1R8QA

Full-length arf1-gdp-mg in complex with brefeldin a and a sec7 domain
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title Structural snapshots of the mechanism and inhibition of a guanine nucleotide exchange factor
pubmed doi rcsb
source organism Bos taurus
molecule tags Protein transport/exchange factor
total genus 62
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r8qA00
2LCFA 4HDCA 4DHEA 1HA3A 1GNRA 1OXTA 2ZRFA 1JXOA 3I92A 4C0JA 2BV3A 2ZI4A 4C7OB 2O8BA 3OESA 4Z1MD 3LY5A 2Z43A 1LFDB 1QG4A 4LBZA 5CLLA 3QKRA 4V0ME 3B1VA 1XCPA 3ONWA 2WV9A 5EE3A 1AZTA 1R0ZA 3RHFA 3NTUA 1W5TA 3OE7D 3SBDA 4KFSA 1S3SA 1GKUB 2QP9X 1KJZA 3I73A 4MUBA 2O8DB 4BECA 1IN4A 2ZUBA 5AUOB 2NOAA 3ASZA 4C0QC 4OHVA 2XXAB 1NY6A 3VHXA 4PO1A 2Q3MA 3UMRA 4DLZA 2QGZA 1QHNA 2VHUA 1G7TA 1G5RA 2D2EA 3CR8A 5SZKB 3TAHA 4KITB 1ZU5A 2CL6X 3T1TA 2FU5C 3MGCA 5AUQA 5G53C 1SXJB 3E2IA 2RHDA 1RRPA 5H70A 1IN6A 3OIYA 3QVUA 2OO7A 2ZYUX 4Q7LA 3C7KA 2IYVA 3AB3A 1HY3A 5DN6A 3C15C 4GMDA 4DLTA 3CW2A 2GCNA 1N5LA 2ZSDA 4PO8A 1G4UR 2BBWA 3K0FB 5CYOA 4GZMA 1J2JA 1XFAA 3NBYC 4XD7A 2QE7A 4DDWA 2FGJA 5L3RA 3N70A 2WBLC 3QKSA 5BQ5A 3U7HB 4LY6A 3I3SR 1TNDA 4V0MA 4ZKDA 4P33A 3PUYA 2BEKA 3PJRA 3SFVA 1QDEA 3D8BA 4JLNA 3B7GA 3OAAD 3BB3A 3EZ9A 3KFXA 1TUEA 2FEOA 1M6NA 3K0AB 3QXHA 3OIVA 4A0HA 2IYLD 5CLQA 3W3AA 3BERA 1T0JB 1W46A 4E09A 1W2GA 2WWXA 5KPJA 4UXIA 1PVOA 2ZYTX 2C8VA 3U6BA 2FOLA 3OFNA 4E22A 1OB2A 3DL0A 2GJSA 2H18A 1OHHD 4DSNA 4Q1EA 2G83A 3QJYA 2QSYA 1FNMA 3KKQA 3CNNA 1N6KA 3R7WA 4E5UA 3GJ7A 4Q4AA 4UQOA 4ZDIA 1MO6A 4Q1FA 2ZJ8A 2NQ2C 3DOFA 3K0SA 3K09C 1G3UA 2VLIA 3CNLA 3A1SA 2GCOB 4RVCA 1CJUC 3O8BA 4PHGA 2VSOA 1BS1A 1T91A 2PCJA 4KCGA 2IC5A 2Z83A 2ZRGA 4EAQA 1IY2A 3IIMA 4YMUA 4FMCF 5EE0A 3NWJA 4OHZA 3U2QA 2WWGA 1DG1G 1P61B 4QXAA 4RD3A 3Q3JB 1AA9A 4IW3B 2MSCB 2BJVA 2REXB 1ZM7A 3THOA 4PHTA 4L5BA 3QEOA 3SDZA 4A2QA 3IO3A 1QBKC 5FR1A 2WMNB 1VHLA 3DO6A 1XZPA 3AV0B 4LV8B 4ON9A 5AJWA 4ASUA 4I1UA 3UIEA 2MSEB 3C16C 3KQNA 5C4GB 2O0JA 3LQRA 1GG2A 1ESNA 4NDZA 4Q4LA 2F1IA 2CHQA 1KI4A 1F5NA 5CK5A 2FFHA 1CRPA 4BLPA 4CRWB 1IN8A 1NIPA 1TQDA 1VIYA 3SI7A 1CJMA 2EYUA 2C9CA 1JAIA 1E0SA 4B71A 3GLHE 4A92A 1TPZA 4R71A 1OLOA 2NTYC 5JEDA 3W8RA 1E2PA 1GRRA 3ETLA 5JRZA 1YZNA 4MYHA 4KFRA 5C4MA 4JJZA 1Z6XA 3WBKA 4Q7JB 4MQBA 4XWKA 5CJ2A 3ZVMA 1N6RA 4YONB 4D0GA 4QJ3A 3AVWA 1UKZA 3P4XA 4DUGD 2NGRA 1KJWA 1MO5A 1XJQA 1OIXA 4JMPA 1KGDA 3SEAA 1P2SA 4LV6A 4ZPXA 4C7OA 3GFPA 4TZ6A 2JIZD 3BE4A 1CJTC 2I1QA 1N2CE 4DLUA 2ZI6A 2HF9A 3TUZC 1A2KC 4PO9A 4MRVA 2X2FA 3TUJC 3U3JA 4A4DA 2IYTA 4Q9KA 3EG5A 5CYPA 2D4HA 1OPXA 2Q9AA 2R6GA 2CJWB 3FMOB 4ZO4A 4BFWA 2I4IA 4NH0A 1ZVQA 3BH6A 4GP7A 3FHTA 1D8TA 2QT1A 3G5UA 4GMXA 5FBLB 4BE7B 4KU4A 1OIVA 2AWOA 1FP7A 1XXHB 2WKPA 3QI2A 1NKTA 3AVOA 4TYWA 2O8DA 2QMUA 2HDNB 3L0PA 3NDBB 2WZQA 2A2ZA 2V6JA 1KDTA 2C98A 2ZJYA 4A0GA 4KBGA 2XXAA 3PFIA 5EXXA 4JVLA 3UK6A 1ZUHA 2NO1A 1QHXA 1WB9A 3K70B 2F9MA 4E07A 4PQRA 3RYTC 4C3ZA 2BCJQ 3E5HA 3VR6A 4YMTA 4WOPA 1XTRA 3EWSA 3CIOA 3I72A 3B85A 4QHTA 4KO8A 3W6OA 3VNVA 2PZFA 3RS2A 1OB5A 1P6XA 3FDIA 4LHZA 1XDBA 1XEWY 4HAZA 3V00A 5JRJA 5JI2E 1RJ9B 3GD7A 5TV2A 6Q21A 1YR9A 1ZYUA 2IXGA 2B6HA 2X19A 1NVVR 4TSFA 1QRAA 5BW8A 2G1JA 2X2EA 1N6IA 1AJEA 2D74A 4AD8A 3K0FA 4M9QA 4KVGA 1E32A 2DCUA 5KTYA 2FZLA 2YOFA 721PA 2ZRBA 4Q47A 1S4QA 4RD6A 4DCUA 4B2PA 3CZQA 2FJUA 3NVAA 1OYWA 5DHFA 5J5CA 4TL6A 3CR7A 3LH5A 2WWYA 4BPBA 3A4NA 1AN0A 4DLRA 2AX4A 3B82A 3I32A 2JA1A 2P3SA 3VNUA 2QRNA 2W0MA 2QI9C 2XJ4A 3B1WA 3K0AA 4LUCA 3ADDA 3SYKA 1UBEA 1ANKA 1BYIA 3CRQA 3T5DA 1ZJ6A 4DCVA 4P4SB 1NKSA 2NPFA 1G8HA 2HT6A 3A1UA 4LJ4A 2B7BA 2EVWX 3CX6A 2WJGA 1VKJA 1Z0IA 1M7BA 1KOFA 3WRXC 4RFVA 4O0MA 1FUKA 3OF5A 5E7JA 1GUAA 2JLWA 1G6HA 5FUWA 1E2LA 3QUSA 2ZVQX 2VRWA 2VP6A 3QPUA 4TQUS 4KSBA 1KI6B 5GADl 2HF8A 4BLTA 2GCOA 5FBQB 1UKEA 1UADA 4KAXA 1E9BA 1OE0A 4LWZA 2QTVB 2RGXA 1KNXA 5DIFA 1HYQA 2G77B 4TLEA 5E7IA 1HT1E 1HQYE 4KV9A 2E1RA 2K5UA 3A1TA 4Q18A 2VHCA 1EWQA 2WVJA 1IBRA 1KK3A 2BOVA 3MJRA 1N5KA 4L16A 2C9YA 4OYHA 3V4FA 2XZLA 3C5CA 1NP6A 4NHOA 2WJIA 2CLCX 2CK3A 2VBCA 1AS3A 4Q7KA 1OKKA 1FOEB 4RFSB 4Q66C 3KJHA 2XITA 1E1QD 4JLPA 3C41J 4BZXA 1PJRA 5JWHA 2W0SA 4QGAA 1XMSA 3I8SA 1TF7A 4BWYA 2GDJA 1GKIA 4YMWA 1XXHE 4K81B 3WYAA 1YE8A 2OEPA 4WA7A 1F6BA 1HH4A 2Z5FA 2WM9B 3J81k 4L15A 2YZ2A 1Z08A 3GJ3A 3SE0A 1GRNA 3ICEA 1DO2A 3LLUA 3WY9A 3DPUA 3EC2A 1OXSC 3KUCA 2PLRA 4X8HA 4BGDA 3UG6A 1JEEA 3SQXA 4ZKEA 2V1UA 3O47A 1ETUA 1G20E 2DBYA 3CX7A 4MDFA 3NIBA 1TMKA 1IJEA 1YR7A 2WOOA 4WIAA 5EE1A 4TL9A 2FX3A 1QHGA 1U98A 3AGPA 4A2WA 3PCRB 4YDSA 2WSSD 3ZZTA 2ZI9A 4RD1A 4A0RA 3LAWA 3IEVA 2XTNA 1Y3AA 4QOSA 1WRBA 4PX9A 1NNEA 3VU9B 1XTSA 1N0VC 5HZHA 3B6EA 3TR0A 5H1YA 3BXZA 1KI9A 4HAXA 4JYCA 4JLJA 2G88A 4BFXA 3O8DA 4FWTA 5DNYB 5EXPA 5FUXA 1G6OA 1ZNZA 4M1WA 5HKKA 4JBYA 2QQ0A 3W3ZB 4BFUA 3S1AB 5C18A 2CNWA 2JLUA 4EJSB 2IS1A 2GA8A 4PAQA 3CM0A 2CJWA 3MCAA 3BK7A 4D26A 2IF2A 1E9FA 2OE2A 4PANA 4Q1DA 1NVXQ 4LHVA 3CRMA 2YVUA 1WQ1R 4MDEA 1Z07A 4B3CA 1K8RA 4R7ZA 5FBRB 1XPRA 2ZS7A 1XXHA 5JZVA 1SQ5A 4RZXA 1CBUA 3MWJA 3RC8A 3EXAA 4HUQB 5CB8A 3AF0A 2ZI5A 1U9IA 3VHLB 2X8AA 2JLXA 1RE0A 4B44A 2A5FA 2TMKA 2BBTA 2R2AA 4V0KA 4PC1A 3HU2A 3QG5A 2OCPA 3RS0A 3ZYCA 5EJEA 5KDDA 5JLJA 1X8JA 3UWOA 3AUXA 1LW7A 1KDRA 4ZCIA 2OAQ1 5FPTA 4N0EA 2V1XA 3P1JA 2QBYB 3TSZA 1ZBDA 2VIIA 4NMMA 5IT5A 4TL7A 2GJAA 2MSDB 3KJGA 3L0IB 1RJ9A 5KYKA 2CDNA 3H1TA 3BFXA 5DI9A 2C99A 1J70A 4E03A 3I8XA 1CJVC 1Z8FA 5HCNA 2GVZC 1TF5A 3AH8A 3PITA 1H8HD 1DELA 1DEKA 1GL9B 2J0SA 5A0FA 1HUQA 3AF4A 3ZS8A 4IKEA 4WBSA 4B3GA 1NG1A 2IYZA 5F9HA 3TSWA 1Z6GA 2OLKA 1TL7C 3C8UA 1W44A 2JJ1D 3E1SA 3LRPA 5G3YA 4GNKA 4F7WA 4DDTA 3U7FB 1XMVA 2BWJA 2J59A 2WIBA 2ZS8A 4K46A 4DLVA 4HAYA 3A36A 4IDHA 1NVUQ 1ONBA 2W00A 4LK2A 5KSZA 4P4SA 4X8MA 1ZAKA 4W5JA 4AY2A 2IS4A 2IK8A 3W6PA 2V4ZA 2GXQA 3DMNA 2F55A 3KQLA 3B78A 1Z22A 3CWQA 1X1SA 2RGDA 4I1OA 1ZIOA 2GF9A 4R98A 2FDCA 4LC1A 2HV8A 3PEWA 1NN0A 5SZHB 1HTWA 1XEWX 1E1RA 1R6BX 2BC9A 1G7SA 5JCZA 1NJFA 1KI6A 2A5GA 3KXIA 3OZXA 3ZVNA 2REBA 3Q5DA 1JECA 3Q72A 3ZJYA 4JSYA 1OH7A 2GVDC 2REOA 4MKGA 2FPMA 3HYTA 4GOKA 4AKHA 1DAMA 1RYHA 4C4PA 1LTQA 1RYFA 2JGNA 1DOAA 3FTQA 3PXGA 1XF9A 4HSEA 4YDHB 3QVVA 1RFLA 2NO6A 2OILA 5DHAA 3LW7A 2D3WA 2ZJZA 4ZDJA 1OFIA 2NG1A 2WICA 2NMVA 1FP6A 4RFSA 5FOWA 3BWDD 2IS6A 3BB1A 4AIIA 3FPAA 2WAXA 2ZAMA 3GQBA 2AXPA 4TMZA 3KX2A 1R7RA 3RAPR 2OG2A 2BJWA 4RY2A 3TVTA 3KL4A 4B6EA 1NBMA 3QBTA 5B2ZA 4YMSA 4OKSA 2BM0A 3OIWA 1KI3A 1Q22A 1OH6A 2A3RA 1VG1A 3QXSA 3WYFA 4XTCS 3SJCA 1IM2A 3EPKA 1RC8A 1KMHB 5TMPA 3E70C 2VEDA 3QSYA 1Q44A 3D3QA 2GEUA 1S9HA 4FCWA 4AKEA 4XOIA 2NIPA 2WKQA 4TYPA 4DB2A 2QMHA 3SFZA 4Q48A 3SJAA 4ARZB 2BM1A 4C2UA 5B30A 4M8NE 1XCGB 2GBLC 2W83A 1GP2A 1RRGA 2WSMA 3SNHA 3A4LA 1NLYA 5FUYA 4DCTA 5BXQC 2ZE8A 3R8FA 5DN6D 3KKNA 3B60A 3OIUA 3U3KA 4BEJA 1W36B 2UZ3A 4UNQA 3VU9A 4EPRA 2XGJA 4MKFA 1J90A 2RMKA 2VP4A 1O87A 2CE2X 1Q1EA 2X1VA 2QORA 4XD7D 5E95A 2QE7D 2P65A 4HI0E 1DAGA 1X8KA 2CHVA 2ODWA 4DSOA 2ZSAA 2CCJA 4PPNA 5FTKA 4YLGA 3FGNA 3X1DA 1Z29A 2ZYWX 3NHBA 2EFCB 5B64A 1P7CA 2KWIA 3S1AA 2BMEA 3RS5A 4EJSA 1IAQA 5FOXA 4LPKA 5J4KA 2IT1A 1P2TA 4R2HA 3TSOA 1AS2A 1KDPA 3DDCA 4XVQA 1P75A 1CULC 2F6RA 1L4UA 1D2NA 3DMDA 4LCBA 4FMCB 4GBMA 1O3YA 3V9PA 2DR3A 4G01B 2OXRA 3L2OB 4GZLA 4HUQA 5HPYB 1RIFA 3GCGA 3B2EA 3NG1A 1XBTA 1CEEA 3LV8A 1GRQA 2ZRDA 2Q6TA 3OFND 1KI7A 3ND8A 4MUAA 1FX0B 3RS3A 3RC3A 1UEIA 3LW8A 3MWLA 2EWVA 1SKYB 1Z2AA 1Q57A 2GILA 3UXMA 3RLFA 5CDFE 2QBYA 2WAYA 3SHWA 3GP8A 3EZ2A 4NYMR 2IYUA 4OHYA 3R9WA 3FFBA 3V4RA 1T0HB 2IYWA 4IFEA 1DG3A 4TTPA 2GAOA 3EAQA 2G0TA 4ZIRB 1F2TB 2O8EB 3F0TA 3H0KA 4JLVA 3DHWC 3GJ5A 3C4JA 1KSHA 3AP2A 4QM7A 4C9BA 3UPUA 1W4AA 2OZEA 4D4LA 3PIRA 4FCTA 5FI0B 4CIDA 5L3SB 1NG9A 1CRQA 4HZUB 1W4BA 5FPSA 1E2FA 1FPMA 2ZM5A 4ASUD 5DO9A 4QBFA 1KIMA 3CONA 3K8YA 4XVRA 1HV8A 1M7HA 2QU8A 2A5YB 3U3RA 1VECA 4M1YA 1P2UA 4IEIA 1FTNA 1NMXA 3RNLA 1ODFA 1XPOA 1EX7A 3WMGA 4HUTA 1TAGA 2YWHA 1VYVA 4LJ7A 5DLQC 1OXVA 2AFIE 1JAHA 4RKEA 2EFGA 5HR5A 5H8WA 1MRSA 1W0JA 4Z8XA 4Q19A 2N42A 3FVQA 3CH5A 3NC1C 4LPSA 2OBMA 3EWAA 4KYUA 4LYAA 2AKAB 1COWA 4POAA 1SHZA 4D81A 3UG7A 3QG1A 4RCYA 1XMJA 1E98A 3F5FA 1U99A 1S2MA 5CDFA 1DAIA 4AKIA 2A7QA 2GWHA 3H86A 3RVBA 3QOFA 1EESA 3HR7A 1L8QA 3CF6R 4N3NA 2CE7A 4HB0A 1W49A 1LY1A 2GBLA 1NVVQ 3F8TA 4QNRA 4J0QA 4A1FA 4QL3A 4FXPA 3AKYA 3U60B 3GJXC 4L9WA 2FZ4A 2RH5A 3EARA 5FL7A 1BMFA 4N1AA 2DWOA 1Z63A 4JLKA 1F2UB 4LYJA 4L9SA 2IEYA 3REFA 1L4YA 3MFYA 1E9DA 5JBQA 3KXKA 5TXGA 4RZ2A 5JS7A 1S0UA 1OFHA 3GEEA 3SYNA 1AKYA 2ZRIA 2ZEJA 3IIJA 5UKDA 2GJ9A 1M8PA 1D2MA 3DM9B 4HAUA 5CJPA 2RCNA 4KLZA 1Q20A 4P0TA 1RVDA 1S96A 5K8LA 1VTKA 4JBWA 1NVWQ 2J0VA 3Q9LA 1KMHA 5DGXA 1EFUA 4O2LA 3L0SA 1MO3A 5LDDC 3THYB 2V54A 1E69A 4NCNA 3RRMA 2QPOA 1KI8A 2OT3B 4GSYA 4FWIB 1E9CA 1JI0A 4TLCA 4BFYA 3NDPA 3LDAA 1SKYE 1YQTA 4ARZA 1P60A 3WXMA 2J0UB 2P6NA 3GLGB 1P9RA 2A78A 5FPYA 1MRNA 1KI2A 1T3LA 2HXSA 3NH6A 4TSFD 1UEJA 3EPHA 4C2TA 4M1TA 1UDXA 4UJ5A 3H4MA 4L4UA 4EQ6B 4NYIR 1KY3A 5BYJA 4HLCA 1SXJC 1S1CA 1ZCBA 3LBHA 4GPTA 4QC2A 1WDTA 4GDFA 2V3CC 5TVKA 2BMJA 2R65A 4H9GA 3DZ8A 2F1RA 3TAUA 2CVFA 2ZJBA 2A5DA 2JDIA 4PAMA 3W34A 1UM8A 4KSCA 3ZIAA 4TQAA 2R6FA 2ANBA 2DWPA 4JL6A 2R44A 2Y8EA 4AK9A 2H17A 5LBIA 4AG5A 5BN5A 4LJ8A 1TEXA 3LXXA 5AK0A 1HT2E 1KK0A 4KHZA 1VCIA 2PEYA 5KU1A 4HB2A 2J3EA 4JLOA 1NN3A 2W6JD 4UNNA 1I2DA 1VHTA 2GAAA 5ANRB 1FX0A 4EPWA 2QNRA 3LO5A 2ZSFA 3CRVA 5EZ5A 4NPHA 4PHFA 1K5GA 2QT0A 2XSZA 1AS0A 3GJ8A 1S8FA 1YVDA 1R4AA 2HLDD 5HZKA 2XB2A 1JJVA 3WYGA 2ZRAA 1AGPA 3AP3A 1J99A 4ABYA 4C0BA 2ZRNA 2IWRA 4QBIA 1KYIA 4XSHA 1GITA 4ZIRA 1F2TA 1VCMA 2O8EA 1M1YE 2HYDA 1U8YA 1LS6A 1AKEA 2W6IA 1XD9A 1C9KA 3KUDA 3W90A 2CK3D 4X8LA 4NL4H 1A1VA 2VHJA 4MA4A 3TH5A 1JB1A 3FYHA 4HZUA 1ZD9A 2FEMA 1OKKD 4DRZA 1WE2A 2E9SA 3HWSA 2VF8A 1SXJE 1DAEA 4MRPA 1GTVA 3B8HA 4LJ5A 1L2TA 5GJWC 4XVUA 2OLJA 2GKSA 4PC7A 4B32A 2Q3FA 5IF9A 2JLSA 3ASYA 2QMOA 4A82A 4YMVA 4DIEA 4M9XA 5DE3A 4Q1CA 3NC0C 2ZJOA 5GJBA 1E2QA 5JWOA 3I5YA 3M0EA 1Q3HA 4M9SA 1DE0A 1T6NA 3KJEA 1E0AA 4QM6A 2R62A 2QROA 3PQCA 3AKDA 5JSZB 2VSFA 1DAKA 1W0KA 2H57A 2I1VB 5JJKA 5FOSA 3B1ZA 5EXTA 1U81A 4F4CA 2QSZA 5DYGA 3THWB 4AKGA 1E2DA 5HCIA 4AYTA 1TU4A 3TNFA 3Q7PA 1UBFA 4BQSA 1Z5ZA 4WZ6A 4G0NA 2AFHE 3AGQA 2VPPA 2JCSA 1N25A 2F3TA 1WXQA 4Q1BA 2CL0X 1G1MA 4L8GA 4Z51A 2YOGA 2EQBA 5HKKD 1LB1B 1JXMA 1F2UA 1A5TA 1LVGA 1Z0FA 2CNWD 2BKUA 2ZVPX 3FWYA 3I4LA 1Z83A 2NO0A 2AHOA 1SXJA 2V7QA 3LBNA 1AZSC 5J4LA 3NKVA 1LNZA 3JZAA 1AIPA 3NXSA 4WZBE 2C95A 1XD2B 3CRW1 1US8B 4OQMA 1MV5A 4HYYA 4KXFB 4PZZA 4ITRC 2H5EA 5FTMA 4KODA 1NI3A 1NN5A 4U00A 1VG0B 2DYKA 2XNDA 1GSIA 1P72A 3K70D 2FA9A 3THYA 2ZTSA 4QJ4A 4GP6A 3AVVA 1JNYA 3B1XA 4YC7A 4BZQA 3U61B 4DLYA 1E2GA 1AK2A 3VQTA 4FD2A 2N1BA 1U9IC 3AVPA 3LA6A 2ZUDA 2J0UA 3GLGA 3EX7C 3GFOA 4DLWA 3QXJA 3FB4A 2B92A 3T35A 3K70C 5F9FA 2OBLA 2QRZA 3RRYA 5AJVB 2CVHA 4NZYA 1P4SA 2ERYA 3LVQE 4M1MA 4QG7A 4IDOA 4EQ6A 4A15A 3SHFA 1PZNA 3VKHA 3T12A 4JLMA 2IYYA 1YZTA 2RGCA 4OQXA 3FKQA 2BIFA 2O0HA 2R9VA 3WP1B 2Q21A 4TL8A 3GLIB 3NBXX 4TWZA 1EGAA 4B73A 4IXMA 4PTLA 4XIGS 1E94E 4TN1A 2PCLA 4HDQB 1YZLA 2QY9A 3KXLA 3R20A 5BN4A 3RSLA 5CM8B 4UXHA 4YQFA 1VCNA 3L82B 4B3XA 5GJCA 3TQFA 2IYQA 3A58B 3H2YA 3LXRA 1NY5A 4P4TA 3WMEA 4PZLA 2A30A 1EX6A 1UFQA 5C1BA 1J8MF 4GOJA 1N3BA 1EG7A 2ZPTX 4P32A 3R9IA 5IRCD 2JLZA 4FINA 5E7MA 3HPRA 1R5OA 4JVSB 2GEDA 3JZMA 4LYFA 4DCSA 4DWJA 3ZQJA 5J4YA 4IXNA 3X1ZA 4GT1A 1ZD8A 3IUYA 1G4AE 1KAOA 5A5GA 3ICQB 4HB4A 1YZKA 1OXXK 4OBEA 1KKLA 4RKFA 4W5WA 5J4VA 1E1RD 5G41A 1U8ZA 1NLZA 4NCKA 1XZQA 2WJHA 4IVQA 2O8CB 3BH0A 1XJCA 2VSXA 2C04A 2A9KA 1BOFA 1OSNA 1Q0UA 2QPAA 3U3MA 3UMSA 4AYWA 2VP5A 4B3FX 2BDTA 1M2OB 4LRWA 4PSAA 2J87A 4JVNA 2ATVA 3I1FA 2P67A 5CIWA 2ODEA 1K5DA 2C9OA 3P4YA 5EUQB 2VHTA 3T1QA 3GMTA 3MRSA 1G17A 4IOLA 4O2RA 1ZCAA 5G3ZA 1T4GA 2GZAA 3DKPA 1YR6A 5ELXA 4Q02A 4HLDA 1TQ4A 3AVQA 4LGMA 4FMBB 3CZPA 1SVKA 3GJ0A 1VIAA 4GOXA 1UKYA 4I1SA 4NYJR 5GJVC 2WWWA 5KHOC 3ADKA 1MH1A 4URYR 1R0XA 1G3MA 1UAAA 1G3QA 5AJXA 2WWFA 3CX8A 3BB4A 3DKVA 3IQXA 4M0LA 4F4IA 1ZINA 3CPHA 3AEZA 4Q00A 2QMEA 4BFTA 1Z28A 2MMCA 2J1LA 2FF7A 2D62A 2PT7A 3WBJA 1G9XA 5A4JA 1CR0A 2YWEA 3ADCA 4B6FA 2OCYC 3U44B 5SZJA 4DDUA 2HCBA 1NJGA 4PC6A 3WP0A 1Z0DA 1CKEA 3AVXA 4NTZA 3CB4A 4CDGA 4PXAA 3SU8A 2RGGA 3MWKA 4PZYA 4QBGB 2HYIC 1ELOA 5JSZA 4PHHA 1E2IA 1QF9A 1IQPA 1XEFA 2IA5A 1GM5A 1W7AA 2QZ4A 4NYMQ 3THWA 4KYIB 4OI2A 1GAJA 1ZNWA 3SBEA 1E79A 3UKDA 4D4KA 1E2JA 2O0KA 3UANA 1R10A 2ZRPA 4K8OA 4AWXA 1BIFA 1XCMA 2EW1A 2GXUA 2XX3A 1XMIA 3GLIE 1CTQA 1R0YA 2Z6VA 2J45A 3HU1A 4Z8YA 4LZZA 1WA5A 3TGPA 2JLYA 2HEIA 3CPEA 3VR2A 5K8UA 4OI4A 1SGWA 3DVLA 2UVQA 2PH1A 4B33A 1MABB 2BEJA 421PA 4BFVA 2PX0A 2WMOB 1U94A 3AKCA 1XD2A 1KI1A 1US8A 5AUPB 3HPQA 2WTUA 3IGFA 4RD0A 4KBFA 3AF1A 1IN7A 1MOZA 1KO8A 2C5LA 4W9MC 4EJSC 3PEYA 4QRHA 1TF2A 4LBYA 3GPLA 2P2LA 1W2HA 1YHNA 1RW4A 5L3QB 1JR3E 1G5PA 1R2QA 3MMPA 2E87A 3U5ZB 4B47A 3THXB 4OI0A 2CCKA 2XNSA 3RS7A 4LC0A 1N0WA 1EXMA 3FKSA 3IHLA 4G1UC 2RGNA 4V0LA 1T3SA 4M21A 1TTTA 4DT1B 2JLVA 4Q9JA 2O5VA 2ZI7A 2WWHA 5FOTA 4ZV4A 2ZXUA 2QEQA 4DVGA 1NBME 2XEXA 1QZXA 1G64A 3EC1A 4PR0A 2QGNA 1FTSA 1W5SA 1Z0JA 1II8B 2FSFA 1IXSB 2CXXA 2I3BA 3QXXA 2FWRA 2ODBA 2G9NA 3VKGA 1QHIA 1I4LD 3DM5A 3GLIA 4OI1A 5F98A 1KKMA 3MUFA 5FR2A 2B7CA 3FMFA 2YINC 1EFRA 2HUPA 1CLUA 1G8PA 3NEJA 4C0LA 4OQNA 4V03A 3PR1A 1P62B 4Q9LA 4M53A 4V02A 2VQSA 2ZSBA 2KB0A 4U5XA 4WZAE 5J40A 5KO2A 3PG5A 3EPLA 3PV0A 1UBGA 2IXEA 4DEXA 3ZZUA 2AK2A 2NPIA 2UZIR 1OH8A 1OW3B 1M34E 3M4YA 4F4JA 4Q21A 4D80A 3G0HA 1W0JD 4JBXA 1LF5A 2ZJ5A 4H1UA 3SN6A 5EE5B 2FN4A 3OEHA 1COWD 1JR3A 1UJ2A 2FV8A 1M74A 4DSUA 1G21E 2IYXA 4URUR 2Q9CA 1OV4A 1G3RA 2HCJB 4G5OA 2PLFA 1OF1A 1BKDR 4Q4HB 4TYNA 3RWOA 4MRRA 3KTAB 2O8CA 4X8OA 2W2XA 4UXJA 5TDHA 1Q1ZA 4M1SA 4ESVA 1E2NA 2ZRCA 2F43B 3VFDA 1JQLB 1UBCA 5E4FA 1C4OA 1Q1QA 3A37A 4IEEA 5KUTA 1OFUX 3GJ6A 1HE8B 1BO6A 1G8FA 2O52A 2OCBA 3QPVA 4LI0A 4Y0AA 2G6BA 3K0CA 4Q01A 4AURA 4EPVA 4AC9A 2FG5A 3B9QA 3IKJA 3LFUA 5J4HA 4NYIQ 5JMTA 2VA8A 3CNOA 2FSIA 4JSTA 5FL7D 1G19A 1BMFD 2WKRA 3K9LA 5AWFC 5KPDA 1SVMA 2CMKA 2DFKB 5EP4A 4CGZA 3AVTA 2VP0A 5TY0A 4P31A 1DAHA 4IVPA 3A8TA 4EIWA 2WSSA 3A4MA 2OFXA 4GL2A 1SULA 1SVLA 2ECKA 4G5QA 3R9XA 521PA 2QP4A 3HR8A 3HJNA 1OYYA 1KZGB 2SHKA 3VKWA 3W6NA 4I81A 3CWZA 3U3OA 4JJKA 1E9RA 3MJHA 1DPFA 1HE1C 2OFWA 5H68A 1CR1A 1DAFA 1R5NA 1CR4A 4XSGA 5IK2A 4A8JB 3AVUA 3AQ4A 1T8UA 2ZE6A 1KSJA 2FE4A 3QKTA 3ZH9B 1RRFA 1CP2A 3KKOA 4RD4A 3TR5A 3D7MA 4TMKA 3U44A 2V8OA 4QKQA 1HURA 3IPYA 5C46F 1SKQA 4UNRA 3IILA 1G41A 1A2BA 2R6DA 5EE9A 1AQYA 5FH9A 3PEUA 2ZRLA 2A5JA 4TLDA 4TTQA 3O8CA 1E96A 2ZI3A 4EKDA 1TUIA 5FI1B 5D3QA 1SVIA 1FMJA 3IBGA 5M04A 1W36D 1HQCA 4MITA 2PZGA 1E6CA 2ONJA 4OQLA 4DB4A 3ADBA 4FIDA 3MD0A 2ATXA 1E9AA 2ZRHA 3LQQA 1WP9A 2G1KA 4WAUA 2IUSA 3KQKA 4PFSA 4ILEA 4AI6A 2OBNA 1NF3A 3TMKA 2BBOA 5L3VA 3K9GA 3NBFA 3NHAA 4M1KA 4AG6A 1W36C 3WNBA 2JDID 3EA5A 4P3YA 4P4UA 5TARA 4MYUA 3CF0A 1N6OA 3ZIAD 3CRRA 4TT3A 1MABA 4BUJA 1YU9A 4A8JC 4QGHA 4O3MA 4JS0A 4KI0A 3OEEA 2YV5A 5JI3E 3DZDA 4IOKA 1AM4D 3BBPA 4XTRA 3WNDA 4HDOB 1KDOA 4WXRA 5FBWB 1XEXB 2JLQA 2O8FB 3RABA 1SVSA 3VR1A 5KNCA 1VMAA 1SZPA 4US2R 2YNMA 3KKMA 4PAOA 4G5GA 2FFQA 5L3QA 1ZNYA 2JJ1A 4JL5A 4TQ9A 4CYMA 5L8VA 2VH5R 2ZE5A 4A6PA 3THXA 2JJ8A 5GVSA 4IRUB 1H8EA 2XSZD 2Q9BA 1VG9B 1YRBA 3SQWA 1NSTA 2WWIA 2HJGA 1P9WA 2J41A 4DT1A 4MGKR 2NZJA 2GXAA 1ZU4A 3UATA 1YRAA 3SS8A 1ZUNB 2IYSA 4C0HA 4F92B 1Q12A 2RGAA 5JJIA 1MT0A 4FW9A 1DADA 1GVNB 2F1HA 2ORIA 1G7RA 1XJ0A 2W2VA 5DH9A 2KI5A 1KO1A 3LLMA 1II8A 5KNBA 2DFNA 4A6XA 3EPJA 5DYIA 3G82C 4CT4B 2W6ID 5BWMA 4LJ6A 621PA 1CS4C 1KHTA 1D2EA 4DDVA 1FQKA 2OUKA 1VYTA 5D3MB 5LD2B 4B35A 1E2EA 2B8WA 2OV2A 4DXAA 4PSKA 2YKGA 5JJLA 3K9NA 3T5GA 3BD9A 4QJ5A 5KSOA 3KZ1E 3QY0A 4YXWA 1E2KA 2XAUA 1QHYA 3BC1A 2VL7A 2WPDA 2D06A 1WBBA 3TJZA 3U7GA 1RKBA 3T06B 3Q7QA 1ZIPA 3K0EA 4S2EA 3QQ5A 1FZQA 3QEJA 2R8RA 5DI3B 2ZETA 1CIPA 5HTKA 2IUUA 4F91B 5AJYA 3AF2A 4URXR 3TVDA 1LS1A 2DPXA 2IW3A 2GK7A 5KNDA 4US1R 1P73A 3ZLJA 1BYUA 3LNCA 1T8TA 1X6VA 2IBMA 1F48A 3CPJB 4NP6A 4NE2A 2KE5A 2G0NA 1II9A 4EFMA 2J7PA 1HEIA 2V9PA 4B76A 3RANA 2YJTD 2F9LA 4EPTA 1GOTA 4Q4HA 1OH5A 4TMVA 1W0KD 3ZD6A 3QNUA 3KTAA 3T61A 4PQYA 4PPFA 1JPNA 1NMZA 2F43A 2GZDA 3TW4A 5LD2C 4KJZA 3IBYA 3GLHB 1TEVA 2C78A 2GHIA 2PT5A 2XOKA 1T5IA 1JJ7A 2AXNA 4NCJA 3RRNA 2B21A 4PC3A 1S9DA 4D4MA 1IONA 1VYUA 1I2MA 4JZKA 1D9XA 4DSTA 2DB3A 4NU0A 1IN5A 2ZANA 4LOAA 3SJZA 1R5BA 5KSPA 5EQTA 1PV4A 2BHRA 5IDVA 4GRAA 3GFTA 1IY0A 1SXJD 2PEZA 2V7QD 4A36A 3UWKA 2P0EA 1Y63A 4MRSA 2QAGB 2DHRA 5TB5A 4DBLC 5BN3A 2QA5A 1N6LA 4ACAA 2ZJ2A 1T9HA 3N2EA 4LHWA 2FFAA 2J46A 3PUXA 2BKEA 2XTMA 4LV5B 2XNDD 4URZR 4A8JA 4HB3A 1Z0KA 1VDZA 3B5JA 1F60A 4CEIB 2VP9A 4XH9B 2H1LA 3BFKA 3R8CA 3LWNA 3AP1A 1DBSA 1KO5A 5FTJA 3LX5A 4IDNA 821PA 2AD1A 3FFAA 5FL3A 2EYQA 2OSBA 1UF9A 3ZVRA 1VPLA 4Q9IA 4OJKA 2HXYA 4IDPA 1W48A 1N5IA 2QL6A 3VMFA 2IWHA 2H16A 3EA0A 2FFBA 1GDDA 3MAAC 1PLJA 2XZOA 3SZRA 3WNCA 3RWMB 2JAQA 1P3JA 2VYFA 5FFMA 3PEVA 3A6PC 3AVYA 4URVR 2BBSA 3M1IA 4G3XA 2QAGC 1T3HA 4KFTA 4OHWA 2AR7A 2JASA 3AUYA 2IEZA 1PUIA 2RGEA 4JLDA 2GF0A 5DISB 3NH9A 1EWRA 1OIWA 1T5LA 1F3OA 2ODNA 4WXPA 4FMDB 2GZHA 1KJYA 4GI7A 3BH7A 4DJTA 1RRCA 4CT5A 4NYJQ 2JJ2A 1X3SA 1XU4A 1VCOA 1E0JA 3Q5EA 1V43A 3CO5A 2GETA 3TRFA 5FOUA 1XEXA 5CM9C 2O8FA 2P5SA 1SVWA 2ZRKA 4W7SA 3BRWD 5L3SA 2PL3A 2GRJA 2VO1A 2Q3HA 1E4VA 2F7SA 2D2FA 2ANCA 2D7DA 1ZM4A 4MYTA 1U90A 2WJVA 2IYRA 2X77A 2XB4A 2QM7A 4DCNA 2ORVA 1XTIA 2ZR7A 4G5RA 1KK2A 4RZUA 2KBFA 3TBKA 4Z1MA 1QHHB 2YHSA 2V55B 1L7VC 1Z2CA 1II0A 3CKLA 1D9ZA 3A1VA 5EZ6B 3QKUA 1N6PA 2DWQA 2YC2C 5KDOA 4ZDKA 3LX8A 5D3MA 2QTHA 1WMSA 2NO9A 3OE7A 2NO7A 1UPTA 2C96A 3N2IA 4CEHB 1E3MA 3FMPB 4IOMA 3LBIA 3C5HA 4UJ3A 3GLGE 3TUIC 3I62A 3I61A 1DVRA 1X8LA 2CBZA 1SVOA 3KFVA 4EDHA 4M9ZA 4DKXA 2QQEA 4HLUC 2ZRMA 1UDWA 3TQCA 1W1WA 5DI3A 2XZPA 1ESMA 2IF0A 2YWGA 2JATA 3WMFA 2VP2A 4Q4JB 5CK4A 2AWNA 1FW6A 2GJKA 2PMDA 2ONKA 3EIQA 3PUZA 5FTNA 3SC3A 3TKLA 1E2MA 1XX6A 2YYZA 4EPXA 1ZW6A 1XTJA 2AK3A 2J5XA 5EXSA 3W5JA 3RS4A 4Q1AA 5GVRA 1IHUA 2AD5A 3B9PA 4JLBA 4B75A 4U7DA 4TMXA 3L8ZA 2ZUCA 2C2HA 1TX4B 3CUEF 3IO5A 1E79D 4JT4A 3HYRA 2YWFA 4US0R 3EZ7A 1GKYA 2KBEA 3GLHA 2WJYA 4FI3C 5FPHA 1M7GA 1TQ2A 3P26A 4DLXA 2Z0MA 3U4QB 1R8QA 3BGWA 5P21A 3KKPA 3P27A 4XWAA 4KFUA 4CF7A 1IXRC 3OAAA 3KB2A 3OHMA 2RGBA 3GEIA 5HE9A 3T1OA 2GEVA 1R0WA 3MSXA 1U8AA 4D25A 4O25A 4DZZA 3ZVLA 5K8TA 1OJLA 4LHXA 2QAGA 1Z06A 1WF3A 2G3YA 1XNJA 4IVRA 4ZCLA 3B1YA 3K09A 1ZM2A 1JEDA 1CJKC 1GILA 3BJIC 3IQWA 5DSZA 4URWR 2F3RA 3X2SA 2RHMA 3FHCB 1V5WA 4TZ0A 2LWIA 2RKOA 1OHHA 4UNSA 4R2IA 1ZD1A 4CEIA 1DARA 4PSVA 2QP3A 1YJ5A 2ZR9A 1OT3A 4DLSA 1Z3IX 5EP1A 3BFVA 2EU8A 2ZE7A 4MKHA 3T1VA 1DTSA 2DY1A 2V6IA 4WVFA 3SJBA 4V0OA 3FKSD 1Z47A 1G18A 1E0KA 2VHQA 4BZPA 4PPQA 2J9RA 2XTZA 5F2EA 4B48A 4BLSA 4C0SA 2FGKA 1CF4A 3ECCA 3MLEA 3A1WA 1K6MA 2OXCA 2R6AA 1R8SA 1KY2A 5EP2A 2ORWA 1A7JA 1E9EA 2IHBA 3W8NA 3N5CA 1XD8A 2W6JA 3C14C 3EIHA 5J47A 3QF4B 2RGNC 4QGGA 2EFDB 2LKDA 4Q5IA 4D4JA 2GJ8A 4EFNA 4HZIA 4Y0VA 4RJLA 1FL9A 4LHYA 2HLDA 4W5HA 3TLXA 1KZ7B 2W58A 5AJZA 5JHGB 3TE6A 1W4RA 1S3GA 4H1VA 1EFRD 1G7CA 3EASA 4GFDA 2LKCA 1IXZA 2ZU6A 1CU1A 4LBWA 1XWIA 4RD2A 1FMLA 1U2RA 3Q85A 4FMDF 1YZUA 5AUNB 5JFGA 1N6NA 3FMIA 3BIFA 3D31A 3QENA 4CEJB 1KSGA 1KMQA 2ZROA 4M2LA 2GK6A 4LJ9A 1C1YA 5FTLA 1MKYA 3H84A 3JVUA 4HAVA 3GEHA 4MGZR 3WHLA 4BLRA 1ZP6A 5JECA 3OEHD 1JR3D 2GXSA 4HLUA 4QHYA 4A0FA 3TK1A 4B3DA 3WHKA 2FMXA 2NZ8A 2QAJA 3ZDQA 2PZEA 4Z54A 3PVSA 2PJRA 2KJQA 2FNAA 1NRJB 3K1JA 3L0OA 2P6UA 2ZYVX 5IHPA 3KQHA 3VX3A 4DUGA 1NBMD 4UNPA 2CEAA 2OESA 2W2TA 5EUMA 2PMKA 3L43A 1G291 4MRNA 4TLBA 1ZUIA 5K8IA 3AM1A 1QHHA 2AKYA 2JIZA 3KDSE 4ZDWA 2QTFA 1XPUA 1E9SA 2HT1A 5EP3A 5FOVA 3CF2A 4HEJA 3SR0A 2FH5B 1A4RA 3ZGXA 3LVRE 2BMDA 3X1YA 4BFZA 5JCPA 3L8YA 1NL3A 4IDQA 1MR3F 2GTPA 4IOJA 1XTQA 4IFBA 2OFOA 1NLFA 3PENA 4N0DA 4CEHA 1EK0A 3CBQA 3K0CC 3VR3A 1ZRHA 1KK1A 2ASEA 3EZFA 2CLSA 3NEYA 1JR6A 1GNQA 4Q9HA 1QVRA 1YZQA 4MH0R 3EZ6A 1W47A 3B13B 4LBVA 2PX3A 1ZM9A 3U6KA 1E99A 3DOEA 2EWWA 4DEYA 5B57C 4LSGA 1WBDA 2ZSEA 4XWOA 1TU3A 3X1XA 4ESHA 5IK2D 2OAP1 1SHKA 3IDQA 3I5XA 4D82A 4Q4JA 4A9AA 2HJVA 1QHSA 3U7EB 2J7KA 4QHSA 4B2IA 3EIEA 1Z6TA 1OFTA 1GNPA 5F3WB 5BYKA 3M6AA 3VR4A 1KAGA 1H65A 1RZ3A 2GNOA 1UKVY 1J7KA 2VF7A 1RPZA 5CIQA 2CCGA 4NBSA 3RDPA 2P5TB 3ZS9A 1J8YF 1YZGA 1XTKA 4MGIR 1PUJA 4LYHA 3UMFA 2RAPA 4NCHA 3TW8B 4F93B 1CR2A 4WW0A 3U4QA 3REGA 3GLFB 1DO0A 4BLOA 4LX0A 2QENA 5LB4A 1AGRA 1IJFA 4JL8A 4TLAA 1GL6A 3QIAA 1G3IA 1ZC3A 3AF3A 1S1MA 4TT3D 4TTRA 4V0NA 4EFLA 4OK3A 2MMGA 3OEED 1N5JA 1Z0AA 2L0XA 2DFLA 2WOJA 2EFEB 3P32A 1Q3TA 4MGYR 3EW9A 4RZ3A 2RB4A 2VTKA 1GWNA 2ZR0A 2QPTA 3HP1A 1OXUA 4LDJA 3TIFA 5JEEA 2N46A 3IEUA 1KO4A 5E3HA 1YR8A 1G5TA 4M4SA 3VAAA 3SYLA 1ZNXA 4HLQB 1IOZA 4KVAA 2IX3A 2J0QA 2XJ9A 3P20A 3QBVA 4AYXA 4D6PA 3KQUA 1H8ED 4Q03A 1E4YA 5C2JB 4ZI3A 1X1RA 5FPKA 3CH4B 3IPXA 3FHOA 1Z6AA 4XJXA 3ZD7A 2H92A 4II7A 1I4DD 4BASA 4C30A 1FUUA 4F38A 4C0AC 2IXFA 5HE8A 2JEOA 2O8BB 1GL7A 8OHMA 1U0JA 4PQFA 1XRJA 1EFHA 3QKRB 5FBVB 3DEFA 4I4LA 4QFMA 2WIAA 3QF4A 1FNNA 3JVVA 4I1VA 2F1JA 1KNQA 1E1QA 5JWRA 2GCPA 2CL7X 2D7CA 5CB6A 4NONA 4M22A 4C0KA 1WCV1 5CITA 1W4CA 2OHFA 4OQFA 5LB2A 1ZMXA 2B8TA 4YXWD 3HU3A 2IL1A 2WPDD 2Z4RA 1TQ6A 3BOSA 2ZIAA 4BRUA 2BCGY 3VTKA 2C77A 4UKDA 1I4TD 5KSYA 4B2LA 4EPYA 4PC2A 4JIMA 4CEJA 5LPNA 1KO7A 1GIAA 1GZSA 1Z6YA 2QM8A 2H8KA 3IHWA 2IS2A 4ZCMA 2YC4C 3K53A 4A2PA 4JVMA 2Q0HA 1U0HC 2ERXA 1G8GA 1NIJA 1P2VA 2ZJAA 3RSOA 2H7VA 4G5SA 4OL0A 2P6RA 4D2IA 1U0LA 2J7PD 3MG9A 4JT2A 1P5ZB 4LJYA 2CLDX 4JYBA 1G8YA 1P9NA 4CW7A 1ZC4A 1NSFA 3KJIA 2ZAOA 1FFHA 1B23P 4FN5A 4B34A 3D6TB 3PUVA 4Q7MB 4BEBA 2FPLA 2R6CA 4B3BA 4JLAA 3QKSB 2XOKD 1Q21A 3QPWA 2AL7A 4I99A 2IUTA 5JS8A 1TADA 3PUWA 4OK6A 2AN9A 1JALA 1N0UA 1KSFX 1XP8A 3T15A 3X1WA 4TYYA 3GLFE 3QF7A 1JBKA 2YOHA 2JLRA 3NBZC 4R9UC 3GJ4A 3KB1A 4TMWA 4OJQA 2OM2A 4FCVA 4EUNA 4CVNA 4BLQA 2FSHA 4B43A 3FE2A 3O8RA 1G16A 1CXZA 2ZU0C 3QE0A 4D0LB 4CZ2A 1JQJC 4M1OA 5B58C 4DC9A 4MYCA 3VX4A 3IIKA 4TMTA 4DIDA 4ACBA 2GESA 2BVNA 3CLVA 3R7WB 2ZREA 3FOZA 5KOYA 4LJAA 2WJJA 3QXCA 4Q4AB 2Z4SA 4RSGA 3SOPA 5G40A 2PJZA 1KTVA 1XB2A 1QVAA 4JKIA 4JKYA 4PPGA 2ZS9A 1FQJA 4OK5A 2EFHB 3ZZ0A 1D5CA 2IHYA 1EFTA 4NKRA 121PA 3F3YA 1DS6A 5FUVA 1PLLA 1BH2A 2PBRA 2ZITA 3AKEA 2OCAA 221PA 2WHXA 1H8HA 3W9YA 4S35A 1X86B 2QN6A 1LF0A 2DFTA 5AR1A 4QGFA 4IHQA 1NN1A 4HATA 4QBHA 1A82A 3RRZA 4B74A 3T34A 3VR5A 3GLFA 3LD9A 1NMYA 2QG6A 1GFIA 1QG2A 4D0NA 2CHGA 3MWYW 1VG8A 5KDLA 1B0UA 3ND9A 4RCZA 4ERNA 4ZI2A 2FSGA 5JHHB 2ZRJA 5SZIA 1LV7A 3BAFA 2C03A 3BORA 2ZQ5A 4OHXA 1D6JA 1AQUA 2JJ2D 2UKDA 4BFSA 1ZM3A 3ZQ6A 4HAWA 3BS4A 1E2HA 3HDTA 1IY1A 1Q1BA 1N6HA 4TYQA 3Q8XB 4NCIA 2KSQA 3K9HA 4BRWA 3W5IA 2QUZA 4KLNA 1MO4A 2BMFA 3WRYC 1PLKA 4MKIA 1YKSA 1JPJA 1EFCA 2FPKA 4U02A 4QNMA 4IJMA
chains in the Genus database with same CATH superfamily
1ZJ5A 3DKKA 4BYGA 3V3KA 1HA3A 3OZIA 3OX1A 3RIYA 1DRUA 1YI1A 3FOWA 4WERA 3M9WA 1JXOA 4MK4A 1EHIA 2ZK7A 5LQNA 1RWWA 2BV3A 3DJFA 2V7VA 3A9TA 3OESA 1Q19A 4OATA 4Z1MD 3MMNA 1SC3A 5K8JB 1X38A 4C05A 3F90A 1RQGA 2O2JA 2JGJA 1W6RA 1XCPA 5FHQA 2WMDA 3F6RA 3EPJA 1NTRA 4EG3A 4MIYA 4NBNA 4NH4A 5EE3A 4E5NA 4BXOA 3GJTA 1B93A 1L9XA 1OXKB 1W5TA 2HRQA 4J16C 3OE7D 4L5IA 4OQPA 4KFSA 4XDYA 5EUBA 3ZX5A 1EDDA 4EEZA 5C9ZA 2A0UA 1U31A 2R1ZA 3GR6A 5AUOB 3AIIA 2C7GA 2NOAA 3KAJA 3R5HA 4AWBA 4C0QC 4OHVA 2OORC 1T9AA 2D1SA 2IZ5A 4Z2YA 3TQRA 3I9V6 1P9OA 4F71A 2BFWA 2PA0A 4KIGA 4PO1A 2Q3MA 2AQIA 3RB8A 2QGZA 2QTCA 1SBIA 3PTZA 3WGHA 2VBIA 4FKMA 3TQIA 1G5RA 3CR8A 3PHBE 1Y42X 3TAHA 1GCOA 1JHAA 5IASA 3MS4A 2FZEA 2Q3CA 5JQGA 1T36A 4OH7A 4OIMA 5K6RA 5AUQA 2CNDA 3FPSA 3QM1A 1FS5A 2OFFA 1EJ0A 2Y1OA 3QVUA 2IV7A 3LQ2A 1H4QA 1JQ5A 2XE6A 2YZGA 2REQB 4OXIA 4Q7LA 1HY3A 4OU5A 3C15C 4FKBA 2VEOA 3P9NA 4JFAA 4Q12A 4DV1B 1W30A 4Z53A 3BK1A 3R09A 3IKLA 4LDZA 3BG5A 4AY5A 5E6SA 1N5LA 1NF2A 4QVIA 4PO8A 4ZQIA 3K0FB 5CYOA 1XFAA 3ZY2A 4YRDA 3V1MA 1GPWB 4P5EA 1PJ4A 3N2ZB 4NG4A 2FGJA 2G8LA 3AESB 3KOOA 3GY0A 5L3RA 2XHEA 1A9XB 1FRNA 3O4GA 2WBLC 5BQ5A 4OGKA 3ZLUA 4DR2B 2JZCA 4P33A 3VKFA 2IIQA 1Q77A 2QW0X 4CF6A 3FCSB 5I3ZA 1Y1SA 3DV0A 5CFLA 3ACBA 1ORDA 2WV7A 2ONZA 1ZZEA 3EZ9A 4U6QA 4LF4B 2FEOA 2ARKA 3QPAA 1EH5A 3SK0A 1CEXA 4OJMX 2X9QA 5LMCA 1FW8A 3KUXA 4XRRA 5K3EA 1H0SA 3PWKA 4H2DA 4HD8A 4UVIA 4K8RB 4MW5A 3NOXA 3P9PA 2WWXA 4NOKA 3ZCXA 1U2PA 2HD4A 4B83A 1ORWA 1C7JA 5KPJA 3C3MA 4JOSA 3OFNA 3DL0A 2BFEB 1FFAA 2JI6A 1PSZA 2BF4A 2ZAYA 3DMTA 3H19A 1A69A 3KKQA 3CNNA 1N6KA 3LUAA 3OLWA 4Z6KA 1ZPDA 3GJ7A 4JQYA 4UQOA 2IKSA 3QYJA 1CY6A 1XZCA 5K4GA 2NQ2C 4U7PB 4EGAA 5AHXA 1X7XA 1HDCA 2IDJA 5THXA 1FSFA 5G0WA 2GCOB 4E94A 5IJ9A 4L3WA 1BS1A 1YTLA 2IC5A 2WSBA 2Z83A 2ZRGA 5CX1A 1DV2A 3NWJA 5EE0A 4OHZA 4BMNA 4CLOB 2X7HA 1PR9A 2ZPAA 4QXAA 4YP9A 1BGXT 2ZAIA 4IRXA 3Q3JB 1EUCA 3NHSA 2FPRA 4IG9A 1XZBA 4FJ0A 2IYOA 3TE7A 5THKA 3SDZA 5LP6F 5T4BA 1QBKC 4LMPA 2L2QA 1DBIA 1JLSA 1K7SN 2WMNB 3DO6A 3O91A 5AJWA 1MC4A 1BQEA 2HWKA 3A0UA 4I1UA 1KAEA 4C06A 5DGDA 2D59A 3LU1A 3UIEA 3L0CA 1HBJA 2MSEB 1SA0A 2TS1A 5CTAA 2YHIB 3KQNA 3UJ8A 2K87A 2GQ0A 3WLQA 2FK7A 1GG2A 1Q0PA 4FOTA 1XAHA 1UKCA 1ESNA 5IX8A 4Q4LA 2CHFA 1GQFA 3FN4A 4X9XA 5BYBA 3D4OA 2DPGA 3MOIA 4TWBA 4UDYX 1QQTA 1A9ZA 5CK5A 2DXIA 4BLPA 4NK4A 2FYTA 1NIPA 1RXEA 1A5BB 1TQDA 3EH2A 2PA3A 3LOQA 3SIRA 4XUDA 2PBLA 1G55A 3OTGA 1M3SA 3DDUA 1BE8A 1TPZA 2EX0A 3WLSA 5ICEA 2P8SA 2MYNA 1OGJA 4M8SA 3SGLA 1HX7A 4RE6A 2R8OA 1UZNA 4F1WA 4R68A 3ETLA 2YJZA 3QX9A 2C83A 4RZIA 2GSWA 3CUYA 3LPCA 4WLVA 2WDZA 3EW7A 3PEEA 4ZQHA 4Q82A 3EVBA 4H17A 3UMCA 4MAMA 4D0GA 5AVOA 2XVYA 3GYGA 5HZGA 3BDIA 4E30A 3LPNA 4XM2A 1XJQA 1YXMA 1J21A 1HDEA 4JMPA 1KGDA 4WXMA 2D7JA 5AOBA 3VNQA 5I51A 4NNOA 4NFLA 3BTVA 2NP7A 4J0KA 3KSUA 4RK0A 1XMXA 4TZ6A 2JIZD 3BE4A 5C1DA 1VQ1A 2F4NA 3TUZC 3G17A 3PQ3A 2IYTA 4KMSA 4A4DA 1B14A 4CIVA 2NXCA 2BL4A 1SCNE 2CJWB 4RPLA 1PT7A 3F7MA 3GO4A 3C8DA 4R1UA 1CV2A 1FXWF 4GGPA 4PG5A 2QT1A 3UATA 2Z98A 1AKWA 1H2HA 4LCJA 3Q41A 5FBLB 3R7NA 3WIUA 4BE7B 4KU4A 2MIIA 1OIVA 2WKPA 1FP7A 1XXHB 3ABIA 3QI2A 3AVOA 4I14A 2AYZA 2HDNB 1GZ7A 1P1BA 2XH8A 5KYUB 3NDBB 2UZAA 1KDTA 4H35A 2PM8A 2C98A 1T13A 3C1AA 4KBGA 3PFIA 3QYFA 3FR8A 4HY3A 1ZUHA 2NO1A 4KI7A 4R3NA 1QHXA 4WCFB 4DSAA 1GG5A 3S44A 2RC5A 3N1UA 2X5KO 3E5HA 4YMTA 1AMUA 3GGGA 4J0GA 5J9FA 4OCZA 3CIOA 1JQAA 3B85A 3P0IA 4KO8A 1TEHA 4GSKA 2NWQA 3VNVA 4JUIA 2PZFA 1PT6A 1EWVA 1X14A 3K4PA 1OB5A 5BRNA 1P6XA 1K86A 3LLCA 4IHJF 5CNMA 1XDBA 1ZW1A 1YQEA 2WK1A 1RYDA 3V00A 2NU7B 5JRJA 5J3JA 2YJ4A 3FOBA 2WHYA 2REQA 6Q21A 5IH7A 1RT9A 1ZYUA 2IXGA 1JFRA 1Z12A 2V9CA 2X8WA 3OPQA 4YR7A 2FW1A 1BE1A 1M0TA 1P74A 2HB6A 4FGWA 1GR1A 4PX5A 4KAFA 5FIUA 1J6UA 2D74A 1Q7RA 1QGAA 3K0FA 4M9QA 5CA1F 3DCIA 4KVGA 2DCUA 4C43A 5HIJA 2YOFA 2H1VA 5EUCA 4DCUA 3AESA 4D96A 2Z6AA 1ZIYA 4OXYA 1M54A 2GK3A 2VS1A 1AB5A 2FJUA 2XD4A 3C6ZA 3NVAA 4KQHA 1OYWA 4X7BA 3RTDA 1UZLA 5J5CA 4TL6A 3DBHB 2G28A 2O7NA 3BULA 4J1NA 3UEOA 1ILWA 3GPIA 3VI4B 2WWYA 2Q4TA 2JLAA 2H2WA 3JWGA 2B7LA 3M7IA 1MEJA 2AX4A 3FUUA 3R6LA 4DG8A 1V4BA 5IARA 3V1YA 2I4OA 4CIXA 3P19A 1XZMA 3VNUA 2QRNA 1CX9B 2W0MA 2XJ4A 1NGSA 2G36A 4LUCA 1BGWA 3HB0A 1J5EB 3RG8A 1A27A 4O4HF 4OM7A 1ANKA 1M5UA 4MX8A 4OTZA 4CU2A 1RZRA 2FJ0A 1ULSA 4P4SB 1UIRA 2WWVD 3SSAA 4OLJA 1G8HA 3D3KA 4RELA 3WLTA 4CM3A 3DL2A 2OCLA 2DHEA 3OCWA 3NWPA 5FA5A 3U26A 3WJ2A 5HMLA 2CT8A 1E60A 4YIKA 1SCUB 2EVWX 5BSEA 4UTNA 5LIPA 1Y6JA 4OSPA 3CX6A 3H5TA 4LXHA 2BFEA 3L7NA 1KOFA 1EWKA 3F9CA 5JZBA 1FTYA 3H65A 5H4HA 5E7JA 3QU2A 3OF5A 4BY9E 2JLWA 4DNOA 1G6HA 3P0FA 4UULA 1G2IA 4RULA 3HN2A 2ZVQX 2VRWA 3QPUA 1FJXA 4ZOCA 5GADl 4N41A 1BJKA 2GCOA 2C7PA 2XNCA 3RUPA 1UKEA 1UADA 1OE0A 3TB4A 1EUDB 4GSLA 2EX4A 5EHQA 1D6MA 2AQKA 1MU0A 1RM3A 5BN5A 3B3FA 2PLNA 5E7QA 5HGJA 4CLOA 1HQYE 3CHYA 1V41E 1J00A 3A1TA 5HIMA 1CUBA 3DQQA 3FWPA 5DM1A 3DYBA 4CUZA 5IWCA 2QIPA 1RPNA 3HVHA 2C9YA 1EP2B 4W9RA 3MB5A 4MHTA 4D6YA 2WJIA 4BEWA 1Q7GA 1WV0A 1NW4A 2FHPA 2FVXA 2QN8A 3PGLA 4LXYA 3FMVA 1FOEB 4A6XA 2H48A 3IP3A 4JLPA 1HPLA 2KS6A 1PJRA 3DDOA 4JC8A 5JWHA 4QGAA 1EK5A 5EC8A 2F3UA 2YHIA 4BWYA 4H3SA 1JQEA 2XUGA 2JBHA 4HXFB 2I4MA 1F8XA 1GKIA 1XXHE 4K81B 5EPEA 4CXMA 1C80A 2OEPA 4WA7A 4EI8A 1DQRA 1CP3A 1HH4A 1WXEA 3HCAA 2Z5FA 3Q88A 2A67A 3DT9A 2PH5A 4KXMA 3J81k 5IN5A 4C7XA 3GJ3A 3WDMA 3DFKA 3LLUA 3WY9A 3PC6A 1GY8A 4X1OA 5KOHB 5J59A 1ZEMA 3KUCA 4HRVA 3CZ4A 1RHUA 4W8OA 1JHXA 2P9ZA 3N8DA 3VYSB 4ZKEA 4LCEA 2QLNA 4U8HA 3UK0A 4PNEA 2QXTA 1G8MA 3O47A 1G20E 2DBYA 3CX7A 4NAHA 4MDFA 2V6FA 2P3OA 4W9NC 2DZDA 2GPYA 2W4QA 4ENRA 5I47A 5K03A 1QHGA 1EVZA 1PGOA 1W5BA 3BIOA 1KETA 3AGPA 4YCCA 4NCAA 4H1HA 5ALJA 1RJEA 2PQ0A 4GGOA 5MHTA 2HBYA 1U0OC 3OPMA 2PZBA 3QJ5A 4MQ5A 4QDTA 4MDHA 3VU9B 3LVBA 1N0VC 5HZHA 4NMWA 3ZU3A 4L08A 5G0UA 4DMLA 1M34B 2DCMA 3BXZA 3GLTA 4HAXA 3BMCB 1IULA 5BUZA 2PRZA 5HF8A 5EXPA 3VO9A 5DNYB 5FUXA 3HLYA 1KF0A 1U1DA 4LNAA 2LCQA 4J03A 1YB4A 4BFUA 1LLFA 1VLHA 1V8BA 1YD7A 3S1AB 4WV3A 2O19A 4X24A 5C18A 2CNWA 2FWMX 2M32A 2FMKA 1YZFA 2QTMA 2GA8A 3GLQA 3H2GA 4P2GA 2PGXA 5A4KA 2IGTA 1QXSA 2CJWA 3MCAA 4G63A 3KTFA 3BGDA 4ZVPA 1E9FA 2OE2A 3PP8A 1RAHA 3VI3B 4BCCA 1NVXQ 3OTHA 1EBUA 5MGBA 3CRMA 4F5EA 4MDEA 1XPRA 1K8RA 1XXHA 5JZVA 1KRXA 3EGEA 2Z56A 3H2KA 1I3CA 5KYUA 3V1TC 4FYXA 2K2QB 2XOXA 4EG5A 2BLLA 1QH1A 1U9IA 2GEKA 3QWFA 2GBFA 4BBJA 1RE0A 3PFHA 3RHTA 1KDZA 1MIOB 4WCFA 1M6WA 2AB0A 3HU2A 3IUEA 5KDDA 4I9FA 5JMPA 3G13A 1X8JA 3IMGA 3R5SA 4B3IA 3D4LA 1L8OA 1GQRA 4ZCIA 3LKZA 4D9KA 5FPTA 5DXJA 5JNLA 4XAQA 4N0EA 2R60A 3LWDA 2PKCA 2VK1A 4TM7A 3WLFA 2EBWA 4RS4A 2QBYB 1CLEA 1ZBDA 5IT5A 1DQZA 4FT4A 4NF2A 1C7EA 2CJPA 2NU8B 4CF3A 4ED9A 3UGJA 1A7UA 2C7BA 2NYUA 2VAXA 3PX2A 4U2DA 2OXIA 1GXSB 3TCKA 3BZUA 2VSQA 3H1TA 3BFXA 4B40A 4WK4B 2PMEA 3Q98A 4Y9SA 3ZDEA 4C5AA 4BIIA 1Z8FA 3AMVA 5LMNB 4HNUA 2GM5A 1TF5A 3DLCA 3LGAA 4S1TA 3FIJA 1DELA 5ALQA 5EZYB 3WK8A 3KQVA 1NOJA 3F6YA 5A0FA 3RU2A 5DHUA 5K9ZA 4ZTBA 1HUQA 3VR5H 4J3FA 3KT3A 5LJIA 2YY7A 1JJFA 5TMDA 4R16A 2IYZA 4RY8A 1YJQA 3NKFA 3DBHA 3LBAA 2FMFA 2YNMD 2Y0EA 1W44A 3AK4A 4HKTA 1AURA 4OO3A 3K0KA 4KMMA 3BHMA 2VHWA 3LRPA 5G3YA 1ZCJA 1Z88A 3ZGLA 4F7WA 5JMOA 3WWPA 8GPBA 1AGNA 4TWIA 3KZVA 2HDWA 1UWLA 3TM5A 4K46A 4DLVA 2GB4A 4AS2A 2FX2A 1GCIA 2SECE 3HA7A 3KOYA 1ONBA 1JEAA 3M5PA 3H5AA 4LK2A 4P4SA 2B4RO 1J23A 4CKBB 5J23A 5G1OA 3JQAD 2IS4A 2IK8A 1ODJA 2E82A 3AZPA 2D5BA 4H59A 4XCXA 3W6PA 5B3KA 1PF7E 2ESRA 1MX5A 1SCUA 1Z22A 4D9JA 1X1SA 1Y4UA 4BATA 2GF9A 3KHUA 1QG6A 4R98A 5JS2A 2FDCA 2CN1A 4LC1A 1DB3A 1Z4NA 5SZHB 2YZMA 3ZBTA 4Y18A 2BC9A 5DSTA 4EX6A 1G7SA 1UJ6A 2AOXA 5TQVA 3WOVA 2A5GA 3ER8A 2YJ6A 2HA5A 1WLYA 2W2PA 3I76A 3STYA 3ZVNA 2HWYA 3LM8A 4PFJA 3UBMA 1EUDA 2F48A 1YS9A 2JLBA 5KKAA 4MKGA 3HYTA 4GOKA 4NPCA 3Q3VA 3EJWA 4RPIA 3D5TA 3ODGA 2PT6A 1E5TA 1FYVA 4YCAA 3PXGA 3ZGYA 1TK9A 3OE5A 1H69A 4IGFA 3UJDA 2O6HA 2BFAA 4YDHB 4AJJA 2NO6A 4ZARA 2EKQA 3WX0A 3D59A 4NDAA 3BRCA 3LPAA 2NG1A 4BVJA 6LDHA 2NMVA 4KE7A 5ALUA 5FOWA 1ZMBA 3W1WA 5HUJA 4KVZA 1VE5A 1JFLA 1YZYA 2X86A 4DLNA 5CD9A 2RD2A 5KMGB 5BYAA 1MJFA 4NATA 4QPPA 3TVTA 4B6EA 3M6IA 4EDFA 5JARA 5EHNA 2CV1A 2N3ZA 2IP4A 1JWLA 1Q0RA 1VG1A 3ANTA 4XTCS 3EB9A 1Q0SA 4QECA 2XVAA 4DV2B 2LDXA 3E35A 3UB3A 4CCAA 1WULS 3D81A 1IM2A 5KJ1A 3EPKA 3CISA 3L5OA 4ZRNA 1PWYE 2VEDA 4NBVA 5JSYA 5KJ6A 4UUBA 3AL3A 1I4WA 5ESDA 5C53B 5CU7A 3QGMA 4DNXA 1B2LA 2GEUA 2OHOA 5HILA 4AKEA 4DR3B 4FGJA 2WKQA 5U1PA 1JSCA 1PS8A 1HDYA 1PG0A 3JVDA 1JLHA 3FZEA 2QMHA 4QARA 3RH0A 2HI0A 2R5WA 2RB5A 1QB8A 3OOYA 4MRMB 5ALSA 3SJAA 1D4OA 1U3DA 2X5NA 4MMZB 2HSEA 5B30A 3D6FA 5K05A 1V5GA 5EG5A 2W83A 1I6KA 1G0NA 1N75A 2DR0A 2OC4A 1JDUA 3A4LA 2IPLA 3HN7A 3KQMA 3JARB 4GI2A 4UPVA 4DCTA 1LSJA 2XE4A 3L8MA 2ZE8A 2HJHA 3R8FA 1MHTA 1AQLA 1K7YA 3UNXA 3U3KA 1W36B 2UZ3A 3WNVA 3GCDA 2P4EA 4HP8A 4UNQA 5ES3A 3VU9A 2C84A 1HOXA 3I2GA 2XUJA 2B9VA 2VP4A 1M34A 1Q1EA 1I6LA 5E95A 4XD7D 2R1TB 3BMCA 1JIJA 2Y2VA 2XDAA 3VPAA 1CFZA 3HYSA 4UBJA 5DXAA 3ZG6A 3CNBA 1RKVA 3IAEA 4BMZA 4GI5A 2Q50A 1FLNA 3GV0A 4PPNA 4FDTA 5FTKA 1KPIA 2ZYWX 3NHBA 5TMBA 4DDKA 3AWIA 3HJAA 3S1AA 1I0ZA 1TQ8A 2BMEA 3BE6A 2C4TA 1IUKA 4LPKA 1KYTA 5J4KA 2IT1A 1P2TA 2B25A 1P4RA 3LO8A 4ENPA 3QOWA 1AS2A 4JEMA 4ZJZA 3CEHA 2VPZA 5HW0A 1CULC 4Q9NA 4KOEC 2W70A 2HTFA 2QR2A 4EKNB 1O3YA 1W1UA 3V9PA 5IVDA 3OZEA 3UV7A 4G01B 4P0QB 5EGNA 3ORRA 3H0CA 4G2NA 1EQ2A 3PXDA 1N5MA 5F78A 4IXTA 1JG3A 2CBGA 4C4XA 3T0FA 4NBKA 3ZU5A 1MIOA 4RJTA 4URFA 4A6DA 2JEZA 3V42A 1QF6A 1FX0B 4QOFA 4K0KB 3RC3A 3PLAE 3LW8A 2P62A 2W6CX 3T7CA 5JNSA 1D2RA 3T7DA 5CDYA 1Q57A 1EVJA 1VJDA 3IUQA 1E61A 5CDFE 2QBYA 2WAYA 3SHWA 4LVNA 3U9SA 4ZAVA 3ZVKA 1WXFA 3FROA 1I51A 2CXPA 2IYUA 4HRXA 4NYMR 2NU8A 3NUZA 3FZNA 3U9TA 1GXSA 2IYWA 3E15A 1NHGA 1VPDA 1NI4B 1NOKA 2WA1A 4UHBA 1MW9X 2GAOA 3EAQA 4J0DA 3P45A 5A7GA 1F2TB 4V0QA 1SUPA 1TUGA 2HSJA 4ZIRB 3H0KA 1T43A 1YR3A 2I6QA 1U4SA 2X3YA 4NHEA 2M6KA 2YY6A 5BR4A 3E48A 5K6TA 1STOA 3VO1A 1E5QA 1DKLA 3L8DA 3BMXA 5EZYA 3RFXA 2YVAA 4QM7A 3UPUA 1NU8A 1Y48E 4CIDA 3SAJA 1PNOA 4XQ9A 2C7OA 1HNWB 3CZ5A 1CRQA 4HZUB 2IPOA 4BGUA 1CT9A 3C87A 1U63A 1FPMA 3KV3O 3QFHA 3KE9A 4GR5A 3RHSA 1Y6QA 2Q3LA 1KZHA 1WAMA 1M7HA 2A5YB 4RL4A 5JNWA 1YR1A 3GU3A 4ECEA 4FZJA 1ODFA 4WFQA 3SKXA 1M1XB 5FBHA 1EP3B 4MS1B 1CDOA 1LRJA 4ZZ0A 1KS9A 2OD2A 4K9QA 4HGNA 3HM9A 2W71A 4YJDA 2GZ1A 3VH4A 4CKBA 4YRQA 1T6XA 3QELB 2JIQA 3EUWA 1QVVA 1ZA2A 3EHEA 1XNHA 4ECAA 4KYUA 5GIOE 2AKAB 1RP1A 3EBLA 1IWOA 1L3BA 1SHZA 4LC9A 1F14A 4POAA 4ZVMA 1EK6A 3TZ6A 3UG7A 1R66A 3TEFA 4EITA 4KPUB 3W5CA 3SC4A 1U99A 2FEPA 1DAIA 1T8RA 1Q92A 3OU7A 5CDFA 3WGOA 4AKIA 1O95A 1JTVA 1ODCA 4ZCTA 1CUXA 3MTJA 4G5HA 3TG8A 1DWPA 1SUFA 2PVCA 4CL2A 2G5TA 1WF6A 2DKOA 1SBNE 2NQ8A 1PQUA 4YJ2B 1BZYA 1UFKA 4N3NA 1MB2A 1G8SA 3HCNA 2NYAA 4GPIB 1LJ8A 3F8TA 3HGTA 4J0QA 5EGSA 1GQOA 2PSFA 5KCZA 3TX6A 3NTVA 4JI8B 4QL3A 2HQRA 2WT8A 3K96A 3AKYA 2FFRA 3GYBA 3GJXC 3DOUA 2P3LA 4L9WA 3AI1A 3EARA 4N1AA 1SD5A 2V5VA 3CE6A 3P94A 1Z63A 3ZWWA 1QIDA 4MWGA 3NDRA 4COKA 4DXHA 3HO8A 1BXGB 1IM8A 1FFSA 2FG7C 1QV9A 1E9DA 2RHHA 2YXNA 5JBQA 4E2ZA 1P8JA 3PHIA 4YHBA 4G86A 3MQ4A 4L3OA 1LH0A 4Y1GA 1Z7BA 4ND4A 4LRSB 5LZ8A 4E4RA 5KMGA 4QYXA 1XZAA 3IR6A 2AJCA 3BM5A 3HXQA 2W6PA 5L3ZA 2PUGA 1M8PA 1D2MA 2G4LA 3IEXA 4U7GA 1Q20A 1NMEA 4X93A 4HMOA 2G1PA 2V6MA 1S96A 3S5UA 2Z5LA 4UUNA 2BSXA 1AXGA 2BUAA 3D54D 4JBWA 5DLDA 3WQRA 4ENSA 1R0LA 1RXCA 4DJJA 4FM9A 3DLHA 3ZV7A 2P2DA 2IX9A 2QR5A 1RKXA 2W4MA 3VBCA 3VR6D 5IDYA 4N7MA 2CMHA 2W2LD 1YFKA 4XIIA 1JI0A 4BFYA 4MRMA 3GRAA 3R5FA 1H6BA 2IYNA 5D84A 3RJMA 5CP8A 1GTRA 3NT5A 4PNZA 3UJ7A 3W5BA 3JARA 1MRNA 4RGQA 1KI2A 1PFUA 1T3LA 1T9BA 4L0DA 2HXSA 4LY0A 2XCTB 2PX4A 5ICFA 4OXKA 1GNLA 1ZJ4A 3GGCA 4M1TA 3R0XA 1Y1QA 2OD7A 2K7FA 4MNTA 4UJ5A 4FN4A 5GONB 4PF1A 1KY3A 4L75A 1I0LA 4F6CA 4TLLB 5CA0B 4FFOA 1P0QA 1PS0A 2GZ3A 2R1TA 4GWLA 2ZUUA 4GPTA 3V5NA 1SC1A 1WDTA 4O63O 4EENA 4V1CI 3FTFA 1JG7A 5TVKA 2QJRA 4H9GA 2NQTA 3PGVA 5DRTA 1L7RA 1PR1A 2P9GA 1P1KA 2A5DA 2G17A 3M2TA 5H83A 3UJPA 4YP0A 3PD0A 3KOUA 1TFRA 3URMA 3ZIAA 3CC8A 2R6FA 3L49A 3ZIUA 3S6JA 3IMEA 3PDHA 4LGYA 4UFNA 3CLRC 2DWPA 3WNZA 3GEMA 3ETHA 2R44A 3GQVA 1SRQA 1VJ5A 2EL9A 4LSZA 4R51A 4E4TA 4HFJA 3DBRA 3RUCA 3S55A 1L7MA 2I6UA 1TEXA 5AK0A 1HT2E 5AW7A 1FLAA 3GFRA 1K89A 3ESCA 3NCTA 2B94A 4D8WA 2X0EA 2FPSA 4D9BA 2O0MA 1NUHA 4EA9A 3H97A 3SLKA 4HTFB 4JLOA 5AJUA 1NN3A 4P98A 5HIKA 4EUFA 1FX0A 2GK4A 2QNRA 3BYZA 2ZSFA 3DT8A 3CRVA 5EZ5A 4YRKA 1E7WA 1B43A 1E9VA 2QT0A 1HFKA 4XGNA 3RRXA 1RXSA 2XSZA 2KPOA 3LWZA 4QRIA 1UMCB 2E4AA 3D8HA 1YVDA 3WOHA 2FZCA 3ZCQA 1GPLA 1NW9B 2X5OA 3GK3A 2AZ4A 4LOKA 2JIMA 2OK7A 5C1IA 3QBDA 1CUUA 5DHTA 1M0EA 2IYPA 1YK0A 4PYMA 3KVNA 3TTUA 1J99A 4CTNA 1NI4A 4QDJA 2ZRNA 2HWXA 1Y7LA 5EINA 4PN7A 4LX8A 4TMYA 4ZIRA 1F2TA 2OMEA 3ILYA 1OGYA 3HDGA 2W42A 1RZVA 3VZQA 5JO0A 5EIEA 1JW9B 1JFTA 3HSSA 2W6IA 3EZNA 4NMXB 4XEHA 4BKPA 2EWMA 4YAOA 1C9KA 3KUDA 3ESRA 3OP1A 3FIUA 2QOEA 3CSUA 4HZUA 2GM9A 2A88A 2B5VA 3L93A 3M9LA 4DRZA 1CYDA 1WE2A 5LSAA 4BNTA 2ODQA 2VF8A 1SXJE 3ZHUA 4MRPA 4IJ5A 4LG1A 5ER6A 3UB4A 1CUEA 4NMHA 1U2SA 4E12A 1GTVA 1QX4A 3GF4A 3WGKA 4UUOA 1JIVA 1MXHA 4XVUA 5I9TA 3FPLA 2BT4A 2GKSA 3TMAA 1U0GA 1J1UA 3VSDA 5JYBA 2NADA 4MS1A 2P6OA 3IE0A 3KUKA 3HA2A 4U0KA 2SKEA 3W5UA 4QVGA 1M73E 2BR5A 5DE3A 1YRWA 2FEXA 2ZJOA 1TZCA 1E2QA 3ML1A 3QELA 4O3FA 2RSLA 5JWOA 3EDOA 2OXTA 1SG0A 4CKXA 1KFJB 3M0EA 1Q3HA 3D3EA 1CUIA 3ZHYA 5AOVA 1O6BA 1T6NA 4QM6A 2RH4A 2R62A 4KPUA 1OY1A 3C4QA 3HKCB 3HJBA 2JHCA 1B42A 2Z57A 3B1ZA 5EXTA 1SQ0A 3U9LA 4YJ2A 4AYTA 4JUFA 3TNFA 2AYYA 1PGNA 2VDKB 4JI5B 1VMKA 4QX6A 1EHYA 4WZ6A 4F06A 3PQFA 4DMGA 3UFBA 1C2TA 4HJXA 1GFZA 4DUYB 1WXQA 5I9NA 1PK9A 2Y1WA 3M33A 1YQGA 3NOQA 4Z51A 2EQAA 1KP2A 1X42A 4HNGA 3ZXIA 2INGX 3GLVA 2FLWA 2YBEA 2ZTLA 1A5TA 3GNTA 5IDQA 4MI1A 1LZLA 1BXGA 4GMHA 3FWYA 2P2YA 3C3YA 3FDZB 2ODAA 5C3MA 2MOKA 2NO0A 3LBNA 1SXJA 5KYTA 4E4YA 4I0WB 3P7MA 10MHA 2VJDA 2J33A 5CXSA 4XWTA 2O2ZA 3JZAA 1AIPA 1KHHA 2FHSA 3NXSA 2Y05A 4G56A 2C95A 4PVCA 3VC2A 1XD2B 4D57A 4YAEA 1DTWB 1RS0A 1MV5A 2V45A 4FLEA 4HYYA 4WBNF 5I45A 1Y9DA 4ITRC 4CTOA 5FTMA 1R6VA 2ZWIA 3FSGD 4NESA 2E4YA 2CW5A 2VHYA 4KXWA 1JG2A 1BNCA 4XYGA 4X66B 4GYYA 4WACA 1SCIA 2WSIA 1U3FA 3I2JA 3JVIA 3AVVA 3ITNA 1JNYA 3CY6A 2YJNA 2EATA 4UFPA 3ILHA 3JD1A 1RJGA 4I08A 1CUSA 1XMOB 1U9IC 1B4DA 4L0QA 3ZHSA 5EJ4A 3GFOA 4G97A 1K6XA 2C1XA 3QXJA 3RT1A 3FB4A 2B92A 3T35A 4D8XA 2Y27A 9LDTA 1PZFA 2ZTUA 2QRZA 3V8MA 1U5AA 4D9MA 3OZVA 1P4SA 5FJJA 1IPFA 3EZXA 3SKYA 5DULA 3DOIA 1EK1A 4HGOA 4PLFA 5GONA 5A4AA 3LUJA 4DA9A 7AT1A 1KQFA 3T12A 4I1PA 5DWVA 3ZE8A 2IYYA 3UTDA 1YZTA 3VPHA 5CA0A 4HN4B 3G5LA 2O0HA 2R9VA 4KFCA 2M1ZA 5T41A 2DTEA 3DO5A 1EGAA 1J8QA 4C4SA 3E3AA 3N6VA 1QONA 4IXMA 4PTLA 1E64A 1JSRA 4KQIA 4KX3A 1FJGB 3EIWA 4Y1RB 1HG1A 4HDQB 1YZLA 3R20A 1ZD5A 2HPZA 2Z5GA 2SNIE 1Z36A 2O1WA 3N6XA 5GJCA 5BSKA 1KBZA 1GPBA 3H2YA 5JAHA 2H54A 4ZZ1A 3HXPA 1JLMA 4H7HA 4P4TA 4YRIA 1EBBA 4YLEA 2QD2A 2LE0A 2XWQA 4OFBA 1SOAA 3RROA 3GGOA 3WMEA 2VJQA 1FP2A 1I0IA 5KYYB 3HY4A 4QGBA 5JCJD 1N3BA 1EG7A 4NNPA 5FKJA 5BSHA 1NW5A 5I7FA 1ZISA 2QY6A 2EP5A 2RKWA 4C3UA 4XIFA 4OB7A 2GBGA 2JAPA 4DWJA 2I2FA 1BHQ1 4IXNA 3FYDA 4BWFB 3ZNQA 3K32A 1ZD8A 3H0EA 1G4AE 4GT1A 4HTFA 3BRWA 5A5GA 2Q4EA 3QX7A 3N0WA 2B30A 3IHTA 4DIKA 1TI7A 4GM1A 4W5WA 3FJ1A 4EY7A 5J4VA 3D0RA 5J2TF 1G6KA 1P1CA 1UMCA 1NLZA 1SK9A 5G41A 1XZQA 2BGTA 1I7NA 1LDBA 1QZZA 4IVQA 1W581 1ZL0A 2Z9CA 3HFJA 3ILXA 2Q28A 4JMLA 2O8CB 4I9UA 1XJCA 2VSXA 2C04A 5CH5A 1J42A 5L4LA 3S8EA 4PSAA 3JPYA 1DKPA 2J87A 3INGA 4JVNA 1U7XA 4FR2A 1CR6A 3QPBA 4E5KA 4EY8A 4D8TA 1K5DA 1YQUA 1QMGA 4JB8A 1P6QA 2PV7A 3OU6A 3D8RA 1JI3A 4CM1A 4O2RA 4KXVA 1XYGA 1QIFA 1MD9A 1T4GA 3DKPA 4IILA 3PPVA 2GERA 4RTSA 2JGDB 3HO1A 1NATA 1FYDA 2UDPA 3F3KA 4HLDA 1KDVA 4F9TA 5HJ5A 5LUAA 4FMBB 5AKKA 4EY5A 4LF8B 3A14A 4ZWNA 1L4MA 1SVKA 3FPBA 3G2MA 3GJ0A 3BA1A 4GOXA 5C81A 3P0EA 4AS1A 3R9XB 5EFOA 4GU5A 5GJVC 5JXHA 4KPEC 3HJUA 4UAJA 3SZLA 4Z9BA 3DAGA 1MH1A 4YK7A 3WLHA 4IIFA 2V03A 2P9FA 5AJXA 1CJCA 3CX8A 4KQKA 5FA6A 4F4IA 4C4OA 4QG3A 4Q00A 3AEZA 5HZMA 1XYYA 2AVNA 1M0WA 1P7VA 2FF7A 2J1LA 2WHPB 3WBJA 4CT0A 1O97D 3FTPA 4JY7A 5A4JA 2YWEA 3QUTA 5FI3A 3O2QB 1OI2A 1Y5MA 2NU9B 1V5IA 1KOLA 1HWYA 1WQ4A 1FTWA 2BISA 2NO4A 4ITVA 4LAFA 5SZJA 5HKBA 1NJGA 2VNKA 1O9GA 1B74A 4CM4A 3EPRA 1B8NA 1THTA 4ROSA 4B9EA 4PXAA 3MWKA 2HYIC 4TWRA 1WEKA 3HKCA 1MB0A 3JD3A 2NZXA 4HWPA 4OREX 4PHHA 1Z9BA 3OJFA 1E2IA 1O89A 3EXFB 4E2YA 2UVDA 1GM5A 1ZXXA 2ZIXB 1G6Q1 3GDOA 1ZQ9A 3OZ7A 4L6AA 4NYMQ 1QHEA 1UC9A 2YQZA 1GAJA 4HAIA 4KYIB 4LZWA 1B26A 3SBEA 3VZCA 1E79A 3KELA 4D4KA 4ZYVA 5K3FB 3NNNA 2FPUA 1RJWA 1QH8B 3JQ7B 3MXOA 5D8DA 4FDMA 3A26A 2AZXA 1JSXA 3L8CA 1C9MA 3UCXA 1XCMA 2EW1A 1PJAA 1JZTA 4DDMA 5C32A 4UE3S 5KNBA 5FAKA 3HU1A 4ID9A 3GP3A 4PGHA 4BV2A 2CYCA 5K8UA 3CPEA 4G89A 4WNYA 1GPKA 1GQSA 2QTBA 3FDZA 3R3JA 4L4YA 4LEIA 5EEGA 5LQCA 2A9QA 1S2GA 1XA3A 3K9BA 5ICGA 1U3CA 1WMBA 4BKRA 3AKCA 1V3TA 1XD2A 4F3RA 1KI1A 2XI4A 1IH8A 1DTWA 1TIKA 4ZI7B 3IGFA 3OG9A 3AF1A 4RSRA 3Q2KA 4EG7A 1FCJA 1KO8A 1FVFA 2C5LA 2J08A 2Q0XA 4UARA 3T0GA 3QX3A 5KQGA 2FZ5A 3AI2A 1JSZA 2QX7A 1T34A 1PX0A 4MVJM 2W8ZA 2QZPA 4N48A 4PZEA 3GT3A 2XDQB 2X5XA 2HPAA 4NARA 2OCXA 2NNLD 5IJ0B 5L3QB 4UBKA 4RDCA 1CQIB 3K9WA 1U2GA 4K88A 3OIDA 2XNSA 1EQUA 2A6PA 3UMBA 1Q6YA 1WB6A 2NU6B 5EL0A 4KIFA 4CM8B 4YRNA 3DLIA 2WLTA 3HWRA 1I7PA 4FC7A 4MZDA 5BMVF 4P53A 1EX9A 3QV1A 2O5VA 3U09A 2JLVA 1XK6A 1HLPA 2BMAA 3TEJA 2VJYA 2GAJA 3IDSA 5I3CA 4I46A 4UHHA 2F1KA 5CD1A 2IKQA 2Q6VA 2H0QA 1X7WB 2XQJA 2ZT5A 1VJRA 3JCZA 4PR0A 2PUVA 1FTSA 1W5SA 1X7HA 1Z0JA 3HCBA 1OYOA 4EJ2A 1PWZA 5LWHA 1VJTA 1FFBA 4FILA 4MAAA 5JFOA 2B8JA 3T1NA 1WKCA 2JD0A 4A0SA 3S2FA 2QNBA 1TM2A 5EJ9A 2H1RA 1A9SA 3F67A 3IEIA 4OI1A 3CW9A 4K05A 1V9CA 1M5RA 4HEA1 4Y1RA 4BFCA 1T9KA 2B7CA 3GDWA 1EFRA 1MP0A 3B3QA 3UW1A 3TZLA 1CLUA 1G8PA 1C4KA 1R3UA 1RP7A 1UBRS 2ZT8A 1MTOA 3GZNB 4N5IX 1B2RA 1KR5A 3PR1A 2OBBA