA 4B32A 2ZSDA 1DS6A 3UPUA 1WBBA 4RZUA 2IWRA 1H8ED 4TQUS 1JEEA 2WWGA 1W2HA 4W5HA 1N6PA 4AYTA 3P1JA 3RC8A 3T06B 2NO6A 1E9BA 3LVQE 1X8KA 4KFUA 2IW3A 3RDPA 1WP9A 2FZLA 3SJCA 1T5LA 4QKQA 3PENA 2CVFA 2NO0A 5IK2D 4HAYA 3DVLA 2XSZD 3GLGA 2GCNA 3GFTA 4LC0A 4IXMA 1P61B 3BH0A 1G8YA 2ZXUA 3TRFA 3LW7A 3PCRB 2JLYA 1Q1ZA 1TL7C 2QP3A 1E9SA 3KJIA 2VPPA 4B47A 4LHWA 4D81A 2HCJB 1BIFA 1Q1BA 2XNSA 2ZYVX 4Q01A 3W8NA 3U3OA 2QROA 3SJBA 4BFVA 4IFEA 3M4YA 5FOTA
chains in the Genus database with same CATH superfamily
5HMLA 1I6KA 4YO7A 3ROZA 4URVR 2JKYA 2XTJA 2YC4C 3RARA 2JHPA 1P9RA 1B2RA 3NTLA 1TVCA 3CHYA 4TXHA 3TQFA 4CKXA 3EAGA 1K4YA 2AOUB 3HDGA 3E3MA 4P82A 2WJJA 3FDFA 3R7DA 2I54A 3F6PA 4H2DA 3WLOA 3PXXA 2ERCA 4AICA 3OM8A 1L5HB 4ARZB 1HETA 1ECGA 2OV1A 5DEIA 2JW5A 3DT9A 1NFRA 3JQDA 1X77A 5HCIA 3U09A 4XQ9A 2ZSIA 2WHYA 4K3VA 3S2IA 5HS6A 4RY0A 1XD2B 1ZHFA 1WU8A 1ZEMA 4DCCA 1ECCA 1JMYA 2R4QA 5FTWA 3ERCA 3P9NA 2XA9A 2G67A 4IM7A 1QO0D 1QOPB 2QD1A 1RWWA 1FQJA 4TMKA 2RHRA 2WU8A 4Q9LA 3G1WA 3SS8A 3BJMA 4PQGA 3WO1A 4CTKA 2VH1A 1V5FA 1YS4A 4EVSA 4P4TA 5DTMA 4JR2A 5BNIA 3HR4A 1ADJA 3RRBA 4DUZB 1HRKA 5L6MB 2XY4A 3DKRA 5A5DA 1PR0A 2ZIEA 4ZYXA 2PZGA 5CLGA 4Y2TA 2GCPA 1TMYA 5KTSA 3LP8A 1GTJ1 4JLWA 3PD1A 5D7NA 4MB0A 1TKAA 1G8PA 2BHTA 4LG1A 4NTZA 2IOQA 1TPZA 3WTBA 3I9FA 2DSNA 2WFLB 1XQYA 3Q2OA 5BR4A 3R3VA 3AJEA 721PA 3IP9A 3S27A 1JH9A 2WNSA 2J6HA 1CUJA 4I1RA 2PXCA 3LRTA 1VBMA 3IQGX 4ITVA 2HZ7A 4PSUA 1RR6A 1SA0B 4BRSA 5MF6A 3IEVA 3ZGXA 5IFKA 2BRUA 5IDYA 2G0NA 1RKUA 1T2UA 1IHOA 1K7FB 4JNKA 4Q47A 4GLFA 4Q9DA 3B1FA 1A76A 3PFGA 1QE0A 2J3IA 1M1NB 4GPEA 4WY8A 4IYJA 3W6OA 4NCAA 3CE6A 5IXJA 1BEZA 4WOCA 2AXQA 3M5PA 4JODA 2VDNB 4W6ZA 5AKLA 1C4WA 3M6AA 4UXJA 3GFPA 5BN5B 3B36A 4PZPA 1KL7A 2AXPA 2ETXA 1YZTA 3A04A 2VZLA 2ABWA 4MVJE 5DYYA 7GPBA 4LUCA 2GM5A 1KQNA 5KHOC 4MV3A 3RADC 2QQ0A 4ZTBA 1QBKC 3R7WB 3E5RA 3VNSA 3UEOA 5KNCA 1SGWA 3R7SA 1QZXA 2GLUA 2BOVA 3INYA 4NBUA 3S8YA 2ZTHA 4JQZA 3P19A 1FDTA 1GA1A 1H2AS 2HUNA 4MJXA 2IE8A 2WG1A 4FC7A 2C2OA 1O97C 4N5IX 3EPHA 4ESHA 3DO8A 3I61A 3L8ZA 3BWXA 3HYLA 3Q7TA 3P2MA 1GGNA 4RZXA 3GGDA 4X41A 5LD2C 3L7BA 2B82A 4PC2A 3F8TA 3AFMA 2DHQA 4X45A 3U7EB 3GYGA 5B1HA 1DIHA 2BZ0A 3PD0A 4FYJA 2B9VA 2EZ9A 3U4IA 4J75A 1EDOA 3C7TA 3A9TA 3AVPA 3DNMA 3H4TA 2GK4A 1XDZA 3ND8A 3QFCA 4EX6A 3H1FA 1E1CB 1OVGA 2ANCA 2EJBA 3EX7C 3K1JA 4NDAA 2Q3HA 3FMGA 4YGYA 1V9LA 2ZXEA 1TD1A 3IMGA 4TROA 2H4WA 5BW6B 3RSQA 3W6UA 1GKLA 4A6DA 1NXTA 2GT1A 1OXVA 1PL7A 4LY0A 4OU5A 1JQ5A 3RFUA 4F2GA 1EUDA 1QCCA 4TWAA 2Y1WA 2W6CX 1WKBA 3PT5A 4I36A 3DT6A 3VYUB 2V97A 1SXGA 3DE6X 3L93A 2HEGA 4RGYA 1N2EA 4U1RA 4MA4A 4ZAXA 4G1BA 3EGOA 4MW1A 4D92A 1JG3A 4OXIA 2W58A 3ZLBA 2OSVA 2PBRA 5A4AA 4B45A 2PA0A 1W35A 1YOBA 5ALJA 1KJ8A 3OZDA 1DRWA 3E9CA 5ITSA 4X71A 3PC2A 2GFQA 3LK7A 2NU7B 4RFLA 1QIFA 2GCEA 4MLDA 4XX0A 1XCGB 4R7TA 2VQ3A 4LZPA 5JWHA 3O1IC 2OCXA 5TEWA 4D9JA 1WDKA 2WHRA 2O5RA 2X58A 4Q3DA 2LV8A 3MQ2A 2A30A 4JLSA 2WF6A 3WADA 1EB9A 1S1MA 5IYZF 3D4NA 4BGDA 1QGZA 1ZMTA 2BMWA 1HLPA 1H42A 1W5SA 4QJ5A 1T36B 4ZI5A 5BXQC 2W6ID 4EBFA 2R8PA 4MYRA 3G59A 4A8HA 2ZP1A 4QDKA 1Q84A 5JCXA 1JFTA 4ARCA 3DKVA 4FLFA 3QHAA 5GGYA 4GL2A 4OPMA 3O93A 3SYRA 1Z16A 2WMNB 1NASA 5CIWA 1TYEB 1OI7A 2MSEB 2Q5JA 2ZUWA 3X0DA 4TV9A 4K0KB 3HN2A 3WJAA 2BE9A 1TADA 3CB4A 4P2GA 4PSKA 4ALMA 3ZHRA 3UHFA 4IOKA 1LD3A 2D3WA 4NZNA 1IZ7A 3EZGA 1ZG3A 4RZQA 5A3VA 5K3AA 5AQEA 1DQPA 1H2ZA 3B1VA 3N1UA 4ZJZA 1ZVKA 3IKLA 3HQ4O 4AZ0B 4LYEA 1JDBB 3DMFA 2RGYA 3IPRA 4GXTA 1KE1A 2R6R1 4JQSA 2DH6A 1AN9A 2HWWA 3O0TA 5INTA 4CEHB 3I04A 3QPBA 3FTQA 2RHMA 4DR2B 4D4HA 3L4BA 1K5HA 1Q7EA 1U8AA 4P9NA 1ZI8A 2C0CA 5A4MS 5K2MA 5KKCA 3A6KA 4W7SA 2VR1A 2WDZA 5DWDA 2PZFA 4Z51A 5EWJB 4LF8B 1T1GA 2HFJA 3G68A 3A4YA 1JKJB 4EFLA 1ZVJA 1SUSA 4C7OB 3ZE1B 3IJEB 3KUXA 2PFGA 1SC4A 1M6YA 4KN8A 3SZGA 4C7KA 4KQFA 5FX2A 2EP8A 3GBPA 3CZMA 1XTTA 5B3JA 1H2RS 1JEYB 5J59A 3RJ5A 1SCNE 1E4EB 1ZGGA 2REXB 3FJYA 2UUOA 3ZU5A 4EI9A 4Q6BA 2C8JA 4W5QA 4JI2B 1Z0JA 1FDSA 1SVUA 3DDSA 1KIMA 1A9TA 3GJ0A 3IE1A 1HQYE 2P6OA 1EP1B 3N6XA 2XGOA 2WD9A 2X9LA 4CKEB 4WBSA 4C4RA 1GT91 2JLBA 1QHSA 5J2UF 5LD2B 1OQAA 3DG9A 2PMFA 5GV7A 2WHPB 1RQGA 3DQPA 3MPOA 5EIOA 4BFXA 1MORA 1CS4C 3SC6A 4JP2A 4C3ZA 2RGNC 5EFZA 3WXMA 1IXYA 4IXTA 2Z6AA 1M2NA 4MRMB 5LBTA 5FL7D 5JNVA 1TTHA 3CLHA 1GWNA 3R77A 1AMOA 1C9JA 1MENA 3OZWA 5ELLA 2DPMA 4LRYA 2ZB2A 2PGJA 1TTTA 3GBSA 5ENVA 3KT3A 4ABYA 5CM9C 3KQWA 2ZVJA 1B6TA 4IIFA 1V26A 4NFSA 1VRVA 5LDHA 3CKYA 3RR2A 3COZA 3GJRA 3JXEA 3KUDA 4ZOAA 3UWOA 5LNK6 4HS9A 3TI9A 3UK1A 4BX0A 1U1CA 3G17A 3NHWA 3N8NA 5IXYA 5ILQA 5HZHA 1Z4IA 3EVAA 3K0EA 1WSBA 4CIYA 2MSDB 3BCHA 1FVOA 3AR7A 1OLUA 1XBTA 2W70A 1YQQA 3M83A 4RVUA 2DFPA 2QVXX 2X9QA 2AMJA 2REQB 3D1JA 3NV9A 2X42A 4HNTA 3UJ8A 1OH8A 4EG1A 1T0BA 1FFCA 1IN6A 1EZ1A 1F48A 3TK1A 2HL6A 4Z0NA 3CWCA 3LKVA 1YJQA 3RU2A 1NVEA 1C1DA 1EHCA 1TJ4A 5H70A 2QJRA 2UYYA 1Q0UA 3NOQA 3JASA 1LBQA 2B94A 1K5GA 4RADA 1YUMA 1CJKC 3DFZA 3HU2A 4HFMA 4KK3A 1FEZA 1KXZA 1U7UA 5D00A 5D6NA 5DBHX 2VA8A 5J5AA 9GPBA 1XEWX 1NMEA 2ODBA 1A4XA 4PWYA 3QYJA 5T64A 2V45A 1J5PA 4HDSA 4HZIA 2NU9B 2QL5A 1IY2A 2QAIA 2JFBA 3FJOA 4HWOA 1K2VN 2W4QA 1XA3A 3CF6R 4NE9A 2F4VB 3EVDA 4LJ6A 3L92A 1CRWG 1P2TA 4YDQA 2I7XA 1E3DA 4HD8A 3I52A 4HDNB 5I9BA 5KOJA 1OWPA 2BGWA 1XQVA 2QBYA 3R7NA 2RGWA 4D56A 4EO9A 4NZPA 4ZK6A 3FH0A 3OQNA 5JBIA 3JQAB 5MGBA 4CEJA 3LBYA 3LQYA 1UPBA 2GZMA 3MMNA 3EPRA 1DAFA 2E37A 2VCHA 4Z9BA 3TM5A 4BBPA 3KQOA 4EFDA 2VQSA 1DHTA 2DM6A 1KIFA 3KV3O 4MLZA 4ND6A 2AKYA 3NWJA 4YRDA 1EVJA 3OQIB 1W5BA 2I9KA 2ORIA 1KEZA 3PDUA 4GOMD 4P80A 4X3CA 5EIAA 3RVDA 5THKA 4B6QA 2KLHA 5CUQA 1JTFA 5HOQA 4IIYA 2Y0PA 1GLNA 3L1VA 5KQSA 1XLUA 2PD3A 4QUGA 1R50A 4YASA 3T35A 3LC7O 2C9YA 4MW0A 4EUNA 4LJSA 2SCUB 3ZE0B 3PJDA 2GYYA 3TLGB 5I8WA 4E0BA 1QGED 1HYEA 1UK9A 1F4VA 2CE7A 2AJ8A 3KEMA 3F9CA 4HGNA 4R9RA 1E1RD 1JV2B 4O2BF 5IP5A 2XMZA 5DK4A 1G0NA 2AJCA 4NE7A 3VJKA 4CMGA 4KR3A 2XIQA 2Z8ZA 1NOIA 4CDGA 2WTMA 1V95A 3MERA 1MT3A 5EE0A 1JKXA 1Z2PX 4YAWA 5E3HA 5E0KB 5ULLA 1IEXA 1X7WA 4XSHA 2QWXA 3NEPX 4BDSA 4V2IA 1L4BA 3BMCA 3OX1A 4MQUA 4X1KA 2PXAA 2AJLI 2BP7A 4HH4A 3NHSA 4KXWA 1G55A 1UBFA 2FJPA 3SEFA 5LP6A 2HQSA 4JR0A 1FJXA 4HR7A 1Z4LA 4NOKA 1TK2A 3AEZA 4OGKA 4TMWA 5HP4A 4IYRA 4N5HX 1MT0A 2D0IA 4PYMA 2AOUA 2JFGA 2OGSA 4QWWA 4CODB 3B3QA 1UDXA 5I51A 3FYSA 4NBWA 1FSPA 3IAAA 2HMUA 2NV0A 4ZOLB 5JXHA 3F9RA 1NRXA 4HSGA 3SLKA 1E8NA 5KTMA 1C2TA 2WE8A 4B6EA 4ZO4A 5IUJC 3N76A 5K0TA 2Z98A 1QS0A 4K6HA 1J21A 2AA3A 3KSBC 2QF7A 1OA1A 4QYMA 4BZZA 2QA5A 3NV7A 3DMTC 1J0XO 4PAMA 2DY0A 4Y6OA 5EUCA 5IHPA 3LBHA 1G38A 2C0PA 2G9VA 2PN1A 1I36A 2O7VA 2QRQA 3OA0A 1NJFA 1P7PA 3QEJA 1GFZA 2FGJA 4RL6A 1BCSB 3F96A 4Z3OA 1WL8A 4HQRA 5AK3A 2WYWA 1YBFA 4MGHA 1DOZA 5JJLA 2JD2A 5E4TA 2Q5QA 2FQYA 2Z4TA 1EE1A 3LDUA 4LMRA 2NO7A 3TTUA 2QG9A 4UQLA 4BMDA 4PEVA 3FUWA 1DE0A 1JIQA 1Z08A 3DO6A 2WWYA 5SZJA 3D5EA 2VN8A 3BTOA 2O8CB 4WERA 4RANA 1CNMA 3WIEA 5CA0B 5CG1A 2GRUA 2X9GA 3IELA 4FBMA 4W6QA 3W7VA 2MJLA 4URHA 5BQ5A 3UT0A 4BNXA 4DNOA 1J2TA 5JS1A 1SKQA 4JEMA 3ZY4A 4ZCMA 1TA9A 3ELBA 1H1LB 2JGDA 1FVHA 1U28A 2IITA 2XB6A 1YL6A 1VKJA 3TECE 2BI8A 2FXIA 4RNDB 3EVFA 2WWHA 3PJRA 1CJVC 1AQUA 4OI0A 1RQPA 2C61A 1WDWB 2OL4A 3VO8A 4DDUA 2F59A 3QBVA 4X7MA 4ZT5A 1EJBA 2GEVA 3NRBA 1KK2A 3HNPA 1NFFA 4W99A 1P0CA 1FYFA 4WW0A 4I19A 2QZSA 4BJ1A 2B4YA 5KWVA 5AHWA 1V7ZA 1GLVA 2B2CA 4URFA 2P11A 3PUJA 2WFAA 3W3AD 2VT6A 4B83A 1U2PA 5IK2A 1U7WA 4YH1A 3EUWA 4MICA 5G3YA 1ND6A 1BA2A 1BW9B 1NVAA 4BUJA 1DPGA 4MIYA 3DGEC 3AETA 3FMPB 3LNTA 5EZSA 3S44A 2PK3A 1BDBA 2E0IA 3DNPA 5K4AA 1WW3A 1NNI1 3UWKA 4AN1A 2IYSA 2V3VA 4ILEA 1T3SA 3PITA 4ZTZB 4FC6A 2P2CA 2FQWA 1IG0A 1N2CB 1XYYA 4BX9A 4UFPA 4YYZA 1NA5A 1SUFA 2JLXA 1KYXA 3BRWA 4L2IA 2PKQP 2XMBA 1HZJA 3D5QA 3K2QA 1KY2A 1Q1EA 3OT4A 5ALMA 1V7CA 1JG7A 2F1RA 3BB3A 4J03A 5AIAA 4M1KA 5TARA 4I3HA 1CP3A 3PC7A 1L5QA 3QKSA 4GI3A 4JKYA 1YB5A 5I5EA 5IKEA 3GA0A 5EIBD 1CQJA 1D5WA 1MH1A 3KYDA 3UCFA 4BLPA 1DJLA 2WMYA 5DIFA 4XD2A 2WU1A 5FBZA 3EEOA 1ZGJA 1NUSA 2X4GA 1IWPB 4WEOA 4QHTA 4JGBA 5LA6A 1XROA 3FBWA 2V5UA 4GRIA 3NOOA 4B3FX 1C1XB 2RHDA 3KPUA 3O1LA 2ZIXA 3WK9A 5K8VA 1B3RA 5FO0A 2DBYA 2C2YA 2QLBA 3C7KA 3GUZA 5F2OA 3WJ7A 2Z5GA 5LOVF 3AR2A 2QUBA 3A4MA 3Q5GA 2JGEA 1IHYA 2P68A 4WKNA 5K0FA 1UXHA 2AFRA 3UMSA 1X9IA 2GNAA 2HHLA 2QRHA 2HGZA 4HWRA 3RJMA 2P2GA 2ZAOA 5KSYA 1SKBA 3U4QA 3UK7A 4WK0B 4C20A 1PFWA 1JR3A 3ZKWA 3C45A 2JC3A 4IXNA 3EUAA 2R8ZA 1HE2A 2W98A 2J3DA 3TSOA 1JQ3A 2JLAA 4N9QA 2EG5A 4HRXA 5HGJA 1LBTA 2FUG1 4IDEA 4KVFA 2CVOA 4K28A 4X1OA 3VPFA 3WGHA 1NVWQ 3T3NA 1FRFS 1YZYA 3DR5A 2OENG 2G40A 4BN5A 4DC0A 5KX5F 2QYTA 2QUKA 3F8SA 3GB9A 1LVGA 4MMYB 2Z1DA 4XX0B 4F2PA 1Y9DA 1FYWA 3I6BA 3THYB 3IQHX 2VDVE 2J6IA 2JI9A 3H3FA 1XE3A 3ND6A 4JT8A 4NCBA 3GQVA 3RT9A 4V03A 1QO0A 1T15A 3KS9A 2D13A 2BKXA 2DBVO 2VKTA 3KQVA 4EUKA 2PE5A 2VPXA 1ISFA 1WPGA 3Q8KA 2V1UA 3M4XA 1KEEB 5ITVA 4K9SA 4MUJA 1ZI6A 1WZIA 2QE6A 1Y1QA 2AK2A 3LQKA 3BC1A 3TXYA 4J0JA 3R0VA 4PSVA 4XYEA 9MHTA 2ZTMA 4RVOA 2NXCA 3KLNA 4QELA 4DM7A 1FZQA 4WZAE 1J22A 4KSBA 2CXXA 1XZBA 5ARCA 1MB0A 4F21A 4MEBA 2ASVA 3DUFA 4MARA 4W63A 2Z95A 1ORVA 2GN4A 1ONPA 2DP4E 2PUVA 1A7AA 1EP9A 5BP7A 3ZWKA 1SZDA 2HRRA 3NBZC 4XPIB 1WUIS 5G4KB 4EARA 3DBHA 1K66A 2G04A 4P6VF 5J3JA 4L9RA 1U7XA 4G9BA 1TIBA 1TMKA 2AW5A 3PHIA 1YFJA 5CJ2A 3B9QA 2O8FB 2JHGA 2CXRA 4KFSA 3KXKA 4RGVA 4ODIA 1YT5A 4OIFA 1EX7A 3SD7A 1OFUA 3W5CA 4HJXA 3SJAA 1Y1SA 1YRLA 1ZK1A 1G4AE 2O8NA 3LX5A 4ERXA 4XD7D 3FOAA 4R68A 4MYUA 3TZBA 4HB2A 3IP6A 4CI9A 1NVTA 4O8CA 1CUBA 1NYQA 4PRLA 4FNMA 4BMYA 1Q0PA 1TO1E 5JPCA 2J0QA 4YR7A 2ACWA 5AI5A 2IL1A 4ILKA 1J2JA 5U4QA 1O03A 1GQSA 3FVTA 3AQIA 4Q1BA 4YTEA 5FPQA 5BR7A 5GZ1A 3A6LA 3DP9A 2ZYUX 2KM1A 3DLCA 4MGIR 4DLRA 2XUFA 1U3VA 3LO8A 3QTTA 5ALSA 1M0WA 3V2UA 2G06A 1CS0B 1S4QA 1WEKA 4DT1B 2Y76A 3JRXA 1WXFA 2DLCX 5K8IA 3G9TA 3DXZA 1M34B 4LYJA 5C5DA 5DGIA 4UBKA 2Q8QA 5C7LO 4Q48A 2AFVA 1K8YB 1TGVA 3DLAA 4ALKA 4QDTA 1GZ7A 4KYVA 4ZT2A 3CF4A 4K86A 1O57A 4EEKA 4Q9IA 4JBLA 4G6ZA 5EG5A 5A6SA 4BNDA 4F92B 3FOFC 3UUEA 1HH4A 1NPYA 3AEUB 5JZVA 5KYWA 4MHSA 3ZDBA 1ZQ1A 1RXWA 4MUXA 1OI3A 1VE3A 1OE0A 1UWCA 4D3FA 4COOA 3DAYA 1NI5A 1XU7A 3W2TA 4XGQA 1V9SA 3LYAA 1I2ZA 4UQOA 2O2HA 5BW5A 4UBMA 1DTWB 4ENTA 5THQA 1T29A 4AECA 4HQLA 1K8XB 1N2CE 3MD0A 2OBFA 1KBOA 2WSYB 1L8XA 1SIBE 3VDMA 2HRDA 1Y9ZA 3C0KA 4GWGA 1CU1A 5KDOA 4MDYA 5AOAA 5MN6A 8LDHA 2F3SA 1CK4A 4IV8A 1RJFA 3LRPA 1PKEA 4NU8X 3VPHA 1Z2OX 1NVBA 1AXRA 3EDRA 3GUUA 2ECFA 3G2NA 4QOGA 3C3PA 3PDIA 2P5TB 3K92A 4MQ6A 4NZYA 5GJCA 4M98A 3PQFA 5ALRA 1JPUA 1U31A 1ODLA 4G8BA 2CW5A 4N6GA 4ARUA 2IEDA 1CHNA 1IHPA 4N0PA 3PRJA 4N01A 4LRXA 4U7HA 5TX7A 3ZV7A 3ILXA 1H3FA 1U0OC 1V4VA 3R23A 2ZCVA 5FBQB 4FT2A 2ICAA 4Z0PA 3RODA 4E46A 4ZDIA 4OG2A 3B1ZA 2JJMA 2CJWA 3V32A 3ROTA 2VYND 4P1ZA 1VL1A 1YRWA 2C5FA 1GKYA 2AQHA 3PX3A 3BULA 1RU3A 3EGDA 4M7RA 2H54A 3V1MA 2ZBPA 5KEIA 1GZSA 4G4IA 2YX1A 5EZYB 4DB4A 5JECA 4RABA 5FUQA 1SBYA 4YT8A 4L3OA 1IJFA 4OL9A 3B9RA 3OTQA 3FWPA 2C9ZA 4PIVA 4Y2QA 4ZV4A 3HCNA 4G0YA 1AUPA 2MYTA 3ZU4A 3WRYA 2E21A 2JGAA 3LY9A 1E4YA 1ETUA 1DTEA 1T0IA 2VJMB 2Y0BA 3EVBA 4W1QA 2FTKE 1UPUA 1R0ZA 3OOEA 4DXAA 5DHTA 1F1JA 1O54A 4KQHA 4EHDA 1VMEA 2I67A 4AIRA 1XPRA 1GUFA 3TBFA 3MBIA 1QOQB 3O4RA 3KOMA 2PWAA 1FDRA 4WN9A 3RGGA 2HV8A 3JQCA 3SEQA 2C5LA 3ME5A 4PRZA 4ZD6A 4M36A 3VHRA 1XEXA 3QWHA 4EUHA 1FDVA 4MS3B 1XCLA 3SXPA 1XWFA 2JASA 4LXTA 3F6RA 4LXGA 5FDFA 1NSTA 1ZH8A 1KQOA 3GPIA 1A50B 1GT6A 2Q4OA 1VPEA 3E35A 3IT2A 1D2NA 1SURA 1ZRSA 3FNBA 3RVBA 3UHAA 3T5PA 2OM2A 2IHBA 3K31A 2AMFA 4KPUB 5G1OA 1IM5A 1RJ9B 3D9QX 3QXGA 4F1KA 1WDMA 2JGFA 3P0HA 1P39A 3WMWA 3PK0A 3A26A 4L8LA 4Z1MA 1WTAA 1UQTA 4FYXA 3GGGA 3VDQA 5AXAA 1RBQA 2HJRA 4BE4A 5AVUA 3AFNA 3GQBB 4DREA 1EPUA 1XOIA 1QYDA 2ZT8A 5KMGB 1Z13A 1GRRA 2R7KA 1R5NA 4P0TA 3T7DA 3VC1A 4BO8A 3JQGB 5SY6A 3TTXA 1C8LA 5DTRA 4WRRA 2GYUA 1JQAA 3FGPA 3HKEB 4KPEC 4LOLA 1YFKA 3RUCA 3ADBA 1GUDA 3JZFA 4ZCLA 1PJAA 4GOND 4PXYA 4TWBA 4B85A 2IYOA 1F9AA 4BNJA 4B43A 4JVSB 4G89A 3UB3A 1UXOA 3DFFA 1UXIA 3U7QA 4EVQA 5C81A 1BNCA 1COZA 2OAP1 3GRKA 4KU4A 2PRKA 4OI1A 1HE8B 4C08A 2QTMA 2YVUA 2Q1UA 3PGJA 4XUCA 4EKYA 1N7JA 3THWB 1J1IA 1TM2A 4YJ3F 3KL4A 1K3FA 2C2ZA 3KT8A 3DDZX 3QFRA 4LYYA 3PEVA 1UBUS 5CK5A 2J67A 2XMPA 2FE1A 1C3JA 2HD4A 3WB9A 2PUJA 3H5NA 4FR2A 4GMXA 3O1HB 4Q3CA 1G5FA 1RWPA 4FDVA 3M8KA 3VSEA 3C3DA 1MEOA 2EW1A 4FFLA 3UMGA 1CLEA 3LH5A 3LWNA 3V4OA 4P0PB 5TGTA 3EBLA 4QYXA 3TOCA 1SQ0A 4DR5B 1E77A 2NVUA 1OXTA 3HSYA 3IDSA 5KREA 4AZ3B 2NXJA 3EY9A 4R2IA 3BGOS 5KNCD 1P0FA 3MG9A 2BFPA 1N4AA 2FHSA 2I4RA 2XMCA 2GZ3A 4QAQA 3ASYA 4UNNA 2IHNA 1PGOA 1U0NA 1YQUA 1GGVA 2QV0A 3R5KA 2QVLA 4BECA 1LC3A 1G0OA 2FPKA 2O1WA 3F6BX 3ND9A 4WE3A 5I7AA 5JNWA 3U6KA 1MNQA 4MW7A 3GVPA 1H2EA 5E9AA 1J0DA 1M8PA 2Y77A 5E7JA 2R8YA 4JQOA 1A4UA 3VO2A 4C05A 3T3OA 4RF5A 4C43A 1R3UA 3JVVA 2G9RA 2ATXA 3O8OB 4N4AA 2OFPA 2XCLA 2FEMA 1DG9A 4QUDA 2VP0A 1DP4A 4WL0A 5AVZA 4CEIB 2JA2A 3B6IA 1QG2A 3ZI7A 4DNFA 5D5HA 3ZK9A 1U2DC 1NG9A 4D0SA 2RK4A 5IUKC 4DBVO 1JBEA 2BAGA 4XDYA 4RK4A 2CC2A 1Z5UA 2MR6A 2ZYGA 1S8FA 1ACJA 2P5YA 3WLHA 2IYNA 5AHXA 2DFLA 2CD7A 2QRGA 5KVQA 5KTYA 4E1BA 3CN9A 4DJEC 1T5BA 2ORYA 3BDIA 2BR3A 3N07A 1SUCA 3BERA 3ANMA 3C5VA 4KDFA 1UEJA 4DDWA 2OHJA 3TQCA 5BQPA 2W2LA 2CE2X 4UEJA 1HTWA 5ELXA 2WM2A 1UAGA 2O2DA 1XVAA 1ZCBA 2BFOA 2OO5A 1GKUB 1EM6A 3VAZA 1XALA 4NYMQ 2R6FA 3HKBA 1XAHA 2O3RA 4AJIA 3CG4A 1X8XA 3WRXC 4Q21A 3SYMA 4PO8A 2X0RA 2XGMA 1U2ZA 1ENPA 1YQDA 5B3JC 1EGMB 4F91B 4G0UA 1N2ZA 5DW3A 1PJSA 4R8KA 4F3RA 1MAVA 4XCXA 2OE2A 1ZK2A 2IUSA 3RVOA 5F3RA 3KVNA 1G9SA 1R6UA 3FLAA 4QXRA 4OJMX 2UYOA 3WMEA 4RLSA 4FCVA 5HQ3A 1XF9A 3F49S 2NSYA 2WJ6A 3FUXA 4O2AB 4DR4B 1R0LA 3C6YA 3LZDA 4H9GA 4MQBA 3VR2A 4QO8A 3VU1A 4CIXA 1GTZA 2EFCB 2HPZA 4OM8A 5KOHB 2PQ6A 4V38A 1A9XB 1N0WA 2AFIE 3P9YA 4JP5A 5CNKA 4YIKA 3WLKX 5FWXB 2UUCB 1ZD2P 1ZGAA 2VOEA 2AW3A 2FFJA 2IV7A 4IMPA 2MYUA 4ZO9A 1KO1A 5BWBA 1RMYA 2MIIA 3DBLA 3K6KA 4GI7A 4QPCA 3GRUA 4BLQA 3JAWB 4RHXA 3ZUGA 3VOBA 2FKAA 5FPYA 4ESOA 5LMNB 5J43A 3BOSA 1H22A 3LLUA 3PUYA 4DA6A 821PA 4HN2A 1RHKA 5EJGA 5GTDA 5HJEA 1SQSA 3AI1A 3RC9A 2PT6A 3AHIA 3BD7A 2BM0A 3DTYA 2LCFA 3HPRA 3PC8C 3Q0EA 3FR8A 2VXOA 4ISCA 4JLJA 4AZWA 5KJ1A 4TTJA 5B12A 3KEFA 3BCRA 1O1YA 3GLVA 3REQB 2ORED 1OASA 3VVBA 2RHLA 4PXSA 2FUG6 4A5OA 2F55A 5LOVA 5DGCA 1E66A 2EATA 1EFHA 4G09A 3D7LA 1YBVA 2IVFA 1T9GR 5BSRA 5BQFA 3PRYA 1GCGA 2XCQA 3L40A 2PWYA 4FZVA 1ENOA 2QRVA 2FNAA 3O4IA 3U44B 4O6VA 2P6RA 1EDEA 1P7VA 4HYTA 1JMKC 1HWYA 3P2EA 2ZUCA 3E70C 3HY6A 5EESA 4XGNA 3I4FA 1T0JB 3H75A 2UZAA 1AKEA 1DFHA 4ETNA 2PUCA 3N2ZB 5AOBA 1L4HA 3UFXA 3KRTA 1XKQA 5DP1A 4J16A 5IDQA 4XM0A 3OTOB 1C4KA 1WHTA 4DM3A 2JVIA 3R8FA 1E1LA 1K86A 5K9ZA 1VP9A 2XW6A 3I2FA 3F71A 2R1TA 2YJ5A 4LXQA 4TV8A 4BNYA 5ESXA 5KTOA 1C4OA 1G2IA 1NF8A 4Z9FA 1KS2A 1NR5A 4G1UC 5G4LA 2HSDA 2M32A 4KUEA 3RT1A 3TAHA 3VDRA 3ZQKA 3CU5A 3D7RA 4EHLA 1ESCA 3EZ9A 3A4IA 3KUKA 4A15A 1MP0A 3N9IA 2QN3A 1RYZA 2Y99A 4RVHA 1NURA 5C8ZA 3KKOA 4TYPA 1W25A 2VBCA 1GPWB 2VPTA 3E0QA 4IJVA 1Q1QA 1OROA 3K1AB 2YYYA 2QE7D 1SU4A 2FEKA 3O6VA 3CNHA 4CKBA 5HDBB 2WV7A 3KR9A 4X90A 4DCTA 3SVLA 3GZNB 4YCSA 2Q99A 3WGMA 1QHHA 5I9LA 3T4UA 2WWXA 3DEFA 2SICE 3NVMB 1SIOA 4PC6A 1KY5A 1CEEA 3MYYA 1O96B 3IQIX 5AMXA 4DCMA 4ZOCA 1DUIA 5ALIA 3GHYA 1PG0A 1EJ2A 3ILVA 5ERYA 2R1VB 2CXPA 1WAMA 2RGCA 3VR6D 1YQTA 4B7AA 4CMEA 1NV8A 1OZAA 3IVAA 5EP3A 1P29A 4E94A 3C8HA 1QIJA 2P4SA 5I7EA 3OPYA 2M6RA 2Y1DA 3PUVA 1NYTA 5G0TA 3HLYA 1A8PA 4KFCA 2BFCA 3NHJA 2HHCA 1QYWA 1E63A 4G4JA 3BH6A 4Z86A 1V43A 4PZYA 3FFWA 2EGUA 4UTOA 1AHHA 1AA6A 1E3MA 2I80A 3ANNA 3KJNA 4Q6WA 3U3KA 5C2JB 3ICVA 3AVVA 5HGXA 3CLUC 4RLHA 1SB8A 4C01A 4TKUA 4B75A 3JQQA 4CV1A 1I6LA 2Q8PA 3T3DA 5FRDA 1QAMA 1S3IA 3FMVA 3V7UA 1DBQA 3JD1A 1PQPA 2QX8A 1PQWA 4KWCA 3PX2A 4RD4A 3LXRA 3NRCA 4C6RA 4EKGA 1N25A 1IN8A 1IUOA 1E8MA 1HLFA 1XZEA 2PX4A 3KHKA 3OLWA 4RGQA 2E5LB 3MHTA 1GQQA 2YYZA 3KQTA 5JCPA 3S2GA 2G1PA 3HUDA 3ZY3A 2FWPA 1HL7A 5IT5A 4AKIA 3N2LA 3I9NA 2FPPB 4L72A 3JAKB 2CKMA 1QORA 1CY7A 1DPFA 1HT3A 6AT1A 2X23A 2O7RA 1I3LA 1CUIA 3EH1A 4TL7A 1DXHA 3AERA 4JZKA 3C6XA 4K2HA 1NULA 3W3AH 3WYEA 4E7PA 3AESA 3NYWA 3GNLA 4UUOA 5C4IA 1D2CA 1KQGA 1PEDA 3Q15C 5D01A 1N0HA 1XDGA 3V3TA 1X94A 3WIOA 2DTXA 1XZNA 3FAZA 3QJYA 4B74A 4EY7A 3PP8A 1A5TA 2QG6A 3KJFA 3O4GA 1Y0BA 2J07A 2WQ7A 3GGJA 5FBHA 4GDFA 1XHLA 4MR8A 1E2HA 4HEHA 3U62A 3V9AA 4IIHA 4BWVA 5KQLA 4B2YA 2QM3A 4KVZA 2Q7OE 3D8NA 4YQYA 3W6NA 1TRKA 2PGOA 4PQRA 3DMRA 3W5SA 1DUVG 1W34A 3EGWA 1UDBA 2G72A 1ZIDA 4BN0A 1BVUA 3I5YA 3V4LA 3B3FA 2VXBA 3LCMA 4X84A 2H2WA 4CGZA 1D6NA 1XXHE 4PHGA 4D4IA 4H7EA 1K7YA 2EFGA 2NX2A 4X3PA 1ODJA 4PC7A 2CBGA 4RX1A 3RTEA 1I2DA 5CNIA 3WO0A 1ICEA 1M0TA 2JB9A 3R9KA 5DWVA 2JLQA 2XQKA 1XNRB 1EUQA 3CH5A 3TLZA 2PNFA 2VPQA 5CLLA 1K3UB 1ELOA 1IG3A 1KO4A 1NFQA 5EPEA 3G2HA 4X8OA 2X8JA 2XUIA 4XI9A 1XQXA 3ASUA 3W90A 3DAFA 3EE6A 1SCAA 3NTOA 4S2UA 4LJKA 4YV2A 2FW8A 3QM1A 2B83A 1SXHA 4IIJB 4ZANA 1P19A 1MBZA 2QVZX 3WLLA 1NV9A 2C97A 1IN5A 2X5NA 4WVLA 2WIBA 4MUMA 1EX9A 1NUUA 3TW0A 1CY2A 2GPAA 1I1OA 2V7XA 4NG5A 1ZRMA 5HS4A 3JR3A 1LKZA 4RQUA 2DTDA 1B8OA 1O4WA 3KV1A 3MRVA 3DM9B 2A3NA 1YOVA 4N54A 3NJ8A 2VUIB 5CM2Z 2HWXA 3CF4G 3UB4A 5KTKA 1PGJA 5C1IA 1BWRA 3EC1A 2BH2A 4L07A 2ZBEA 3GMTA 5TLSA 1WXQA 1IATA 2RAUA 3FIJA 1XMVA 4P4GA 1QCDA 1UODA 4X8HA 3EPKA 3OZBA 2CHFA 2AGVA 4UATA 4RELA 3DLBA 4TSFD 1C30B 2ODAA 2ZE8A 1Y9EA 2JD1A 5G53C 1XZFA 5CFNA 3KKEA 1SCQA 5HRUA 1Q50A 1Y6JA 1WG8A 3EIFA 4WV3A 3IUPA 2FMUA 3L7AA 1HLDA 1NTRA 4JLUA 5J1TB 3TVDA 1DKLA 4QQNA 4AJHA 2OOKA 3K9NA 4HY3A 1RXSA 3H16A 4KQXA 4TVKA 4ZC8A 4PPQA 2VNHA 2M6SA 3FDJA 4GLOA 5FF9A 4MUEA 3SXUB 1NF9A 3K9GA 4X8LA 5FWNA 2W6JA 3TTVA 3NDRA 3SIWA 5HJ7A 1V5GA 3SI7A 3B1XA 4L5JA 5J63A 3K09C 3BSYA 4IKEA 2IIVA 4XWOA 3EXFB 3PE6A 3QVGB 3KSMA 5CTJA 5C7YA 4C30A 1EE9A 4CUZA 1LNQA 1O6GA 3A32A 5F7JA 5KUTA 3AF6A 2CT8A 4BBAA 3BUSA 2FSHA 3OO0A 1JDVA 3H7AA 5KNDH 3VOTA 1LW7A 3LUDA 3QXJA 3HCAA 2OBYA 5BV2P 3CUUA 3S7ZA 2QRLA 4R71A 2IHUA 3FZNA 1VB3A 5AJWA 4YRKA 4MPRA 1G66A 3I01A 4G25A 5CW1A 4AO6A 3ICQB 1E2LA 1DMSA 1TCVA 3HLTA 2CDRA 1QR2A 1CC1S 5BYAA 1YFZA 1YJBA 1CZKA 1MG5A 2X7JA 3JZIA 3LC2O 4GZLA 2V7GA 3HN6A 2W22A 4KMMA 4D8TA 2R79A 4F4JA 1E0AA 3D6TB 2O1SA 4F45A 3EFOA 3VDXA 2WKPA 4LQ4A 1G6KA 4CMJA 2XLBA 4V0RA 5FPHA 4YX9A 2OXFA 4ZMBA 1FXSA 2BDTA 3HA5A 1AUOA 1RPJA 1SK8A 2AYXA 1VA4A 4R5MA 1USIA 2YHSA 4Q4HA 1U3GA 1BMTA 1C7ZA 1L5MA 4BN4A 4LSWA 5DNYB 1V2GA 3TX6A 4NIMA 4H1VA 3TCNA