1R9HA

Structural genomics of c.elegans: fkbp-type peptidylprolyl isomerase
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
KIDITPKKDGGVLKLIKKEGQGVVKPTTGTTVKVHYVGTLENGTKFDSSRDRGDQFSFNLGRGNVIKGWDLGVATMTKGEVAEFTIRSDYGYGDAGSPPKIPGGATLIFEVELFEWSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506 Binding protein family
publication title Structural Genomics of C.elegans: FKBP-type Peptidylprolyl Isomerase
rcsb
source organism Caenorhabditis elegans
molecule tags Isomerase
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2003-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1r9hA00
2JZVA 1FKHA 1D7HA 3FAPA 1JNTA 4TX0A 4W9OA 3O5QA 1J4HA 2DG9A 5HW6A 4QT3A 4LAWA 2RUDA 3IKDA 4ODQA 2RUQA 2L2SA 2MLXA 2LGOA 4FN2A 2M08A 4LAXA 4ODLA 2DG4A 2PV1A 2XP7A 2ZQVA 3KAIA 3NI6A 2XPBA 4JFKA 4QT2A 2FAPA 4U86A 5HKGA 4ODPA 3O5EA 5J6EA 4ODOA 2LKNA 1M5YA 3LUOA 1KT0A 2XP5A 1BKFA 2XP8A 3CGMA 4FAPA 2PV3A 4W9QA 3NTPA 4LAYA 1FD9A 2XP9A 2ZR5A 5DITA 1FKBA 3O5MA 3O5IA 3IKGA 1KT1A 4JFLA 1A7XA 2KFWA 3VAWA 1JNSA 2ZQSA 3UQAA 1D7JA 2FKEA 2MF9A 3JXVA 3RGCA 4DZ3A 2LPVA 4QIBA 3TCZA 1Q6HA 2PPOA 1FKTA 5HUAA 1FKLA 3O5LA 1D7IA 3ODKA 1PINA 2PPPA 1NMWA 2Q5AA 3RFWA 5HWBA 5HTGA 3PRBA 1Q6UA 3O5OA 5DIUA 2PBCA 1L1PA 2ZR4A 2D9FA 4JFIA 4G50A 4U85A 4O2TA 4JFJA 3O5KA 4DT4A 1R9HA 4R0XA 3KAHA 3CGNA 4JYSA 1FKSA 4DRKA 4DRQA 1NSGA 4TW7A 4TW6A 1PBKA 1F8AB 4TW8A 3TC5A 2PPNA 2AWGA 2OFNA 4J4NA 4DZ2A 2DG3A 1Q1CA 3UQIA 1C9HA 1ZCNA 1FKGA 1FKFA 1FKKA 2UZ5A 3I6CA 4N19A 3TDBA 4MSPA 3O5FA 5D75A 2RURA 5GPGA 1J4RA 2MPHA 3O5DA 1ZK6A 4GGQA 2MNTA 2XP6A 3IK8A 4ODRA 2Y78A 4ODKA 5I98A 1NMVA 3KCEA 1TCOC 4IPXA 2VCDA 4DRJA 1F40A 1FJDA 2XPAA 5HT1A 2ZQUA 1JVWA 2XP4A 1ROTA 4ODMA 1B6CA 1YW5A 2M2AA 2MLZA 1Q6IA 2M1IA 4MGVA 1EQ3A 1EYMA 2KI3A 3O5JA 1U79A 1QPFA 3PRDA 3WH0A 2KR7A 4ODNA 2K8IA 3JYMA 4NNRA 4DRHA 4J4OA 3GPKA 1FKDA 5HW8A 2F2DA 4TYOA 3KACA 1J6YA 2MLYA 1D6OA 4BF8A 4LAVA 2N87A 3H9RB 2IF4A 3KABA 4DROA 1P5QA 4ITZA 4TNSA 1Y0OA 2RUCA 2ZQTA 3UI5A 1J4IA 1FKIA 1QZ2A 4G2PA 3KAFA 3UI6A 3UI4A 2F21A 3KADA 3KZ7A 4DH0A 1YATA 2VN1A 3B7XA 2RQSA 2XP3A 4DIPA 3EY6A 4JFMA 4C02B 1HXVA 1T11A 5HW7A 2PV2A 1FKRA 4GIVA 3OOBA 4U84A 4W9PA 5B8IC 3O5RA 4IQ2A 1QPLA 3NRKA 1BL4A 2ZR6A 3PA7A 4DRNA 3IHZA 5DIVA 4DRIA 4IQCA 3JYJA 1FKJA 3O5PA 2ITKA 1W26A 4DRPA 5HWCA 1FAPA 2KGJA 1ROUA 3O5GA 2KO7A 2LJ4A 3UQBA 1N1AA 2RSEA 3KAGA 5BXJA 2F4EA 3UF8A 4DRMA 3MDYB 2KE0A
chains in the Genus database with same CATH superfamily
1FKHA 1D7HA 3FAPA 3O5QA 1J4HA 4PTMA 3ARSA 3IKDA 4ODQA 2RUQA 1ZBCA 2MLXA 4LAXA 2M08A 2PV1A 3ARYA 1HJVA 4DWSD 5J6EA 3O5EA 2WM0A 4L72B 1M5YA 1D2KA 1BKFA 2DSZA 4W9QA 3O5MA 1E9LA 3WD4A 1HKIA 4WJXA 1JNSA 2ZQSA 2MF9A 1ZL1A 4URIA 4QIBA 2PPOA 2A3AA 1D7IA 3WL1A 2A3EA 1NH6A 5HTGA 3CH9A 1Q6UA 1WNOA 5DIUA 2ZR4A 4JFIA 1UR9A 3PR9A 4XAKA 3B8SA 4TW8A 4J4NA 4WIWA 2DG3A 4DWSC 1RD6A 1FKGA 1FKFA 3AS1A 3O5FA 1E44A 4MNMA 1NWSA 3WKZA 1ZK6A 4Z2HA 4ODKA 2XP6A 3EIPA 3ARTA 4IPXA 2ZQUA 1E6PA 3RM9A 1EQ3A 2G41A 2M1IA 1QPFA 1FFQA 2K8IA 5HBFA 3JYMA 4NNRA 5GQBA 4DRHA 1FKDA 5HW8A 4TYOA 3CHCA 4Z2LA 4BF8A 4Z2GA 3KABA 1GPFA 1J4IA 2B5UB 1W1TA 3KADA 3KZ7A 4DH0A 3WIJA 3ALGA 1W1PA 3EY6A 1W1VA 1BL4A 3G6LA 3IHZA 3ALFA 4IQCA 3JYJA 2ITKA 2KGJA 3CHDA 1K9TA 3O5GA 2LJ4A 2IUZA 2G8ZA 2RSEA 2DT0A 5HKGA 3RM4A 1OWQA 1JNTA 2DT2A 2DG9A 4LAWA 4WKAA 3ARZA 2AOSA 2LGOA 3KAIA 2ZQVA 4U86A 1CTNA 4MNKA 3RM8A 3LUOA 1UR8A 2XP8A 3PRAA 3ARRA 2ZR5A 3O5IA 2PI6A 1A7XA 2KFWA 4HBOA 4Z2JA 1H0IA 3AROA 3JXVA 4QZVB 2LPVA 3TCZA 1FKLA 2Q5AA 3OA5A 3ARWA 3O5OA 2DT3A 2D9FA 4MAVA 4G50A 4DT4A 1R9HA 4R0XA 1LL7A 1GOIA 4JYSA 3BMBA 1NSGA 2O92A 4NSBA 4TW6A 4FAPA 3TC5A 3B9AA 2AWGA 2OFNA 2UZ5A 4WKHA 3WD3A 1NWRA 2RURA 1J4RA 3FY1A 1GRJA 2YBTA 2Y78A 5I98A 1NMVA 2VCDA 1F40A 1SYTA 2XP4A 1EIBA 1B6CA 4LGXA 2M2AA 2KI3A 3O5JA 1U79A 3PRDA 4MPKA 2KR7A 4J4OA 3KACA 1D6OA 1HJWA 1P5QA 2OLHA 2RUCA 2DSVA 4G2PA 1QZ2A 1IX5A 5GPRA 5DEZA 3B7XA 2RQSA 2ETNA 1VF8A 4JFMA 1T11A 1FKRA 2A3CA 5B8IC 4KR0B 3NRKA 3PA7A 4DRNA 5DIVA 4DRIA 2WLZA 1ZU8A 2DPEA 2WLYA 1JNDA 1XHGA 3UQBA 1HKMA 5BXJA 2DSWA 4Z2IA 3MDYB 2DT1A 5HW6A 2L2SA 4ODLA 2DG4A 4ZPWR 4QT2A 3NI6A 4WK9A 4ML4A 4ODPA 1E6RA 2B31A 2LKNA 4MNLA 3CGMA 1O6IA 5DITA 1FKBA 3IKGA 1EDQA 1D7JA 3GTYX 3GU0A 1Q6HA 5HUAA 1NWTA 3O5LA 3FXYA 2PPPA 1NMWA 3RFWA 2DSUA 2O9OA 1H0GA 3PRBA 1L1PA 1OGGA 1EHNA 1NWUA 4JFJA 3AS2A 5DO2A 4DRKA 4DZ2A 1F8AB 2YBUA 3CHEA 1FKKA 1ZCNA 3CHFA 2P4VA 4N19A 3I6CA 1E15A 3TDBA 4MSPA 5D75A 3WQWA 2MPHA 2WK2A 1FFRA 3O5DA 3WD0A 4ODRA 1W9PA 3KCEA 1TCOC 4DRJA 5JH8A 4UDMA 1JVWA 4ODMA 1YW5A 1W1YA 1W9UA 1HJXA 3WD1A 4L3NA 3GPKA 1SR0A 2F2DA 1HKJA 2MLYA 4KQZA 3ARXA 4LAVA 2IF4A 4ZPTR 1Y0OA 3UI5A 4HARA 3AQUA 1FKIA 3KAFA 3BXWA 1YATA 4AY1A 1ZBKA 4P8UA 4ZPVR 4C02B 4DWSA 5HW7A 2PV2A 3OOBA 4NZCA 4U84A 3O5RA 1QPLA 2ZR6A 1ZBWA 4Q22A 3ARUA 3QOKA 3O5PA 1WB0A 4DRPA 5HWCA 1GUVA 1N1AA 2F4EA 3UF8A 4DRMA 2KE0A 1X6NA 2JZVA 4TX0A 4W9OA 5DF0A 2A3BA 4P8XA 2QF8A 1LL6A 1XRVA 4S3KA 4QT3A 1KFWA 2RUDA 3WL0A 1LG2A 1E6ZA 4FN2A 2XP7A 4JFKA 2XPBA 2FAPA 4Q7NA 4IT6A 4HBEA 4ODOA 1KT0A 1ZBVA 2XP5A 2PV3A 3NTPA 4LAYA 1FD9A 1OGBA 2XP9A 1KT1A 4JFLA 3VAWA 3UQAA 2FKEA 4DZ3A 3RGCA 1X6LA 1JCHB 1FKTA 2F23A 3ODKA 3W4RA 1PINA 5HWBA 1E6NA 2PBCA 4U85A 4O2TA 3O5KA 3KAHA 3CGNA 1FKSA 4DRQA 4TW7A 4WKFA 1PBKA 2PPNA 3AS3A 1Q1CA 1LJYA 3ARQA 3UQIA 1C9HA 1JNEA 4P8VA 1ITXA 4Z2KA 5GPGA 1ZB5A 4GGQA 2MNTA 3IK8A 1LL4A 3ARVA 1FJDA 3ARPA 2XPAA 5HT1A 4MTVA 1ROTA 2MLZA 1Q6IA 4MGVA 3CZ8A 4P8WA 4W5UA 1EYMA 4R5EA 3B9DA 4IT4A 3WH0A 4ODNA 4S3JA 1LG1A 4DWSB 1J6YA 1WAWA 1TFVA 3WQVA 2ESCA 2N87A 3H9RB 4DROA 1LQ0A 4ITZA 3G6MA 4TNSA 2ZQTA 2EULA 3UI6A 3UI4A 2F21A 3AS0A 2VN1A 2XP3A 4DIPA 1HXVA 3RMEA 4GIVA 4W9PA 4IQ2A 2FDMA 1W9VA 4MNJA 3B9EA 1FKJA 3WD2A 1W26A 2PN0A 1FAPA 1ROUA 2KO7A 3KAGA 1HKKA 4ZS6A
chains in the Genus database with same CATH topology
1FKHA 1D7HA 3FAPA 3O5QA 1J4HA 4PTMA 3ARSA 3IKDA 4ODQA 2RUQA 1ZBCA 2MLXA 4LAXA 2M08A 2PV1A 3ARYA 1HJVA 4DWSD 5J6EA 3O5EA 2WM0A 4L72B 1M5YA 1D2KA 1BKFA 2DSZA 4W9QA 3O5MA 1E9LA 3WD4A 1HKIA 4WJXA 1JNSA 2ZQSA 2MF9A 1ZL1A 4URIA 4QIBA 2PPOA 2A3AA 1D7IA 3WL1A 2A3EA 1NH6A 5HTGA 3CH9A 1Q6UA 1WNOA 5DIUA 2ZR4A 4JFIA 1UR9A 3PR9A 4XAKA 3B8SA 4TW8A 4J4NA 4WIWA 2DG3A 4DWSC 1RD6A 1FKGA 1FKFA 3AS1A 3O5FA 4MNMA 1NWSA 3WKZA 1ZK6A 4Z2HA 4ODKA 2XP6A 3ARTA 4IPXA 2ZQUA 1E6PA 3RM9A 1EQ3A 2G41A 2M1IA 1QPFA 1FFQA 2K8IA 5HBFA 3JYMA 4NNRA 5GQBA 4DRHA 1FKDA 5HW8A 4TYOA 3CHCA 4Z2LA 4BF8A 4Z2GA 3KABA 1GPFA 1J4IA 1W1TA 3KADA 3KZ7A 4DH0A 3WIJA 3ALGA 1W1PA 3EY6A 1W1VA 1BL4A 3G6LA 3IHZA 3ALFA 4IQCA 3JYJA 2ITKA 2KGJA 3CHDA 1K9TA 3O5GA 2LJ4A 2IUZA 2G8ZA 2RSEA 2DT0A 5HKGA 3RM4A 1OWQA 1JNTA 2DT2A 2DG9A 4LAWA 4WKAA 3ARZA 2AOSA 2LGOA 3KAIA 2ZQVA 4U86A 1CTNA 4MNKA 3RM8A 3LUOA 1UR8A 2XP8A 3PRAA 3ARRA 2ZR5A 3O5IA 2PI6A 1A7XA 2KFWA 4HBOA 4Z2JA 1H0IA 3AROA 3JXVA 4QZVB 2LPVA 3TCZA 1FKLA 2Q5AA 3OA5A 3ARWA 3O5OA 2DT3A 2D9FA 4MAVA 4G50A 4DT4A 1R9HA 4R0XA 1LL7A 1GOIA 4JYSA 1NSGA 2O92A 4NSBA 4TW6A 4FAPA 3TC5A 3B9AA 2AWGA 2OFNA 2UZ5A 4WKHA 3WD3A 1NWRA 2RURA 1J4RA 3FY1A 2YBTA 2Y78A 5I98A 1NMVA 2VCDA 1F40A 1SYTA 2XP4A 1EIBA 1B6CA 4LGXA 2M2AA 2KI3A 3O5JA 1U79A 3PRDA 4MPKA 2KR7A 4J4OA 3KACA 1D6OA 1HJWA 1P5QA 2OLHA 2RUCA 2DSVA 4G2PA 1QZ2A 1IX5A 5GPRA 5DEZA 3B7XA 2RQSA 1VF8A 4JFMA 1T11A 1FKRA 2A3CA 5B8IC 4KR0B 3NRKA 3PA7A 4DRNA 5DIVA 4DRIA 2WLZA 1ZU8A 2DPEA 2WLYA 1JNDA 1XHGA 3UQBA 1HKMA 5BXJA 2DSWA 4Z2IA 3MDYB 2DT1A 5HW6A 2L2SA 4ODLA 2DG4A 4ZPWR 4QT2A 3NI6A 4WK9A 4ML4A 4ODPA 1E6RA 2B31A 2LKNA 4MNLA 3CGMA 1O6IA 5DITA 1FKBA 3IKGA 1EDQA 1D7JA 1Q6HA 5HUAA 1NWTA 3O5LA 3FXYA 2PPPA 1NMWA 3RFWA 2DSUA 2O9OA 1H0GA 3PRBA 1L1PA 1OGGA 1EHNA 1NWUA 4JFJA 3AS2A 5DO2A 4DRKA 4DZ2A 1F8AB 2YBUA 3CHEA 1FKKA 1ZCNA 3CHFA 4N19A 3I6CA 1E15A 3TDBA 4MSPA 5D75A 3WQWA 2MPHA 2WK2A 1FFRA 3O5DA 3WD0A 4ODRA 1W9PA 3KCEA 1TCOC 4DRJA 5JH8A 1JVWA 4ODMA 1YW5A 1W1YA 1W9UA 1HJXA 3WD1A 4L3NA 3GPKA 1SR0A 2F2DA 1HKJA 2MLYA 4KQZA 3ARXA 4LAVA 2IF4A 4ZPTR 1Y0OA 3UI5A 4HARA 3AQUA 1FKIA 3KAFA 3BXWA 1YATA 4AY1A 1ZBKA 4P8UA 4ZPVR 4C02B 4DWSA 5HW7A 2PV2A 3OOBA 4NZCA 4U84A 3O5RA 1QPLA 2ZR6A 1ZBWA 4Q22A 3ARUA 3QOKA 3O5PA 1WB0A 4DRPA 5HWCA 1GUVA 1N1AA 2F4EA 3UF8A 4DRMA 2KE0A 1X6NA 2JZVA 4TX0A 4W9OA 5DF0A 2A3BA 4P8XA 2QF8A 1LL6A 1XRVA 4S3KA 4QT3A 1KFWA 2RUDA 3WL0A 1LG2A 1E6ZA 4FN2A 2XP7A 4JFKA 2XPBA 2FAPA 4Q7NA 4IT6A 4HBEA 4ODOA 1KT0A 1ZBVA 2XP5A 2PV3A 3NTPA 4LAYA 1FD9A 1OGBA 2XP9A 1KT1A 4JFLA 3VAWA 3UQAA 2FKEA 4DZ3A 3RGCA 1X6LA 1FKTA 3ODKA 3W4RA 1PINA 5HWBA 1E6NA 2PBCA 4U85A 4O2TA 3O5KA 3KAHA 3CGNA 1FKSA 4DRQA 4TW7A 4WKFA 1PBKA 2PPNA 3AS3A 1Q1CA 1LJYA 3ARQA 3UQIA 1C9HA 1JNEA 4P8VA 1ITXA 4Z2KA 5GPGA 1ZB5A 4GGQA 2MNTA 3IK8A 1LL4A 3ARVA 1FJDA 3ARPA 2XPAA 5HT1A 4MTVA 1ROTA 2MLZA 1Q6IA 4MGVA 3CZ8A 4P8WA 4W5UA 1EYMA 4R5EA 3B9DA 4IT4A 3WH0A 4ODNA 4S3JA 1LG1A 4DWSB 1J6YA 1WAWA 1TFVA 3WQVA 2ESCA 2N87A 3H9RB 4DROA 1LQ0A 4ITZA 3G6MA 4TNSA 2ZQTA 3UI6A 3UI4A 2F21A 3AS0A 2VN1A 2XP3A 4DIPA 1HXVA 3RMEA 4GIVA 4W9PA 4IQ2A 2FDMA 1W9VA 4MNJA 3B9EA 1FKJA 3WD2A 1W26A 1FAPA 1ROUA 2KO7A 3KAGA 1HKKA 4ZS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZV A;  1FKH A;  1D7H A;  3FAP A;  1JNT A;  4TX0 A;  4W9O A;  3O5Q A;  1J4H A;  2DG9 A;  5HW6 A;  4QT3 A;  4LAW A;  2RUD A;  3IKD A;  4ODQ A;  2RUQ A;  2L2S A;  2MLX A;  2LGO A;  4FN2 A;  2M08 A;  4LAX A;  4ODL A;  2DG4 A;  2PV1 A;  2XP7 A;  2ZQV A;  3KAI A;  3NI6 A;  2XPB A;  4JFK A;  4QT2 A;  2FAP A;  4U86 A;  5HKG A;  4ODP A;  3O5E A;  5J6E A;  4ODO A;  2LKN A;  1M5Y A;  3LUO A;  1KT0 A;  2XP5 A;  1BKF A;  2XP8 A;  3CGM A;  4FAP A;  2PV3 A;  4W9Q A;  3NTP A;  4LAY A;  1FD9 A;  2XP9 A;  2ZR5 A;  5DIT A;  1FKB A;  3O5M A;  3O5I A;  3IKG A;  1KT1 A;  4JFL A;  1A7X A;  2KFW A;  3VAW A;  1JNS A;  2ZQS A;  3UQA A;  1D7J A;  2FKE A;  2MF9 A;  3JXV A;  3RGC A;  4DZ3 A;  2LPV A;  4QIB A;  3TCZ A;  1Q6H A;  2PPO A;  1FKT A;  5HUA A;  1FKL A;  3O5L A;  1D7I A;  3ODK A;  1PIN A;  2PPP A;  1NMW A;  2Q5A A;  3RFW A;  5HWB A;  5HTG A;  3PRB A;  1Q6U A;  3O5O A;  5DIU A;  2PBC A;  1L1P A;  2ZR4 A;  2D9F A;  4JFI A;  4G50 A;  4U85 A;  4O2T A;  4JFJ A;  3O5K A;  4DT4 A;  1R9H A;  4R0X A;  3KAH A;  3CGN A;  4JYS A;  1FKS A;  4DRK A;  4DRQ A;  1NSG A;  4TW7 A;  4TW6 A;  1PBK A;  1F8A B;  4TW8 A;  3TC5 A;  2PPN A;  2AWG A;  2OFN A;  4J4N A;  4DZ2 A;  2DG3 A;  1Q1C A;  3UQI A;  1C9H A;  1ZCN A;  1FKG A;  1FKF A;  1FKK A;  2UZ5 A;  3I6C A;  4N19 A;  3TDB A;  4MSP A;  3O5F A;  5D75 A;  2RUR A;  5GPG A;  1J4R A;  2MPH A;  3O5D A;  1ZK6 A;  4GGQ A;  2MNT A;  2XP6 A;  3IK8 A;  4ODR A;  2Y78 A;  4ODK A;  5I98 A;  1NMV A;  3KCE A;  1TCO C;  4IPX A;  2VCD A;  4DRJ A;  1F40 A;  1FJD A;  2XPA A;  5HT1 A;  2ZQU A;  1JVW A;  2XP4 A;  1ROT A;  4ODM A;  1B6C A;  1YW5 A;  2M2A A;  2MLZ A;  1Q6I A;  2M1I A;  4MGV A;  1EQ3 A;  1EYM A;  2KI3 A;  3O5J A;  1U79 A;  1QPF A;  3PRD A;  3WH0 A;  2KR7 A;  4ODN A;  2K8I A;  3JYM A;  4NNR A;  4DRH A;  4J4O A;  3GPK A;  1FKD A;  5HW8 A;  2F2D A;  4TYO A;  3KAC A;  1J6Y A;  2MLY A;  1D6O A;  4BF8 A;  4LAV A;  2N87 A;  3H9R B;  2IF4 A;  3KAB A;  4DRO A;  1P5Q A;  4ITZ A;  4TNS A;  1Y0O A;  2RUC A;  2ZQT A;  3UI5 A;  1J4I A;  1FKI A;  1QZ2 A;  4G2P A;  3KAF A;  3UI6 A;  3UI4 A;  2F21 A;  3KAD A;  3KZ7 A;  4DH0 A;  1YAT A;  2VN1 A;  3B7X A;  2RQS A;  2XP3 A;  4DIP A;  3EY6 A;  4JFM A;  4C02 B;  1HXV A;  1T11 A;  5HW7 A;  2PV2 A;  1FKR A;  4GIV A;  3OOB A;  4U84 A;  4W9P A;  5B8I C;  3O5R A;  4IQ2 A;  1QPL A;  3NRK A;  1BL4 A;  2ZR6 A;  3PA7 A;  4DRN A;  3IHZ A;  5DIV A;  4DRI A;  4IQC A;  3JYJ A;  1FKJ A;  3O5P A;  2ITK A;  1W26 A;  4DRP A;  5HWC A;  1FAP A;  2KGJ A;  1ROU A;  3O5G A;  2KO7 A;  2LJ4 A;  3UQB A;  1N1A A;  2RSE A;  3KAG A;  5BXJ A;  2F4E A;  3UF8 A;  4DRM A;  3MDY B;  2KE0 A; 
#chains in the Genus database with same CATH topology
 1FKH A;  1D7H A;  3FAP A;  3O5Q A;  1J4H A;  4PTM A;  3ARS A;  3IKD A;  4ODQ A;  2RUQ A;  1ZBC A;  2MLX A;  4LAX A;  2M08 A;  2PV1 A;  3ARY A;  1HJV A;  4DWS D;  5J6E A;  3O5E A;  2WM0 A;  4L72 B;  1M5Y A;  1D2K A;  1BKF A;  2DSZ A;  4W9Q A;  3O5M A;  1E9L A;  3WD4 A;  1HKI A;  4WJX A;  1JNS A;  2ZQS A;  2MF9 A;  1ZL1 A;  4URI A;  4QIB A;  2PPO A;  2A3A A;  1D7I A;  3WL1 A;  2A3E A;  1NH6 A;  5HTG A;  3CH9 A;  1Q6U A;  1WNO A;  5DIU A;  2ZR4 A;  4JFI A;  1UR9 A;  3PR9 A;  4XAK A;  3B8S A;  4TW8 A;  4J4N A;  4WIW A;  2DG3 A;  4DWS C;  1RD6 A;  1FKG A;  1FKF A;  3AS1 A;  3O5F A;  1E44 A;  4MNM A;  1NWS A;  3WKZ A;  1ZK6 A;  4Z2H A;  4ODK A;  2XP6 A;  3EIP A;  3ART A;  4IPX A;  2ZQU A;  1E6P A;  3RM9 A;  1EQ3 A;  2G41 A;  2M1I A;  1QPF A;  1FFQ A;  2K8I A;  5HBF A;  3JYM A;  4NNR A;  5GQB A;  4DRH A;  1FKD A;  5HW8 A;  4TYO A;  3CHC A;  4Z2L A;  4BF8 A;  4Z2G A;  3KAB A;  1GPF A;  1J4I A;  2B5U B;  1W1T A;  3KAD A;  3KZ7 A;  4DH0 A;  3WIJ A;  3ALG A;  1W1P A;  3EY6 A;  1W1V A;  1BL4 A;  3G6L A;  3IHZ A;  3ALF A;  4IQC A;  3JYJ A;  2ITK A;  2KGJ A;  3CHD A;  1K9T A;  3O5G A;  2LJ4 A;  2IUZ A;  2G8Z A;  2RSE A;  2DT0 A;  5HKG A;  3RM4 A;  1OWQ A;  1JNT A;  2DT2 A;  2DG9 A;  4LAW A;  4WKA A;  3ARZ A;  2AOS A;  2LGO A;  3KAI A;  2ZQV A;  4U86 A;  1CTN A;  4MNK A;  3RM8 A;  3LUO A;  1UR8 A;  2XP8 A;  3PRA A;  3ARR A;  2ZR5 A;  3O5I A;  2PI6 A;  1A7X A;  2KFW A;  4HBO A;  4Z2J A;  1H0I A;  3ARO A;  3JXV A;  4QZV B;  2LPV A;  3TCZ A;  1FKL A;  2Q5A A;  3OA5 A;  3ARW A;  3O5O A;  2DT3 A;  2D9F A;  4MAV A;  4G50 A;  4DT4 A;  1R9H A;  4R0X A;  1LL7 A;  1GOI A;  4JYS A;  3BMB A;  1NSG A;  2O92 A;  4NSB A;  4TW6 A;  4FAP A;  3TC5 A;  3B9A A;  2AWG A;  2OFN A;  2UZ5 A;  4WKH A;  3WD3 A;  1NWR A;  2RUR A;  1J4R A;  3FY1 A;  1GRJ A;  2YBT A;  2Y78 A;  5I98 A;  1NMV A;  2VCD A;  1F40 A;  1SYT A;  2XP4 A;  1EIB A;  1B6C A;  4LGX A;  2M2A A;  2KI3 A;  3O5J A;  1U79 A;  3PRD A;  4MPK A;  2KR7 A;  4J4O A;  3KAC A;  1D6O A;  1HJW A;  1P5Q A;  2OLH A;  2RUC A;  2DSV A;  4G2P A;  1QZ2 A;  1IX5 A;  5GPR A;  5DEZ A;  3B7X A;  2RQS A;  2ETN A;  1VF8 A;  4JFM A;  1T11 A;  1FKR A;  2A3C A;  5B8I C;  4KR0 B;  3NRK A;  3PA7 A;  4DRN A;  5DIV A;  4DRI A;  2WLZ A;  1ZU8 A;  2DPE A;  2WLY A;  1JND A;  1XHG A;  3UQB A;  1HKM A;  5BXJ A;  2DSW A;  4Z2I A;  3MDY B;  2DT1 A;  5HW6 A;  2L2S A;  4ODL A;  2DG4 A;  4ZPW R;  4QT2 A;  3NI6 A;  4WK9 A;  4ML4 A;  4ODP A;  1E6R A;  2B31 A;  2LKN A;  4MNL A;  3CGM A;  1O6I A;  5DIT A;  1FKB A;  3IKG A;  1EDQ A;  1D7J A;  3GTY X;  3GU0 A;  1Q6H A;  5HUA A;  1NWT A;  3O5L A;  3FXY A;  2PPP A;  1NMW A;  3RFW A;  2DSU A;  2O9O A;  1H0G A;  3PRB A;  1L1P A;  1OGG A;  1EHN A;  1NWU A;  4JFJ A;  3AS2 A;  5DO2 A;  4DRK A;  4DZ2 A;  1F8A B;  2YBU A;  3CHE A;  1FKK A;  1ZCN A;  3CHF A;  2P4V A;  4N19 A;  3I6C A;  1E15 A;  3TDB A;  4MSP A;  5D75 A;  3WQW A;  2MPH A;  2WK2 A;  1FFR A;  3O5D A;  3WD0 A;  4ODR A;  1W9P A;  3KCE A;  1TCO C;  4DRJ A;  5JH8 A;  4UDM A;  1JVW A;  4ODM A;  1YW5 A;  1W1Y A;  1W9U A;  1HJX A;  3WD1 A;  4L3N A;  3GPK A;  1SR0 A;  2F2D A;  1HKJ A;  2MLY A;  4KQZ A;  3ARX A;  4LAV A;  2IF4 A;  4ZPT R;  1Y0O A;  3UI5 A;  4HAR A;  3AQU A;  1FKI A;  3KAF A;  3BXW A;  1YAT A;  4AY1 A;  1ZBK A;  4P8U A;  4ZPV R;  4C02 B;  4DWS A;  5HW7 A;  2PV2 A;  3OOB A;  4NZC A;  4U84 A;  3O5R A;  1QPL A;  2ZR6 A;  1ZBW A;  4Q22 A;  3ARU A;  3QOK A;  3O5P A;  1WB0 A;  4DRP A;  5HWC A;  1GUV A;  1N1A A;  2F4E A;  3UF8 A;  4DRM A;  2KE0 A;  1X6N A;  2JZV A;  4TX0 A;  4W9O A;  5DF0 A;  2A3B A;  4P8X A;  2QF8 A;  1LL6 A;  1XRV A;  4S3K A;  4QT3 A;  1KFW A;  2RUD A;  3WL0 A;  1LG2 A;  1E6Z A;  4FN2 A;  2XP7 A;  4JFK A;  2XPB A;  2FAP A;  4Q7N A;  4IT6 A;  4HBE A;  4ODO A;  1KT0 A;  1ZBV A;  2XP5 A;  2PV3 A;  3NTP A;  4LAY A;  1FD9 A;  1OGB A;  2XP9 A;  1KT1 A;  4JFL A;  3VAW A;  3UQA A;  2FKE A;  4DZ3 A;  3RGC A;  1X6L A;  1JCH B;  1FKT A;  2F23 A;  3ODK A;  3W4R A;  1PIN A;  5HWB A;  1E6N A;  2PBC A;  4U85 A;  4O2T A;  3O5K A;  3KAH A;  3CGN A;  1FKS A;  4DRQ A;  4TW7 A;  4WKF A;  1PBK A;  2PPN A;  3AS3 A;  1Q1C A;  1LJY A;  3ARQ A;  3UQI A;  1C9H A;  1JNE A;  4P8V A;  1ITX A;  4Z2K A;  5GPG A;  1ZB5 A;  4GGQ A;  2MNT A;  3IK8 A;  1LL4 A;  3ARV A;  1FJD A;  3ARP A;  2XPA A;  5HT1 A;  4MTV A;  1ROT A;  2MLZ A;  1Q6I A;  4MGV A;  3CZ8 A;  4P8W A;  4W5U A;  1EYM A;  4R5E A;  3B9D A;  4IT4 A;  3WH0 A;  4ODN A;  4S3J A;  1LG1 A;  4DWS B;  1J6Y A;  1WAW A;  1TFV A;  3WQV A;  2ESC A;  2N87 A;  3H9R B;  4DRO A;  1LQ0 A;  4ITZ A;  3G6M A;  4TNS A;  2ZQT A;  2EUL A;  3UI6 A;  3UI4 A;  2F21 A;  3AS0 A;  2VN1 A;  2XP3 A;  4DIP A;  1HXV A;  3RME A;  4GIV A;  4W9P A;  4IQ2 A;  2FDM A;  1W9V A;  4MNJ A;  3B9E A;  1FKJ A;  3WD2 A;  1W26 A;  2PN0 A;  1FAP A;  1ROU A;  2KO7 A;  3KAG A;  1HKK A;  4ZS6 A; 
#chains in the Genus database with same CATH homology
 1FKH A;  1D7H A;  3FAP A;  3O5Q A;  1J4H A;  4PTM A;  3ARS A;  3IKD A;  4ODQ A;  2RUQ A;  1ZBC A;  2MLX A;  4LAX A;  2M08 A;  2PV1 A;  3ARY A;  1HJV A;  4DWS D;  5J6E A;  3O5E A;  2WM0 A;  4L72 B;  1M5Y A;  1D2K A;  1BKF A;  2DSZ A;  4W9Q A;  3O5M A;  1E9L A;  3WD4 A;  1HKI A;  4WJX A;  1JNS A;  2ZQS A;  2MF9 A;  1ZL1 A;  4URI A;  4QIB A;  2PPO A;  2A3A A;  1D7I A;  3WL1 A;  2A3E A;  1NH6 A;  5HTG A;  3CH9 A;  1Q6U A;  1WNO A;  5DIU A;  2ZR4 A;  4JFI A;  1UR9 A;  3PR9 A;  4XAK A;  3B8S A;  4TW8 A;  4J4N A;  4WIW A;  2DG3 A;  4DWS C;  1RD6 A;  1FKG A;  1FKF A;  3AS1 A;  3O5F A;  4MNM A;  1NWS A;  3WKZ A;  1ZK6 A;  4Z2H A;  4ODK A;  2XP6 A;  3ART A;  4IPX A;  2ZQU A;  1E6P A;  3RM9 A;  1EQ3 A;  2G41 A;  2M1I A;  1QPF A;  1FFQ A;  2K8I A;  5HBF A;  3JYM A;  4NNR A;  5GQB A;  4DRH A;  1FKD A;  5HW8 A;  4TYO A;  3CHC A;  4Z2L A;  4BF8 A;  4Z2G A;  3KAB A;  1GPF A;  1J4I A;  1W1T A;  3KAD A;  3KZ7 A;  4DH0 A;  3WIJ A;  3ALG A;  1W1P A;  3EY6 A;  1W1V A;  1BL4 A;  3G6L A;  3IHZ A;  3ALF A;  4IQC A;  3JYJ A;  2ITK A;  2KGJ A;  3CHD A;  1K9T A;  3O5G A;  2LJ4 A;  2IUZ A;  2G8Z A;  2RSE A;  2DT0 A;  5HKG A;  3RM4 A;  1OWQ A;  1JNT A;  2DT2 A;  2DG9 A;  4LAW A;  4WKA A;  3ARZ A;  2AOS A;  2LGO A;  3KAI A;  2ZQV A;  4U86 A;  1CTN A;  4MNK A;  3RM8 A;  3LUO A;  1UR8 A;  2XP8 A;  3PRA A;  3ARR A;  2ZR5 A;  3O5I A;  2PI6 A;  1A7X A;  2KFW A;  4HBO A;  4Z2J A;  1H0I A;  3ARO A;  3JXV A;  4QZV B;  2LPV A;  3TCZ A;  1FKL A;  2Q5A A;  3OA5 A;  3ARW A;  3O5O A;  2DT3 A;  2D9F A;  4MAV A;  4G50 A;  4DT4 A;  1R9H A;  4R0X A;  1LL7 A;  1GOI A;  4JYS A;  1NSG A;  2O92 A;  4NSB A;  4TW6 A;  4FAP A;  3TC5 A;  3B9A A;  2AWG A;  2OFN A;  2UZ5 A;  4WKH A;  3WD3 A;  1NWR A;  2RUR A;  1J4R A;  3FY1 A;  2YBT A;  2Y78 A;  5I98 A;  1NMV A;  2VCD A;  1F40 A;  1SYT A;  2XP4 A;  1EIB A;  1B6C A;  4LGX A;  2M2A A;  2KI3 A;  3O5J A;  1U79 A;  3PRD A;  4MPK A;  2KR7 A;  4J4O A;  3KAC A;  1D6O A;  1HJW A;  1P5Q A;  2OLH A;  2RUC A;  2DSV A;  4G2P A;  1QZ2 A;  1IX5 A;  5GPR A;  5DEZ A;  3B7X A;  2RQS A;  1VF8 A;  4JFM A;  1T11 A;  1FKR A;  2A3C A;  5B8I C;  4KR0 B;  3NRK A;  3PA7 A;  4DRN A;  5DIV A;  4DRI A;  2WLZ A;  1ZU8 A;  2DPE A;  2WLY A;  1JND A;  1XHG A;  3UQB A;  1HKM A;  5BXJ A;  2DSW A;  4Z2I A;  3MDY B;  2DT1 A;  5HW6 A;  2L2S A;  4ODL A;  2DG4 A;  4ZPW R;  4QT2 A;  3NI6 A;  4WK9 A;  4ML4 A;  4ODP A;  1E6R A;  2B31 A;  2LKN A;  4MNL A;  3CGM A;  1O6I A;  5DIT A;  1FKB A;  3IKG A;  1EDQ A;  1D7J A;  1Q6H A;  5HUA A;  1NWT A;  3O5L A;  3FXY A;  2PPP A;  1NMW A;  3RFW A;  2DSU A;  2O9O A;  1H0G A;  3PRB A;  1L1P A;  1OGG A;  1EHN A;  1NWU A;  4JFJ A;  3AS2 A;  5DO2 A;  4DRK A;  4DZ2 A;  1F8A B;  2YBU A;  3CHE A;  1FKK A;  1ZCN A;  3CHF A;  4N19 A;  3I6C A;  1E15 A;  3TDB A;  4MSP A;  5D75 A;  3WQW A;  2MPH A;  2WK2 A;  1FFR A;  3O5D A;  3WD0 A;  4ODR A;  1W9P A;  3KCE A;  1TCO C;  4DRJ A;  5JH8 A;  1JVW A;  4ODM A;  1YW5 A;  1W1Y A;  1W9U A;  1HJX A;  3WD1 A;  4L3N A;  3GPK A;  1SR0 A;  2F2D A;  1HKJ A;  2MLY A;  4KQZ A;  3ARX A;  4LAV A;  2IF4 A;  4ZPT R;  1Y0O A;  3UI5 A;  4HAR A;  3AQU A;  1FKI A;  3KAF A;  3BXW A;  1YAT A;  4AY1 A;  1ZBK A;  4P8U A;  4ZPV R;  4C02 B;  4DWS A;  5HW7 A;  2PV2 A;  3OOB A;  4NZC A;  4U84 A;  3O5R A;  1QPL A;  2ZR6 A;  1ZBW A;  4Q22 A;  3ARU A;  3QOK A;  3O5P A;  1WB0 A;  4DRP A;  5HWC A;  1GUV A;  1N1A A;  2F4E A;  3UF8 A;  4DRM A;  2KE0 A;  1X6N A;  2JZV A;  4TX0 A;  4W9O A;  5DF0 A;  2A3B A;  4P8X A;  2QF8 A;  1LL6 A;  1XRV A;  4S3K A;  4QT3 A;  1KFW A;  2RUD A;  3WL0 A;  1LG2 A;  1E6Z A;  4FN2 A;  2XP7 A;  4JFK A;  2XPB A;  2FAP A;  4Q7N A;  4IT6 A;  4HBE A;  4ODO A;  1KT0 A;  1ZBV A;  2XP5 A;  2PV3 A;  3NTP A;  4LAY A;  1FD9 A;  1OGB A;  2XP9 A;  1KT1 A;  4JFL A;  3VAW A;  3UQA A;  2FKE A;  4DZ3 A;  3RGC A;  1X6L A;  1FKT A;  3ODK A;  3W4R A;  1PIN A;  5HWB A;  1E6N A;  2PBC A;  4U85 A;  4O2T A;  3O5K A;  3KAH A;  3CGN A;  1FKS A;  4DRQ A;  4TW7 A;  4WKF A;  1PBK A;  2PPN A;  3AS3 A;  1Q1C A;  1LJY A;  3ARQ A;  3UQI A;  1C9H A;  1JNE A;  4P8V A;  1ITX A;  4Z2K A;  5GPG A;  1ZB5 A;  4GGQ A;  2MNT A;  3IK8 A;  1LL4 A;  3ARV A;  1FJD A;  3ARP A;  2XPA A;  5HT1 A;  4MTV A;  1ROT A;  2MLZ A;  1Q6I A;  4MGV A;  3CZ8 A;  4P8W A;  4W5U A;  1EYM A;  4R5E A;  3B9D A;  4IT4 A;  3WH0 A;  4ODN A;  4S3J A;  1LG1 A;  4DWS B;  1J6Y A;  1WAW A;  1TFV A;  3WQV A;  2ESC A;  2N87 A;  3H9R B;  4DRO A;  1LQ0 A;  4ITZ A;  3G6M A;  4TNS A;  2ZQT A;  3UI6 A;  3UI4 A;  2F21 A;  3AS0 A;  2VN1 A;  2XP3 A;  4DIP A;  1HXV A;  3RME A;  4GIV A;  4W9P A;  4IQ2 A;  2FDM A;  1W9V A;  4MNJ A;  3B9E A;  1FKJ A;  3WD2 A;  1W26 A;  1FAP A;  1ROU A;  2KO7 A;  3KAG A;  1HKK A;  4ZS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...