1R9QA

Structure analysis of prox in complex with proline betaine
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
309
structure length
309
Chain Sequence
ADLPGKGITVNPVQSTITEETFQTLLVSRALEKLGYTVNKPSEVDYNVGYTSLASGDATFTAVNWTPLHDNMYEAAGGDKKFYREGVFVNGAAQGYLIDKKTADQYKITNIAQLKDPKIAKLFDTNGDGKADLTGCNPGWGCEGAINHQLAAYELTNTVTHNQGNYAAMMADTISRYKEGKPVFYYTWTPYWVSNELKPGKDVVWLQVPFSALPGDKNADTKLPNGANYGFPVSTMHIVANKAWAEKNPAAAKLFAIMQLPVADINAQNAIMHDGKASEGDIQGHVDGWIKAHQQQFDGWVNEALAAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine betaine-binding periplasmic protein
publication title Cation-pi Interactions as Determinants for Binding of the Compatible Solutes Glycine Betaine and Proline Betaine by the Periplasmic Ligand-binding Protein ProX from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 112
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2003-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1r9qA01
3.40.190.100 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Glycine betaine-binding periplasmic protein; domain 2 1r9qA02
2ZXTA 4E0WA 3M3FA 4HS7A 3R26A 3KGCA 3G3HA 4LP2B 1JQFA 2Z23A 5H8QB 3R7XA 1A40A 4P0IA 3EQ1A 2I0CA 3MVYA 4ND9A 1CE2A 2V84A 1ZKBA 3VLUA 4XXUA 2O69A 5CMKA 1B4ZA 3LR1A 4LATA 3D4GA 1GTKA 2PT1A 4F3GA 1I6BA 3E13X 1N76A 4G2ZA 3ZKLA 3VVEA 1AL3A 1B7ZA 3EHTA 1AMFA 4IO5A 4KYEA 1MY2A 3RTFB 5H8FB 1XC1A 3RTWB 4I1DA 3EHUA 3KSJA 3IB2A 1L5TA 1O7TA 1Y1MA 2V25A 3CFLA 2ZYKA 3RNNA 5KDTB 3A09A 3S9EA 4XKRA 3GZGA 1B3HA 2GRVA 4IO2A 5H8QA 2KLFA 3OO7A 2Q8JA 1D4NA 1J1NA 4GLIA 3K1MA 1PB7A 3K00A 3L6GA 3T96B 3S4UA 1QKAA 2O7UA 4F2OA 2LAOA 3UP9A 1DTZA 3GXAA 4KR5A 3PD9A 2DWAA 4ELRA 2I3VA 3TMGA 4YMAA 1TWYA 3T22A 1A99A 1POY1 4MFIA 5H8FA 2OCUA 4QFNA 2ABHA 5DT6A 1FTLA 3AXFA 1P1UA 3QYTA 4TQUQ 1BIYA 4R74A 1MH3A 1Y20A 4RNSA 2QS1A 3Q29A 3VV5A 2RINA 5KDTA 5AA1A 4PQJA 1B9JA 2AL5A 1R6ZA 5ICTA 3LC8A 2BJJX 1MY3A 2XXUA 1LB9A 3MP8A 4OETA 2Q88A 3B6WA 4DLDA 1P1WA 4FECA 3WAFA 1EZOA 4KQPA 1O64A 1D3KA 5CC2A 2DOJA 4X9TA 1AIVA 4F31B 3MZBA 1FQAA 3E3KA 1AOVA 3SKPA 1EH3A 4QFKA 1US5A 4ZEDA 2QMXA 4YZZA 4IY6A 1IIWA 3U94A 3MPLA 1EZPA 4FIMA 2ALUA 3O6HA 3LSLA 4H8IA 4KPTA 1YTVA 3O6GA 2GFEA 5CBSA 2B3BA 1B0HA 1IITA 3V89B 3LBSA 3HV1A 1LCTA 3OOAA 4QSDA 2YJPA 4X48A 3F11A 4ZZEA 2RC9A 4OESA 4NWCA 5L9SA 1S50A 3KOTA 2I0BA 2RKMA 1GV8A 5CMCA 4EQ9A 3O9PA 1US4A 2VD2A 1URDA 2Y7KA 2DE2A 3U93A 3MUQA 4QSCA 3OD7A 3PUVE 5AA4B 3OXNA 4R2BA 4EXLA 2O7IA 4YB5A 3N94A 4LQ5A 2QJEA 1PC3A 2DSFA 4P0GA 2XXTA 2Z8EA 3S9MC 4F18A 1QVSA 5IAIA 3TTKA 4GRKA 3TTLA 1IXCA 5DVIA 1I6AA 5TP9B 4Q8RA 2Y7RA 3KZGA 5FHNA 2H5YA 2VP1A 2Z22A 5CM6A 1SDXA 1H3DA 1Y3PA 4DCXA 1MS7A 4OEUA 3GBAA 4YKIA 3QIMA 4K3FA 4OENA 2OLBA 4IO7A 1SBPA 3G3IA 1XOCA 3BFUA 5AA4A 2FYIA 1B7HA 4DZ1A 2GH9A 1IXGA 1FQBA 3GBBA 1ELJA 3MW0A 1B5JA 1NKXA 1BKAA 1MM6A 4X1BA 3KSXA 2Y84A 4ZS9A 3K6XA 1POTA 2X7QA 3KJTA 5BUUA 5TP9A 1H43A 1S9TA 4YKPA 3TCGA 1MY1A 1B1HA 2Y7WA 4G8NA 2THIA 4Q30B 4EQBA 3UN6A 3OSQA 1M5BA 3TTNA 1Z7NE 2P2AA 5TPAB 4HW8A 2VHAA 5CBRA 4U21A 3TTMA 1IXIA 3MZ1A 1DOTA 4Z0IA 2UVGA 1JW4A 3CG3A 4EDPA 2D3IA 1FQFA 3IORA 2QS2A 4GIZA 2PMSA 1VR5A 1MXVA 4RPNA 2O1LA 5DVFA 1Y1ZA 3FV2A 4YICA 3MJNA 1M5FA 1SW5A 3FXQA 2DS9A 3TCHA 1B58A 2XX8A 1VE4A 4H5FA 3TEPA 1B3EA 5I59B 3L6HA 3T66A 4FATA 2A5TB 4RY1A 5CMBA 4TLMB 2UYFA 4DCYA 2PX1A 1Y4CA 2DYXA 2HXWA 4O3CA 3T9UA 2F7CA 5TPAA 4IO3A 4BDMA 5ELVA 4RJZA 1B5HA 3C33A 2GHAA 5HBCA 3IB0A 3IO6A 2F6GA 4QFPA 4BDRA 4H8JA 4TLLB 1B7UA 3IAZA 2I4BA 2OK2A 4KYSA 3KJ7A 4U1ZA 4G68B 4JXIA 4ONYA 1MXZA 2DQVA 4H1XA 1N7WA 3FXRA 4E0XA 2DXYA 3PV0E 1B3LA 5M2VA 1N7XA 4DXUA 4YKKA 1H44A 3TKDA 3LSFB 5I59A 3T9HB 1MXUA 2A5TA 3IOTA 3TYHA 4YMBA 2H4IA 3RN8A 4ECFA 4PFUA 4KCDA 4H67A 1MH4A 3CFXA 3U8QA 2DWJA 3G3FA 3V5AA 3UIFA 1OLCA 2XD2A 1MQDA 3RT6B 4FE8A 5B70A 5HM4B 3C36A 4IY5A 3RY3A 4OFLA 2W7YA 4FJPA 3H7MA 3MZ9A 4JBZA 4G68A 1NNKA 4RK9A 5KCJB 4EXKA 2G29A 2YPNA 4XKPA 4LQ2A 3MVZA 1MPCA 3OO8A 2PBWA 2RCBA 3BKIB 5I58B 1A8FA 1B5IA 4FAJA 4YU0A 3H4ZA 2Z8FA 3PUYE 4QFLA 1IXHA 3KN8A 2PT2A 1ATGA 5L8DA 2DWHA 3VVDA 3I3VA 2O1MA 3RUMA 2DVCA 4PFTA 3MVXA 4MH5A 4R6KA 3H6VA 4R9GA 3BFTA 3K2DA 3DELB 4OXVA 2I3WA 3CFZA 1NNPA 1B32A 4AQ4A 5KCJA 4NE4A 3BBRA 4POWA 4ZEKA 1GGGA 3TUSA 1ZTYA 3UA8A 4JSDA 1TXFA 3CRBA 3OENA 1P99A 3OELA 4QFOA 1SI0A 5I58A 2RC8A 1MQJA 3THIA 2ZNTA 3PMVA 1R1NA 1XS5A 2UVHA 1YCJA 1IZ1A 4ELPA 2NVUB 1P1OA 4XKNA 3PPQA 1BLFA 4PFWA 1ANFA 3U72A 3K1NA 4ZE8A 1WODA 3VLVA 4MBPA 3SETA 3I6VA 4KYDA 1HSEA 3WAEA 3FATA 3IO4A 4MLQA 2E0SA 4R2FA 2R9JA 2F78A 2OBGA 2HZLA 4G8HA 1FTJA 4JDFA 1AH5A 3VLWA 1JEUA 5LOMA 1TT1A 3CVGA 4LA9A 4PE5B 4FEDA 1LBBA 1EU8A 1NNFA 1UIUA 1SVXB 4F39A 2AIXA 1B51A 4OYVA 1PB8A 2NOOA 1WDNA 1LFGA 5JTYB 1FQCA 3RQTA 3C31A 4G4PA 4F29A 2F6PA 1A55A 1B40A 3TTRA 1N0TA 2X7PA 1JNFA 4Z7EA 2XXXA 1VFEA 4F3PA 3RLFE 1Y9UA 4OQOA 3TODA 5DYHA 3O97A 2O6AA 1OQGA 4I9DA 3O2AA 1SD3A 4LZ5A 3SEYA 1MXYA 1NNTA 3M3KA 5I84A 3KN3A 4L17A 5A5XB 4ZZAA 3R6UA 3B6TA 5ICQA 3FGSA 1IQ7A 1NH8A 3VXBA 5JTYA 2IEEA 3IOUA 3EF7A 4GL8A 1OLAA 1MXWA 3VDFA 4BDQA 2D5WA 3M8UA 4KD5A 2ZNSA 4O3BA 4MF3A 4F22A 3PGFA 1RYOA 4XKQA 2DVZA 1NMUA 1MQIA 4AB5A 3TELA 4G68C 4U4XA 1VSOA 4ZDMA 4O3AA 1Q1KA 1MRPA 1MDQA 2PVUA 4HCWA 3KG2A 3Q27A 2RCAA 1SYIA 3CSGA 4NF6B 1FW0A 1JVXA 1Y4TA 3A3CA 3FD3A 4ESXA 3K6VA 5A5XA 4NWDA 2Q2AA 3OSRA 3JV9A 3N6TA 4OHNA 4GXAA 2XHDA 2Z8DA 3PPNA 1EZ9A 2E1SA 4BDOA 2DXRA 3KEIA 4OTEA 1T0KA 4PFYA 4LZ8A 3W15C 3SEWA 4FORA 1B46A 2FA7A 1B0LA 3G3GA 5FTHA 1BTJA 1USYH 3N26A 4F3SA 3OMBA 2I49A 3T93B 2HCAA 3G3KA 3PUZE 3ILTB 4EF2A 2CMOA 1LAGE 3IJOB 3SDFA 4NMYA 1USYE 4OEVA 1QKBA 1D9YA 2ONKE 4NTLA 3SERA 3RGYA 3MAMA 4NF6A 3DP6A 3TZAA 5I56B 1LLSA 1P1NA 3TCFA 1Y3QA 3G3JA 1GR2A 1ZMGA 4JWXA 1QJMA 4LVQA 3SESA 4ELOA 4Q5TA 4EUOA 3KFMA 4F1YA 3S9NC 2AL4A 1UTHB 4DDDA 4NF8B 3P7IA 2B65A 4NF4B 4ZE9A 1LBCA 1DPPA 2I48A 4BDLA 4KHZE 3LUYA 5ITPA 4U22A 4UA8A 3UORA 1MXXA 4OERA 4F19A 3QAXA 3UGWA 1LB8A 2V3QA 3HHFA 1B1XA 2REJA 4F1UA 1XHYA 3MBPA 1LAHE 2XXWA 4NF5B 5I56A 2RF1A 1RKMA 4HTGA 5K2YA 1I6QA 3K1PA 3TAJA 3O6IA 1SI1A 2Q89A 1BP5A 2ZYMA 3IB1A 3I5OA 4MLVA 3M3LA 5EYFA 1UTHA 2Q2CA 4NF8A 4ISUA 4R6HA 1B3FA 3IL1B 4NF4A 1QW0A 1NL5A 4KI0E 1B4HA 5CMMA 3G7WA 4FEBA 3MWBA 3CR9A 1QUIA 4EQ7A 1IUDA 2H25A 1FQEA 3KN7A 2OWTA 3ILUB 3H03A 4OZ9A 2F36A 3IOWA 1RYXA 4NF5A 3H6TA 3GLBA 4IGRA 5H8HB 3U92A 2B3FA 1TFAA 2A5SA 4R6YA 2X26A 4JB7A 4IB2A 3ECRA 5AA2D 1DPEA 4ZEIA 3HN0A 5CI5A 1LSTA 5L9MA 2ESNA 3HHGA 1DTGA 2QS4A 3ONMA 4LUBA 4HCYA 4JWYA 5AA2B 4WKMA 4YB6A 2XXVA 3OO6A 1S7YA 1Q35A 4ZEBA 3SEXA 1FTMA 2F7BA 2HZKA 2XD3A 4XTCQ 1ZJLA 2F34A 3TQWA 4LONB 1DMBA 2V3UA 3FV1A 2I4CA 4JSOA 1H76A 4EF1A 2FNCA 1A8EA 1OVTA 1JEVA 5H8HA 1DSNA 2I6EA 4IGTA 4G8MA 2ZYNA 1LAXA 1OVBA 1ZIUA 4N6PA 4TOZA 1N04A 3RPWA 2VGQA 5H8SA 3MC2A 2P0SA 4JWOA 2REGA 3U1OA 1NFTA 1F9BA 1UQWA 4N13A 5DVJA 3C34A 2OZZA 3QSLA 1Z7ME 5AA2A 2GHBA 3FVKA 4YB7A 4R73A 2XXRA 4RXLA 5B7DA 1YPNA 5K2XA 2O51A 3FASA 3DP4A 3EHSA 3B7DA 3IX1A 4BDNA 4OFJA 3TPAA 5AE4A 4R9FA 1N3WA 2QMWA 3S2VA 1PBPA 2ZNUA 5H8NB 4G77A 2F7AA 5I2NB 1TFDA 5L9OA 4C0RA 2QRYA 5ITOA 1B2HA 1MM7A 3JZJA 1JVYA 1QUJA 2XX9A 4RYAA 4YKJA 1H45A 2ZYOA 3QUFA 1MQHA 3FZVA 3S9LC 1B52A 1URSA 4M1VA 2QPQA 3UK4A 3C32A 1UIVA 1D9VA 5DEXB 2UVIA 3LSXA 3V83A 1JETA 4RK2A 3FJGA 3CG1A 2ONRA 5H8NA 5HPQA 4N07A 3TQLA 2F8DA 5I2NA 1II5A 4PETA 1SW2A 2UYEA 4R72A 2VOZA 3FJ7A 4RPOA 3FXUA 5I2KB 3QXMA 3PPPA 3FJMA 2QS3A 4GXSB 4IO4A 3ZS6A 2VD3A 4C1UA 3FIRA 2Y7PA 4BLAA 5CRYA 2R71A 4GL0A 4QF9A 1FQDA 1M5EA 4RA1A 2H9BA 3DP8A 2PYYA 4OWDA 1P1QA 2R6GE 4PP0A 4NEDA 1Y3NA 5DEXA 2M8CA 4GFRA 4DIGA 4X1DA 3A3UA 4H0WA 4WEDA 2V3TA 1UTBB 3IJXB 3PPRA 3O29A 3H06B 4P11A 2XXIA 1KWHA 3B6QA 4KFQA 3K6UA 1JW5A 5I2KA 1YAEA 1A54A 1OQHA 3T9XB 5FTIA 5EHSA 5JEIA 1LAFE 3OEMA 1JW1A 4IO6A 1VFDA 3MP1A 3TDJA 1SW4A 2AYSA 2XXHA 2NWJA 3W9VA 1O63A 1M5DA 3HO7A 2DWIA 5KZTA 2DP8A 1WVJA 1N84A 1SYHA 3PU5A 4UACA 5JK4A 2F35A 5FHOA 3RT8A 2UXAA 3K4UA 4ESWA 4LZ7A 2O68A 4POXA 1FTOA 3PUWE 2OJTA 1A7LA 4DXCA 3MP6A 4KCCA 1UTBA 2HAVA 3Q25A 1B05A 3OEKA 2F97A 4ZEFA 2IA4A 1B3GA 5FHMA 3IOVA 2XXYA 4H6DA 4F3BA 3VE1B 3EPEA 1PB9A 1QULA 3VVFA 4YAHX 4H5GA 3H6UA 3PUXE 2WKYA 5ISUA 4OVJA 2P1SA 1B6HA 2Y7IA 1OIBA 3K01A 3JYRA 2ONSA 3CIJA 2HQ0A 1HSLA 2RC7A 2O84X 1MQGA 5AA3A 4U4SA 4Q0CA 2D21A 4QHQA 5F1QA 3HSTA 1FTKA 1MPDA 3KBRA 3CI8A 1XVYA 1IEJA 4F2QA 3TFLA 3FVNA 5EHMA 2XXPA 3FVGA 3QK6A 3MQ9A 1NH7A 1PDAA 3OO9A 1QUKA 2YLNA 3K6WA 4DXBA 5DTBA 4OFOA 1ZBMA 1XVXA 3O66A 3D4CA 3H3GA 4GF8A 3KOSA 1GVCA 3N5LA 1M5CA 3ZKKA 3VXCA 1PBQA 3C9HA 4ZECA 3USDA 2ZMBA 4U1OA 2HAUA 1LCFA 2QL3A 1MDP1 1MPBA 4DE8A 3O28A 5I57B 5IKBA 3SEUA 3MPKA 3IR1A 3HCQA 3N6UA 2HEUA 3IK6B 3VFJA 4WEPA 4I62A 1MG1A 3SEVA 2NUVA 3Q26A 4I8CA 1MY0A 3ZSFA 4GWOA 4C1TA 2V93A 1I69A 3PMWA 4H65A 4U23A 1HSJA 4XIGQ 5F7VA 2DE3A 2H98A 3CSBA 3DLNA 3HPIA 3LSWA 1LFIA 2HFBA 5TU0A 4QRZA 4M4GA 2I58A 4F1VA 4OMBA 1LFHA 3W9WA 3PPOA 4U2RA 4AB6A 1PEBA 1ZU0A 2DE4A 2Q9TA 5I57A 3QUJA 1SW1A 3E4RA 1FCKA 1ZLQA 2ANJA 3EN3A 3T9VA 3C4MA 2G93A 4GD5A 4GVOA 3MVWA 2XXQA 3PD8A 2UVJA 3E9XA 1N3XA 4R75A 3Q28A 3FVOA 5J1DA 3DM0A 4THIA 5BWJA 2NXOA 3C35A 2F5XA 4QSEA 1OMPA 1CB6A 3K02A 2OWSA 3H6WA 3FUZA 4GOTA 3V8XB 2QSXA 1XT8A 2CZLA 2H99A 1MY4A 1SQYA 2XX7A 1URGA 3ODBA 4ELQA 1R9QA 1LGBC 1R9LA 4WXJA 3PMXA 3K0VA 4GQOA
chains in the Genus database with same CATH superfamily
1BK4A 2ZXTA 4E0WA 3M3FA 4HS7A 2BJIA 3R26A 3KGCA 5ET5A 3G3HA 4LP2B 1JQFA 2Z23A 5H8QB 3R7XA 1A40A 4P0IA 4PGPA 2CEXA 3EQ1A 5J16A 2I0CA 3MVYA 4XF5A 4ND9A 1CE2A 2V84A 1ZKBA 4FBPA 4PE3A 3VLUA 4XXUA 2O69A 4N6KA 4O7IA 5CMKA 1B4ZA 3LR1A 4LATA 3D4GA 1GTKA 2PT1A 4F3GA 1I6BA 3E13X 1NV2A 1N76A 4G2ZA 3ZKLA 3VVEA 1YYZA 1AL3A 1B7ZA 3EHTA 1AMFA 4IO5A 1K9ZA 4KYEA 1MY2A 3RTFB 5H8FB 3NOHA 1XC1A 3RTWB 4I1DA 3EHUA 3KSJA 3IB2A 1L5TA 1O7TA 1Y1MA 2V25A 3CFLA 2ZYKA 3RNNA 5KDTB 3A09A 5EYHA 1EYKA 2QVRA 3S9EA 4XKRA 1FBEA 3GZGA 1B3HA 2GRVA 4IO2A 5H8QA 2KLFA 3OO7A 1LEVA 2Q8JA 1D4NA 1J1NA 2FBPA 2WX9A 4GLIA 3K1MA 1PB7A 3K00A 3L6GA 3T96B 3S4UA 1QKAA 2OX3A 2O7UA 4F2OA 2LAOA 3UP9A 1DTZA 3GXAA 1NI9A 4KR5A 3PD9A 2DWAA 4ELRA 2Y5KA 2I3VA 2HHMA 3TMGA 4YMAA 1TWYA 3T22A 1A99A 1POY1 4MFIA 5H8FA 2OCUA 4X04A 1FBFA 1NUWA 4QFNA 2ABHA 5DT6A 1FTLA 3AXFA 1P1UA 3QYTA 4TQUQ 1BIYA 4R74A 1MH3A 1Y20A 4RNSA 2QS1A 4PAKA 3Q29A 3VV5A 3B8BA 2RINA 5KDTA 5AA1A 5ET7A 4PQJA 1B9JA 4GBVA 2AL5A 1R6ZA 5ICTA 2WBBA 3LC8A 2BJJX 1MY3A 2XXUA 1LB9A 3MP8A 4OETA 2Q88A 3B6WA 4DLDA 1P1WA 4FECA 3WAFA 1EZOA 4O8MA 2KR0A 4KQPA 1O64A 1D3KA 5CC2A 2DOJA 2QVUA 4IR8A 4X9TA 1AIVA 4F31B 3MZBA 1FQAA 3E3KA 1AOVA 3SKPA 1EH3A 4PF6A 4QFKA 1US5A 4N8GA 4ZEDA 2QMXA 4P9KA 4YZZA 4IY6A 1IIWA 3U94A 3MPLA 1EZPA 4FIMA 2ALUA 4UABA 3O6HA 3LSLA 4H8IA 1EYIA 4KPTA 1YTVA 3O6GA 2GFEA 4GWZA 5CBSA 2B3BA 1IITA 1B0HA 3V89B 3LBSA 3HV1A 1LCTA 1Q9DA 3OOAA 4QSDA 2YJPA 4X48A 3F11A 4ZZEA 2CZKA 2RC9A 4OESA 4NWCA 5L9SA 1S50A 3KOTA 2QVVA 2I0BA 2RKMA 1GV8A 5CMCA 4EQ9A 3O9PA 2F3BA 1US4A 2VD2A 1URDA 2Y7KA 1NUZA 2DE2A 5EQ8A 3U93A 4H46A 3MUQA 4QSCA 4NHBA 3OD7A 3PUVE 5AA4B 3OXNA 4R2BA 4EXLA 2O7IA 4YB5A 1NV0A 3N94A 4LQ5A 2QJEA 2WYPA 1PC3A 4PFIA 2DSFA 4P0GA 2XXTA 2Z8EA 3S9MC 4F18A 1QVSA 5IAIA 5LTCA 3TTKA 3PTYA 4GRKA 3TTLA 1IXCA 5DVIA 1I6AA 5TP9B 4Q8RA 2Y7RA 3KZGA 3B50A 5FHNA 2H5YA 2VP1A 2Z22A 5CM6A 1SDXA 1H3DA 4PAFA 1Y3PA 4DCXA 1MS7A 3MYUA 5EQ9A 4OEUA 3GBAA 5T3JA 4YKIA 3QIMA 4K3FA 4OENA 2OLBA 4IO7A 3EKIA 1SBPA 3G3IA 1XOCA 3BFUA 5AA4A 2FYIA 1B7HA 4NQ8A 4DZ1A 2GH9A 1IXGA 1FQBA 3GBBA 1ELJA 3MW0A 1B5JA 1NKXA 1BKAA 4N8YA 1MM6A 4X1BA 1FJ9A 5EQAA 3KSXA 2Y84A 4ZS9A 3K6XA 1POTA 2X7QA 3KJTA 5BUUA 5TP9A 1H43A 2QFLA 1S9TA 4YKPA 4NN3A 3TCGA 1MY1A 1B1HA 2Y7WA 4G8NA 4NAPA 2THIA 4Q30B 4EQBA 3UN6A 3OSQA 1M5BA 3TTNA 1Z7NE 2P2AA 2PFZA 5TPAB 4HW8A 2VHAA 5I5PA 5CBRA 4U21A 1KZ8A 3TTMA 1IXIA 3MZ1A 4O94A 1DOTA 1D9QA 4Z0IA 2UVGA 4GX6A 1JW4A 3CG3A 4EDPA 2D3IA 1FQFA 3D1RA 3IORA 2QS2A 4GIZA 2PMSA 1VR5A 1MXVA 1FPKA 4RPNA 2O1LA 5DVFA 1Y1ZA 3FV2A 4YICA 3MJNA 1M5FA 1SW5A 3FXQA 2DS9A 3TCHA 1B58A 2XX8A 1VE4A 4H5FA 3TEPA 1B3EA 5I59B 3L6HA 3T66A 4FATA 2A5TB 4RY1A 5CMBA 4TLMB 2UYFA 4DCYA 1G0IA 2PX1A 1Y4CA 2DYXA 1JP4A 2HXWA 3T1BA 4O3CA 3T9UA 2F7CA 5TPAA 4PTKA 4IO3A 4BDMA 5ELVA 4RJZA 1B5HA 3C33A 2GHAA 5HBCA 1DK4A 3IB0A 1AWBA 3CHGA 3IO6A 2F6GA 4QFPA 4BDRA 4H8JA 4TLLB 1B7UA 4GX3A 3IAZA 2I4BA 2OK2A 4KYSA 3KJ7A 2CZHA 4MJOA 4U1ZA 4G68B 4JXIA 4ONYA 4H45A 1MXZA 2DQVA 4H1XA 1N7WA 1EYJA 1LBZA 3FXRA 4E0XA 2DXYA 1IMEA 3PV0E 1B3LA 5M2VA 1N7XA 4PDHA 4DXUA 4YKKA 1H44A 3TKDA 3LSFB 5I59A 1RDZA 3T9HB 1MXUA 2A5TA 3IOTA 3TYHA 4YMBA 2H4IA 3RN8A 4ECFA 2WBDA 4PFUA 5IZ1A 4KCDA 4H67A 1MH4A 3CFXA 3U8QA 2DWJA 3G3FA 3V5AA 3UIFA 1OLCA 4MNIA 2XD2A 1MQDA 3RT6B 4FE8A 5B70A 5HM4B 3C36A 4IY5A 3RY3A 4OFLA 2W7YA 4FJPA 3H7MA 3MZ9A 4JBZA 4G68A 1NNKA 4RK9A 5KCJB 4EXKA 4OVTA 2G29A 2YPNA 4XKPA 4LQ2A 4GWUA 3MVZA 4PCDA 1MPCA 3OO8A 2CEYA 2XWIA 2PBWA 2RCBA 3BKIB 5I58B 1A8FA 1B5IA 4FAJA 4YU0A 4N91A 2FIXA 3H4ZA 2Z8FA 3PUYE 4QFLA 1IXHA 1NV1A 3IFAA 3FBPA 3KN8A 2PT2A 1ATGA 5L8DA 1VDWA 2VT5A 2DWHA 3VVDA 4NX1A 3I3VA 2O1MA 3RUMA 2DVCA 4PFTA 3MVXA 4MH5A 4R6KA 3H6VA 4R9GA 3BFTA 3K2DA 3DELB 3ISPA 4OXVA 2I3WA 2WYKA 3CFZA 1NNPA 1B32A 4AQ4A 5KCJA 4HXVA 4NE4A 3BBRA 4POWA 4ZEKA 1GGGA 3TUSA 5IGAA 1ZTYA 3UA8A 4JSDA 1TXFA 3CRBA 3OENA 1P99A 3OELA 4QFOA 1SI0A 4XFEA 5I58A 2RC8A 1MQJA 3THIA 1KA1A 2ZNTA 3PMVA 3E79A 5I7IA 1R1NA 1XS5A 2UVHA 1YCJA 1IZ1A 4ELPA 2NVUB 1P1OA 4GWSA 4XKNA 3PPQA 1BLFA 4PFWA 1ANFA 3U72A 3K1NA 4JVCA 4ZE8A 4QBAA 1WODA 3VLVA 4MBPA 3SETA 3I6VA 4KYDA 1HSEA 3WAEA 3FATA 3IO4A 4MLQA 2E0SA 4R2FA 2R9JA 2F78A 2OBGA 2HZLA 2FHYA 4G8HA 1FTJA 4P1EA 4JDFA 4PBQA 1AH5A 3VLWA 1JEUA 5LOMA 1TT1A 3CVGA 4LA9A 4PE5B 4FEDA 1LBBA 2VPNA 1EU8A 1NNFA 1UIUA 1SVXB 4F39A 1IMCA 2AIXA 1B51A 1FPGA 4OYVA 1PB8A 2NOOA 1NUYA 1WDNA 1LFGA 1IMDA 5JTYB 5IZZA 1FQCA 4MNPA 3RQTA 3C31A 4G4PA 4F29A 3FXBA 4P56A 2V4CA 2F6PA 1A55A 3E78A 1B40A 3TTRA 1N0TA 2X7PA 1JNFA 4Z7EA 4MAGA 2XXXA 1VFEA 4F3PA 2ZZVA 3RLFE 1Y9UA 4OQOA 3TODA 5DYHA 3O97A 2O6AA 1OQGA 4I9DA 3O2AA 1SD3A 4LZ5A 5ESYA 4PDDA 3SEYA 1MXYA 1NNTA 3M3KA 5I84A 3KN3A 4L17A 4KXPA 5A5XB 4ZZAA 4GBWA 3R6UA 3B6TA 5ICQA 4I3YA 3FGSA 1IQ7A 1FBGA 1NH8A 1FPEA 3VXBA 5JTYA 2IEEA 3IOUA 3RYDA 2KQZA 3EF7A 4GL8A 1OLAA 2L5VA 1MXWA 3VDFA 3BIGA 4BDQA 1XI6A 2D5WA 3M8UA 4KD5A 2ZNSA 4O3BA 1NV3A 4MF3A 4I3EA 4F22A 3PGFA 1RYOA 4XKQA 2DVZA 1NMUA 1MQIA 4AB5A 3TELA 4G68C 4U4XA 1VSOA 4ZDMA 4O3AA 1Q1KA 1MRPA 1MDQA 2PVUA 5EQ7A 4HCWA 3KG2A 3Q27A 1FBPA 2XWOA 1RDYA 2RCAA 4PF8A 1SYIA 3CSGA 4NF6B 1FW0A 1JVXA 1Y4TA 3A3CA 3FD3A 4ESXA 2Q74A 3K6VA 5A5XA 4NWDA 2Q2AA 3OSRA 3JV9A 3N6TA 4OHNA 2CZIA 5I3SA 4GXAA 2XHDA 2Z8DA 3PPNA 1EZ9A 2E1SA 4BDOA 2DXRA 3KEIA 4OTEA 1T0KA 1G0HA 4PFYA 4LZ8A 3W15C 3SEWA 4FORA 1B46A 3KC1A 4HE1A 2FA7A 1B0LA 3G3GA 5FTHA 1NUXA 3GYYA 1BTJA 4GX4A 4MX6A 1USYH 3N26A 4F3SA 1YZ0A 5ET8A 3OMBA 3KBZA 2I49A 3T93B 4PGNA 2HCAA 5A5LA 3G3KA 3PUZE 3ILTB 3T0JA 4EF2A 2CMOA 1LAGE 3IJOB 3SDFA 4NMYA 1USYE 4OEVA 1QKBA 1D9YA 1FJ6A 2ONKE 4NTLA 3SERA 3SZPA 3RGYA 3MAMA 4NF6A 3DP6A 3TZAA 1NV4A 5I56B 1LLSA 1P1NA 2DDKA 3TCFA 1Y3QA 3G3JA 1GR2A 1ZMGA 4JWXA 1QJMA 4LVQA 3SESA 4ELOA 4Q5TA 4EUOA 3KFMA 4F1YA 3S9NC 2AL4A 1UTHB 4DDDA 4NF8B 3P7IA 2B65A 4N4UA 4NF4B 4ZE9A 1LBCA 1DPPA 2I48A 4BDLA 4KHZE 2Q8MA 3LUYA 2ZZXA 5ITPA 3HFUA 1FBDA 4U22A 4UA8A 5IM2A 3UORA 2HPGA 1MXXA 4OVPA 4I40A 4OERA 4F19A 3QAXA 3UGWA 1LB8A 2V3QA 3HHFA 1B1XA 3MSTA 2REJA 4F1UA 1XHYA 3MBPA 1LAHE 2XXWA 4NF5B 1FTAA 5I56A 2RF1A 1RKMA 4JVIA 4HTGA 5K2YA 4PFBA 1I6QA 3K1PA 4GWYA 3TAJA 2XWVA 3O6IA 1SI1A 2Q89A 1BP5A 2ZYMA 1FPDA 3IB1A 3I5OA 1LBWA 4MLVA 3M3LA 5EYFA 1UTHA 2Q2CA 4NF8A 1RDXA 4ISUA 1SPIA 4R6HA 1B3FA 3IL1B 4NF4A 2PCRA 1QW0A 1NL5A 4KI0E 1B4HA 5CMMA 2B4LA 3G7WA 4FEBA 3MWBA 4OVSA 1NV5A 3CR9A 4MEVA 1QUIA 4EQ7A 2P3VA 1IUDA 2H25A 1FQEA 3KN7A 2OWTA 3ILUB 3H03A 4OZ9A 2F36A 4NF5A 1RYXA 3IOWA 1KA0A 3H6TA 3GLBA 4IGRA 2JJKA 5H8HB 3U92A 2B3FA 1TFAA 2A5SA 4R6YA 2X26A 4JB7A 4IB2A 3ECRA 5AA2D 1DPEA 4ZEIA 3HN0A 5CI5A 1LSTA 5L9MA 2ESNA 3HHGA 1DTGA 2QS4A 3ONMA 5F24A 4OVRA 4LUBA 4HCYA 1DBZA 4JWYA 5AA2B 5LDZA 4WKMA 4YB6A 2XXVA 3OO6A 1S7YA 1Q35A 4ZEBA 3SEXA 4DI3D 3LV0A 1FTMA 2F7BA 2HZKA 2XD3A 4XTCQ 1ZJLA 2F34A 4AS4A 3TQWA 4LONB 1DMBA 1IMAA 1FPJA 2V3UA 3FV1A 2I4CA 4JSOA 4P47A 1H76A 4EF1A 2FNCA 1A8EA 1OVTA 4N17A 1JEVA 5H8HA 4DI4B 1DSNA 2I6EA 4IGTA 4G8MA 2ZYNA 1LAXA 1OVBA 3RPLB 1ZIUA 4N6PA 4TOZA 1N04A 4QXDA 3RPWA 2VGQA 5H8SA 3MC2A 2P0SA 4JWOA 2REGA 4X8RA 3U1OA 1NFTA 1F9BA 1UQWA 4N13A 5DVJA 3A29A 2OZZA 3C34A 3QSLA 1Z7ME 5AA2A 2GHBA 1LBXA 3FVKA 4YB7A 4R73A 2XXRA 4RXLA 5B7DA 1FPIA 4MHFA 1YPNA 5K2XA 2O51A 1FPFA 3FASA 3DP4A 3EHSA 3B7DA 3IX1A 2PFYA 4BDNA 4NF0A 1NV7A 4OFJA 4PBHA 3TPAA 5AE4A 4R9FA 1N3WA 2QMWA 3S2VA 1PBPA 2ZNUA 5H8NB 1IMBA 4G77A 2F7AA 4GWWA 5I2NB 1TFDA 5L9OA 4C0RA 2QRYA 5ITOA 1B2HA 1FSAA 1MM7A 3JZJA 1JVYA 1QUJA 1NV6A 2XX9A 3RPLA 4RYAA 4YKJA 4PFRA 1H45A 4OA4A 2ZYOA 3QUFA 4N6DA 4MMPA 2B4MA 2WEFA 1MQHA 3FZVA 3S9LC 1B52A 1URSA 4M1VA 2QPQA 3UK4A 1IMFA 3C32A 1UIVA 4MCOA 1D9VA 5DEXB 4P8BA 2UVIA 3LSXA 3V83A 1FPLA 1JETA 4RK2A 3FJGA 3CG1A 2ONRA 5H8NA 5HPQA 4N07A 3TQLA 2F8DA 5I2NA 1II5A 4PETA 1SW2A 2UYEA 4R72A 2VOZA 3FJ7A 4RPOA 3FXUA 5I2KB 3QXMA 3PPPA 3FJMA 2QS3A 4GXSB 2VPOA 1YXIA 4IO4A 3ZS6A 2VD3A 4C1UA 3FIRA 2Y7PA 4BLAA 4P3LA 5CRYA 2R71A 4GL0A 4QF9A 1FQDA 1M5EA 4NGUA 4RA1A 2H9BA 4OVQA 3DP8A 2PYYA 4OWDA 4MIJA 1P1QA 2R6GE 4PP0A 4NEDA 2FVZA 1Y3NA 5DEXA 4GFRA 2M8CA 4X1DA 4DIGA 3A3UA 4H0WA 4WEDA 1INPA 2V3TA 1UTBB 3IJXB 3PPRA 3O29A 3H06B 4P11A 2XXIA 1KWHA 3B6QA 4KFQA 3K6UA 4NG7A 1JW5A 3BIHA 5I2KA 1YAEA 1A54A 1OQHA 3T9XB 5FTIA 5EHSA 5JEIA 1LAFE 3OEMA 1JW1A 4IO6A 1VFDA 3MP1A 1FRPA 3TDJA 1SW4A 2AYSA 4HE2A 2XXHA 4JVDA 2NWJA 1QGXA 3W9VA 1O63A 1M5DA 3HO7A 2DWIA 5KZTA 2DP8A 1WVJA 1FBHA 1N84A 1SYHA 3PU5A 3U65A 4UACA 5JK4A 2F35A 2XA5A 5FHOA 3RT8A 2UXAA 3K4UA 4ESWA 4LZ7A 2O68A 4POXA 1FTOA 3PUWE 2OJTA 1A7LA 4DXCA 3MP6A 4KCCA 5ET6A 1UTBA 2HAVA 3Q25A 1B05A 3OEKA 2F97A 4ZEFA 2IA4A 1B3GA 5FHMA 3IOVA 2XXYA 4H6DA 4F3BA 3VE1B 3EPEA 1PB9A 1QULA 4PAIA 3VVFA 2FIEA 4YAHX 4H5GA 3H6UA 3PUXE 2WKYA 5ISUA 4OVJA 2P1SA 1B6HA 2XXKA 2Y7IA 1OIBA 2ZZWA 3K01A 3JYRA 2ONSA 3CIJA 2HQ0A 1HSLA 2RC7A 2O84X 1MQGA 5AA3A 2MKZA 3ROJA 2Y5LA 4U4SA 4Q0CA 2D21A 4QHQA 5F1QA 3HSTA 1FTKA 1MPDA 3KBRA 3CI8A 1K9YA 1XVYA 1IEJA 4F2QA 3TFLA 3FVNA 5EHMA 2XXPA 3FVGA 3QK6A 3MQ9A 1NH7A 1PDAA 3OO9A 1QUKA 2YLNA 3K6WA 4OANA 4DXBA 5DTBA 4OFOA 1ZBMA 1XVXA 3O66A 3D4CA 3H3GA 4GF8A 3KOSA 1GVCA 3N5LA 1LBVA 4GWXA 1M5CA 4N15A 3ZKKA 3VXCA 1PBQA 3C9HA 2R8TA 4ZECA 3USDA 4N81A 4MNCA 2ZMBA 4U1OA 2HAUA 1LCFA 2QL3A 1MDP1 1MPBA 1CNQA 4DE8A 3O28A 5I57B 2P3NA 4PC9A 5IKBA 3SEUA 3MPKA 3IR1A 3HCQA 3N6UA 2HEUA 5FBPA 3IK6B 3VFJA 5IZ3B 4WEPA 4I62A 1MG1A 3SEVA 2NUVA 3Q26A 4AS5A 4LN5A 4I8CA 1MY0A 3ZSFA 4GWOA 4C1TA 2V93A 1I69A 3PMWA 4H65A 4U23A 1HSJA 4XIGQ 5F7VA 2DE3A 2H98A 3CSBA 3DLNA 3QMFA 3HPIA 3LSWA 4O7MA 1LFIA 2HFBA 5TU0A 4QRZA 1FPBA 1LBYA 4M4GA 2I58A 4F1VA 4OMBA 1LFHA 3W9WA 3PPOA 4U2RA 5EYGA 4AB6A 1PEBA 2GQ1A 1ZU0A 2OWZA 2DE4A 2Q9TA 3KC0A 2XWKA 5I57A 3QUJA 1SW1A 3E4RA 1FCKA 4HE0A 1ZLQA 2ANJA 3EN3A 3T9VA 3C4MA 2G93A 4GD5A 4P1LA 4GVOA 3MVWA 2XXQA 3PD8A 1FBCA 2UVJA 4G61A 3E9XA 1N3XA 4XEQA 2F3DA 4R75A 3Q28A 3FVOA 5IZ3A 5J1DA 3DM0A 4THIA 5BWJA 2NXOA 3C35A 3IFCA 2HXRA 2F5XA 4QSEA 1OMPA 1CB6A 3K02A 2OWSA 3H6WA 3FUZA 4GOTA 3V8XB 2QSXA 1XT8A 2CZLA 2H99A 5DW8A 1MY4A 1SQYA 2XX7A 1URGA 3LUZA 3ODBA 4ELQA 1R9QA 1LGBC 1R9LA 4WXJA 3PMXA 1DCUA 3K0VA 4GQOA
chains in the Genus database with same CATH topology
2ZXTA 4E0WA 3M3FA 4HS7A 3R26A 3KGCA 3G3HA 4LP2B 1JQFA 2Z23A 5H8QB 3R7XA 1A40A 4P0IA 3EQ1A 2I0CA 3MVYA 4ND9A 1CE2A 2V84A 1ZKBA 3VLUA 4XXUA 2O69A 5CMKA 1B4ZA 3LR1A 4LATA 3D4GA 1GTKA 2PT1A 4F3GA 1I6BA 3E13X 1N76A 4G2ZA 3ZKLA 3VVEA 1AL3A 1B7ZA 3EHTA 1AMFA 4IO5A 4KYEA 1MY2A 3RTFB 5H8FB 1XC1A 3RTWB 4I1DA 3EHUA 3KSJA 3IB2A 1L5TA 1O7TA 1Y1MA 2V25A 3CFLA 2ZYKA 3RNNA 5KDTB 3A09A 3S9EA 4XKRA 3GZGA 1B3HA 2GRVA 4IO2A 5H8QA 2KLFA 3OO7A 2Q8JA 1D4NA 1J1NA 4GLIA 3K1MA 1PB7A 3K00A 3L6GA 3T96B 3S4UA 1QKAA 2O7UA 4F2OA 2LAOA 3UP9A 1DTZA 3GXAA 4KR5A 3PD9A 2DWAA 4ELRA 2I3VA 3TMGA 4YMAA 1TWYA 3T22A 1A99A 1POY1 4MFIA 5H8FA 2OCUA 4QFNA 2ABHA 5DT6A 1FTLA 3AXFA 1P1UA 3QYTA 4TQUQ 1BIYA 4R74A 1MH3A 1Y20A 4RNSA 2QS1A 3Q29A 3VV5A 2RINA 5KDTA 5AA1A 4PQJA 1B9JA 2AL5A 1R6ZA 5ICTA 3LC8A 2BJJX 1MY3A 2XXUA 1LB9A 3MP8A 4OETA 2Q88A 3B6WA 4DLDA 1P1WA 4FECA 3WAFA 1EZOA 4KQPA 1O64A 1D3KA 5CC2A 2DOJA 4X9TA 1AIVA 4F31B 3MZBA 1FQAA 3E3KA 1AOVA 3SKPA 1EH3A 4QFKA 1US5A 4ZEDA 2QMXA 4YZZA 4IY6A 1IIWA 3U94A 3MPLA 1EZPA 4FIMA 2ALUA 3O6HA 3LSLA 4H8IA 4KPTA 1YTVA 3O6GA 2GFEA 5CBSA 2B3BA 1B0HA 1IITA 3V89B 3LBSA 3HV1A 1LCTA 3OOAA 4QSDA 2YJPA 4X48A 3F11A 4ZZEA 2RC9A 4OESA 4NWCA 5L9SA 1S50A 3KOTA 2I0BA 2RKMA 1GV8A 5CMCA 4EQ9A 3O9PA 1US4A 2VD2A 1URDA 2Y7KA 2DE2A 3U93A 3MUQA 4QSCA 3OD7A 3PUVE 5AA4B 3OXNA 4R2BA 4EXLA 2O7IA 4YB5A 3N94A 4LQ5A 2QJEA 1PC3A 2DSFA 4P0GA 2XXTA 2Z8EA 3S9MC 4F18A 1QVSA 5IAIA 3TTKA 4GRKA 3TTLA 1IXCA 5DVIA 1I6AA 5TP9B 4Q8RA 2Y7RA 3KZGA 5FHNA 2H5YA 2VP1A 2Z22A 5CM6A 1SDXA 1H3DA 1Y3PA 4DCXA 1MS7A 4OEUA 3GBAA 4YKIA 3QIMA 4K3FA 4OENA 2OLBA 4IO7A 1SBPA 3G3IA 1XOCA 3BFUA 5AA4A 2FYIA 1B7HA 4DZ1A 2GH9A 1IXGA 1FQBA 3GBBA 1ELJA 3MW0A 1B5JA 1NKXA 1BKAA 1MM6A 4X1BA 3KSXA 2Y84A 4ZS9A 3K6XA 1POTA 2X7QA 3KJTA 5BUUA 5TP9A 1H43A 1S9TA 4YKPA 3TCGA 1MY1A 1B1HA 2Y7WA 4G8NA 2THIA 4Q30B 4EQBA 3UN6A 3OSQA 1M5BA 3TTNA 1Z7NE 2P2AA 5TPAB 4HW8A 2VHAA 5CBRA 4U21A 3TTMA 1IXIA 3MZ1A 1DOTA 4Z0IA 2UVGA 1JW4A 3CG3A 4EDPA 2D3IA 1FQFA 3IORA 2QS2A 4GIZA 2PMSA 1VR5A 1MXVA 4RPNA 2O1LA 5DVFA 1Y1ZA 3FV2A 4YICA 3MJNA 1M5FA 1SW5A 3FXQA 2DS9A 3TCHA 1B58A 2XX8A 1VE4A 4H5FA 3TEPA 1B3EA 5I59B 3L6HA 3T66A 4FATA 2A5TB 4RY1A 5CMBA 4TLMB 2UYFA 4DCYA 2PX1A 1Y4CA 2DYXA 2HXWA 4O3CA 3T9UA 2F7CA 5TPAA 4IO3A 4BDMA 5ELVA 4RJZA 1B5HA 3C33A 2GHAA 5HBCA 3IB0A 3IO6A 2F6GA 4QFPA 4BDRA 4H8JA 4TLLB 1B7UA 3IAZA 2I4BA 2OK2A 4KYSA 3KJ7A 4U1ZA 4G68B 4JXIA 4ONYA 1MXZA 2DQVA 4H1XA 1N7WA 3FXRA 4E0XA 2DXYA 3PV0E 1B3LA 5M2VA 1N7XA 4DXUA 4YKKA 1H44A 3TKDA 3LSFB 5I59A 3T9HB 1MXUA 2A5TA 3IOTA 3TYHA 4YMBA 2H4IA 3RN8A 4ECFA 4PFUA 4KCDA 4H67A 1MH4A 3CFXA 3U8QA 2DWJA 3G3FA 3V5AA 3UIFA 1OLCA 2XD2A 1MQDA 3RT6B 4FE8A 5B70A 5HM4B 3C36A 4IY5A 3RY3A 4OFLA 2W7YA 4FJPA 3H7MA 3MZ9A 4JBZA 4G68A 1NNKA 4RK9A 5KCJB 4EXKA 2G29A 2YPNA 4XKPA 4LQ2A 3MVZA 1MPCA 3OO8A 2PBWA 2RCBA 3BKIB 5I58B 1A8FA 1B5IA 4FAJA 4YU0A 3H4ZA 2Z8FA 3PUYE 4QFLA 1IXHA 3KN8A 2PT2A 1ATGA 5L8DA 2DWHA 3VVDA 3I3VA 2O1MA 3RUMA 2DVCA 4PFTA 3MVXA 4MH5A 4R6KA 3H6VA 4R9GA 3BFTA 3K2DA 3DELB 4OXVA 2I3WA 3CFZA 1NNPA 1B32A 4AQ4A 5KCJA 4NE4A 3BBRA 4POWA 4ZEKA 1GGGA 3TUSA 1ZTYA 3UA8A 4JSDA 1TXFA 3CRBA 3OENA 1P99A 3OELA 4QFOA 1SI0A 5I58A 2RC8A 1MQJA 3THIA 2ZNTA 3PMVA 1R1NA 1XS5A 2UVHA 1YCJA 1IZ1A 4ELPA 2NVUB 1P1OA 4XKNA 3PPQA 1BLFA 4PFWA 1ANFA 3U72A 3K1NA 4ZE8A 1WODA 3VLVA 4MBPA 3SETA 3I6VA 4KYDA 1HSEA 3WAEA 3FATA 3IO4A 4MLQA 2E0SA 4R2FA 2R9JA 2F78A 2OBGA 2HZLA 4G8HA 1FTJA 4JDFA 1AH5A 3VLWA 1JEUA 5LOMA 1TT1A 3CVGA 4LA9A 4PE5B 4FEDA 1LBBA 1EU8A 1NNFA 1UIUA 1SVXB 4F39A 2AIXA 1B51A 4OYVA 1PB8A 2NOOA 1WDNA 1LFGA 5JTYB 1FQCA 3RQTA 3C31A 4G4PA 4F29A 2F6PA 1A55A 1B40A 3TTRA 1N0TA 2X7PA 1JNFA 4Z7EA 2XXXA 1VFEA 4F3PA 3RLFE 1Y9UA 4OQOA 3TODA 5DYHA 3O97A 2O6AA 1OQGA 4I9DA 3O2AA 1SD3A 4LZ5A 3SEYA 1MXYA 1NNTA 3M3KA 5I84A 3KN3A 4L17A 5A5XB 4ZZAA 3R6UA 3B6TA 5ICQA 3FGSA 1IQ7A 1NH8A 3VXBA 5JTYA 2IEEA 3IOUA 3EF7A 4GL8A 1OLAA 1MXWA 3VDFA 4BDQA 2D5WA 3M8UA 4KD5A 2ZNSA 4O3BA 4MF3A 4F22A 3PGFA 1RYOA 4XKQA 2DVZA 1NMUA 1MQIA 4AB5A 3TELA 4G68C 4U4XA 1VSOA 4ZDMA 4O3AA 1Q1KA 1MRPA 1MDQA 2PVUA 4HCWA 3KG2A 3Q27A 2RCAA 1SYIA 3CSGA 4NF6B 1FW0A 1JVXA 1Y4TA 3A3CA 3FD3A 4ESXA 3K6VA 5A5XA 4NWDA 2Q2AA 3OSRA 3JV9A 3N6TA 4OHNA 4GXAA 2XHDA 2Z8DA 3PPNA 1EZ9A 2E1SA 4BDOA 2DXRA 3KEIA 4OTEA 1T0KA 4PFYA 4LZ8A 3W15C 3SEWA 4FORA 1B46A 2FA7A 1B0LA 3G3GA 5FTHA 1BTJA 1USYH 3N26A 4F3SA 3OMBA 2I49A 3T93B 2HCAA 3G3KA 3PUZE 3ILTB 4EF2A 2CMOA 1LAGE 3IJOB 3SDFA 4NMYA 1USYE 4OEVA 1QKBA 1D9YA 2ONKE 4NTLA 3SERA 3RGYA 3MAMA 4NF6A 3DP6A 3TZAA 5I56B 1LLSA 1P1NA 3TCFA 1Y3QA 3G3JA 1GR2A 1ZMGA 4JWXA 1QJMA 4LVQA 3SESA 4ELOA 4Q5TA 4EUOA 3KFMA 4F1YA 3S9NC 2AL4A 1UTHB 4DDDA 4NF8B 3P7IA 2B65A 4NF4B 4ZE9A 1LBCA 1DPPA 2I48A 4BDLA 4KHZE 3LUYA 5ITPA 4U22A 4UA8A 3UORA 1MXXA 4OERA 4F19A 3QAXA 3UGWA 1LB8A 2V3QA 3HHFA 1B1XA 2REJA 4F1UA 1XHYA 3MBPA 1LAHE 2XXWA 4NF5B 5I56A 2RF1A 1RKMA 4HTGA 5K2YA 1I6QA 3K1PA 3TAJA 3O6IA 1SI1A 2Q89A 1BP5A 2ZYMA 3IB1A 3I5OA 4MLVA 3M3LA 5EYFA 1UTHA 2Q2CA 4NF8A 4ISUA 4R6HA 1B3FA 3IL1B 4NF4A 1QW0A 1NL5A 4KI0E 1B4HA 5CMMA 3G7WA 4FEBA 3MWBA 3CR9A 1QUIA 4EQ7A 1IUDA 2H25A 1FQEA 3KN7A 2OWTA 3ILUB 3H03A 4OZ9A 2F36A 3IOWA 1RYXA 4NF5A 3H6TA 3GLBA 4IGRA 5H8HB 3U92A 2B3FA 1TFAA 2A5SA 4R6YA 2X26A 4JB7A 4IB2A 3ECRA 5AA2D 1DPEA 4ZEIA 3HN0A 5CI5A 1LSTA 5L9MA 2ESNA 3HHGA 1DTGA 2QS4A 3ONMA 4LUBA 4HCYA 4JWYA 5AA2B 4WKMA 4YB6A 2XXVA 3OO6A 1S7YA 1Q35A 4ZEBA 3SEXA 1FTMA 2F7BA 2HZKA 2XD3A 4XTCQ 1ZJLA 2F34A 3TQWA 4LONB 1DMBA 2V3UA 3FV1A 2I4CA 4JSOA 1H76A 4EF1A 2FNCA 1A8EA 1OVTA 1JEVA 5H8HA 1DSNA 2I6EA 4IGTA 4G8MA 2ZYNA 1LAXA 1OVBA 1ZIUA 4N6PA 4TOZA 1N04A 3RPWA 2VGQA 5H8SA 3MC2A 2P0SA 4JWOA 2REGA 3U1OA 1NFTA 1F9BA 1UQWA 4N13A 5DVJA 3C34A 2OZZA 3QSLA 1Z7ME 5AA2A 2GHBA 3FVKA 4YB7A 4R73A 2XXRA 4RXLA 5B7DA 1YPNA 5K2XA 2O51A 3FASA 3DP4A 3EHSA 3B7DA 3IX1A 4BDNA 4OFJA 3TPAA 5AE4A 4R9FA 1N3WA 2QMWA 3S2VA 1PBPA 2ZNUA 5H8NB 4G77A 2F7AA 5I2NB 1TFDA 5L9OA 4C0RA 2QRYA 5ITOA 1B2HA 1MM7A 3JZJA 1JVYA 1QUJA 2XX9A 4RYAA 4YKJA 1H45A 2ZYOA 3QUFA 1MQHA 3FZVA 3S9LC 1B52A 1URSA 4M1VA 2QPQA 3UK4A 3C32A 1UIVA 1D9VA 5DEXB 2UVIA 3LSXA 3V83A 1JETA 4RK2A 3FJGA 3CG1A 2ONRA 5H8NA 5HPQA 4N07A 3TQLA 2F8DA 5I2NA 1II5A 4PETA 1SW2A 2UYEA 4R72A 2VOZA 3FJ7A 4RPOA 3FXUA 5I2KB 3QXMA 3PPPA 3FJMA 2QS3A 4GXSB 4IO4A 3ZS6A 2VD3A 4C1UA 3FIRA 2Y7PA 4BLAA 5CRYA 2R71A 4GL0A 4QF9A 1FQDA 1M5EA 4RA1A 2H9BA 3DP8A 2PYYA 4OWDA 1P1QA 2R6GE 4PP0A 4NEDA 1Y3NA 5DEXA 2M8CA 4GFRA 4DIGA 4X1DA 3A3UA 4H0WA 4WEDA 2V3TA 1UTBB 3IJXB 3PPRA 3O29A 3H06B 4P11A 2XXIA 1KWHA 3B6QA 4KFQA 3K6UA 1JW5A 5I2KA 1YAEA 1A54A 1OQHA 3T9XB 5FTIA 5EHSA 5JEIA 1LAFE 3OEMA 1JW1A 4IO6A 1VFDA 3MP1A 3TDJA 1SW4A 2AYSA 2XXHA 2NWJA 3W9VA 1O63A 1M5DA 3HO7A 2DWIA 5KZTA 2DP8A 1WVJA 1N84A 1SYHA 3PU5A 4UACA 5JK4A 2F35A 5FHOA 3RT8A 2UXAA 3K4UA 4ESWA 4LZ7A 2O68A 4POXA 1FTOA 3PUWE 2OJTA 1A7LA 4DXCA 3MP6A 4KCCA 1UTBA 2HAVA 3Q25A 1B05A 3OEKA 2F97A 4ZEFA 2IA4A 1B3GA 5FHMA 3IOVA 2XXYA 4H6DA 4F3BA 3VE1B 3EPEA 1PB9A 1QULA 3VVFA 4YAHX 4H5GA 3H6UA 3PUXE 2WKYA 5ISUA 4OVJA 2P1SA 1B6HA 2Y7IA 1OIBA 3K01A 3JYRA 2ONSA 3CIJA 2HQ0A 1HSLA 2RC7A 2O84X 1MQGA 5AA3A 4U4SA 4Q0CA 2D21A 4QHQA 5F1QA 3HSTA 1FTKA 1MPDA 3KBRA 3CI8A 1XVYA 1IEJA 4F2QA 3TFLA 3FVNA 5EHMA 2XXPA 3FVGA 3QK6A 3MQ9A 1NH7A 1PDAA 3OO9A 1QUKA 2YLNA 3K6WA 4DXBA 5DTBA 4OFOA 1ZBMA 1XVXA 3O66A 3D4CA 3H3GA 4GF8A 3KOSA 1GVCA 3N5LA 1M5CA 3ZKKA 3VXCA 1PBQA 3C9HA 4ZECA 3USDA 2ZMBA 4U1OA 2HAUA 1LCFA 2QL3A 1MDP1 1MPBA 4DE8A 3O28A 5I57B 5IKBA 3SEUA 3MPKA 3IR1A 3HCQA 3N6UA 2HEUA 3IK6B 3VFJA 4WEPA 4I62A 1MG1A 3SEVA 2NUVA 3Q26A 4I8CA 1MY0A 3ZSFA 4GWOA 4C1TA 2V93A 1I69A 3PMWA 4H65A 4U23A 1HSJA 4XIGQ 5F7VA 2DE3A 2H98A 3CSBA 3DLNA 3HPIA 3LSWA 1LFIA 2HFBA 5TU0A 4QRZA 4M4GA 2I58A 4F1VA 4OMBA 1LFHA 3W9WA 3PPOA 4U2RA 4AB6A 1PEBA 1ZU0A 2DE4A 2Q9TA 5I57A 3QUJA 1SW1A 3E4RA 1FCKA 1ZLQA 2ANJA 3EN3A 3T9VA 3C4MA 2G93A 4GD5A 4GVOA 3MVWA 2XXQA 3PD8A 2UVJA 3E9XA 1N3XA 4R75A 3Q28A 3FVOA 5J1DA 3DM0A 4THIA 5BWJA 2NXOA 3C35A 2F5XA 4QSEA 1OMPA 1CB6A 3K02A 2OWSA 3H6WA 3FUZA 4GOTA 3V8XB 2QSXA 1XT8A 2CZLA 2H99A 1MY4A 1SQYA 2XX7A 1URGA 3ODBA 4ELQA 1R9QA 1LGBC 1R9LA 4WXJA 3PMXA 3K0VA 4GQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXT A;  4E0W A;  3M3F A;  4HS7 A;  3R26 A;  3KGC A;  3G3H A;  4LP2 B;  1JQF A;  2Z23 A;  5H8Q B;  3R7X A;  1A40 A;  4P0I A;  3EQ1 A;  2I0C A;  3MVY A;  4ND9 A;  1CE2 A;  2V84 A;  1ZKB A;  3VLU A;  4XXU A;  2O69 A;  5CMK A;  1B4Z A;  3LR1 A;  4LAT A;  3D4G A;  1GTK A;  2PT1 A;  4F3G A;  1I6B A;  3E13 X;  1N76 A;  4G2Z A;  3ZKL A;  3VVE A;  1AL3 A;  1B7Z A;  3EHT A;  1AMF A;  4IO5 A;  4KYE A;  1MY2 A;  3RTF B;  5H8F B;  1XC1 A;  3RTW B;  4I1D A;  3EHU A;  3KSJ A;  3IB2 A;  1L5T A;  1O7T A;  1Y1M A;  2V25 A;  3CFL A;  2ZYK A;  3RNN A;  5KDT B;  3A09 A;  3S9E A;  4XKR A;  3GZG A;  1B3H A;  2GRV A;  4IO2 A;  5H8Q A;  2KLF A;  3OO7 A;  2Q8J A;  1D4N A;  1J1N A;  4GLI A;  3K1M A;  1PB7 A;  3K00 A;  3L6G A;  3T96 B;  3S4U A;  1QKA A;  2O7U A;  4F2O A;  2LAO A;  3UP9 A;  1DTZ A;  3GXA A;  4KR5 A;  3PD9 A;  2DWA A;  4ELR A;  2I3V A;  3TMG A;  4YMA A;  1TWY A;  3T22 A;  1A99 A;  1POY 1;  4MFI A;  5H8F A;  2OCU A;  4QFN A;  2ABH A;  5DT6 A;  1FTL A;  3AXF A;  1P1U A;  3QYT A;  4TQU Q;  1BIY A;  4R74 A;  1MH3 A;  1Y20 A;  4RNS A;  2QS1 A;  3Q29 A;  3VV5 A;  2RIN A;  5KDT A;  5AA1 A;  4PQJ A;  1B9J A;  2AL5 A;  1R6Z A;  5ICT A;  3LC8 A;  2BJJ X;  1MY3 A;  2XXU A;  1LB9 A;  3MP8 A;  4OET A;  2Q88 A;  3B6W A;  4DLD A;  1P1W A;  4FEC A;  3WAF A;  1EZO A;  4KQP A;  1O64 A;  1D3K A;  5CC2 A;  2DOJ A;  4X9T A;  1AIV A;  4F31 B;  3MZB A;  1FQA A;  3E3K A;  1AOV A;  3SKP A;  1EH3 A;  4QFK A;  1US5 A;  4ZED A;  2QMX A;  4YZZ A;  4IY6 A;  1IIW A;  3U94 A;  3MPL A;  1EZP A;  4FIM A;  2ALU A;  3O6H A;  3LSL A;  4H8I A;  4KPT A;  1YTV A;  3O6G A;  2GFE A;  5CBS A;  2B3B A;  1B0H A;  1IIT A;  3V89 B;  3LBS A;  3HV1 A;  1LCT A;  3OOA A;  4QSD A;  2YJP A;  4X48 A;  3F11 A;  4ZZE A;  2RC9 A;  4OES A;  4NWC A;  5L9S A;  1S50 A;  3KOT A;  2I0B A;  2RKM A;  1GV8 A;  5CMC A;  4EQ9 A;  3O9P A;  1US4 A;  2VD2 A;  1URD A;  2Y7K A;  2DE2 A;  3U93 A;  3MUQ A;  4QSC A;  3OD7 A;  3PUV E;  5AA4 B;  3OXN A;  4R2B A;  4EXL A;  2O7I A;  4YB5 A;  3N94 A;  4LQ5 A;  2QJE A;  1PC3 A;  2DSF A;  4P0G A;  2XXT A;  2Z8E A;  3S9M C;  4F18 A;  1QVS A;  5IAI A;  3TTK A;  4GRK A;  3TTL A;  1IXC A;  5DVI A;  1I6A A;  5TP9 B;  4Q8R A;  2Y7R A;  3KZG A;  5FHN A;  2H5Y A;  2VP1 A;  2Z22 A;  5CM6 A;  1SDX A;  1H3D A;  1Y3P A;  4DCX A;  1MS7 A;  4OEU A;  3GBA A;  4YKI A;  3QIM A;  4K3F A;  4OEN A;  2OLB A;  4IO7 A;  1SBP A;  3G3I A;  1XOC A;  3BFU A;  5AA4 A;  2FYI A;  1B7H A;  4DZ1 A;  2GH9 A;  1IXG A;  1FQB A;  3GBB A;  1ELJ A;  3MW0 A;  1B5J A;  1NKX A;  1BKA A;  1MM6 A;  4X1B A;  3KSX A;  2Y84 A;  4ZS9 A;  3K6X A;  1POT A;  2X7Q A;  3KJT A;  5BUU A;  5TP9 A;  1H43 A;  1S9T A;  4YKP A;  3TCG A;  1MY1 A;  1B1H A;  2Y7W A;  4G8N A;  2THI A;  4Q30 B;  4EQB A;  3UN6 A;  3OSQ A;  1M5B A;  3TTN A;  1Z7N E;  2P2A A;  5TPA B;  4HW8 A;  2VHA A;  5CBR A;  4U21 A;  3TTM A;  1IXI A;  3MZ1 A;  1DOT A;  4Z0I A;  2UVG A;  1JW4 A;  3CG3 A;  4EDP A;  2D3I A;  1FQF A;  3IOR A;  2QS2 A;  4GIZ A;  2PMS A;  1VR5 A;  1MXV A;  4RPN A;  2O1L A;  5DVF A;  1Y1Z A;  3FV2 A;  4YIC A;  3MJN A;  1M5F A;  1SW5 A;  3FXQ A;  2DS9 A;  3TCH A;  1B58 A;  2XX8 A;  1VE4 A;  4H5F A;  3TEP A;  1B3E A;  5I59 B;  3L6H A;  3T66 A;  4FAT A;  2A5T B;  4RY1 A;  5CMB A;  4TLM B;  2UYF A;  4DCY A;  2PX1 A;  1Y4C A;  2DYX A;  2HXW A;  4O3C A;  3T9U A;  2F7C A;  5TPA A;  4IO3 A;  4BDM A;  5ELV A;  4RJZ A;  1B5H A;  3C33 A;  2GHA A;  5HBC A;  3IB0 A;  3IO6 A;  2F6G A;  4QFP A;  4BDR A;  4H8J A;  4TLL B;  1B7U A;  3IAZ A;  2I4B A;  2OK2 A;  4KYS A;  3KJ7 A;  4U1Z A;  4G68 B;  4JXI A;  4ONY A;  1MXZ A;  2DQV A;  4H1X A;  1N7W A;  3FXR A;  4E0X A;  2DXY A;  3PV0 E;  1B3L A;  5M2V A;  1N7X A;  4DXU A;  4YKK A;  1H44 A;  3TKD A;  3LSF B;  5I59 A;  3T9H B;  1MXU A;  2A5T A;  3IOT A;  3TYH A;  4YMB A;  2H4I A;  3RN8 A;  4ECF A;  4PFU A;  4KCD A;  4H67 A;  1MH4 A;  3CFX A;  3U8Q A;  2DWJ A;  3G3F A;  3V5A A;  3UIF A;  1OLC A;  2XD2 A;  1MQD A;  3RT6 B;  4FE8 A;  5B70 A;  5HM4 B;  3C36 A;  4IY5 A;  3RY3 A;  4OFL A;  2W7Y A;  4FJP A;  3H7M A;  3MZ9 A;  4JBZ A;  4G68 A;  1NNK A;  4RK9 A;  5KCJ B;  4EXK A;  2G29 A;  2YPN A;  4XKP A;  4LQ2 A;  3MVZ A;  1MPC A;  3OO8 A;  2PBW A;  2RCB A;  3BKI B;  5I58 B;  1A8F A;  1B5I A;  4FAJ A;  4YU0 A;  3H4Z A;  2Z8F A;  3PUY E;  4QFL A;  1IXH A;  3KN8 A;  2PT2 A;  1ATG A;  5L8D A;  2DWH A;  3VVD A;  3I3V A;  2O1M A;  3RUM A;  2DVC A;  4PFT A;  3MVX A;  4MH5 A;  4R6K A;  3H6V A;  4R9G A;  3BFT A;  3K2D A;  3DEL B;  4OXV A;  2I3W A;  3CFZ A;  1NNP A;  1B32 A;  4AQ4 A;  5KCJ A;  4NE4 A;  3BBR A;  4POW A;  4ZEK A;  1GGG A;  3TUS A;  1ZTY A;  3UA8 A;  4JSD A;  1TXF A;  3CRB A;  3OEN A;  1P99 A;  3OEL A;  4QFO A;  1SI0 A;  5I58 A;  2RC8 A;  1MQJ A;  3THI A;  2ZNT A;  3PMV A;  1R1N A;  1XS5 A;  2UVH A;  1YCJ A;  1IZ1 A;  4ELP A;  2NVU B;  1P1O A;  4XKN A;  3PPQ A;  1BLF A;  4PFW A;  1ANF A;  3U72 A;  3K1N A;  4ZE8 A;  1WOD A;  3VLV A;  4MBP A;  3SET A;  3I6V A;  4KYD A;  1HSE A;  3WAE A;  3FAT A;  3IO4 A;  4MLQ A;  2E0S A;  4R2F A;  2R9J A;  2F78 A;  2OBG A;  2HZL A;  4G8H A;  1FTJ A;  4JDF A;  1AH5 A;  3VLW A;  1JEU A;  5LOM A;  1TT1 A;  3CVG A;  4LA9 A;  4PE5 B;  4FED A;  1LBB A;  1EU8 A;  1NNF A;  1UIU A;  1SVX B;  4F39 A;  2AIX A;  1B51 A;  4OYV A;  1PB8 A;  2NOO A;  1WDN A;  1LFG A;  5JTY B;  1FQC A;  3RQT A;  3C31 A;  4G4P A;  4F29 A;  2F6P A;  1A55 A;  1B40 A;  3TTR A;  1N0T A;  2X7P A;  1JNF A;  4Z7E A;  2XXX A;  1VFE A;  4F3P A;  3RLF E;  1Y9U A;  4OQO A;  3TOD A;  5DYH A;  3O97 A;  2O6A A;  1OQG A;  4I9D A;  3O2A A;  1SD3 A;  4LZ5 A;  3SEY A;  1MXY A;  1NNT A;  3M3K A;  5I84 A;  3KN3 A;  4L17 A;  5A5X B;  4ZZA A;  3R6U A;  3B6T A;  5ICQ A;  3FGS A;  1IQ7 A;  1NH8 A;  3VXB A;  5JTY A;  2IEE A;  3IOU A;  3EF7 A;  4GL8 A;  1OLA A;  1MXW A;  3VDF A;  4BDQ A;  2D5W A;  3M8U A;  4KD5 A;  2ZNS A;  4O3B A;  4MF3 A;  4F22 A;  3PGF A;  1RYO A;  4XKQ A;  2DVZ A;  1NMU A;  1MQI A;  4AB5 A;  3TEL A;  4G68 C;  4U4X A;  1VSO A;  4ZDM A;  4O3A A;  1Q1K A;  1MRP A;  1MDQ A;  2PVU A;  4HCW A;  3KG2 A;  3Q27 A;  2RCA A;  1SYI A;  3CSG A;  4NF6 B;  1FW0 A;  1JVX A;  1Y4T A;  3A3C A;  3FD3 A;  4ESX A;  3K6V A;  5A5X A;  4NWD A;  2Q2A A;  3OSR A;  3JV9 A;  3N6T A;  4OHN A;  4GXA A;  2XHD A;  2Z8D A;  3PPN A;  1EZ9 A;  2E1S A;  4BDO A;  2DXR A;  3KEI A;  4OTE A;  1T0K A;  4PFY A;  4LZ8 A;  3W15 C;  3SEW A;  4FOR A;  1B46 A;  2FA7 A;  1B0L A;  3G3G A;  5FTH A;  1BTJ A;  1USY H;  3N26 A;  4F3S A;  3OMB A;  2I49 A;  3T93 B;  2HCA A;  3G3K A;  3PUZ E;  3ILT B;  4EF2 A;  2CMO A;  1LAG E;  3IJO B;  3SDF A;  4NMY A;  1USY E;  4OEV A;  1QKB A;  1D9Y A;  2ONK E;  4NTL A;  3SER A;  3RGY A;  3MAM A;  4NF6 A;  3DP6 A;  3TZA A;  5I56 B;  1LLS A;  1P1N A;  3TCF A;  1Y3Q A;  3G3J A;  1GR2 A;  1ZMG A;  4JWX A;  1QJM A;  4LVQ A;  3SES A;  4ELO A;  4Q5T A;  4EUO A;  3KFM A;  4F1Y A;  3S9N C;  2AL4 A;  1UTH B;  4DDD A;  4NF8 B;  3P7I A;  2B65 A;  4NF4 B;  4ZE9 A;  1LBC A;  1DPP A;  2I48 A;  4BDL A;  4KHZ E;  3LUY A;  5ITP A;  4U22 A;  4UA8 A;  3UOR A;  1MXX A;  4OER A;  4F19 A;  3QAX A;  3UGW A;  1LB8 A;  2V3Q A;  3HHF A;  1B1X A;  2REJ A;  4F1U A;  1XHY A;  3MBP A;  1LAH E;  2XXW A;  4NF5 B;  5I56 A;  2RF1 A;  1RKM A;  4HTG A;  5K2Y A;  1I6Q A;  3K1P A;  3TAJ A;  3O6I A;  1SI1 A;  2Q89 A;  1BP5 A;  2ZYM A;  3IB1 A;  3I5O A;  4MLV A;  3M3L A;  5EYF A;  1UTH A;  2Q2C A;  4NF8 A;  4ISU A;  4R6H A;  1B3F A;  3IL1 B;  4NF4 A;  1QW0 A;  1NL5 A;  4KI0 E;  1B4H A;  5CMM A;  3G7W A;  4FEB A;  3MWB A;  3CR9 A;  1QUI A;  4EQ7 A;  1IUD A;  2H25 A;  1FQE A;  3KN7 A;  2OWT A;  3ILU B;  3H03 A;  4OZ9 A;  2F36 A;  3IOW A;  1RYX A;  4NF5 A;  3H6T A;  3GLB A;  4IGR A;  5H8H B;  3U92 A;  2B3F A;  1TFA A;  2A5S A;  4R6Y A;  2X26 A;  4JB7 A;  4IB2 A;  3ECR A;  5AA2 D;  1DPE A;  4ZEI A;  3HN0 A;  5CI5 A;  1LST A;  5L9M A;  2ESN A;  3HHG A;  1DTG A;  2QS4 A;  3ONM A;  4LUB A;  4HCY A;  4JWY A;  5AA2 B;  4WKM A;  4YB6 A;  2XXV A;  3OO6 A;  1S7Y A;  1Q35 A;  4ZEB A;  3SEX A;  1FTM A;  2F7B A;  2HZK A;  2XD3 A;  4XTC Q;  1ZJL A;  2F34 A;  3TQW A;  4LON B;  1DMB A;  2V3U A;  3FV1 A;  2I4C A;  4JSO A;  1H76 A;  4EF1 A;  2FNC A;  1A8E A;  1OVT A;  1JEV A;  5H8H A;  1DSN A;  2I6E A;  4IGT A;  4G8M A;  2ZYN A;  1LAX A;  1OVB A;  1ZIU A;  4N6P A;  4TOZ A;  1N04 A;  3RPW A;  2VGQ A;  5H8S A;  3MC2 A;  2P0S A;  4JWO A;  2REG A;  3U1O A;  1NFT A;  1F9B A;  1UQW A;  4N13 A;  5DVJ A;  3C34 A;  2OZZ A;  3QSL A;  1Z7M E;  5AA2 A;  2GHB A;  3FVK A;  4YB7 A;  4R73 A;  2XXR A;  4RXL A;  5B7D A;  1YPN A;  5K2X A;  2O51 A;  3FAS A;  3DP4 A;  3EHS A;  3B7D A;  3IX1 A;  4BDN A;  4OFJ A;  3TPA A;  5AE4 A;  4R9F A;  1N3W A;  2QMW A;  3S2V A;  1PBP A;  2ZNU A;  5H8N B;  4G77 A;  2F7A A;  5I2N B;  1TFD A;  5L9O A;  4C0R A;  2QRY A;  5ITO A;  1B2H A;  1MM7 A;  3JZJ A;  1JVY A;  1QUJ A;  2XX9 A;  4RYA A;  4YKJ A;  1H45 A;  2ZYO A;  3QUF A;  1MQH A;  3FZV A;  3S9L C;  1B52 A;  1URS A;  4M1V A;  2QPQ A;  3UK4 A;  3C32 A;  1UIV A;  1D9V A;  5DEX B;  2UVI A;  3LSX A;  3V83 A;  1JET A;  4RK2 A;  3FJG A;  3CG1 A;  2ONR A;  5H8N A;  5HPQ A;  4N07 A;  3TQL A;  2F8D A;  5I2N A;  1II5 A;  4PET A;  1SW2 A;  2UYE A;  4R72 A;  2VOZ A;  3FJ7 A;  4RPO A;  3FXU A;  5I2K B;  3QXM A;  3PPP A;  3FJM A;  2QS3 A;  4GXS B;  4IO4 A;  3ZS6 A;  2VD3 A;  4C1U A;  3FIR A;  2Y7P A;  4BLA A;  5CRY A;  2R71 A;  4GL0 A;  4QF9 A;  1FQD A;  1M5E A;  4RA1 A;  2H9B A;  3DP8 A;  2PYY A;  4OWD A;  1P1Q A;  2R6G E;  4PP0 A;  4NED A;  1Y3N A;  5DEX A;  2M8C A;  4GFR A;  4DIG A;  4X1D A;  3A3U A;  4H0W A;  4WED A;  2V3T A;  1UTB B;  3IJX B;  3PPR A;  3O29 A;  3H06 B;  4P11 A;  2XXI A;  1KWH A;  3B6Q A;  4KFQ A;  3K6U A;  1JW5 A;  5I2K A;  1YAE A;  1A54 A;  1OQH A;  3T9X B;  5FTI A;  5EHS A;  5JEI A;  1LAF E;  3OEM A;  1JW1 A;  4IO6 A;  1VFD A;  3MP1 A;  3TDJ A;  1SW4 A;  2AYS A;  2XXH A;  2NWJ A;  3W9V A;  1O63 A;  1M5D A;  3HO7 A;  2DWI A;  5KZT A;  2DP8 A;  1WVJ A;  1N84 A;  1SYH A;  3PU5 A;  4UAC A;  5JK4 A;  2F35 A;  5FHO A;  3RT8 A;  2UXA A;  3K4U A;  4ESW A;  4LZ7 A;  2O68 A;  4POX A;  1FTO A;  3PUW E;  2OJT A;  1A7L A;  4DXC A;  3MP6 A;  4KCC A;  1UTB A;  2HAV A;  3Q25 A;  1B05 A;  3OEK A;  2F97 A;  4ZEF A;  2IA4 A;  1B3G A;  5FHM A;  3IOV A;  2XXY A;  4H6D A;  4F3B A;  3VE1 B;  3EPE A;  1PB9 A;  1QUL A;  3VVF A;  4YAH X;  4H5G A;  3H6U A;  3PUX E;  2WKY A;  5ISU A;  4OVJ A;  2P1S A;  1B6H A;  2Y7I A;  1OIB A;  3K01 A;  3JYR A;  2ONS A;  3CIJ A;  2HQ0 A;  1HSL A;  2RC7 A;  2O84 X;  1MQG A;  5AA3 A;  4U4S A;  4Q0C A;  2D21 A;  4QHQ A;  5F1Q A;  3HST A;  1FTK A;  1MPD A;  3KBR A;  3CI8 A;  1XVY A;  1IEJ A;  4F2Q A;  3TFL A;  3FVN A;  5EHM A;  2XXP A;  3FVG A;  3QK6 A;  3MQ9 A;  1NH7 A;  1PDA A;  3OO9 A;  1QUK A;  2YLN A;  3K6W A;  4DXB A;  5DTB A;  4OFO A;  1ZBM A;  1XVX A;  3O66 A;  3D4C A;  3H3G A;  4GF8 A;  3KOS A;  1GVC A;  3N5L A;  1M5C A;  3ZKK A;  3VXC A;  1PBQ A;  3C9H A;  4ZEC A;  3USD A;  2ZMB A;  4U1O A;  2HAU A;  1LCF A;  2QL3 A;  1MDP 1;  1MPB A;  4DE8 A;  3O28 A;  5I57 B;  5IKB A;  3SEU A;  3MPK A;  3IR1 A;  3HCQ A;  3N6U A;  2HEU A;  3IK6 B;  3VFJ A;  4WEP A;  4I62 A;  1MG1 A;  3SEV A;  2NUV A;  3Q26 A;  4I8C A;  1MY0 A;  3ZSF A;  4GWO A;  4C1T A;  2V93 A;  1I69 A;  3PMW A;  4H65 A;  4U23 A;  1HSJ A;  4XIG Q;  5F7V A;  2DE3 A;  2H98 A;  3CSB A;  3DLN A;  3HPI A;  3LSW A;  1LFI A;  2HFB A;  5TU0 A;  4QRZ A;  4M4G A;  2I58 A;  4F1V A;  4OMB A;  1LFH A;  3W9W A;  3PPO A;  4U2R A;  4AB6 A;  1PEB A;  1ZU0 A;  2DE4 A;  2Q9T A;  5I57 A;  3QUJ A;  1SW1 A;  3E4R A;  1FCK A;  1ZLQ A;  2ANJ A;  3EN3 A;  3T9V A;  3C4M A;  2G93 A;  4GD5 A;  4GVO A;  3MVW A;  2XXQ A;  3PD8 A;  2UVJ A;  3E9X A;  1N3X A;  4R75 A;  3Q28 A;  3FVO A;  5J1D A;  3DM0 A;  4THI A;  5BWJ A;  2NXO A;  3C35 A;  2F5X A;  4QSE A;  1OMP A;  1CB6 A;  3K02 A;  2OWS A;  3H6W A;  3FUZ A;  4GOT A;  3V8X B;  2QSX A;  1XT8 A;  2CZL A;  2H99 A;  1MY4 A;  1SQY A;  2XX7 A;  1URG A;  3ODB A;  4ELQ A;  1R9Q A;  1LGB C;  1R9L A;  4WXJ A;  3PMX A;  3K0V A;  4GQO A; 
#chains in the Genus database with same CATH topology
 1BK4 A;  2ZXT A;  4E0W A;  3M3F A;  4HS7 A;  2BJI A;  3R26 A;  3KGC A;  5ET5 A;  3G3H A;  4LP2 B;  1JQF A;  2Z23 A;  5H8Q B;  3R7X A;  1A40 A;  4P0I A;  4PGP A;  2CEX A;  3EQ1 A;  5J16 A;  2I0C A;  3MVY A;  4XF5 A;  4ND9 A;  1CE2 A;  2V84 A;  1ZKB A;  4FBP A;  4PE3 A;  3VLU A;  4XXU A;  2O69 A;  4N6K A;  4O7I A;  5CMK A;  1B4Z A;  3LR1 A;  4LAT A;  3D4G A;  1GTK A;  2PT1 A;  4F3G A;  1I6B A;  3E13 X;  1NV2 A;  1N76 A;  4G2Z A;  3ZKL A;  3VVE A;  1YYZ A;  1AL3 A;  1B7Z A;  3EHT A;  1AMF A;  4IO5 A;  1K9Z A;  4KYE A;  1MY2 A;  3RTF B;  5H8F B;  3NOH A;  1XC1 A;  3RTW B;  4I1D A;  3EHU A;  3KSJ A;  3IB2 A;  1L5T A;  1O7T A;  1Y1M A;  2V25 A;  3CFL A;  2ZYK A;  3RNN A;  5KDT B;  3A09 A;  5EYH A;  1EYK A;  2QVR A;  3S9E A;  4XKR A;  1FBE A;  3GZG A;  1B3H A;  2GRV A;  4IO2 A;  5H8Q A;  2KLF A;  3OO7 A;  1LEV A;  2Q8J A;  1D4N A;  1J1N A;  2FBP A;  2WX9 A;  4GLI A;  3K1M A;  1PB7 A;  3K00 A;  3L6G A;  3T96 B;  3S4U A;  1QKA A;  2OX3 A;  2O7U A;  4F2O A;  2LAO A;  3UP9 A;  1DTZ A;  3GXA A;  1NI9 A;  4KR5 A;  3PD9 A;  2DWA A;  4ELR A;  2Y5K A;  2I3V A;  2HHM A;  3TMG A;  4YMA A;  1TWY A;  3T22 A;  1A99 A;  1POY 1;  4MFI A;  5H8F A;  2OCU A;  4X04 A;  1FBF A;  1NUW A;  4QFN A;  2ABH A;  5DT6 A;  1FTL A;  3AXF A;  1P1U A;  3QYT A;  4TQU Q;  1BIY A;  4R74 A;  1MH3 A;  1Y20 A;  4RNS A;  2QS1 A;  4PAK A;  3Q29 A;  3VV5 A;  3B8B A;  2RIN A;  5KDT A;  5AA1 A;  5ET7 A;  4PQJ A;  1B9J A;  4GBV A;  2AL5 A;  1R6Z A;  5ICT A;  2WBB A;  3LC8 A;  2BJJ X;  1MY3 A;  2XXU A;  1LB9 A;  3MP8 A;  4OET A;  2Q88 A;  3B6W A;  4DLD A;  1P1W A;  4FEC A;  3WAF A;  1EZO A;  4O8M A;  2KR0 A;  4KQP A;  1O64 A;  1D3K A;  5CC2 A;  2DOJ A;  2QVU A;  4IR8 A;  4X9T A;  1AIV A;  4F31 B;  3MZB A;  1FQA A;  3E3K A;  1AOV A;  3SKP A;  1EH3 A;  4PF6 A;  4QFK A;  1US5 A;  4N8G A;  4ZED A;  2QMX A;  4P9K A;  4YZZ A;  4IY6 A;  1IIW A;  3U94 A;  3MPL A;  1EZP A;  4FIM A;  2ALU A;  4UAB A;  3O6H A;  3LSL A;  4H8I A;  1EYI A;  4KPT A;  1YTV A;  3O6G A;  2GFE A;  4GWZ A;  5CBS A;  2B3B A;  1IIT A;  1B0H A;  3V89 B;  3LBS A;  3HV1 A;  1LCT A;  1Q9D A;  3OOA A;  4QSD A;  2YJP A;  4X48 A;  3F11 A;  4ZZE A;  2CZK A;  2RC9 A;  4OES A;  4NWC A;  5L9S A;  1S50 A;  3KOT A;  2QVV A;  2I0B A;  2RKM A;  1GV8 A;  5CMC A;  4EQ9 A;  3O9P A;  2F3B A;  1US4 A;  2VD2 A;  1URD A;  2Y7K A;  1NUZ A;  2DE2 A;  5EQ8 A;  3U93 A;  4H46 A;  3MUQ A;  4QSC A;  4NHB A;  3OD7 A;  3PUV E;  5AA4 B;  3OXN A;  4R2B A;  4EXL A;  2O7I A;  4YB5 A;  1NV0 A;  3N94 A;  4LQ5 A;  2QJE A;  2WYP A;  1PC3 A;  4PFI A;  2DSF A;  4P0G A;  2XXT A;  2Z8E A;  3S9M C;  4F18 A;  1QVS A;  5IAI A;  5LTC A;  3TTK A;  3PTY A;  4GRK A;  3TTL A;  1IXC A;  5DVI A;  1I6A A;  5TP9 B;  4Q8R A;  2Y7R A;  3KZG A;  3B50 A;  5FHN A;  2H5Y A;  2VP1 A;  2Z22 A;  5CM6 A;  1SDX A;  1H3D A;  4PAF A;  1Y3P A;  4DCX A;  1MS7 A;  3MYU A;  5EQ9 A;  4OEU A;  3GBA A;  5T3J A;  4YKI A;  3QIM A;  4K3F A;  4OEN A;  2OLB A;  4IO7 A;  3EKI A;  1SBP A;  3G3I A;  1XOC A;  3BFU A;  5AA4 A;  2FYI A;  1B7H A;  4NQ8 A;  4DZ1 A;  2GH9 A;  1IXG A;  1FQB A;  3GBB A;  1ELJ A;  3MW0 A;  1B5J A;  1NKX A;  1BKA A;  4N8Y A;  1MM6 A;  4X1B A;  1FJ9 A;  5EQA A;  3KSX A;  2Y84 A;  4ZS9 A;  3K6X A;  1POT A;  2X7Q A;  3KJT A;  5BUU A;  5TP9 A;  1H43 A;  2QFL A;  1S9T A;  4YKP A;  4NN3 A;  3TCG A;  1MY1 A;  1B1H A;  2Y7W A;  4G8N A;  4NAP A;  2THI A;  4Q30 B;  4EQB A;  3UN6 A;  3OSQ A;  1M5B A;  3TTN A;  1Z7N E;  2P2A A;  2PFZ A;  5TPA B;  4HW8 A;  2VHA A;  5I5P A;  5CBR A;  4U21 A;  1KZ8 A;  3TTM A;  1IXI A;  3MZ1 A;  4O94 A;  1DOT A;  1D9Q A;  4Z0I A;  2UVG A;  4GX6 A;  1JW4 A;  3CG3 A;  4EDP A;  2D3I A;  1FQF A;  3D1R A;  3IOR A;  2QS2 A;  4GIZ A;  2PMS A;  1VR5 A;  1MXV A;  1FPK A;  4RPN A;  2O1L A;  5DVF A;  1Y1Z A;  3FV2 A;  4YIC A;  3MJN A;  1M5F A;  1SW5 A;  3FXQ A;  2DS9 A;  3TCH A;  1B58 A;  2XX8 A;  1VE4 A;  4H5F A;  3TEP A;  1B3E A;  5I59 B;  3L6H A;  3T66 A;  4FAT A;  2A5T B;  4RY1 A;  5CMB A;  4TLM B;  2UYF A;  4DCY A;  1G0I A;  2PX1 A;  1Y4C A;  2DYX A;  1JP4 A;  2HXW A;  3T1B A;  4O3C A;  3T9U A;  2F7C A;  5TPA A;  4PTK A;  4IO3 A;  4BDM A;  5ELV A;  4RJZ A;  1B5H A;  3C33 A;  2GHA A;  5HBC A;  1DK4 A;  3IB0 A;  1AWB A;  3CHG A;  3IO6 A;  2F6G A;  4QFP A;  4BDR A;  4H8J A;  4TLL B;  1B7U A;  4GX3 A;  3IAZ A;  2I4B A;  2OK2 A;  4KYS A;  3KJ7 A;  2CZH A;  4MJO A;  4U1Z A;  4G68 B;  4JXI A;  4ONY A;  4H45 A;  1MXZ A;  2DQV A;  4H1X A;  1N7W A;  1EYJ A;  1LBZ A;  3FXR A;  4E0X A;  2DXY A;  1IME A;  3PV0 E;  1B3L A;  5M2V A;  1N7X A;  4PDH A;  4DXU A;  4YKK A;  1H44 A;  3TKD A;  3LSF B;  5I59 A;  1RDZ A;  3T9H B;  1MXU A;  2A5T A;  3IOT A;  3TYH A;  4YMB A;  2H4I A;  3RN8 A;  4ECF A;  2WBD A;  4PFU A;  5IZ1 A;  4KCD A;  4H67 A;  1MH4 A;  3CFX A;  3U8Q A;  2DWJ A;  3G3F A;  3V5A A;  3UIF A;  1OLC A;  4MNI A;  2XD2 A;  1MQD A;  3RT6 B;  4FE8 A;  5B70 A;  5HM4 B;  3C36 A;  4IY5 A;  3RY3 A;  4OFL A;  2W7Y A;  4FJP A;  3H7M A;  3MZ9 A;  4JBZ A;  4G68 A;  1NNK A;  4RK9 A;  5KCJ B;  4EXK A;  4OVT A;  2G29 A;  2YPN A;  4XKP A;  4LQ2 A;  4GWU A;  3MVZ A;  4PCD A;  1MPC A;  3OO8 A;  2CEY A;  2XWI A;  2PBW A;  2RCB A;  3BKI B;  5I58 B;  1A8F A;  1B5I A;  4FAJ A;  4YU0 A;  4N91 A;  2FIX A;  3H4Z A;  2Z8F A;  3PUY E;  4QFL A;  1IXH A;  1NV1 A;  3IFA A;  3FBP A;  3KN8 A;  2PT2 A;  1ATG A;  5L8D A;  1VDW A;  2VT5 A;  2DWH A;  3VVD A;  4NX1 A;  3I3V A;  2O1M A;  3RUM A;  2DVC A;  4PFT A;  3MVX A;  4MH5 A;  4R6K A;  3H6V A;  4R9G A;  3BFT A;  3K2D A;  3DEL B;  3ISP A;  4OXV A;  2I3W A;  2WYK A;  3CFZ A;  1NNP A;  1B32 A;  4AQ4 A;  5KCJ A;  4HXV A;  4NE4 A;  3BBR A;  4POW A;  4ZEK A;  1GGG A;  3TUS A;  5IGA A;  1ZTY A;  3UA8 A;  4JSD A;  1TXF A;  3CRB A;  3OEN A;  1P99 A;  3OEL A;  4QFO A;  1SI0 A;  4XFE A;  5I58 A;  2RC8 A;  1MQJ A;  3THI A;  1KA1 A;  2ZNT A;  3PMV A;  3E79 A;  5I7I A;  1R1N A;  1XS5 A;  2UVH A;  1YCJ A;  1IZ1 A;  4ELP A;  2NVU B;  1P1O A;  4GWS A;  4XKN A;  3PPQ A;  1BLF A;  4PFW A;  1ANF A;  3U72 A;  3K1N A;  4JVC A;  4ZE8 A;  4QBA A;  1WOD A;  3VLV A;  4MBP A;  3SET A;  3I6V A;  4KYD A;  1HSE A;  3WAE A;  3FAT A;  3IO4 A;  4MLQ A;  2E0S A;  4R2F A;  2R9J A;  2F78 A;  2OBG A;  2HZL A;  2FHY A;  4G8H A;  1FTJ A;  4P1E A;  4JDF A;  4PBQ A;  1AH5 A;  3VLW A;  1JEU A;  5LOM A;  1TT1 A;  3CVG A;  4LA9 A;  4PE5 B;  4FED A;  1LBB A;  2VPN A;  1EU8 A;  1NNF A;  1UIU A;  1SVX B;  4F39 A;  1IMC A;  2AIX A;  1B51 A;  1FPG A;  4OYV A;  1PB8 A;  2NOO A;  1NUY A;  1WDN A;  1LFG A;  1IMD A;  5JTY B;  5IZZ A;  1FQC A;  4MNP A;  3RQT A;  3C31 A;  4G4P A;  4F29 A;  3FXB A;  4P56 A;  2V4C A;  2F6P A;  1A55 A;  3E78 A;  1B40 A;  3TTR A;  1N0T A;  2X7P A;  1JNF A;  4Z7E A;  4MAG A;  2XXX A;  1VFE A;  4F3P A;  2ZZV A;  3RLF E;  1Y9U A;  4OQO A;  3TOD A;  5DYH A;  3O97 A;  2O6A A;  1OQG A;  4I9D A;  3O2A A;  1SD3 A;  4LZ5 A;  5ESY A;  4PDD A;  3SEY A;  1MXY A;  1NNT A;  3M3K A;  5I84 A;  3KN3 A;  4L17 A;  4KXP A;  5A5X B;  4ZZA A;  4GBW A;  3R6U A;  3B6T A;  5ICQ A;  4I3Y A;  3FGS A;  1IQ7 A;  1FBG A;  1NH8 A;  1FPE A;  3VXB A;  5JTY A;  2IEE A;  3IOU A;  3RYD A;  2KQZ A;  3EF7 A;  4GL8 A;  1OLA A;  2L5V A;  1MXW A;  3VDF A;  3BIG A;  4BDQ A;  1XI6 A;  2D5W A;  3M8U A;  4KD5 A;  2ZNS A;  4O3B A;  1NV3 A;  4MF3 A;  4I3E A;  4F22 A;  3PGF A;  1RYO A;  4XKQ A;  2DVZ A;  1NMU A;  1MQI A;  4AB5 A;  3TEL A;  4G68 C;  4U4X A;  1VSO A;  4ZDM A;  4O3A A;  1Q1K A;  1MRP A;  1MDQ A;  2PVU A;  5EQ7 A;  4HCW A;  3KG2 A;  3Q27 A;  1FBP A;  2XWO A;  1RDY A;  2RCA A;  4PF8 A;  1SYI A;  3CSG A;  4NF6 B;  1FW0 A;  1JVX A;  1Y4T A;  3A3C A;  3FD3 A;  4ESX A;  2Q74 A;  3K6V A;  5A5X A;  4NWD A;  2Q2A A;  3OSR A;  3JV9 A;  3N6T A;  4OHN A;  2CZI A;  5I3S A;  4GXA A;  2XHD A;  2Z8D A;  3PPN A;  1EZ9 A;  2E1S A;  4BDO A;  2DXR A;  3KEI A;  4OTE A;  1T0K A;  1G0H A;  4PFY A;  4LZ8 A;  3W15 C;  3SEW A;  4FOR A;  1B46 A;  3KC1 A;  4HE1 A;  2FA7 A;  1B0L A;  3G3G A;  5FTH A;  1NUX A;  3GYY A;  1BTJ A;  4GX4 A;  4MX6 A;  1USY H;  3N26 A;  4F3S A;  1YZ0 A;  5ET8 A;  3OMB A;  3KBZ A;  2I49 A;  3T93 B;  4PGN A;  2HCA A;  5A5L A;  3G3K A;  3PUZ E;  3ILT B;  3T0J A;  4EF2 A;  2CMO A;  1LAG E;  3IJO B;  3SDF A;  4NMY A;  1USY E;  4OEV A;  1QKB A;  1D9Y A;  1FJ6 A;  2ONK E;  4NTL A;  3SER A;  3SZP A;  3RGY A;  3MAM A;  4NF6 A;  3DP6 A;  3TZA A;  1NV4 A;  5I56 B;  1LLS A;  1P1N A;  2DDK A;  3TCF A;  1Y3Q A;  3G3J A;  1GR2 A;  1ZMG A;  4JWX A;  1QJM A;  4LVQ A;  3SES A;  4ELO A;  4Q5T A;  4EUO A;  3KFM A;  4F1Y A;  3S9N C;  2AL4 A;  1UTH B;  4DDD A;  4NF8 B;  3P7I A;  2B65 A;  4N4U A;  4NF4 B;  4ZE9 A;  1LBC A;  1DPP A;  2I48 A;  4BDL A;  4KHZ E;  2Q8M A;  3LUY A;  2ZZX A;  5ITP A;  3HFU A;  1FBD A;  4U22 A;  4UA8 A;  5IM2 A;  3UOR A;  2HPG A;  1MXX A;  4OVP A;  4I40 A;  4OER A;  4F19 A;  3QAX A;  3UGW A;  1LB8 A;  2V3Q A;  3HHF A;  1B1X A;  3MST A;  2REJ A;  4F1U A;  1XHY A;  3MBP A;  1LAH E;  2XXW A;  4NF5 B;  1FTA A;  5I56 A;  2RF1 A;  1RKM A;  4JVI A;  4HTG A;  5K2Y A;  4PFB A;  1I6Q A;  3K1P A;  4GWY A;  3TAJ A;  2XWV A;  3O6I A;  1SI1 A;  2Q89 A;  1BP5 A;  2ZYM A;  1FPD A;  3IB1 A;  3I5O A;  1LBW A;  4MLV A;  3M3L A;  5EYF A;  1UTH A;  2Q2C A;  4NF8 A;  1RDX A;  4ISU A;  1SPI A;  4R6H A;  1B3F A;  3IL1 B;  4NF4 A;  2PCR A;  1QW0 A;  1NL5 A;  4KI0 E;  1B4H A;  5CMM A;  2B4L A;  3G7W A;  4FEB A;  3MWB A;  4OVS A;  1NV5 A;  3CR9 A;  4MEV A;  1QUI A;  4EQ7 A;  2P3V A;  1IUD A;  2H25 A;  1FQE A;  3KN7 A;  2OWT A;  3ILU B;  3H03 A;  4OZ9 A;  2F36 A;  4NF5 A;  1RYX A;  3IOW A;  1KA0 A;  3H6T A;  3GLB A;  4IGR A;  2JJK A;  5H8H B;  3U92 A;  2B3F A;  1TFA A;  2A5S A;  4R6Y A;  2X26 A;  4JB7 A;  4IB2 A;  3ECR A;  5AA2 D;  1DPE A;  4ZEI A;  3HN0 A;  5CI5 A;  1LST A;  5L9M A;  2ESN A;  3HHG A;  1DTG A;  2QS4 A;  3ONM A;  5F24 A;  4OVR A;  4LUB A;  4HCY A;  1DBZ A;  4JWY A;  5AA2 B;  5LDZ A;  4WKM A;  4YB6 A;  2XXV A;  3OO6 A;  1S7Y A;  1Q35 A;  4ZEB A;  3SEX A;  4DI3 D;  3LV0 A;  1FTM A;  2F7B A;  2HZK A;  2XD3 A;  4XTC Q;  1ZJL A;  2F34 A;  4AS4 A;  3TQW A;  4LON B;  1DMB A;  1IMA A;  1FPJ A;  2V3U A;  3FV1 A;  2I4C A;  4JSO A;  4P47 A;  1H76 A;  4EF1 A;  2FNC A;  1A8E A;  1OVT A;  4N17 A;  1JEV A;  5H8H A;  4DI4 B;  1DSN A;  2I6E A;  4IGT A;  4G8M A;  2ZYN A;  1LAX A;  1OVB A;  3RPL B;  1ZIU A;  4N6P A;  4TOZ A;  1N04 A;  4QXD A;  3RPW A;  2VGQ A;  5H8S A;  3MC2 A;  2P0S A;  4JWO A;  2REG A;  4X8R A;  3U1O A;  1NFT A;  1F9B A;  1UQW A;  4N13 A;  5DVJ A;  3A29 A;  2OZZ A;  3C34 A;  3QSL A;  1Z7M E;  5AA2 A;  2GHB A;  1LBX A;  3FVK A;  4YB7 A;  4R73 A;  2XXR A;  4RXL A;  5B7D A;  1FPI A;  4MHF A;  1YPN A;  5K2X A;  2O51 A;  1FPF A;  3FAS A;  3DP4 A;  3EHS A;  3B7D A;  3IX1 A;  2PFY A;  4BDN A;  4NF0 A;  1NV7 A;  4OFJ A;  4PBH A;  3TPA A;  5AE4 A;  4R9F A;  1N3W A;  2QMW A;  3S2V A;  1PBP A;  2ZNU A;  5H8N B;  1IMB A;  4G77 A;  2F7A A;  4GWW A;  5I2N B;  1TFD A;  5L9O A;  4C0R A;  2QRY A;  5ITO A;  1B2H A;  1FSA A;  1MM7 A;  3JZJ A;  1JVY A;  1QUJ A;  1NV6 A;  2XX9 A;  3RPL A;  4RYA A;  4YKJ A;  4PFR A;  1H45 A;  4OA4 A;  2ZYO A;  3QUF A;  4N6D A;  4MMP A;  2B4M A;  2WEF A;  1MQH A;  3FZV A;  3S9L C;  1B52 A;  1URS A;  4M1V A;  2QPQ A;  3UK4 A;  1IMF A;  3C32 A;  1UIV A;  4MCO A;  1D9V A;  5DEX B;  4P8B A;  2UVI A;  3LSX A;  3V83 A;  1FPL A;  1JET A;  4RK2 A;  3FJG A;  3CG1 A;  2ONR A;  5H8N A;  5HPQ A;  4N07 A;  3TQL A;  2F8D A;  5I2N A;  1II5 A;  4PET A;  1SW2 A;  2UYE A;  4R72 A;  2VOZ A;  3FJ7 A;  4RPO A;  3FXU A;  5I2K B;  3QXM A;  3PPP A;  3FJM A;  2QS3 A;  4GXS B;  2VPO A;  1YXI A;  4IO4 A;  3ZS6 A;  2VD3 A;  4C1U A;  3FIR A;  2Y7P A;  4BLA A;  4P3L A;  5CRY A;  2R71 A;  4GL0 A;  4QF9 A;  1FQD A;  1M5E A;  4NGU A;  4RA1 A;  2H9B A;  4OVQ A;  3DP8 A;  2PYY A;  4OWD A;  4MIJ A;  1P1Q A;  2R6G E;  4PP0 A;  4NED A;  2FVZ A;  1Y3N A;  5DEX A;  4GFR A;  2M8C A;  4X1D A;  4DIG A;  3A3U A;  4H0W A;  4WED A;  1INP A;  2V3T A;  1UTB B;  3IJX B;  3PPR A;  3O29 A;  3H06 B;  4P11 A;  2XXI A;  1KWH A;  3B6Q A;  4KFQ A;  3K6U A;  4NG7 A;  1JW5 A;  3BIH A;  5I2K A;  1YAE A;  1A54 A;  1OQH A;  3T9X B;  5FTI A;  5EHS A;  5JEI A;  1LAF E;  3OEM A;  1JW1 A;  4IO6 A;  1VFD A;  3MP1 A;  1FRP A;  3TDJ A;  1SW4 A;  2AYS A;  4HE2 A;  2XXH A;  4JVD A;  2NWJ A;  1QGX A;  3W9V A;  1O63 A;  1M5D A;  3HO7 A;  2DWI A;  5KZT A;  2DP8 A;  1WVJ A;  1FBH A;  1N84 A;  1SYH A;  3PU5 A;  3U65 A;  4UAC A;  5JK4 A;  2F35 A;  2XA5 A;  5FHO A;  3RT8 A;  2UXA A;  3K4U A;  4ESW A;  4LZ7 A;  2O68 A;  4POX A;  1FTO A;  3PUW E;  2OJT A;  1A7L A;  4DXC A;  3MP6 A;  4KCC A;  5ET6 A;  1UTB A;  2HAV A;  3Q25 A;  1B05 A;  3OEK A;  2F97 A;  4ZEF A;  2IA4 A;  1B3G A;  5FHM A;  3IOV A;  2XXY A;  4H6D A;  4F3B A;  3VE1 B;  3EPE A;  1PB9 A;  1QUL A;  4PAI A;  3VVF A;  2FIE A;  4YAH X;  4H5G A;  3H6U A;  3PUX E;  2WKY A;  5ISU A;  4OVJ A;  2P1S A;  1B6H A;  2XXK A;  2Y7I A;  1OIB A;  2ZZW A;  3K01 A;  3JYR A;  2ONS A;  3CIJ A;  2HQ0 A;  1HSL A;  2RC7 A;  2O84 X;  1MQG A;  5AA3 A;  2MKZ A;  3ROJ A;  2Y5L A;  4U4S A;  4Q0C A;  2D21 A;  4QHQ A;  5F1Q A;  3HST A;  1FTK A;  1MPD A;  3KBR A;  3CI8 A;  1K9Y A;  1XVY A;  1IEJ A;  4F2Q A;  3TFL A;  3FVN A;  5EHM A;  2XXP A;  3FVG A;  3QK6 A;  3MQ9 A;  1NH7 A;  1PDA A;  3OO9 A;  1QUK A;  2YLN A;  3K6W A;  4OAN A;  4DXB A;  5DTB A;  4OFO A;  1ZBM A;  1XVX A;  3O66 A;  3D4C A;  3H3G A;  4GF8 A;  3KOS A;  1GVC A;  3N5L A;  1LBV A;  4GWX A;  1M5C A;  4N15 A;  3ZKK A;  3VXC A;  1PBQ A;  3C9H A;  2R8T A;  4ZEC A;  3USD A;  4N81 A;  4MNC A;  2ZMB A;  4U1O A;  2HAU A;  1LCF A;  2QL3 A;  1MDP 1;  1MPB A;  1CNQ A;  4DE8 A;  3O28 A;  5I57 B;  2P3N A;  4PC9 A;  5IKB A;  3SEU A;  3MPK A;  3IR1 A;  3HCQ A;  3N6U A;  2HEU A;  5FBP A;  3IK6 B;  3VFJ A;  5IZ3 B;  4WEP A;  4I62 A;  1MG1 A;  3SEV A;  2NUV A;  3Q26 A;  4AS5 A;  4LN5 A;  4I8C A;  1MY0 A;  3ZSF A;  4GWO A;  4C1T A;  2V93 A;  1I69 A;  3PMW A;  4H65 A;  4U23 A;  1HSJ A;  4XIG Q;  5F7V A;  2DE3 A;  2H98 A;  3CSB A;  3DLN A;  3QMF A;  3HPI A;  3LSW A;  4O7M A;  1LFI A;  2HFB A;  5TU0 A;  4QRZ A;  1FPB A;  1LBY A;  4M4G A;  2I58 A;  4F1V A;  4OMB A;  1LFH A;  3W9W A;  3PPO A;  4U2R A;  5EYG A;  4AB6 A;  1PEB A;  2GQ1 A;  1ZU0 A;  2OWZ A;  2DE4 A;  2Q9T A;  3KC0 A;  2XWK A;  5I57 A;  3QUJ A;  1SW1 A;  3E4R A;  1FCK A;  4HE0 A;  1ZLQ A;  2ANJ A;  3EN3 A;  3T9V A;  3C4M A;  2G93 A;  4GD5 A;  4P1L A;  4GVO A;  3MVW A;  2XXQ A;  3PD8 A;  1FBC A;  2UVJ A;  4G61 A;  3E9X A;  1N3X A;  4XEQ A;  2F3D A;  4R75 A;  3Q28 A;  3FVO A;  5IZ3 A;  5J1D A;  3DM0 A;  4THI A;  5BWJ A;  2NXO A;  3C35 A;  3IFC A;  2HXR A;  2F5X A;  4QSE A;  1OMP A;  1CB6 A;  3K02 A;  2OWS A;  3H6W A;  3FUZ A;  4GOT A;  3V8X B;  2QSX A;  1XT8 A;  2CZL A;  2H99 A;  5DW8 A;  1MY4 A;  1SQY A;  2XX7 A;  1URG A;  3LUZ A;  3ODB A;  4ELQ A;  1R9Q A;  1LGB C;  1R9L A;  4WXJ A;  3PMX A;  1DCU A;  3K0V A;  4GQO A; 
#chains in the Genus database with same CATH homology
 2ZXT A;  4E0W A;  3M3F A;  4HS7 A;  3R26 A;  3KGC A;  3G3H A;  4LP2 B;  1JQF A;  2Z23 A;  5H8Q B;  3R7X A;  1A40 A;  4P0I A;  3EQ1 A;  2I0C A;  3MVY A;  4ND9 A;  1CE2 A;  2V84 A;  1ZKB A;  3VLU A;  4XXU A;  2O69 A;  5CMK A;  1B4Z A;  3LR1 A;  4LAT A;  3D4G A;  1GTK A;  2PT1 A;  4F3G A;  1I6B A;  3E13 X;  1N76 A;  4G2Z A;  3ZKL A;  3VVE A;  1AL3 A;  1B7Z A;  3EHT A;  1AMF A;  4IO5 A;  4KYE A;  1MY2 A;  3RTF B;  5H8F B;  1XC1 A;  3RTW B;  4I1D A;  3EHU A;  3KSJ A;  3IB2 A;  1L5T A;  1O7T A;  1Y1M A;  2V25 A;  3CFL A;  2ZYK A;  3RNN A;  5KDT B;  3A09 A;  3S9E A;  4XKR A;  3GZG A;  1B3H A;  2GRV A;  4IO2 A;  5H8Q A;  2KLF A;  3OO7 A;  2Q8J A;  1D4N A;  1J1N A;  4GLI A;  3K1M A;  1PB7 A;  3K00 A;  3L6G A;  3T96 B;  3S4U A;  1QKA A;  2O7U A;  4F2O A;  2LAO A;  3UP9 A;  1DTZ A;  3GXA A;  4KR5 A;  3PD9 A;  2DWA A;  4ELR A;  2I3V A;  3TMG A;  4YMA A;  1TWY A;  3T22 A;  1A99 A;  1POY 1;  4MFI A;  5H8F A;  2OCU A;  4QFN A;  2ABH A;  5DT6 A;  1FTL A;  3AXF A;  1P1U A;  3QYT A;  4TQU Q;  1BIY A;  4R74 A;  1MH3 A;  1Y20 A;  4RNS A;  2QS1 A;  3Q29 A;  3VV5 A;  2RIN A;  5KDT A;  5AA1 A;  4PQJ A;  1B9J A;  2AL5 A;  1R6Z A;  5ICT A;  3LC8 A;  2BJJ X;  1MY3 A;  2XXU A;  1LB9 A;  3MP8 A;  4OET A;  2Q88 A;  3B6W A;  4DLD A;  1P1W A;  4FEC A;  3WAF A;  1EZO A;  4KQP A;  1O64 A;  1D3K A;  5CC2 A;  2DOJ A;  4X9T A;  1AIV A;  4F31 B;  3MZB A;  1FQA A;  3E3K A;  1AOV A;  3SKP A;  1EH3 A;  4QFK A;  1US5 A;  4ZED A;  2QMX A;  4YZZ A;  4IY6 A;  1IIW A;  3U94 A;  3MPL A;  1EZP A;  4FIM A;  2ALU A;  3O6H A;  3LSL A;  4H8I A;  4KPT A;  1YTV A;  3O6G A;  2GFE A;  5CBS A;  2B3B A;  1B0H A;  1IIT A;  3V89 B;  3LBS A;  3HV1 A;  1LCT A;  3OOA A;  4QSD A;  2YJP A;  4X48 A;  3F11 A;  4ZZE A;  2RC9 A;  4OES A;  4NWC A;  5L9S A;  1S50 A;  3KOT A;  2I0B A;  2RKM A;  1GV8 A;  5CMC A;  4EQ9 A;  3O9P A;  1US4 A;  2VD2 A;  1URD A;  2Y7K A;  2DE2 A;  3U93 A;  3MUQ A;  4QSC A;  3OD7 A;  3PUV E;  5AA4 B;  3OXN A;  4R2B A;  4EXL A;  2O7I A;  4YB5 A;  3N94 A;  4LQ5 A;  2QJE A;  1PC3 A;  2DSF A;  4P0G A;  2XXT A;  2Z8E A;  3S9M C;  4F18 A;  1QVS A;  5IAI A;  3TTK A;  4GRK A;  3TTL A;  1IXC A;  5DVI A;  1I6A A;  5TP9 B;  4Q8R A;  2Y7R A;  3KZG A;  5FHN A;  2H5Y A;  2VP1 A;  2Z22 A;  5CM6 A;  1SDX A;  1H3D A;  1Y3P A;  4DCX A;  1MS7 A;  4OEU A;  3GBA A;  4YKI A;  3QIM A;  4K3F A;  4OEN A;  2OLB A;  4IO7 A;  1SBP A;  3G3I A;  1XOC A;  3BFU A;  5AA4 A;  2FYI A;  1B7H A;  4DZ1 A;  2GH9 A;  1IXG A;  1FQB A;  3GBB A;  1ELJ A;  3MW0 A;  1B5J A;  1NKX A;  1BKA A;  1MM6 A;  4X1B A;  3KSX A;  2Y84 A;  4ZS9 A;  3K6X A;  1POT A;  2X7Q A;  3KJT A;  5BUU A;  5TP9 A;  1H43 A;  1S9T A;  4YKP A;  3TCG A;  1MY1 A;  1B1H A;  2Y7W A;  4G8N A;  2THI A;  4Q30 B;  4EQB A;  3UN6 A;  3OSQ A;  1M5B A;  3TTN A;  1Z7N E;  2P2A A;  5TPA B;  4HW8 A;  2VHA A;  5CBR A;  4U21 A;  3TTM A;  1IXI A;  3MZ1 A;  1DOT A;  4Z0I A;  2UVG A;  1JW4 A;  3CG3 A;  4EDP A;  2D3I A;  1FQF A;  3IOR A;  2QS2 A;  4GIZ A;  2PMS A;  1VR5 A;  1MXV A;  4RPN A;  2O1L A;  5DVF A;  1Y1Z A;  3FV2 A;  4YIC A;  3MJN A;  1M5F A;  1SW5 A;  3FXQ A;  2DS9 A;  3TCH A;  1B58 A;  2XX8 A;  1VE4 A;  4H5F A;  3TEP A;  1B3E A;  5I59 B;  3L6H A;  3T66 A;  4FAT A;  2A5T B;  4RY1 A;  5CMB A;  4TLM B;  2UYF A;  4DCY A;  2PX1 A;  1Y4C A;  2DYX A;  2HXW A;  4O3C A;  3T9U A;  2F7C A;  5TPA A;  4IO3 A;  4BDM A;  5ELV A;  4RJZ A;  1B5H A;  3C33 A;  2GHA A;  5HBC A;  3IB0 A;  3IO6 A;  2F6G A;  4QFP A;  4BDR A;  4H8J A;  4TLL B;  1B7U A;  3IAZ A;  2I4B A;  2OK2 A;  4KYS A;  3KJ7 A;  4U1Z A;  4G68 B;  4JXI A;  4ONY A;  1MXZ A;  2DQV A;  4H1X A;  1N7W A;  3FXR A;  4E0X A;  2DXY A;  3PV0 E;  1B3L A;  5M2V A;  1N7X A;  4DXU A;  4YKK A;  1H44 A;  3TKD A;  3LSF B;  5I59 A;  3T9H B;  1MXU A;  2A5T A;  3IOT A;  3TYH A;  4YMB A;  2H4I A;  3RN8 A;  4ECF A;  4PFU A;  4KCD A;  4H67 A;  1MH4 A;  3CFX A;  3U8Q A;  2DWJ A;  3G3F A;  3V5A A;  3UIF A;  1OLC A;  2XD2 A;  1MQD A;  3RT6 B;  4FE8 A;  5B70 A;  5HM4 B;  3C36 A;  4IY5 A;  3RY3 A;  4OFL A;  2W7Y A;  4FJP A;  3H7M A;  3MZ9 A;  4JBZ A;  4G68 A;  1NNK A;  4RK9 A;  5KCJ B;  4EXK A;  2G29 A;  2YPN A;  4XKP A;  4LQ2 A;  3MVZ A;  1MPC A;  3OO8 A;  2PBW A;  2RCB A;  3BKI B;  5I58 B;  1A8F A;  1B5I A;  4FAJ A;  4YU0 A;  3H4Z A;  2Z8F A;  3PUY E;  4QFL A;  1IXH A;  3KN8 A;  2PT2 A;  1ATG A;  5L8D A;  2DWH A;  3VVD A;  3I3V A;  2O1M A;  3RUM A;  2DVC A;  4PFT A;  3MVX A;  4MH5 A;  4R6K A;  3H6V A;  4R9G A;  3BFT A;  3K2D A;  3DEL B;  4OXV A;  2I3W A;  3CFZ A;  1NNP A;  1B32 A;  4AQ4 A;  5KCJ A;  4NE4 A;  3BBR A;  4POW A;  4ZEK A;  1GGG A;  3TUS A;  1ZTY A;  3UA8 A;  4JSD A;  1TXF A;  3CRB A;  3OEN A;  1P99 A;  3OEL A;  4QFO A;  1SI0 A;  5I58 A;  2RC8 A;  1MQJ A;  3THI A;  2ZNT A;  3PMV A;  1R1N A;  1XS5 A;  2UVH A;  1YCJ A;  1IZ1 A;  4ELP A;  2NVU B;  1P1O A;  4XKN A;  3PPQ A;  1BLF A;  4PFW A;  1ANF A;  3U72 A;  3K1N A;  4ZE8 A;  1WOD A;  3VLV A;  4MBP A;  3SET A;  3I6V A;  4KYD A;  1HSE A;  3WAE A;  3FAT A;  3IO4 A;  4MLQ A;  2E0S A;  4R2F A;  2R9J A;  2F78 A;  2OBG A;  2HZL A;  4G8H A;  1FTJ A;  4JDF A;  1AH5 A;  3VLW A;  1JEU A;  5LOM A;  1TT1 A;  3CVG A;  4LA9 A;  4PE5 B;  4FED A;  1LBB A;  1EU8 A;  1NNF A;  1UIU A;  1SVX B;  4F39 A;  2AIX A;  1B51 A;  4OYV A;  1PB8 A;  2NOO A;  1WDN A;  1LFG A;  5JTY B;  1FQC A;  3RQT A;  3C31 A;  4G4P A;  4F29 A;  2F6P A;  1A55 A;  1B40 A;  3TTR A;  1N0T A;  2X7P A;  1JNF A;  4Z7E A;  2XXX A;  1VFE A;  4F3P A;  3RLF E;  1Y9U A;  4OQO A;  3TOD A;  5DYH A;  3O97 A;  2O6A A;  1OQG A;  4I9D A;  3O2A A;  1SD3 A;  4LZ5 A;  3SEY A;  1MXY A;  1NNT A;  3M3K A;  5I84 A;  3KN3 A;  4L17 A;  5A5X B;  4ZZA A;  3R6U A;  3B6T A;  5ICQ A;  3FGS A;  1IQ7 A;  1NH8 A;  3VXB A;  5JTY A;  2IEE A;  3IOU A;  3EF7 A;  4GL8 A;  1OLA A;  1MXW A;  3VDF A;  4BDQ A;  2D5W A;  3M8U A;  4KD5 A;  2ZNS A;  4O3B A;  4MF3 A;  4F22 A;  3PGF A;  1RYO A;  4XKQ A;  2DVZ A;  1NMU A;  1MQI A;  4AB5 A;  3TEL A;  4G68 C;  4U4X A;  1VSO A;  4ZDM A;  4O3A A;  1Q1K A;  1MRP A;  1MDQ A;  2PVU A;  4HCW A;  3KG2 A;  3Q27 A;  2RCA A;  1SYI A;  3CSG A;  4NF6 B;  1FW0 A;  1JVX A;  1Y4T A;  3A3C A;  3FD3 A;  4ESX A;  3K6V A;  5A5X A;  4NWD A;  2Q2A A;  3OSR A;  3JV9 A;  3N6T A;  4OHN A;  4GXA A;  2XHD A;  2Z8D A;  3PPN A;  1EZ9 A;  2E1S A;  4BDO A;  2DXR A;  3KEI A;  4OTE A;  1T0K A;  4PFY A;  4LZ8 A;  3W15 C;  3SEW A;  4FOR A;  1B46 A;  2FA7 A;  1B0L A;  3G3G A;  5FTH A;  1BTJ A;  1USY H;  3N26 A;  4F3S A;  3OMB A;  2I49 A;  3T93 B;  2HCA A;  3G3K A;  3PUZ E;  3ILT B;  4EF2 A;  2CMO A;  1LAG E;  3IJO B;  3SDF A;  4NMY A;  1USY E;  4OEV A;  1QKB A;  1D9Y A;  2ONK E;  4NTL A;  3SER A;  3RGY A;  3MAM A;  4NF6 A;  3DP6 A;  3TZA A;  5I56 B;  1LLS A;  1P1N A;  3TCF A;  1Y3Q A;  3G3J A;  1GR2 A;  1ZMG A;  4JWX A;  1QJM A;  4LVQ A;  3SES A;  4ELO A;  4Q5T A;  4EUO A;  3KFM A;  4F1Y A;  3S9N C;  2AL4 A;  1UTH B;  4DDD A;  4NF8 B;  3P7I A;  2B65 A;  4NF4 B;  4ZE9 A;  1LBC A;  1DPP A;  2I48 A;  4BDL A;  4KHZ E;  3LUY A;  5ITP A;  4U22 A;  4UA8 A;  3UOR A;  1MXX A;  4OER A;  4F19 A;  3QAX A;  3UGW A;  1LB8 A;  2V3Q A;  3HHF A;  1B1X A;  2REJ A;  4F1U A;  1XHY A;  3MBP A;  1LAH E;  2XXW A;  4NF5 B;  5I56 A;  2RF1 A;  1RKM A;  4HTG A;  5K2Y A;  1I6Q A;  3K1P A;  3TAJ A;  3O6I A;  1SI1 A;  2Q89 A;  1BP5 A;  2ZYM A;  3IB1 A;  3I5O A;  4MLV A;  3M3L A;  5EYF A;  1UTH A;  2Q2C A;  4NF8 A;  4ISU A;  4R6H A;  1B3F A;  3IL1 B;  4NF4 A;  1QW0 A;  1NL5 A;  4KI0 E;  1B4H A;  5CMM A;  3G7W A;  4FEB A;  3MWB A;  3CR9 A;  1QUI A;  4EQ7 A;  1IUD A;  2H25 A;  1FQE A;  3KN7 A;  2OWT A;  3ILU B;  3H03 A;  4OZ9 A;  2F36 A;  3IOW A;  1RYX A;  4NF5 A;  3H6T A;  3GLB A;  4IGR A;  5H8H B;  3U92 A;  2B3F A;  1TFA A;  2A5S A;  4R6Y A;  2X26 A;  4JB7 A;  4IB2 A;  3ECR A;  5AA2 D;  1DPE A;  4ZEI A;  3HN0 A;  5CI5 A;  1LST A;  5L9M A;  2ESN A;  3HHG A;  1DTG A;  2QS4 A;  3ONM A;  4LUB A;  4HCY A;  4JWY A;  5AA2 B;  4WKM A;  4YB6 A;  2XXV A;  3OO6 A;  1S7Y A;  1Q35 A;  4ZEB A;  3SEX A;  1FTM A;  2F7B A;  2HZK A;  2XD3 A;  4XTC Q;  1ZJL A;  2F34 A;  3TQW A;  4LON B;  1DMB A;  2V3U A;  3FV1 A;  2I4C A;  4JSO A;  1H76 A;  4EF1 A;  2FNC A;  1A8E A;  1OVT A;  1JEV A;  5H8H A;  1DSN A;  2I6E A;  4IGT A;  4G8M A;  2ZYN A;  1LAX A;  1OVB A;  1ZIU A;  4N6P A;  4TOZ A;  1N04 A;  3RPW A;  2VGQ A;  5H8S A;  3MC2 A;  2P0S A;  4JWO A;  2REG A;  3U1O A;  1NFT A;  1F9B A;  1UQW A;  4N13 A;  5DVJ A;  3C34 A;  2OZZ A;  3QSL A;  1Z7M E;  5AA2 A;  2GHB A;  3FVK A;  4YB7 A;  4R73 A;  2XXR A;  4RXL A;  5B7D A;  1YPN A;  5K2X A;  2O51 A;  3FAS A;  3DP4 A;  3EHS A;  3B7D A;  3IX1 A;  4BDN A;  4OFJ A;  3TPA A;  5AE4 A;  4R9F A;  1N3W A;  2QMW A;  3S2V A;  1PBP A;  2ZNU A;  5H8N B;  4G77 A;  2F7A A;  5I2N B;  1TFD A;  5L9O A;  4C0R A;  2QRY A;  5ITO A;  1B2H A;  1MM7 A;  3JZJ A;  1JVY A;  1QUJ A;  2XX9 A;  4RYA A;  4YKJ A;  1H45 A;  2ZYO A;  3QUF A;  1MQH A;  3FZV A;  3S9L C;  1B52 A;  1URS A;  4M1V A;  2QPQ A;  3UK4 A;  3C32 A;  1UIV A;  1D9V A;  5DEX B;  2UVI A;  3LSX A;  3V83 A;  1JET A;  4RK2 A;  3FJG A;  3CG1 A;  2ONR A;  5H8N A;  5HPQ A;  4N07 A;  3TQL A;  2F8D A;  5I2N A;  1II5 A;  4PET A;  1SW2 A;  2UYE A;  4R72 A;  2VOZ A;  3FJ7 A;  4RPO A;  3FXU A;  5I2K B;  3QXM A;  3PPP A;  3FJM A;  2QS3 A;  4GXS B;  4IO4 A;  3ZS6 A;  2VD3 A;  4C1U A;  3FIR A;  2Y7P A;  4BLA A;  5CRY A;  2R71 A;  4GL0 A;  4QF9 A;  1FQD A;  1M5E A;  4RA1 A;  2H9B A;  3DP8 A;  2PYY A;  4OWD A;  1P1Q A;  2R6G E;  4PP0 A;  4NED A;  1Y3N A;  5DEX A;  2M8C A;  4GFR A;  4DIG A;  4X1D A;  3A3U A;  4H0W A;  4WED A;  2V3T A;  1UTB B;  3IJX B;  3PPR A;  3O29 A;  3H06 B;  4P11 A;  2XXI A;  1KWH A;  3B6Q A;  4KFQ A;  3K6U A;  1JW5 A;  5I2K A;  1YAE A;  1A54 A;  1OQH A;  3T9X B;  5FTI A;  5EHS A;  5JEI A;  1LAF E;  3OEM A;  1JW1 A;  4IO6 A;  1VFD A;  3MP1 A;  3TDJ A;  1SW4 A;  2AYS A;  2XXH A;  2NWJ A;  3W9V A;  1O63 A;  1M5D A;  3HO7 A;  2DWI A;  5KZT A;  2DP8 A;  1WVJ A;  1N84 A;  1SYH A;  3PU5 A;  4UAC A;  5JK4 A;  2F35 A;  5FHO A;  3RT8 A;  2UXA A;  3K4U A;  4ESW A;  4LZ7 A;  2O68 A;  4POX A;  1FTO A;  3PUW E;  2OJT A;  1A7L A;  4DXC A;  3MP6 A;  4KCC A;  1UTB A;  2HAV A;  3Q25 A;  1B05 A;  3OEK A;  2F97 A;  4ZEF A;  2IA4 A;  1B3G A;  5FHM A;  3IOV A;  2XXY A;  4H6D A;  4F3B A;  3VE1 B;  3EPE A;  1PB9 A;  1QUL A;  3VVF A;  4YAH X;  4H5G A;  3H6U A;  3PUX E;  2WKY A;  5ISU A;  4OVJ A;  2P1S A;  1B6H A;  2Y7I A;  1OIB A;  3K01 A;  3JYR A;  2ONS A;  3CIJ A;  2HQ0 A;  1HSL A;  2RC7 A;  2O84 X;  1MQG A;  5AA3 A;  4U4S A;  4Q0C A;  2D21 A;  4QHQ A;  5F1Q A;  3HST A;  1FTK A;  1MPD A;  3KBR A;  3CI8 A;  1XVY A;  1IEJ A;  4F2Q A;  3TFL A;  3FVN A;  5EHM A;  2XXP A;  3FVG A;  3QK6 A;  3MQ9 A;  1NH7 A;  1PDA A;  3OO9 A;  1QUK A;  2YLN A;  3K6W A;  4DXB A;  5DTB A;  4OFO A;  1ZBM A;  1XVX A;  3O66 A;  3D4C A;  3H3G A;  4GF8 A;  3KOS A;  1GVC A;  3N5L A;  1M5C A;  3ZKK A;  3VXC A;  1PBQ A;  3C9H A;  4ZEC A;  3USD A;  2ZMB A;  4U1O A;  2HAU A;  1LCF A;  2QL3 A;  1MDP 1;  1MPB A;  4DE8 A;  3O28 A;  5I57 B;  5IKB A;  3SEU A;  3MPK A;  3IR1 A;  3HCQ A;  3N6U A;  2HEU A;  3IK6 B;  3VFJ A;  4WEP A;  4I62 A;  1MG1 A;  3SEV A;  2NUV A;  3Q26 A;  4I8C A;  1MY0 A;  3ZSF A;  4GWO A;  4C1T A;  2V93 A;  1I69 A;  3PMW A;  4H65 A;  4U23 A;  1HSJ A;  4XIG Q;  5F7V A;  2DE3 A;  2H98 A;  3CSB A;  3DLN A;  3HPI A;  3LSW A;  1LFI A;  2HFB A;  5TU0 A;  4QRZ A;  4M4G A;  2I58 A;  4F1V A;  4OMB A;  1LFH A;  3W9W A;  3PPO A;  4U2R A;  4AB6 A;  1PEB A;  1ZU0 A;  2DE4 A;  2Q9T A;  5I57 A;  3QUJ A;  1SW1 A;  3E4R A;  1FCK A;  1ZLQ A;  2ANJ A;  3EN3 A;  3T9V A;  3C4M A;  2G93 A;  4GD5 A;  4GVO A;  3MVW A;  2XXQ A;  3PD8 A;  2UVJ A;  3E9X A;  1N3X A;  4R75 A;  3Q28 A;  3FVO A;  5J1D A;  3DM0 A;  4THI A;  5BWJ A;  2NXO A;  3C35 A;  2F5X A;  4QSE A;  1OMP A;  1CB6 A;  3K02 A;  2OWS A;  3H6W A;  3FUZ A;  4GOT A;  3V8X B;  2QSX A;  1XT8 A;  2CZL A;  2H99 A;  1MY4 A;  1SQY A;  2XX7 A;  1URG A;  3ODB A;  4ELQ A;  1R9Q A;  1LGB C;  1R9L A;  4WXJ A;  3PMX A;  3K0V A;  4GQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...