1R9TJ

Rna polymerase ii strand separated elongation complex, mismatched nucleotide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA strand
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1r9tJ00
2L7ZA 1U78A 1RPWA 3A02A 2XB5A 5FLMJ 1JJ6C 1K83J 2Y30A 3HKZN 1F43A 1POGA 2RAEA 2YUSA 2HOSA 2PMZN 5M5WJ 4BKXA 2R7ZJ 5IYDJ 2OF7A 3ZQFA 2EZKA 5IYCJ 1JKOC 2LLKA 3QPSA 3S15J 3OIOA 2L7FP 3LSGA 2OPTA 2WAQN 1I3QJ 2EZLA 4BBSJ 2JJ7A 5F0CA 3TEDA 2MSYA 2WV1A 3FIWA 3MN2A 4M3BA 4DW6A 3S1RJ 4MO7A 3HOZJ 1OCTC 2H1KA 2P81A 4MLOA 4CYCA 2HOTA 4G12A 2VKEA 4BY7J 3SDGA 5HODA 1X58A 4A3KJ 1WPKA 3ZQHA 4DZJA 1MSFC 2DJNA 2EZIA 1SANA 4A3EJ 1JKQC 2K9QA 2ECBA 1JTXA 5FKOA 2JK3A 1MH4A 2GM4A 2KT0A 1IRZA 3JRBA 1TWHJ 2R93J 3S16J 5BNGA 1HDPA 1MBJA 3BR6A 1JT0A 1D5YA 4IHWA 3HOYJ 2XGCA 1AKHB 2GLOA 3GTMJ 5IOZA 1JJ8C 4D7NA 3FISA 1OCPA 4FISA 1T33A 3RZOJ 5EZGA 1ETOA 2EBIA 3SFIA 3BT9A 1VF9A 2HI3A 3Q3SA 4XRSG 2ELKA 2HOAA 2R5ZA 2QF7A 3HM5A 2Y2ZA 3JREA 2JN6A 1UHSA 1BL0A 1QRYA 3HGYA 5K7FA 1T56A 4FTHA 1MBGA 1WH5A 1BA5A 2W48A 2QCOA 1Y1WJ 2EQRA 1ETVA 2MG4A 2COBA 1W0UA 3S17J 2K40A 2R0QC 3JRHA 2R5YA 1ZK8A 3IH4A 1IUFA 1HF0A 4A3IJ 2IEKA 1RR7A 1VNDA 4V2GA 2HDDA 3HEFA 2Y9ZA 1QVTA 2LR8A 3BR3A 3GBGA 4QSHA 3ZQCA 4LOCA 4A3JJ 2O9LA 2JA5J 1XC5A 2ID3A 2XPWA 4IHYA 1WCMJ 3OOUA 2LFBA 2K9NA 2K9SA 1ZR2A 3S1NJ 3E7LA 2M34A 1DU0A 1YRNA 1RKWA 1GUUA 1TC3C 1DU6A 1GV2A 1MBFA 3LSJA 5IP6A 5IOYA 3JRFA 2E2HJ 2XPVA 2HXOA 1BW6A 2O7OA 3LNQA 1IC8A 1JT6A 4A3LJ 5C4XJ 4UUSB 3LSPA 1MNMC 3PO2J 3B6AA 1XG1A 1NK3P 2Y9YA 2O8KA 2I10A 1G2HA 4A93J 3HOVJ 2L0KA 1ENHA 1U9NA 4C3IJ 1TWAJ 3GTKJ 4JX6A 4B3AA 3BR0A 1LFBA 4AYBN 4DYQA 1H8AC 2DA5A 2EZHA 4FCYA 2JA6J 4DZPA 4XICA 1IDZA 1ZKGA 1IGNA 2TRTA 1GT0C 1W0TA 1X2NA 1OFCX 3HB9A 5FJ8J 1PUFB 1B72A 5GPCA 1LFUP 3M3YJ 5J1RA 2JWTA 3TP3A 2R92J 3H3VK 3G1MA 3K7AJ 2ID6A 3A01A 2XB0X 3IH2A 5M3MJ 3TW7A 2VPRA 1GDTA 1AU7A 4M6VA 1O4XA 4B4CA 3GTGJ 1F36A 2DA1A 4DYCA 4IHVA 3ZQGA 4C3HJ 5C4JJ 4L5EA 2YU9J 2WB1N 4A3FJ 1AHDP 1FIPA 4B1RA 2B63J 5J1UA 3C2BA 2IAIA 3CDLA 4JX5A 1ZGWA 2XPUA 3IV5A 2CRGA 3MVPA 3LSRA 3OSFA 1MH3A 4IHXA 2HXIA 5EG0B 4JP0A 2MW8A 2LD5A 3FK7A 5C3EJ 4J19A 3JRDA 1ETXA 2ECCA 1LE8B 3H0GJ 1MBEA 3G1LA 3BR2A 2CJJA 1WH7A 4MFDA 1HOMA 4XIDA 2LP0A 1TWCJ 1WGXA 5C44J 2NVTJ 2MGQA 5K7HA 4I6ZA 1ITYA 3WHBA 5DS9A 1JUSA 2DMPA 1UG2A 2XSDC 3UKGA 2X6OA 3A03A 4DYRA 3HOWJ 5JLXA 1JTYA 3D1NI 5M3FJ 1MBKA 4BBRJ 1BW5A 3GTQJ 2E19A 4RDUA 1PUFA 3NARA 5GP9A 3TP0A 2NVQJ 3G1OA 3BQYA 3GTOJ 3GTPJ 1HLVA 3HDDA 2FD5A 1MBHA 1Z0XA 2EH3A 2DA4A 4V2FA 5F1JA 1IV6A 1H89C 2D5VA 1NK2P 4X6AJ 1HDDC 1RESA 2DA3A 3BG9A 2AO9A 5M5YJ 4W97A 2M8GX 4C2MJ 1HCRA 2FX0A 3K2AA 4HNVA 5M5XJ 1ZR4A 1TWFJ 5EZHA 2N8GA 4EEFG 1ETYA 2CU7A 5E3OA 4FE7A 1JKPC 2NS8A 2CUFA 4CYCB 1SFOJ 2NOGA 4A3MJ 1AKHA 2JA7J 3HOUJ 2CQQA 2M2EA 4D5CA 2VKVA 3ZQIA 3CMYA 1LE8A 5JLWA 2ZB9A 3BTJA 2Y31A 3BG3A 4C3JJ 5EF6A 3Q0UA 3QPLA 3JRCA 4UUTA 3BTIA 3S14J 4XK4A 3S1MJ 5EYRA 1RKTA 1B8IB 3O8HA 5FLVA 2CUEA 5E3LA 1ETWA 1ETQA 3LOCA 2NVYJ 3ZOBA 1CQTA 5K7ZA 5IP9J 3DCFA 1IG7A 4ABZA 3SJMA 4XRMA 3L1PA 2R5ZB 1QPIA 2DA2A 2ME6A 2IBDA 3JRGA 4A3GJ 1FTZA 1VFCA 4Y7NJ 2ME0A 1FIAA 4A69C 3JRIA 3IH3A 1GVDA 2LKXA 2LVSA 4FE4A 3GTLJ 1ZTRA 3NAUA 5IP7J 2TCTA 2KDZA 1Q1VA 5F04A 3B6CA 2DTZA 2Y0SN 2R5YB 4M3FA 1IJWC 4JYKA 1ORKA 4X1EA 2E2IJ 5FKLA 1QVUA 4D5FA 4AUXA 3F0CA 3RQIA 2DN0A 2M9HA 5F08A 4M3DA 5FKNA 3HOXJ 1FEXA 2HYJA 3S1QJ 3RZDJ 2G0EA 3PO3J 3O8GA 2XGEA 5GPAA 1U8BA 4RBOA 4M3EA 5EEAA 1P7IA 4JX4A 1JGGA 4UUSA 2L7MP 3BTCA 2NVXJ 3FK6A 2DMNA 1K61A 1FTTA 9ANTA 1I6HJ 2DMQA 3BR5A 5F27A 4AC0A 2H8RA 1YRNB 5FKKA 1U9OA 4M3GA 1Y1VJ 4QTRA 1A5JA 3JR9A 1B8IA 1UMQA 2HQ5A 3CCYA 1OJLA 4A3CJ 1XS9A 1FJLA 5EGOB 1IDYA 3JRAA 5J3LA 5E3NA 5F0FA 2LY9A 1GV5A 1ETKA 2E2JJ 2FJ1A 3Q0WA 3QQAA 4S0HB 2DMUA 1RETA 2FQ4A 3MKLA 4BY1J 2GBYA 4W1UA 3CQZJ 4XRSA 1JKRC 2X9DA 3M4OJ 4A3DJ 3Q0VA 5EDNA 2L9RA 2M0CA 1NTCA 1APLC 3GTJJ 1MSEC 2X48A 4QIWN 3HBLA 1JUPA 2LK2A 3DEWA 5DTDA 1BJZA 1B72B 1S7EA 1WI3A 1X2MA 2NS7A 3S2HJ 1P7JA 2DA6A 2E1OA 4Y52J 4I76A 3OSGA 5EG0A 5IYBJ 2AHQA 3PM1A 5F0HA 3A01B 3BG5A 2DA7A 5J1YA 3BQZA 4MIMA 4MFEA 1E3OC 3S2DJ 4D7MA 1ZQ3P 3HGGA 3BR1A 1I50J 4A3BJ 4GFBA 3I4MJ 1EF4A 1JUMA 5FKMA 1R9TJ 1H88C 3RKQA 2XRLA 1A6IA 2JA8J 2LTPA 2YS9A 4BXXJ 1Z77A 2DMTA 3ZQLA 4IEJA 2VI6A 2VUMJ 2XGDA 3WHCA 3VPRA 1VI0A 5EGOA 1TWGJ 2JMWA 4NDLA 5E3MA 3TW6A 3W6VA 3I4NJ 2CQXA 3BTLA 5IPAA 3FKIJ
chains in the Genus database with same CATH superfamily
5ERIA 1RPWA 4XN0A 4YIIA 2QSHX 3KP5A 1FMWA 1JJ6C 3IHUA 2X1DA 3KP3A 1SD4A 1WJAA 2O8XA 3TO9A 1FYLA 1G4DA 1YIJI 5DUIA 1Q1HA 3QPTA 4BYYA 2LF7A 2DK8A 2PMZN 2F6CA 2R7ZJ 3ECOA 2ZJ2A 1WJFA 2COMA 4JQFA 2FOWA 3LL7A 2EFNA 5IYCJ 2DYRH 1ODDA 3WTZA 3QWLA 3VOEA 2LLKA 3QPSA 1HA8A 5CVRA 3TKYA 1Z1DA 1G8XA 4N0BA 3BG7A 3LSGA 1I3QJ 2EZLA 1YG2A 4ASNA 2V9KA 5F0CA 3RTRA 2WV1A 4UNOA 3MN2A 4M3BA 4HNUA 2P81A 4MLOA 4HSRA 3CDHA 1WFXA 3HPGA 3KE2A 1SAXA 1YIOA 1FY7A 1WHUA 1X1PA 2EZIA 4CUGA 1WQ2A 4A3EJ 3KEOA 1JKQC 2ECBA 1AWCA 1QPMA 3J80K 1XTAA 3T0YA 2KIQA 4Q4ZF 2GM4A 1FOXA 2KT0A 3FM5A 2OTLI 1XGSA 1TWHJ 3BDDA 4G8XA 4MTEA 1LVAA 2BE5F 3S16J 3MCZA 3UR3C 1EA3A 1HDPA 1MBJA 5AIPA 2GA1A 2YPRA 2XUBA 3COAC 4PFOA 2XGCA 3VEPA 5DCFA 4C9YA 4D7NA 5JVTA 3G73A 1YX5A 2KRCA 4XOPA 1TBXA 2F4IA 4RAGA 2DODA 4DBQA 1QNTA 1J75A 2XF7A 1ETOA 1FYKA 1S7AA 3CP2A 3Q3SA 4F7ZA 1DP7P 4XRSG 3HRUA 5KAFC 1EKEA 3IWZA 2Y2ZA 3H1CA 5DYMA 3JREA 2KISA 5LHHA 1BL0A 2OCEA 3S32A 2O3FA 3OYMA 4EGYA 3HGYA 2W00A 3BC8A 3ZP5A 1Y1WJ 2EQRA 5E20A 3S3OA 4RM2A 1MZBA 3DP7A 2K86A 2DYSH 2F5VA 4YEJA 3JRHA 1HBXG 3IH4A 2VKDA 4A3IJ 1RR7A 3MD2A 5F64A 2HWVA 4BUPA 3BY6A 3I3LA 1D5VA 3ERED 3E5QA 2VJIA 2ZXIA 3GBGA 4M74A 4HDVA 4BXFA 4E7KA 2ZNZA 4LOCA 2ZJPF 1O3RA 4XLEA 2ID3A 2XPWA 1IN4A 1O7FA 2KPMA 4IHYA 3EYIA 1WCMJ 4J01A 3GFIA 1JE8A 1VZ0A 2LFBA 2MA3A 2M7AA 2K9SA 3KPHA 2CUZA 3ABLH 4N4NB 3C1DA 1TP4A 2M34A 3GMEA 1DU0A 2ZSIB 3MZ8A 5JI6A 1A31A 4KUMA 1GUUA 1V54H 1R4MB 2X1EA 1NG6A 2HDWA 1TC3C 2H1LA 1MBFA 3QODA 1DU6A 1I39A 4E70A 3OYKA 1IN5A 2ZJRF 2E2HJ 2LSOA 2A6HF 2XPVA 2O7OA 1JT6A 2YR2A 4NQWA 1Y8QB 3PSFA 1XG1A 1NK3P 4DIQA 2HNHA 1XN7A 2GIZA 3GWZA 3F8MA 3HOVJ 4MEYF 2L0KA 3MKZA 1BI0A 3BROA 3RDIA 1OCOH 2CG4A 2VC1A 1S72I 3BR0A 4XSZF 1OR7C 1LFBA 4IQ4A 2VONA 2GZWA 1X1CA 3ZMSA 1BR2A 1Y6IA 2JA6J 3QP5A 4DZPA 3EUAA 4XICA 4H0EA 1GT0C 5CVIA 3CMAI 1PUFB 3HB9A 1SVLA 2LREA 3PQJA 5ED4A 3CO6C 2MLGA 4D1QA 1LFUP 1B72A 3ZQ7A 1YW7A 1Z6TA 2JWTA 1QZEA 3H3VK 3K7AJ 3H9QA 3JTHA 2P5LC 2R7WA 4HA8A 3TW7A 5JHFA 4XN3A 1DP3A 1ERDA 1A36A 3VWBA 1UZCA 1JI8A 2BY1A 1Z7LA 4M6VA 4A5NA 4CGZA 2ACJA 1F36A 2DA1A 3ZXSA 4A0XA 1D0ZA 2OJED 2ZCWA 4IHVA 3ZQGA 3H35A 5DD8A 3RYPA 3U1KA 3WTVC 4G7ZF 3DU6A 2PN6A 1AHDP 1TW2A 2FXAA 5BPDA 2VT2A 3C2BA 5J1UA 1D8JA 3LA2A 3CDLA 1X4OA 2CRGA 1ZELA 1UELB 5B1AH 2Y48A 1KYZA 2IS6A 5F6FA 4EV0A 3IRQA 2ECCA 3K2ZA 3L2UA 1PUEE 2DK5A 5DM7F 1MBEA 2LF8A 1B9MA 4IJAA 2E60A 4HOBA 2QWWA 5D5WB 3CCSI 4MFDA 4PGHA 4XIDA 2WY7Q 2JUCA 1SMYF 3H5AA 2M7BA 2NVTJ 5D6FA 3AG3H 5FROA 2H09A 1R5GA 1ZYRF 2HPMA 3HKZA 2Z2SB 3G3ZA 5E17F 1EJ9A 5BQTA 3SEQA 3OR1C 3LFUA 2M1BA 3UKGA 3ZMTA 2DXIA 2RV8A 4DYRA 2RNGA 1XCVA 1MBKA 1OCRH 5M3FJ 1BW5A 3BWGA 4MTDA 3GTQJ 1P2FA 2E19A 1B9NA 2WAQA 4HX8A 4RDUA 1BC8C 4CCMA 4BGDA 4B8XA 3L7WA 3BCBA 3R60A 3CESA 3GTPJ 2HVSA 2G9WA 1YJNI 3BJ6A 1R00A 2BOLA 1XGMA 2FD5A 1KQ0A 3W2VA 1V5EA 4L9TA 4V2FA 3I59B 3ROUA 1PYVA 4R79A 2I8DA 1H89C 1R6RA 1NK2P 4IOCF 1ZG5A 2D5VA 1HDDC 4M6XA 1RESA 2DA3A 3LSMA 2V9VA 4C2MJ 1V5GA 1BR1A 4HNVA 3L2CA 1YI2I 5KVRA 5KAIC 1YQAA 2N8GA 4WF2A 1ETYA 2CU7A 4Q5SF 2DAOA 3EDPA 2XF5A 2LY1A 4CYCB 3GVAA 2UXXA 2W25A 1SFOJ 2CS3A 3M07A 2JUGA 4ENKA 5KHDA 1R36A 2VKVA 4LFUA 1LE8A 5JLWA 4OAYA 2UZKA 1DQUA 3DPTA 1OR7A 1Y8RB 1P92A 1IXSB 1A6QA 3K1MA 1WI9A 4UUTA 3CC7I 3DU5A 1WJ5A 5GADJ 3S14J 1RKTA 2WC2A 4P96A 3IUOA 1IAWA 2W82A 4M73A 2CUEA 1R7JA 3F22A 1AA7A 3V8KA 4IOAF 1ETWA 3RKYA 1BBYA 1QGPA 1QBJA 2NNNA 3WTWC 4UXNA 2RREA 1IG7A 3OY9A 1UAAA 3SJMA 4XRMA 2KQRA 2BW3A 1I3AA 4BQQA 3OYLA 4O3MA 1VQNI 1OYYA 3ESWB 3MQ0A 1IW7F 2ADUA 2KIMA 1J7KA 4FETA 1VFCA 3RKXA 3KFWX 3LA3A 3GXOA 4XL9A 4Y7NJ 1W36D 1FSEA 3IH3A 3DF8A 2CFOA 4CHUA 3E97A 4Q48A 2K7LA 2WADA 1K7AA 2VOOA 5F04A 4ON0A 3B6CA 1OKRA 3K9TA 2IGMA 2QA4I 5D4RA 2O5RA 1FWZA 2RGVA 3WTTC 2R5YB 3W2AA 3HXLA 1XSXA 3KYLA 1B4AA 4EMSA 1Y0NA 1U8RA 4CCOA 3OYNA 1DGWY 2E2IJ 2KHMA 5FKLA 3F0CA 3RQIA 3R4KA 3GX4X 4M3DA 3KP2A 3NEUA 2HYJA 2G0EA 5GAGJ 3KYCB 3T1BA 3O8GA 2EWNA 5FD5A 1T98A 2HDCA 3BOQA 1LNWA 3K1NA 2BVMA 3H9JA 1VQ8I 5J8FA 3CJTB 3CCUI 1RR8C 3G71I 4G7HF 4LK0F 1YRNB 2V9PA 4YELA 5FKKA 2XDVA 2STTA 1Z9CA 1ZRDA 4BDYA 5EJCA 3CO7C 4KA4A 1B8IA 1EH8A 3IL2A 1FJLA 4IO9F 3J81Z 2GAUA 3JRAA 4KMFA 4AYBA 2LY9A 1ETKA 3E3VA 2PJRA 2R7FA 2V4JC 3CF2A 1Z05A 4S0HB 3HRMA 4HLXA 2XROA 2VL8A 3PIPF 4RLQA 2M5WA 2HZDA 2Q2EA 3H3UA 4Y3OA 2O6GE 1FT9A 2E7WA 3IAS2 1OPCA 4ZDOA 4CCKA 3DXJF 5FD6A 2V6CA 2K5CA 4I2OA 2HFHA 3R61A 4II2A 2W1OA 1HQCA 5EDNA 2L9RA 3GFJA 5ICGA 2PMHA 1P4XA 2CW8A 2ZXWH 4QIWN 3HBLA 4OIQF 3KLNA 3ZPLA 1S5LC 4L9JA 3M1EA 3K6GA 4A6DA 1BJZA 2EFWA 5E8GA 4LLNA 1V5FA 1X2MA 4RAZA 2D1VA 2QQAA 1P7JA 2DA6A 2E1OA 5D8KB 5EG0A 1ZHFA 3ERMA 4B47A 1ZG3A 3A01B 2M4GA 5F1RA 4G94A 3BQZA 5J1YA 4MFEA 2DQRA 1IUYA 4D7MA 2R7VA 3HGGA 3BR1A 1I50J 1YE9A 2A05A 2FRHA 2LNBA 4QLCU 4G9YA 5L3BA 4A3BJ 1EF4A 3ML6A 1RI7A 5FKMA 3QOPA 2H94A 2RQPA 4XLNF 2EK5A 3TQNA 4XMYA 4XRFA 2LTPA 2JTVA 3PUFA 3F21A 4LD5A 3ZQLA 2WAEA 2KJCA 4AVPA 3FXQA 2R7TA 3SZTA 4M71A 3WU2C 3L2QA 5ICFA 4IVNA 5D5UB 5LEKA 4XLPF 3IRRA 1J5YA 2CW7A 3W3CA 2DFIA 3TW6A 2VXZA 3FDYA 2K9LA 3QYBA 3W6VA 3I4NJ 4U7BA 4Y33A 3G2BA 2LBFA 3E0JB 1IRFA 5CVUA 3CUQB 4BHPA 4ZYEA 2X1CA 1WSUA 2XB5A 2XHKA 3I58A 4KITB 3HKZN 2VOPA 1LEAA 3L2WA 2RAEA 4M9ZA 2Z16A 1E0EA 1KGSA 3KEQA 2RC4A 2FNAA 4BKXA 3HIFA 4A0ZA 4J00A 2IS1A 3CDIA 3KYDB 4NBQA 1LFPA 5L3FA 4I0BA 2JSCA 1O7LA 4PSXA 2GA2A 1Z6RA 1B59A 2OPTA 2WAQN 3GZNB 5LD2C 2QBYA 2V6EA 5EEGA 2L01A 2GXAA 2DT5A 2CV0A 3HYIA 2IJLA 3TEDA 2MSYA 5LBQA 4DW6A 4MO7A 4B43A 1OCTC 3LSTA 4BY7J 4AM3A 3BP8A 3HUGB 1X58A 3IKTA 4A3KJ 1BOBA 3ZQHA 5HNFA 1MSFC 1Z3XA 3IKVA 1SANA 1HKTA 4MQ9F 1T39A 2QEXI 5L3EA 3JRBA 1FMVA 2DT6A 4XKCA 1Z21A 3BR6A 4CCNA 4D0PA 3MZYA 4ESBA 4ZYDA 3GTMJ 5CQEA 2HVRA 1TL8A 1BJAA 3VB2A 3C18A 1T33A 2ZFWA 1YX3A 1K4TA 2HI3A 1P6RA 2OV7A 5K5QA 2R5ZA 1V55H 3OIQA 1TT0A 1UHSA 2A6TA 5K7FA 1T56A 1FYMA 4AIJA 3TMOA 3I71A 2IGNA 2QCOA 1YW8A 2BY2A 3K10A 4PJMA 1ULYA 1DUXC 5AIQA 2R0QC 3DLAA 1T08B 1HF0A 2NOJB 5TGTA 1VNDA 4ESFA 2CFXA 4C30A 2DPDA 1Z7UA 3AL0C 3R0JA 1UB9A 3ZQCA 2OU2A 2MFZA 3OL4A 2O9LA 2JA5J 1XC5A 1MJAA 2WBMA 1XSVA 2MLKA 3SXYA 3KETA 5TISC 2L5QA 2E1CA 4F55A 1ZR2A 4H4KC 3LSKA 4HX4A 1N25A 2ZKZA 2RKHA 2DOFA 4U0VA 4E7LA 1ZLJA 1VQOI 5ICEA 1RUOA 4ZYAA 1RKWA 2WTEA 3QU3A 2CQNA 5IT3A 1FNNA 1GV2A 1XX5A 1MJBA 5IOYA 5LRSA 4KYWA 2HS5A 2Z3YA 2MYSA 5GAEJ 1FLIA 2HXOA 4S04A 1XDSA 1S6LA 2F5DA 4A3LJ 1YTYA 1VQ4I 3PNTA 4KN7X 4P9UA 3LSPA 4XKVA 1YHQI 3PO2J 4YFKF 1IRGA 2PG4A 2O8KA 2R7UA 4UB6C 1ENHA 4XNFA 2IVMA 3DEUA 1T8IA 1U2WA 1T95A 3TBIA 1SVOA 3FMQA 1IN8A 2OTJI 3MMYB 3MKWB 4BS9A 1C0WA 1IN6A 2WA0A 3BJOA 4A12A 1V4RA 3DBLB 4AYBN 4AD9A 3E6BA 1H8AC 2KIUA 4MNUA 2EZHA 1QHGA 4BE2A 1BIBA 5HLIA 1TLHB 1IGNA 2DOEA 3P9KA 3RPUA 1X2NA 3FXKA 4YFNF 1OFCX 3A1YA 5DCMB 5FJ8J 4EJVA 3ASOH 3L2RA 4RAYA 1IO2A 1LDJA 3SYTA 5HDNA 5IT9K 4BEHA 5HLGA 2OQGA 3G1MA 2IA0A 2FU4A 1W1WE 2ID6A 5M3MJ 1ZGAA 2CMPA 3KZYA 4XOTA 2QKLB 2PFBA 2VPRA 3P5JA 4U88A 1BIAA 3FHNA 3WGGA 3GTGJ 3HL2A 2OQRA 2B7EA 4XKBA 1D1AA 5J47A 4PGGA 2R7OA 5FO5A 4DNCA 4C3HJ 5C4JJ 2Q0OA 3BLYA 2YU9J 5K5RA 4FHTA 4B1RA 2JRMA 1ZGWA 3MVPA 2HKOA 2FA5A 2MBFA 4I09A 5H2FC 2RDPA 4AIKA 1K78B 5A2QZ 3FK7A 5C3EJ 1REPC 3ECHA 3KEYA 4GO1A 1KU3A 3LFKA 2V7FA 2ZNYA 2HVQA 1WH7A 5FLXZ 1R49A 3F9KA 3E1SA 1YJ9I 2LP0A 4LLGF 2VBZA 2XC7A 4ZTFA 2R4GA 1KZHA 1OISA 3VSKA 5K7HA 4I6ZA 1ITYA 4B09A 5DS9A 3FM3A 2DMPA 4CXFA 1UG2A 3REOA 4BE0A 3EETA 2X6OA 4UB8C 3A03A 4PFPA 3I56I 5CVJA 1J0RA 5EEHA 4BBRJ 1DPUA 5GTIC 1O3QA 2BBYA 2Y69H 1QHHD 1PUFA 2TDXA 2NVQJ 1GHCA 2P4WA 5B1BH 4L9VA 3TDZC 4ANJA 3HOSA 3HDDA 2L54A 3LQRA 3FBNB 2STWA 2CWEA 1UG0A 2HTSA 5F1JA 1J2XA 2KZVA 3OYEA 5ICCA 4X6AJ 1WZ2A 4LITA 2L3DA 2AO9A 3F6VA 3V4GA 2M8GX 2GOMA 3FZVA 2HTJA 1ZR4A 1TWFJ 2VKHA 4MQVA 3OYAA 4HPQA 3OYJA 3J7YJ 5EZHA 5DUKA 1KU9A 2IA1A 1L0OC 3FXMA 5B3SH 2R7SA 5E3OA 5J4YA 3K1PA 4P5OA 4KFCA 1JKPC 4GGGA 2HZTA 2NS8A 2NOGA 4A3MJ 2Z5UA 2CQ7A 5BOXA 2GXGA 1AKHA 2JA7J 4NC6A 3K69A 1YFHA 1LVKA 4MHGA 4D5CA 2PQ8A 2ZB9A 2ICWG 3J81K 3K70D 3MEXA 4F91B 2VB6A 2LRDA 3BG3A 1X1AA 2PEXA 3LSHA 4IQJA 2L4MA 3HSFA 5EF6A 2QM3A 1K6YA 2O03A 2DTRA 3QPLA 3JRCA 2HYGD 1I27A 3S1MJ 3OR2C 1ON2A 1MMAA 3QYEA 4OOIA 1YLFA 3ZMZA 1ZGJA 1IZ1A 3CCVI 3H92A 4GXOA 3ZOBA 4IZZA 2EIMH 1HSTA 5J6XA 3G6EI 4II3A 4ABZA 2CUJA 1R22A 2R7QA 3MAJA 4I7HA 5CPRB 5H6QA 1I1GA 2BHYA 4E6KG 4OAZA 4LIUA 1FIAA 2KP6A 4FE4A 5BS6A 1ZTRA 4M72A 2VBWA 4CYDA 1Q1VA 3FXJA 3HZJA 2FF4A 3R6SA 1FPQA 3A4CA 1WVRA 2EPFA 2Y0SN 3ONQA 2L4AA 1E3PA 4M6YA 4ZDLA 5B66C 4ZYGA 2NAZA 1ORKA 3P7NA 4WK8F 1QVUA 1U5TC 4D5FA 4AUXA 2K02A 4Y17A 2DN0A 2M9HA 5F08A 3H0DA 3F8BA 3TDUC 3M8EA 1O3TA 3RZDJ 4HF1A 3E5XA 3F23A 2VQLA 2XGEA 4CCJA 2ZXHA 4RBOA 4M3EA 5FB2A 4HEA2 2MC4A 2H6BA 1P7IA 3QPHA 4JX4A 4UUSA 2L7MP 4RM3A 5E18F 1Z67A 3BTCA 3PFYA 3GO5A 4LGWA 4OIPF 1FTTA 1RC9A 5HS7A 2DMQA 1I6HJ 3BR5A 5F27A 3LSIA 2Y0MA 4M3GA 3W6JB 3ZR8X 3WE3A 3V7CA 4QTRA 4FT8A 3T5XA 1FBQA 5GTHC 2RNJA 2BHZA 5D8LB 1MMNA 2KMUA 5DDGA 3I0TA 3OYGA 1G3TA 3BZKA 2K4JA 1IDYA 4LK1F 5J3LA 4WXHA 3F8NA 4NQWB 2ZJQF 1ZLKA 2M45A 4IHSA 3QQAA 1RETA 2FQ4A 2ELHA 4K2EA 1X3UA 1BI1A 2FEZA 4W1UA 1IXRC 1MW7A 4LG3A 1QZZA 2EB7A 3N97A 4CICA 3E6MA 3CJNA 1UFMA 2HU9A 2QGUA 4R1HA 4G6TB 3WG9A 2HGCA 3DTEA 3CCQI 2IT0A 3DPLC 2K3PA 3SEZA 2EIKH 2BV6A 2M0CA 5L3GA 1APLC 3FXUA 5KCMA 1OCCH 2PLYA 4X0GA 5LHIA 2LK2A 1LDKB 1VQKI 5DTDA 5IT9Z 1B72B 4HAMA 2WB1A 1H9GA 1I5ZA 3S2HJ 2H27A 2K27A 3PNVA 4Y52J 4I76A 5IYBJ 1TTYA 2QZ8A 3DBRB 2DA7A 4MIMA 4NC7A 4Y15A 3K4CA 3TO7A 1R71A 2ETHA 3ZRGA 2K3FA 4E7ZA 3DFGA 3I4MJ 1JUMA 5E1ZB 1R9TJ 1CGPA 1JHFA 1R1UA 3L00A 4RS8A 4CO8A 2JA8J 1JGSA 1SAUA 2X4HA 2YS9A 4BXXJ 2DMTA 2R7DA 2BY3A 3CZ6A 4BH9A 1X3ZB 3CC4I 3IC7A 2CGPA 2Z99A 5H6RA 3ZQQA 3WODF 5CLSA 2GIVA 5FRMA 4IHTA 2OCCH 1VI0A 3JCUC 3OMYA 2JMWA 3SQNA 2NNYA 2CQXA 1LUJB 4E7HA 4LMYA 1GXQA 3BTLA 1LPQA 2L9NA 5IPAA 3FKIJ 3CTAA 3BCAA 1U78A 3A02A 4DGWB 1HW2A 5JVGF 2FOKA 1K83J 2XAGA 2BYVE 3FXOA 3KP6A 2WY8Q 5TJJA 3G4SI 4ZZDA 2D45A 2J5OA 1U5TA 1FX7A 2V26A 3P9IA 2HOSA 5M5WJ 1UCRA 2OF7A 3ZQFA 2EZKA 1IRXA 2OUMA 4HF2A 1PDNC 1JKOC 4A2UA 2M0MA 2X0LA 3Q5FA 3S15J 3Q9VA 4BBSJ 1W5CC 3FIWA 3JTGA 3TOBA 1XGNA 2VXDA 3K4KA 4G12A 2P7CB 2BXZA 3CJQB 2XASA 1WPKA 1STZA 2HQNA 3H3ZA 4DZJA 4L5JA 4AWXB 2HYFA 1I1SA 5E8IA 4BHBA 3HG9A 1RUNA 2V79A 2K9QA 2E1MC 2EV0A 1BI3A 2KIFA 3CCRI 3M1CA 1JTXA 1KU2A 5FKOA 4KDPA 1ZAOA 5DD4A 2AQFA 3NRVA 4Z6YA 1IRZA 2LDUA 3ZGKA 2E5NA 2W57A 3CMMA 1Y0UA 3V42A 2F48A 1USTA 3KZZA 2F5FA 2XAFA 2D2WA 5BNGA 4F92B 2XVCA 1W7PA 2ZMEB 1W5TA 4IHWA 4G6QA 3HJEA 1D8KA 4LB6B 4FISA 3RZOJ 4RB0A 3K4MA 2EBIA 4JK1X 3BT9A 1VF9A 3KP7A 1MDMA 2ELKA 2HOAA 3PQKA 2FNPA 2DCEA 2QF7A 3HM5A 1W4MA 2P6SA 2A68F 4WX9A 3GZ6A 3RPQA 2JN6A 1T2KA 3TO6A 1IXCA 2P0WA 1G3WA 1MBGA 2EA4A 1WH5A 1BA5A 2W48A 4JBAA 4N9HA 3SDBA 2QLZA 1ON1A 1W0UA 2GQQA 4IRHA 2K40A 1DGRM 4A6EA 2BXYA 4OU0A 4HX7A 3ISPA 2H6CA 3PUBA 1ZK8A 3CC2I 1I6XA 4I98B 2V1XA 2DW4A 2BW3B 2M87A 2ZFUA 4V2GA 2EV6A 4A0YA 2Y9ZA 4OIRF 2LR8A 3QYFA 1TQPA 3BR3A 4KICA 5D6EA 1SD7A 5CKTA 2CYYA 2VIXA 4A3JJ 2HQRA 2X6WA 5CQGA 4ZDPA 2A69F 3I55I 4UUVA 1Y56A 4IF4A 3OOUA 5A2QK 2VQCA 3L9FA 5D5XB 4XBFA 2NRAC 3H5RA 3VFZA 4XM3A 3MFKA 2JZYA 2BGCA 2VBXA 5FLXK 4UVCA 4XLCA 4WXDA 1MD0A 1LQ1A 3I54A 3U1DA 2P5VA 1E17A 1F1ZA 1XGOA 2WAFA 3LSJA 3OYDA 5K1YA 3N05A 4KJZA 1YJWI 4CZZA 5CJ9A 4PZJA 3HOTA 1BR4A 1SFXA 2F5CA 1BW6A 3LNQA 1IC8A 3D0SA 4EM1A 3ZMDA 3IWFA 3QU6A 2OD5A 3HTUA 4BAYA 3A2KA 5C4XJ 1MNMC 2M8EA 2LKSA 3B6AA 2M4KA 2Y9YA 4AVZA 1TQMA 3NQOA 1G2HA 4RB1A 1MMSA 1U9NA 3A0BC 2XKOA 4DOZA 3SFZA 2DT7B 1TWAJ 2BZTA 3C7JA 5J40A 5ILVA 2IA2A 3DBHB 4HSTA 4OMZA 1H9TA 3OOPA 4KIGA 3WE2A 2NYXA 4DYQA 4XORA 1LEBA 5JFRA 4LIVA 3PIOF 1IDZA 4EGZA 2PJRB 2TRTA 2V1DA 4UV9A 5D4SA 3AG2H 3X2QH 2DI3A 2XKPA 2CQKA 2Q2EB 3HC7A 2C6YA 5J1RA 5H20A 1O57A 4EJTA 3DKWA 5DV5A 2B9SA 2PX9A 2HKXA 4EJOA 4I0AA 1SMTA 2B0LA 2EFPA 2Z1DA 3GEZA 4IXAA 4B4CA 3H5NA 4DYCA 4CH7A 4O5VA 4E7JA 2IXSA 4OMYA 1AOYA 1S29A 3O3KA 4L5EA 2IGOA 2WB1N 4B44A 4A3FJ 1FIPA 2B63J 5L3DA 2R7RA 3N4MA 4NC8A 2IAIA 1SVMA 4JX5A 1M1EB 4PUSA 3S2WA 3LMMA 1PP7U 2DOAA 1SFEA 2L9VA 4TV7A 3LSRA 4LG0A 1MH3A 2A61A 3PJRA 4IHXA 5EG0B 1IN7A 4UVBA 2MW8A 2OBPA 4BJTA 1B1BA 5HDGA 2FE3A 4J19A 1ETXA 2LYCA 2KDOA 1VQ9I 3E5UA 3E6CC 2X6YA 3H0GJ 1KONA 4PJJA 3G1LA 3ZMUA 3BR2A 2CJJA 1ZH5A 1ZN2A 2R7XA 2CV1A 3QP6A 4U0WA 2UUZA 5LFAA 1TWCJ 3EPZA 2MGQA 1UJ8A 1RIOH 4FQGA 2LG4A 5LEJA 3DKYA 2UV1A 3DPUA 3LAPA 2VQGA 3C2HA 3S3NA 1N77A 2X85A 1EH7A 2XRNA 2HR3A 2P7VB 3OV8A 2E36A 2FSWA 3C3WA 1JTYA 1LJ9A 3D1NI 4HLYA 2VE9A 2P5KA 2D1HA 3SZGA 1N75A 2Y0SA 4I99C 5DCMA 3TP0A 4XR6A 1XPXA 1MKMA 3G1OA 1Z91A 3BQYA 2DBBA 4NUBA 1HLVA 4NHJA 2G7HA 1Z0XA 5LRRA 4PDKA 2DA4A 3JW4A 4A5MA 1IV6A 2OAZA 3TOAA 2LC2A 3GCMA 5M5YJ 1HCRA 4BXUA 1WKMA 2FX0A 4OWRB 5HLHA 2EA2A 1HKQA 3LWFA 2QBYB 1B6AA 2QQ8A 4EEFG 2LH9A 3GUDA 2KRHA 1SD6A 2CUFA 3R0AA 2XV4S 2MD5A 3DWLE 3KZIC 2VJ5A 1D1CA 3HOUJ 1K78A 3J7ZI 2CQQA 2ISYA 2K9MA 3VDXA 2O0YA 3OYFA 2M2EA 3CMYA 3BTJA 1R1TA 1IF1A 1PJRA 2AXTC 4S05A 4FX4A 4YIFA 4C3JJ 5HDKA 4HV6A 3S93A 1S7OA 4XSXF 1QO0D 3SHFA 3W2WA 2DFEA 2QVOA 1X1BA 3U2RA 4BQNA 2QKMB 4CDGA 1K6OA 2VLAA 2JVGA 3BTIA 3H9GA 1KU7A 4BJ5C 5HS8A 3OYIA 4XK4A 4BHCA 2MABA 4HZFA 2F2EA 3OWTA 4WXCA 4EQQA 5FLVA 2PMUA 5HOOA 3OYCA 2FMLA 1K4SA 2DFFA 3BJAA 3FX3A 4R8HA 4UVAA 3F72A 2NVYJ 2G7UA 3RPUD 3DCFA 5IP9J 5K7ZA 3CF5F 3WTYC 1PP8F 2ZC2A 2F5EA 3L1PA 2R5ZB 3DTIA 1QPIA 1G3YA 5ILSA 5GAHJ 5LGNA 2IPQX 1KA8A 2DFHA 3JRGA 1QZYA 4GYGA 1FTZA 1DDNA 1XDUA 4PJLA 3JRIA 3AAFA 2LKXA 2LVSA 4PCQA 4B3XA 3K70C 1D3YA 3NWSA 1R5HA 2DU9A 1VTNC 3GZ5A 3D5SC 4M3FA 2Q8KA 4JYKA 1IJWC 1CF7B 4X1EA 1T6SA 1LKXA 2L02A 4EVIA 5FKNA 3HOXJ 3J7AY 1OMIA 1BOAA 1DPRA 3QOEA 2GXBA 1FEXA 3PO3J 3FF5A 2DDBA 5GPAA 1YYVA 3FMSA 4RA2A 2A5WA 3L2VA 3O2PE 2NVXJ 1XCBA 4Q47A 9ANTA 2Y75A 4KT5C 2H8RA 2V1UA 5B5EC 1U9OA 4NB5A 5DEQA 1A5JA 3JR9A 4A3CJ 3CCYA 3CCEI 2DLLA 1RNLA 2W4SA 2DQLA 1D0YA 5EGOB 1ACIA 4CA0A 1HSJA 5E3NA 4HDUA 2LMDA 1GV5A 1WJDA 1FBSA 4ETSA 3Q0WA 1F9NA 2DMUA 4P1WA 3MKLA 4G7OF 2QSGX 2CW0F 2W85A 2GBYA 3K4BA 4KISA 2JA2A 3CQZJ 1S9HA 1JKRC 4ENMA 1TNTA 3FXRA 2GOXB 2OA4A 4Y13A 1VQPI 3CCLI 2VN2A 3M4OJ 2KFDA 4A3DJ 1QQIA 3Q0VA 4YFXF 4L5IA 3OYBA 2X48A 1USSA 2CO5A 3PNYA 4U7DA 1JUPA 1L3LA 2FQ3A 1VQMI 1S7EA 1X1DA 3PSIA 2NS7A 3HRSA 4BEHB 2AHQA 3PM1A 4IKFA 2JVHA 3M7GA 3FBIB 2KKOA 3S2DJ 3RYRA 1E3OC 1ZQ3P 4XKWA 1Z3YA 3OS2A 4F3QA 1H88C 3RKQA 2ISZA 4Z2YA 5CVVA 2XRLA 1MIJA 3RSNA 1YO5C 2XIGA 1YITI 4XLFA 4BACA 5FRNA 1UHWA 1GXPA 1HW5A 3DLLF 2IS2A 3EQLF 3FMRA 2VI6A 2V1NA 3VYUB 1HKSA 3NWTA 2VUMJ 2XGDA 1SFUA 2QSFX 1TWGJ 2E35A 1P9QC 4YIRX 3KX2A 4PJNA 2OZUA 1J59A 2BEOA 1OQYA 1OYIA 4C2UA 1BI2A 3HTSB 1R58A 2L7ZA 2F4OB 2VJ4A 4EM0B 2ZMEC 1JHHA 1RZ4A 4QWQA 4P9FA 5FLMJ 3M8JA 4WWCA 2Y30A 1F43A 1POGA 3FKJA 3KLOA 3AL0B 2YX7A 5LGTA 2YUSA 3I59A 4CZCA 5IYDJ 3EUHC 1X4PA 3PL8A 1WJCA 1VQ6I 2KL4A 3HPHA 3I5UA 3OIOA 2L7FP 2XF6A 1MGTA 3DTKA 3CCJI 3J7AO 5FFXA 2JJ7A 3CP8A 4ZC3A 2MH9A 3S1RJ 3HOZJ 3Q9SA 2H1KA 4CYCA 3ASNH 2HOTA 2VKEA 3SDGA 1IV8A 5HODA 3DV8A 3U21A 3MKYB 3A0HC 1VQ7I 2ESNA 2DJNA 4AIHA 1A04A 4IRGA 2CV2A 4LB5A 3HHHA 2FBHA 3RCOA 2JK3A 1MH4A 3FWEA 2EJRA 2R93J 4HW0A 2RVCA 1ZRFA 1LB2A 1JT0A 3WG7H 2RQQA 1W36C 2IW5A 1D5YA 3DEEA 3HOYJ 5FFZA 3M9AA 2GLOA 1T38A 3OL3A 3TGNA 1AKHB 5IOZA 1JJ8C 1ZARA 3FISA 3D5RC 1OCPA 5JR3A 1BC7C 4HNTA 1VQLI 5EZGA 5JHUA 2IS4A 1YW9A 5J4VA 3JSPA 3SFIA 4YRVA 4RLFA 1WRJA 4RAFA 3CMEI 2EIJH 3T8TA 3VYRB 4RGSA 3S3MA 2GWRA 1WJBA 3I64A 1T0FC 3E6DA 4HQEA 4I01A 1XB4A 4IRIA 3JAMZ 1QRYA 3EYYA 4FASD 2VT3A 1ONVA 4FTHA 4MEXF 2NXNB 4WCGA 4L18B 3RJPA 1ETVA 2MG4A 2COBA 3GFMA 3CUQC 4KIBA 4F52A 3S17J 4U87A 4EJWA 2ESHA 1OLTA 2R5YA 1IUFA 3K4LA 2IGKA 2IEKA 2HDDA 3HEFA 2J5PA 1QVTA 2HPIA 4QSHA 3RI4A 1MJ9A 2UWMA 3F8CA 4KIFA 4DJAA 4E4HA 1HC8A 1E3HA 1PVEA 1NHAA 3HSEA 2EFQA 1FBUA 2A6EF 2A5YB 2I5UA 2K9NA 1HXDA 1TNSA 2RN7A 3GW2A 2HQAA 1X3WB 3S1NJ 1ZREA 3E7LA 4JOMA 1YRNA 2E5ZA 3OS0A 4RB2C 1FSHA 4BQAA 1JXSA 1YS7A 4RGRA 4KNYA 4YG2F 1J9IA 1D0XA 3WGIA 2ZMEA 3BPXA 3CUOA 3C2GA 4UV8A 5IP6A 3JRFA 2A07F 6PAXA 4DQ2A 3GLXA 4E7IA 3J80Z 3OS1A 5LHGA 3I9V2 1XMXA 2L9SA 3B02A 2ZSHB 2QUFA 2VBYA 4UUSB 3EUHA 3QAHA 1FOYA 2OZ6A 2AQEA 4QPOA 1F4KA 2YU3A 2I10A 3PFIA 4ZJZA 4A93J 1TW3A 5LLQA 3RKWA 5K5OA 1D1BA 4ZZLA 4C3IJ 2YX4A 3JSOA 3ZN1A 2YSRA 1K79A 3GTKJ 4JX6A 2EV5A 4B3AA 1G3SA 5HVQC 1FOWA 1U6GA 2DPUA 2Z9OA 1OYWA 2VPLA 1OCZH 3VSLA 2KRFA 2DA5A 4FCYA 3FHZA 2JPCA 4OIOF 1ZKGA 2MH2A 2Z33A 4M9SA 5BPIA 1W0TA 3CLQA 1A35A 5DM6F 5GPCA 4PK4A 3M3YJ 5IY5H 3TP3A 5E1XA 2R92J 2ELJA 4D9JA 3DKXA 2VODA 3A01A 5KNLA 2XB0X 2XGXA 3IH2A 4BDZA 4AIDA 3ABKH 1W5SA 3T8RA 3WTUC 4ZTJA 1GDTA 4KMUX 1AU7A 1O4XA 3WTSC 2KZGA 5KK1A 4C2TA 3WGHA 4EATA 4ZYHA 5FGMA 1W7PD 1U0JA 2ZO4A 3TL4X 4F93B 1U3EM 3U9GA 2XPUA 3GLLA 3IV5A 2X51A 3CD6I 1KQ8A 1T0FA 2M3AA 3OSFA 3EUKL 1LDDA 2HXIA 1QA6A 1QU3A 4JP0A 2LY2A 3AFHA 2LD5A 2XAHA 2NVUB 3WU1B 3RQ4A 3JRDA 4FX0A 4RGUA 1LE8B 1EV7A 2EINH 4OINF 4BNCA 4U0YA 3V8LA 1R23A 3CUQA 1TQIA 3ELKA 2AXLA 2MD0A 3HRTA 1HOMA 2MC3A 4BE1A 1FC3A 2QQBA 5C44J 1WGXA 2X6XA 2OC6A 4P55A 1S8NA 3WHBA 1JUSA 2LKPA 1GLNA 1BN5A 2DJIA 2XSDC 2PMZA 4GRIA 4EJUA 1H0MA 5HS9A 2DO7A 5JLXA 3MZHA 3HOWJ 5HNHA 2XAUA 1SFKA 3LAJA 1P4WA 3DQVC 3NARA 1WWXA 2QENA 3H36A 5GP9A 2FBIA 2UXNA 3KP4A 4B48A 4ENNA 5E79C 3GTOJ 4HG2A 3HUGA 3P9CA 2XAQA 1RRJA 2O61A 3QRFF 1MBHA 4BJ6C 4Y4RA 2EH3A 1U5TB 2WWYA 2NS0A 3RIRA 4XQFA 3KCCA 2DDAA 2IRFG 3WTXC 2ZXJA 3CLOA 4KT6A 1G6NA 2KLOA 3BG9A 1MMGA 2P8TA 2JT1A 4W97A 3ULQB 4CSWA 3B73A 3K2AA 5M5XJ 4O6JA 2FMYA 4RB3C 4IPAA 4N4OB 2XSJC 3O6BB 2VQHA 1FZPB 3HHGA 2VASA 2HOEA 3AG4H 4FE7A 1FP2A 1N78A 1R1VA 4GCVA 3SZPA 4GYIA 5CYVA 2VE8A 4HF0A 3ZQIA 3I4PA 1VQ5I 4HQMA 2PBIA 2Y31A 4E7SA 3F6OA 3GYHX 3ABUA 4XLHA 1NG7A 3ZCOA 2F4MB 5BMZA 3Q0UA 4XLAA 4HBLA 3HSRA 4AU7A 4IX7A 1HW1A 1W7PB 5AONA 4RGXA 5EYRA 1O3SA 1FOKA 1B8IB 1WJEA 1YOVB 2BY0A 3O8HA 4LLLA 1UHMA 2L7KA 3BZ6A 3WU0A 4L9NA 2CSOA 4ENJA 4CCLA 1E2XA 4MGRA 4PJ0C 5E3LA 2PI0A 2W7NA 1ETQA 1MMDA 3LOCA 1CQTA 2K85A 4HYEA 1MDMB 3K4JA 2EILH 4XONA 4BU2A 2DA2A 3BG6A 3K0LA 1MNDA 2ME6A 2BVLA 4L0YB 2IBDA 4A3GJ 3F3XA 2ME0A 4A69C 3OIPA 4BL0B 4GDFA 1GVDA 4M9XA 3CCMI 3GTLJ 1X19A 3NAUA 5IP7J 2HEOA 3FXLA 2CH0A 1R4NB 2Q1ZB 2TCTA 2KDZA 3UNGC 2H8WA 2DTZA 4G6DA 4ESJA 1SC7A 2KJBA 1BM9A 1EH6A 3VODA 3BPVA 1SEUA 1TZLA 1S3JA 2L2OA 4LJZF 5LGUA 4HV5A 4UHTA 3S1QJ 2E71A 3IP4B 2W84A 1G59A 1XMAA 1R5ID 1J09A 2FBKA 1U8BA 3LA7A 5EEAA 1JGGA 2QYOA 3V7RA 1NH3A 2JPBA 2JRTA 3FK6A 2DMNA 1K61A 4AC0A 3ABMH 1P4AA 1Y1VJ 2IP2A 5D5VB 1F5TA 3VYSB 3I53A 1TT5B 2ZBKA 3AG1H 4N9IA 2XAJA 1UMQA 3V8JA 1XSDA 2HQ5A 3ABTA 1OJLA 1XS9A 2E1NA 2QQ9A 2AS5F 3GFLA 4UY8I 1KQ9A 3VYTB 4KN4X 5F0FA 4EM2A 2E2JJ 2FJ1A 2LBFB 3L09A 5HLTA 1ZG1A 3BZCA 3K4NA 1KYWA 5E1WA 5TRDA 4BY1J 1XD7A 1XMKA 3IAM2 4XRSA 3GF2A 3ZN0A 2X9DA 2R3SA 4PSWA 3V7SA 4I02A 2PJPA 2JSPA 2M30A 1NTCA 4QPQA 3GTJJ 1MSEC 4L0ZB 3AKZA 4RMNA 3ZMVA 2JQ7A 1CF7A 2WV0A 2E1MB 3D5LA 3DEWA 2K4BA 1GVJA 3W6KB 1WI3A 4V19K 2E34A 2W24A 2E7XA 2VJJA 4BQOA 3OSGA 2EFOA 5F0HA 3BG5A 5L3CA 3LQQA 1V3FA 3M8FA 4HRIA 2VC0A 5J8CA 4DBRA 3KIOA 4GFBA 3OYHA 2A3SA 5ILUA 1A6IA 1Y39A 1Z77A 4ITVA 2LOOA 3MWMA 2P6TA 4IEJA 3JAMK 1SD5A 4LG0B 3WHCA 1FP1D 4IL6C 3VPRA 5EGOA 1MNEA 3S8PA 4NDLA 2FUG2 5E3MA 3F8FA 4ZH4F 1YS6A 3CJRB 4NNJA 1ZRCA
chains in the Genus database with same CATH topology
2L7ZA 1U78A 1RPWA 3A02A 2XB5A 5FLMJ 1JJ6C 1K83J 2Y30A 3HKZN 1F43A 1POGA 2RAEA 2YUSA 2HOSA 2PMZN 5M5WJ 4BKXA 2R7ZJ 5IYDJ 2OF7A 3ZQFA 2EZKA 5IYCJ 1JKOC 2LLKA 3QPSA 3S15J 3OIOA 2L7FP 3LSGA 2OPTA 2WAQN 1I3QJ 2EZLA 4BBSJ 2JJ7A 5F0CA 3TEDA 2MSYA 2WV1A 3FIWA 3MN2A 4M3BA 4DW6A 3S1RJ 4MO7A 3HOZJ 1OCTC 2H1KA 2P81A 4MLOA 4CYCA 2HOTA 4G12A 2VKEA 4BY7J 3SDGA 5HODA 1X58A 4A3KJ 1WPKA 3ZQHA 4DZJA 1MSFC 2DJNA 2EZIA 1SANA 4A3EJ 1JKQC 2K9QA 2ECBA 1JTXA 5FKOA 2JK3A 1MH4A 2GM4A 2KT0A 1IRZA 3JRBA 1TWHJ 2R93J 3S16J 5BNGA 1HDPA 1MBJA 3BR6A 1JT0A 1D5YA 4IHWA 3HOYJ 2XGCA 1AKHB 2GLOA 3GTMJ 5IOZA 1JJ8C 4D7NA 3FISA 1OCPA 4FISA 1T33A 3RZOJ 5EZGA 1ETOA 2EBIA 3SFIA 3BT9A 1VF9A 2HI3A 3Q3SA 4XRSG 2ELKA 2HOAA 2R5ZA 2QF7A 3HM5A 2Y2ZA 3JREA 2JN6A 1UHSA 1BL0A 1QRYA 3HGYA 5K7FA 1T56A 4FTHA 1MBGA 1WH5A 1BA5A 2W48A 2QCOA 1Y1WJ 2EQRA 1ETVA 2MG4A 2COBA 1W0UA 3S17J 2K40A 2R0QC 3JRHA 2R5YA 1ZK8A 3IH4A 1IUFA 1HF0A 4A3IJ 2IEKA 1RR7A 1VNDA 4V2GA 2HDDA 3HEFA 2Y9ZA 1QVTA 2LR8A 3BR3A 3GBGA 4QSHA 3ZQCA 4LOCA 4A3JJ 2O9LA 2JA5J 1XC5A 2ID3A 2XPWA 4IHYA 1WCMJ 3OOUA 2LFBA 2K9NA 2K9SA 1ZR2A 3S1NJ 3E7LA 2M34A 1DU0A 1YRNA 1RKWA 1GUUA 1TC3C 1DU6A 1GV2A 1MBFA 3LSJA 5IP6A 5IOYA 3JRFA 2E2HJ 2XPVA 2HXOA 1BW6A 2O7OA 3LNQA 1IC8A 1JT6A 4A3LJ 5C4XJ 4UUSB 3LSPA 1MNMC 3PO2J 3B6AA 1XG1A 1NK3P 2Y9YA 2O8KA 2I10A 1G2HA 4A93J 3HOVJ 2L0KA 1ENHA 1U9NA 4C3IJ 1TWAJ 3GTKJ 4JX6A 4B3AA 3BR0A 1LFBA 4AYBN 4DYQA 1H8AC 2DA5A 2EZHA 4FCYA 2JA6J 4DZPA 4XICA 1IDZA 1ZKGA 1IGNA 2TRTA 1GT0C 1W0TA 1X2NA 1OFCX 3HB9A 5FJ8J 1PUFB 1B72A 5GPCA 1LFUP 3M3YJ 5J1RA 2JWTA 3TP3A 2R92J 3H3VK 3G1MA 3K7AJ 2ID6A 3A01A 2XB0X 3IH2A 5M3MJ 3TW7A 2VPRA 1GDTA 1AU7A 4M6VA 1O4XA 4B4CA 3GTGJ 1F36A 2DA1A 4DYCA 4IHVA 3ZQGA 4C3HJ 5C4JJ 4L5EA 2YU9J 2WB1N 4A3FJ 1AHDP 1FIPA 4B1RA 2B63J 5J1UA 3C2BA 2IAIA 3CDLA 4JX5A 1ZGWA 2XPUA 3IV5A 2CRGA 3MVPA 3LSRA 3OSFA 1MH3A 4IHXA 2HXIA 5EG0B 4JP0A 2MW8A 2LD5A 3FK7A 5C3EJ 4J19A 3JRDA 1ETXA 2ECCA 1LE8B 3H0GJ 1MBEA 3G1LA 3BR2A 2CJJA 1WH7A 4MFDA 1HOMA 4XIDA 2LP0A 1TWCJ 1WGXA 5C44J 2NVTJ 2MGQA 5K7HA 4I6ZA 1ITYA 3WHBA 5DS9A 1JUSA 2DMPA 1UG2A 2XSDC 3UKGA 2X6OA 3A03A 4DYRA 3HOWJ 5JLXA 1JTYA 3D1NI 5M3FJ 1MBKA 4BBRJ 1BW5A 3GTQJ 2E19A 4RDUA 1PUFA 3NARA 5GP9A 3TP0A 2NVQJ 3G1OA 3BQYA 3GTOJ 3GTPJ 1HLVA 3HDDA 2FD5A 1MBHA 1Z0XA 2EH3A 2DA4A 4V2FA 5F1JA 1IV6A 1H89C 2D5VA 1NK2P 4X6AJ 1HDDC 1RESA 2DA3A 3BG9A 2AO9A 5M5YJ 4W97A 2M8GX 4C2MJ 1HCRA 2FX0A 3K2AA 4HNVA 5M5XJ 1ZR4A 1TWFJ 5EZHA 2N8GA 4EEFG 1ETYA 2CU7A 5E3OA 4FE7A 1JKPC 2NS8A 2CUFA 4CYCB 1SFOJ 2NOGA 4A3MJ 1AKHA 2JA7J 3HOUJ 2CQQA 2M2EA 4D5CA 2VKVA 3ZQIA 3CMYA 1LE8A 5JLWA 2ZB9A 3BTJA 2Y31A 3BG3A 4C3JJ 5EF6A 3Q0UA 3QPLA 3JRCA 4UUTA 3BTIA 3S14J 4XK4A 3S1MJ 5EYRA 1RKTA 1B8IB 3O8HA 5FLVA 2CUEA 5E3LA 1ETWA 1ETQA 3LOCA 2NVYJ 3ZOBA 1CQTA 5K7ZA 5IP9J 3DCFA 1IG7A 4ABZA 3SJMA 4XRMA 3L1PA 2R5ZB 1QPIA 2DA2A 2ME6A 2IBDA 3JRGA 4A3GJ 1FTZA 1VFCA 4Y7NJ 2ME0A 1FIAA 4A69C 3JRIA 3IH3A 1GVDA 2LKXA 2LVSA 4FE4A 3GTLJ 1ZTRA 3NAUA 5IP7J 2TCTA 2KDZA 1Q1VA 5F04A 3B6CA 2DTZA 2Y0SN 2R5YB 4M3FA 1IJWC 4JYKA 1ORKA 4X1EA 2E2IJ 5FKLA 1QVUA 4D5FA 4AUXA 3F0CA 3RQIA 2DN0A 2M9HA 5F08A 4M3DA 5FKNA 3HOXJ 1FEXA 2HYJA 3S1QJ 3RZDJ 2G0EA 3PO3J 3O8GA 2XGEA 5GPAA 1U8BA 4RBOA 4M3EA 5EEAA 1P7IA 4JX4A 1JGGA 4UUSA 2L7MP 3BTCA 2NVXJ 3FK6A 2DMNA 1K61A 1FTTA 9ANTA 1I6HJ 2DMQA 3BR5A 5F27A 4AC0A 2H8RA 1YRNB 5FKKA 1U9OA 4M3GA 1Y1VJ 4QTRA 1A5JA 3JR9A 1B8IA 1UMQA 2HQ5A 3CCYA 1OJLA 4A3CJ 1XS9A 1FJLA 5EGOB 1IDYA 3JRAA 5J3LA 5E3NA 5F0FA 2LY9A 1GV5A 1ETKA 2E2JJ 2FJ1A 3Q0WA 3QQAA 4S0HB 2DMUA 1RETA 2FQ4A 3MKLA 4BY1J 2GBYA 4W1UA 3CQZJ 4XRSA 1JKRC 2X9DA 3M4OJ 4A3DJ 3Q0VA 5EDNA 2L9RA 2M0CA 1NTCA 1APLC 3GTJJ 1MSEC 2X48A 4QIWN 3HBLA 1JUPA 2LK2A 3DEWA 5DTDA 1BJZA 1B72B 1S7EA 1WI3A 1X2MA 2NS7A 3S2HJ 1P7JA 2DA6A 2E1OA 4Y52J 4I76A 3OSGA 5EG0A 5IYBJ 2AHQA 3PM1A 5F0HA 3A01B 3BG5A 2DA7A 5J1YA 3BQZA 4MIMA 4MFEA 1E3OC 3S2DJ 4D7MA 1ZQ3P 3HGGA 3BR1A 1I50J 4A3BJ 4GFBA 3I4MJ 1EF4A 1JUMA 5FKMA 1R9TJ 1H88C 3RKQA 2XRLA 1A6IA 2JA8J 2LTPA 2YS9A 4BXXJ 1Z77A 2DMTA 3ZQLA 4IEJA 2VI6A 2VUMJ 2XGDA 3WHCA 3VPRA 1VI0A 5EGOA 1TWGJ 2JMWA 4NDLA 5E3MA 3TW6A 3W6VA 3I4NJ 2CQXA 3BTLA 5IPAA 3FKIJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7Z A;  1U78 A;  1RPW A;  3A02 A;  2XB5 A;  5FLM J;  1JJ6 C;  1K83 J;  2Y30 A;  3HKZ N;  1F43 A;  1POG A;  2RAE A;  2YUS A;  2HOS A;  2PMZ N;  5M5W J;  4BKX A;  2R7Z J;  5IYD J;  2OF7 A;  3ZQF A;  2EZK A;  5IYC J;  1JKO C;  2LLK A;  3QPS A;  3S15 J;  3OIO A;  2L7F P;  3LSG A;  2OPT A;  2WAQ N;  1I3Q J;  2EZL A;  4BBS J;  2JJ7 A;  5F0C A;  3TED A;  2MSY A;  2WV1 A;  3FIW A;  3MN2 A;  4M3B A;  4DW6 A;  3S1R J;  4MO7 A;  3HOZ J;  1OCT C;  2H1K A;  2P81 A;  4MLO A;  4CYC A;  2HOT A;  4G12 A;  2VKE A;  4BY7 J;  3SDG A;  5HOD A;  1X58 A;  4A3K J;  1WPK A;  3ZQH A;  4DZJ A;  1MSF C;  2DJN A;  2EZI A;  1SAN A;  4A3E J;  1JKQ C;  2K9Q A;  2ECB A;  1JTX A;  5FKO A;  2JK3 A;  1MH4 A;  2GM4 A;  2KT0 A;  1IRZ A;  3JRB A;  1TWH J;  2R93 J;  3S16 J;  5BNG A;  1HDP A;  1MBJ A;  3BR6 A;  1JT0 A;  1D5Y A;  4IHW A;  3HOY J;  2XGC A;  1AKH B;  2GLO A;  3GTM J;  5IOZ A;  1JJ8 C;  4D7N A;  3FIS A;  1OCP A;  4FIS A;  1T33 A;  3RZO J;  5EZG A;  1ETO A;  2EBI A;  3SFI A;  3BT9 A;  1VF9 A;  2HI3 A;  3Q3S A;  4XRS G;  2ELK A;  2HOA A;  2R5Z A;  2QF7 A;  3HM5 A;  2Y2Z A;  3JRE A;  2JN6 A;  1UHS A;  1BL0 A;  1QRY A;  3HGY A;  5K7F A;  1T56 A;  4FTH A;  1MBG A;  1WH5 A;  1BA5 A;  2W48 A;  2QCO A;  1Y1W J;  2EQR A;  1ETV A;  2MG4 A;  2COB A;  1W0U A;  3S17 J;  2K40 A;  2R0Q C;  3JRH A;  2R5Y A;  1ZK8 A;  3IH4 A;  1IUF A;  1HF0 A;  4A3I J;  2IEK A;  1RR7 A;  1VND A;  4V2G A;  2HDD A;  3HEF A;  2Y9Z A;  1QVT A;  2LR8 A;  3BR3 A;  3GBG A;  4QSH A;  3ZQC A;  4LOC A;  4A3J J;  2O9L A;  2JA5 J;  1XC5 A;  2ID3 A;  2XPW A;  4IHY A;  1WCM J;  3OOU A;  2LFB A;  2K9N A;  2K9S A;  1ZR2 A;  3S1N J;  3E7L A;  2M34 A;  1DU0 A;  1YRN A;  1RKW A;  1GUU A;  1TC3 C;  1DU6 A;  1GV2 A;  1MBF A;  3LSJ A;  5IP6 A;  5IOY A;  3JRF A;  2E2H J;  2XPV A;  2HXO A;  1BW6 A;  2O7O A;  3LNQ A;  1IC8 A;  1JT6 A;  4A3L J;  5C4X J;  4UUS B;  3LSP A;  1MNM C;  3PO2 J;  3B6A A;  1XG1 A;  1NK3 P;  2Y9Y A;  2O8K A;  2I10 A;  1G2H A;  4A93 J;  3HOV J;  2L0K A;  1ENH A;  1U9N A;  4C3I J;  1TWA J;  3GTK J;  4JX6 A;  4B3A A;  3BR0 A;  1LFB A;  4AYB N;  4DYQ A;  1H8A C;  2DA5 A;  2EZH A;  4FCY A;  2JA6 J;  4DZP A;  4XIC A;  1IDZ A;  1ZKG A;  1IGN A;  2TRT A;  1GT0 C;  1W0T A;  1X2N A;  1OFC X;  3HB9 A;  5FJ8 J;  1PUF B;  1B72 A;  5GPC A;  1LFU P;  3M3Y J;  5J1R A;  2JWT A;  3TP3 A;  2R92 J;  3H3V K;  3G1M A;  3K7A J;  2ID6 A;  3A01 A;  2XB0 X;  3IH2 A;  5M3M J;  3TW7 A;  2VPR A;  1GDT A;  1AU7 A;  4M6V A;  1O4X A;  4B4C A;  3GTG J;  1F36 A;  2DA1 A;  4DYC A;  4IHV A;  3ZQG A;  4C3H J;  5C4J J;  4L5E A;  2YU9 J;  2WB1 N;  4A3F J;  1AHD P;  1FIP A;  4B1R A;  2B63 J;  5J1U A;  3C2B A;  2IAI A;  3CDL A;  4JX5 A;  1ZGW A;  2XPU A;  3IV5 A;  2CRG A;  3MVP A;  3LSR A;  3OSF A;  1MH3 A;  4IHX A;  2HXI A;  5EG0 B;  4JP0 A;  2MW8 A;  2LD5 A;  3FK7 A;  5C3E J;  4J19 A;  3JRD A;  1ETX A;  2ECC A;  1LE8 B;  3H0G J;  1MBE A;  3G1L A;  3BR2 A;  2CJJ A;  1WH7 A;  4MFD A;  1HOM A;  4XID A;  2LP0 A;  1TWC J;  1WGX A;  5C44 J;  2NVT J;  2MGQ A;  5K7H A;  4I6Z A;  1ITY A;  3WHB A;  5DS9 A;  1JUS A;  2DMP A;  1UG2 A;  2XSD C;  3UKG A;  2X6O A;  3A03 A;  4DYR A;  3HOW J;  5JLX A;  1JTY A;  3D1N I;  5M3F J;  1MBK A;  4BBR J;  1BW5 A;  3GTQ J;  2E19 A;  4RDU A;  1PUF A;  3NAR A;  5GP9 A;  3TP0 A;  2NVQ J;  3G1O A;  3BQY A;  3GTO J;  3GTP J;  1HLV A;  3HDD A;  2FD5 A;  1MBH A;  1Z0X A;  2EH3 A;  2DA4 A;  4V2F A;  5F1J A;  1IV6 A;  1H89 C;  2D5V A;  1NK2 P;  4X6A J;  1HDD C;  1RES A;  2DA3 A;  3BG9 A;  2AO9 A;  5M5Y J;  4W97 A;  2M8G X;  4C2M J;  1HCR A;  2FX0 A;  3K2A A;  4HNV A;  5M5X J;  1ZR4 A;  1TWF J;  5EZH A;  2N8G A;  4EEF G;  1ETY A;  2CU7 A;  5E3O A;  4FE7 A;  1JKP C;  2NS8 A;  2CUF A;  4CYC B;  1SFO J;  2NOG A;  4A3M J;  1AKH A;  2JA7 J;  3HOU J;  2CQQ A;  2M2E A;  4D5C A;  2VKV A;  3ZQI A;  3CMY A;  1LE8 A;  5JLW A;  2ZB9 A;  3BTJ A;  2Y31 A;  3BG3 A;  4C3J J;  5EF6 A;  3Q0U A;  3QPL A;  3JRC A;  4UUT A;  3BTI A;  3S14 J;  4XK4 A;  3S1M J;  5EYR A;  1RKT A;  1B8I B;  3O8H A;  5FLV A;  2CUE A;  5E3L A;  1ETW A;  1ETQ A;  3LOC A;  2NVY J;  3ZOB A;  1CQT A;  5K7Z A;  5IP9 J;  3DCF A;  1IG7 A;  4ABZ A;  3SJM A;  4XRM A;  3L1P A;  2R5Z B;  1QPI A;  2DA2 A;  2ME6 A;  2IBD A;  3JRG A;  4A3G J;  1FTZ A;  1VFC A;  4Y7N J;  2ME0 A;  1FIA A;  4A69 C;  3JRI A;  3IH3 A;  1GVD A;  2LKX A;  2LVS A;  4FE4 A;  3GTL J;  1ZTR A;  3NAU A;  5IP7 J;  2TCT A;  2KDZ A;  1Q1V A;  5F04 A;  3B6C A;  2DTZ A;  2Y0S N;  2R5Y B;  4M3F A;  1IJW C;  4JYK A;  1ORK A;  4X1E A;  2E2I J;  5FKL A;  1QVU A;  4D5F A;  4AUX A;  3F0C A;  3RQI A;  2DN0 A;  2M9H A;  5F08 A;  4M3D A;  5FKN A;  3HOX J;  1FEX A;  2HYJ A;  3S1Q J;  3RZD J;  2G0E A;  3PO3 J;  3O8G A;  2XGE A;  5GPA A;  1U8B A;  4RBO A;  4M3E A;  5EEA A;  1P7I A;  4JX4 A;  1JGG A;  4UUS A;  2L7M P;  3BTC A;  2NVX J;  3FK6 A;  2DMN A;  1K61 A;  1FTT A;  9ANT A;  1I6H J;  2DMQ A;  3BR5 A;  5F27 A;  4AC0 A;  2H8R A;  1YRN B;  5FKK A;  1U9O A;  4M3G A;  1Y1V J;  4QTR A;  1A5J A;  3JR9 A;  1B8I A;  1UMQ A;  2HQ5 A;  3CCY A;  1OJL A;  4A3C J;  1XS9 A;  1FJL A;  5EGO B;  1IDY A;  3JRA A;  5J3L A;  5E3N A;  5F0F A;  2LY9 A;  1GV5 A;  1ETK A;  2E2J J;  2FJ1 A;  3Q0W A;  3QQA A;  4S0H B;  2DMU A;  1RET A;  2FQ4 A;  3MKL A;  4BY1 J;  2GBY A;  4W1U A;  3CQZ J;  4XRS A;  1JKR C;  2X9D A;  3M4O J;  4A3D J;  3Q0V A;  5EDN A;  2L9R A;  2M0C A;  1NTC A;  1APL C;  3GTJ J;  1MSE C;  2X48 A;  4QIW N;  3HBL A;  1JUP A;  2LK2 A;  3DEW A;  5DTD A;  1BJZ A;  1B72 B;  1S7E A;  1WI3 A;  1X2M A;  2NS7 A;  3S2H J;  1P7J A;  2DA6 A;  2E1O A;  4Y52 J;  4I76 A;  3OSG A;  5EG0 A;  5IYB J;  2AHQ A;  3PM1 A;  5F0H A;  3A01 B;  3BG5 A;  2DA7 A;  5J1Y A;  3BQZ A;  4MIM A;  4MFE A;  1E3O C;  3S2D J;  4D7M A;  1ZQ3 P;  3HGG A;  3BR1 A;  1I50 J;  4A3B J;  4GFB A;  3I4M J;  1EF4 A;  1JUM A;  5FKM A;  1R9T J;  1H88 C;  3RKQ A;  2XRL A;  1A6I A;  2JA8 J;  2LTP A;  2YS9 A;  4BXX J;  1Z77 A;  2DMT A;  3ZQL A;  4IEJ A;  2VI6 A;  2VUM J;  2XGD A;  3WHC A;  3VPR A;  1VI0 A;  5EGO A;  1TWG J;  2JMW A;  4NDL A;  5E3M A;  3TW6 A;  3W6V A;  3I4N J;  2CQX A;  3BTL A;  5IPA A;  3FKI J; 
#chains in the Genus database with same CATH topology
 5ERI A;  1RPW A;  4XN0 A;  4YII A;  2QSH X;  3KP5 A;  1FMW A;  1JJ6 C;  3IHU A;  2X1D A;  3KP3 A;  1SD4 A;  1WJA A;  2O8X A;  3TO9 A;  1FYL A;  1G4D A;  1YIJ I;  5DUI A;  1Q1H A;  3QPT A;  4BYY A;  2LF7 A;  2DK8 A;  2PMZ N;  2F6C A;  2R7Z J;  3ECO A;  2ZJ2 A;  1WJF A;  2COM A;  4JQF A;  2FOW A;  3LL7 A;  2EFN A;  5IYC J;  2DYR H;  1ODD A;  3WTZ A;  3QWL A;  3VOE A;  2LLK A;  3QPS A;  1HA8 A;  5CVR A;  3TKY A;  1Z1D A;  1G8X A;  4N0B A;  3BG7 A;  3LSG A;  1I3Q J;  2EZL A;  1YG2 A;  4ASN A;  2V9K A;  5F0C A;  3RTR A;  2WV1 A;  4UNO A;  3MN2 A;  4M3B A;  4HNU A;  2P81 A;  4MLO A;  4HSR A;  3CDH A;  1WFX A;  3HPG A;  3KE2 A;  1SAX A;  1YIO A;  1FY7 A;  1WHU A;  1X1P A;  2EZI A;  4CUG A;  1WQ2 A;  4A3E J;  3KEO A;  1JKQ C;  2ECB A;  1AWC A;  1QPM A;  3J80 K;  1XTA A;  3T0Y A;  2KIQ A;  4Q4Z F;  2GM4 A;  1FOX A;  2KT0 A;  3FM5 A;  2OTL I;  1XGS A;  1TWH J;  3BDD A;  4G8X A;  4MTE A;  1LVA A;  2BE5 F;  3S16 J;  3MCZ A;  3UR3 C;  1EA3 A;  1HDP A;  1MBJ A;  5AIP A;  2GA1 A;  2YPR A;  2XUB A;  3COA C;  4PFO A;  2XGC A;  3VEP A;  5DCF A;  4C9Y A;  4D7N A;  5JVT A;  3G73 A;  1YX5 A;  2KRC A;  4XOP A;  1TBX A;  2F4I A;  4RAG A;  2DOD A;  4DBQ A;  1QNT A;  1J75 A;  2XF7 A;  1ETO A;  1FYK A;  1S7A A;  3CP2 A;  3Q3S A;  4F7Z A;  1DP7 P;  4XRS G;  3HRU A;  5KAF C;  1EKE A;  3IWZ A;  2Y2Z A;  3H1C A;  5DYM A;  3JRE A;  2KIS A;  5LHH A;  1BL0 A;  2OCE A;  3S32 A;  2O3F A;  3OYM A;  4EGY A;  3HGY A;  2W00 A;  3BC8 A;  3ZP5 A;  1Y1W J;  2EQR A;  5E20 A;  3S3O A;  4RM2 A;  1MZB A;  3DP7 A;  2K86 A;  2DYS H;  2F5V A;  4YEJ A;  3JRH A;  1HBX G;  3IH4 A;  2VKD A;  4A3I J;  1RR7 A;  3MD2 A;  5F64 A;  2HWV A;  4BUP A;  3BY6 A;  3I3L A;  1D5V A;  3ERE D;  3E5Q A;  2VJI A;  2ZXI A;  3GBG A;  4M74 A;  4HDV A;  4BXF A;  4E7K A;  2ZNZ A;  4LOC A;  2ZJP F;  1O3R A;  4XLE A;  2ID3 A;  2XPW A;  1IN4 A;  1O7F A;  2KPM A;  4IHY A;  3EYI A;  1WCM J;  4J01 A;  3GFI A;  1JE8 A;  1VZ0 A;  2LFB A;  2MA3 A;  2M7A A;  2K9S A;  3KPH A;  2CUZ A;  3ABL H;  4N4N B;  3C1D A;  1TP4 A;  2M34 A;  3GME A;  1DU0 A;  2ZSI B;  3MZ8 A;  5JI6 A;  1A31 A;  4KUM A;  1GUU A;  1V54 H;  1R4M B;  2X1E A;  1NG6 A;  2HDW A;  1TC3 C;  2H1L A;  1MBF A;  3QOD A;  1DU6 A;  1I39 A;  4E70 A;  3OYK A;  1IN5 A;  2ZJR F;  2E2H J;  2LSO A;  2A6H F;  2XPV A;  2O7O A;  1JT6 A;  2YR2 A;  4NQW A;  1Y8Q B;  3PSF A;  1XG1 A;  1NK3 P;  4DIQ A;  2HNH A;  1XN7 A;  2GIZ A;  3GWZ A;  3F8M A;  3HOV J;  4MEY F;  2L0K A;  3MKZ A;  1BI0 A;  3BRO A;  3RDI A;  1OCO H;  2CG4 A;  2VC1 A;  1S72 I;  3BR0 A;  4XSZ F;  1OR7 C;  1LFB A;  4IQ4 A;  2VON A;  2GZW A;  1X1C A;  3ZMS A;  1BR2 A;  1Y6I A;  2JA6 J;  3QP5 A;  4DZP A;  3EUA A;  4XIC A;  4H0E A;  1GT0 C;  5CVI A;  3CMA I;  1PUF B;  3HB9 A;  1SVL A;  2LRE A;  3PQJ A;  5ED4 A;  3CO6 C;  2MLG A;  4D1Q A;  1LFU P;  1B72 A;  3ZQ7 A;  1YW7 A;  1Z6T A;  2JWT A;  1QZE A;  3H3V K;  3K7A J;  3H9Q A;  3JTH A;  2P5L C;  2R7W A;  4HA8 A;  3TW7 A;  5JHF A;  4XN3 A;  1DP3 A;  1ERD A;  1A36 A;  3VWB A;  1UZC A;  1JI8 A;  2BY1 A;  1Z7L A;  4M6V A;  4A5N A;  4CGZ A;  2ACJ A;  1F36 A;  2DA1 A;  3ZXS A;  4A0X A;  1D0Z A;  2OJE D;  2ZCW A;  4IHV A;  3ZQG A;  3H35 A;  5DD8 A;  3RYP A;  3U1K A;  3WTV C;  4G7Z F;  3DU6 A;  2PN6 A;  1AHD P;  1TW2 A;  2FXA A;  5BPD A;  2VT2 A;  3C2B A;  5J1U A;  1D8J A;  3LA2 A;  3CDL A;  1X4O A;  2CRG A;  1ZEL A;  1UEL B;  5B1A H;  2Y48 A;  1KYZ A;  2IS6 A;  5F6F A;  4EV0 A;  3IRQ A;  2ECC A;  3K2Z A;  3L2U A;  1PUE E;  2DK5 A;  5DM7 F;  1MBE A;  2LF8 A;  1B9M A;  4IJA A;  2E60 A;  4HOB A;  2QWW A;  5D5W B;  3CCS I;  4MFD A;  4PGH A;  4XID A;  2WY7 Q;  2JUC A;  1SMY F;  3H5A A;  2M7B A;  2NVT J;  5D6F A;  3AG3 H;  5FRO A;  2H09 A;  1R5G A;  1ZYR F;  2HPM A;  3HKZ A;  2Z2S B;  3G3Z A;  5E17 F;  1EJ9 A;  5BQT A;  3SEQ A;  3OR1 C;  3LFU A;  2M1B A;  3UKG A;  3ZMT A;  2DXI A;  2RV8 A;  4DYR A;  2RNG A;  1XCV A;  1MBK A;  1OCR H;  5M3F J;  1BW5 A;  3BWG A;  4MTD A;  3GTQ J;  1P2F A;  2E19 A;  1B9N A;  2WAQ A;  4HX8 A;  4RDU A;  1BC8 C;  4CCM A;  4BGD A;  4B8X A;  3L7W A;  3BCB A;  3R60 A;  3CES A;  3GTP J;  2HVS A;  2G9W A;  1YJN I;  3BJ6 A;  1R00 A;  2BOL A;  1XGM A;  2FD5 A;  1KQ0 A;  3W2V A;  1V5E A;  4L9T A;  4V2F A;  3I59 B;  3ROU A;  1PYV A;  4R79 A;  2I8D A;  1H89 C;  1R6R A;  1NK2 P;  4IOC F;  1ZG5 A;  2D5V A;  1HDD C;  4M6X A;  1RES A;  2DA3 A;  3LSM A;  2V9V A;  4C2M J;  1V5G A;  1BR1 A;  4HNV A;  3L2C A;  1YI2 I;  5KVR A;  5KAI C;  1YQA A;  2N8G A;  4WF2 A;  1ETY A;  2CU7 A;  4Q5S F;  2DAO A;  3EDP A;  2XF5 A;  2LY1 A;  4CYC B;  3GVA A;  2UXX A;  2W25 A;  1SFO J;  2CS3 A;  3M07 A;  2JUG A;  4ENK A;  5KHD A;  1R36 A;  2VKV A;  4LFU A;  1LE8 A;  5JLW A;  4OAY A;  2UZK A;  1DQU A;  3DPT A;  1OR7 A;  1Y8R B;  1P92 A;  1IXS B;  1A6Q A;  3K1M A;  1WI9 A;  4UUT A;  3CC7 I;  3DU5 A;  1WJ5 A;  5GAD J;  3S14 J;  1RKT A;  2WC2 A;  4P96 A;  3IUO A;  1IAW A;  2W82 A;  4M73 A;  2CUE A;  1R7J A;  3F22 A;  1AA7 A;  3V8K A;  4IOA F;  1ETW A;  3RKY A;  1BBY A;  1QGP A;  1QBJ A;  2NNN A;  3WTW C;  4UXN A;  2RRE A;  1IG7 A;  3OY9 A;  1UAA A;  3SJM A;  4XRM A;  2KQR A;  2BW3 A;  1I3A A;  4BQQ A;  3OYL A;  4O3M A;  1VQN I;  1OYY A;  3ESW B;  3MQ0 A;  1IW7 F;  2ADU A;  2KIM A;  1J7K A;  4FET A;  1VFC A;  3RKX A;  3KFW X;  3LA3 A;  3GXO A;  4XL9 A;  4Y7N J;  1W36 D;  1FSE A;  3IH3 A;  3DF8 A;  2CFO A;  4CHU A;  3E97 A;  4Q48 A;  2K7L A;  2WAD A;  1K7A A;  2VOO A;  5F04 A;  4ON0 A;  3B6C A;  1OKR A;  3K9T A;  2IGM A;  2QA4 I;  5D4R A;  2O5R A;  1FWZ A;  2RGV A;  3WTT C;  2R5Y B;  3W2A A;  3HXL A;  1XSX A;  3KYL A;  1B4A A;  4EMS A;  1Y0N A;  1U8R A;  4CCO A;  3OYN A;  1DGW Y;  2E2I J;  2KHM A;  5FKL A;  3F0C A;  3RQI A;  3R4K A;  3GX4 X;  4M3D A;  3KP2 A;  3NEU A;  2HYJ A;  2G0E A;  5GAG J;  3KYC B;  3T1B A;  3O8G A;  2EWN A;  5FD5 A;  1T98 A;  2HDC A;  3BOQ A;  1LNW A;  3K1N A;  2BVM A;  3H9J A;  1VQ8 I;  5J8F A;  3CJT B;  3CCU I;  1RR8 C;  3G71 I;  4G7H F;  4LK0 F;  1YRN B;  2V9P A;  4YEL A;  5FKK A;  2XDV A;  2STT A;  1Z9C A;  1ZRD A;  4BDY A;  5EJC A;  3CO7 C;  4KA4 A;  1B8I A;  1EH8 A;  3IL2 A;  1FJL A;  4IO9 F;  3J81 Z;  2GAU A;  3JRA A;  4KMF A;  4AYB A;  2LY9 A;  1ETK A;  3E3V A;  2PJR A;  2R7F A;  2V4J C;  3CF2 A;  1Z05 A;  4S0H B;  3HRM A;  4HLX A;  2XRO A;  2VL8 A;  3PIP F;  4RLQ A;  2M5W A;  2HZD A;  2Q2E A;  3H3U A;  4Y3O A;  2O6G E;  1FT9 A;  2E7W A;  3IAS 2;  1OPC A;  4ZDO A;  4CCK A;  3DXJ F;  5FD6 A;  2V6C A;  2K5C A;  4I2O A;  2HFH A;  3R61 A;  4II2 A;  2W1O A;  1HQC A;  5EDN A;  2L9R A;  3GFJ A;  5ICG A;  2PMH A;  1P4X A;  2CW8 A;  2ZXW H;  4QIW N;  3HBL A;  4OIQ F;  3KLN A;  3ZPL A;  1S5L C;  4L9J A;  3M1E A;  3K6G A;  4A6D A;  1BJZ A;  2EFW A;  5E8G A;  4LLN A;  1V5F A;  1X2M A;  4RAZ A;  2D1V A;  2QQA A;  1P7J A;  2DA6 A;  2E1O A;  5D8K B;  5EG0 A;  1ZHF A;  3ERM A;  4B47 A;  1ZG3 A;  3A01 B;  2M4G A;  5F1R A;  4G94 A;  3BQZ A;  5J1Y A;  4MFE A;  2DQR A;  1IUY A;  4D7M A;  2R7V A;  3HGG A;  3BR1 A;  1I50 J;  1YE9 A;  2A05 A;  2FRH A;  2LNB A;  4QLC U;  4G9Y A;  5L3B A;  4A3B J;  1EF4 A;  3ML6 A;  1RI7 A;  5FKM A;  3QOP A;  2H94 A;  2RQP A;  4XLN F;  2EK5 A;  3TQN A;  4XMY A;  4XRF A;  2LTP A;  2JTV A;  3PUF A;  3F21 A;  4LD5 A;  3ZQL A;  2WAE A;  2KJC A;  4AVP A;  3FXQ A;  2R7T A;  3SZT A;  4M71 A;  3WU2 C;  3L2Q A;  5ICF A;  4IVN A;  5D5U B;  5LEK A;  4XLP F;  3IRR A;  1J5Y A;  2CW7 A;  3W3C A;  2DFI A;  3TW6 A;  2VXZ A;  3FDY A;  2K9L A;  3QYB A;  3W6V A;  3I4N J;  4U7B A;  4Y33 A;  3G2B A;  2LBF A;  3E0J B;  1IRF A;  5CVU A;  3CUQ B;  4BHP A;  4ZYE A;  2X1C A;  1WSU A;  2XB5 A;  2XHK A;  3I58 A;  4KIT B;  3HKZ N;  2VOP A;  1LEA A;  3L2W A;  2RAE A;  4M9Z A;  2Z16 A;  1E0E A;  1KGS A;  3KEQ A;  2RC4 A;  2FNA A;  4BKX A;  3HIF A;  4A0Z A;  4J00 A;  2IS1 A;  3CDI A;  3KYD B;  4NBQ A;  1LFP A;  5L3F A;  4I0B A;  2JSC A;  1O7L A;  4PSX A;  2GA2 A;  1Z6R A;  1B59 A;  2OPT A;  2WAQ N;  3GZN B;  5LD2 C;  2QBY A;  2V6E A;  5EEG A;  2L01 A;  2GXA A;  2DT5 A;  2CV0 A;  3HYI A;  2IJL A;  3TED A;  2MSY A;  5LBQ A;  4DW6 A;  4MO7 A;  4B43 A;  1OCT C;  3LST A;  4BY7 J;  4AM3 A;  3BP8 A;  3HUG B;  1X58 A;  3IKT A;  4A3K J;  1BOB A;  3ZQH A;  5HNF A;  1MSF C;  1Z3X A;  3IKV A;  1SAN A;  1HKT A;  4MQ9 F;  1T39 A;  2QEX I;  5L3E A;  3JRB A;  1FMV A;  2DT6 A;  4XKC A;  1Z21 A;  3BR6 A;  4CCN A;  4D0P A;  3MZY A;  4ESB A;  4ZYD A;  3GTM J;  5CQE A;  2HVR A;  1TL8 A;  1BJA A;  3VB2 A;  3C18 A;  1T33 A;  2ZFW A;  1YX3 A;  1K4T A;  2HI3 A;  1P6R A;  2OV7 A;  5K5Q A;  2R5Z A;  1V55 H;  3OIQ A;  1TT0 A;  1UHS A;  2A6T A;  5K7F A;  1T56 A;  1FYM A;  4AIJ A;  3TMO A;  3I71 A;  2IGN A;  2QCO A;  1YW8 A;  2BY2 A;  3K10 A;  4PJM A;  1ULY A;  1DUX C;  5AIQ A;  2R0Q C;  3DLA A;  1T08 B;  1HF0 A;  2NOJ B;  5TGT A;  1VND A;  4ESF A;  2CFX A;  4C30 A;  2DPD A;  1Z7U A;  3AL0 C;  3R0J A;  1UB9 A;  3ZQC A;  2OU2 A;  2MFZ A;  3OL4 A;  2O9L A;  2JA5 J;  1XC5 A;  1MJA A;  2WBM A;  1XSV A;  2MLK A;  3SXY A;  3KET A;  5TIS C;  2L5Q A;  2E1C A;  4F55 A;  1ZR2 A;  4H4K C;  3LSK A;  4HX4 A;  1N25 A;  2ZKZ A;  2RKH A;  2DOF A;  4U0V A;  4E7L A;  1ZLJ A;  1VQO I;  5ICE A;  1RUO A;  4ZYA A;  1RKW A;  2WTE A;  3QU3 A;  2CQN A;  5IT3 A;  1FNN A;  1GV2 A;  1XX5 A;  1MJB A;  5IOY A;  5LRS A;  4KYW A;  2HS5 A;  2Z3Y A;  2MYS A;  5GAE J;  1FLI A;  2HXO A;  4S04 A;  1XDS A;  1S6L A;  2F5D A;  4A3L J;  1YTY A;  1VQ4 I;  3PNT A;  4KN7 X;  4P9U A;  3LSP A;  4XKV A;  1YHQ I;  3PO2 J;  4YFK F;  1IRG A;  2PG4 A;  2O8K A;  2R7U A;  4UB6 C;  1ENH A;  4XNF A;  2IVM A;  3DEU A;  1T8I A;  1U2W A;  1T95 A;  3TBI A;  1SVO A;  3FMQ A;  1IN8 A;  2OTJ I;  3MMY B;  3MKW B;  4BS9 A;  1C0W A;  1IN6 A;  2WA0 A;  3BJO A;  4A12 A;  1V4R A;  3DBL B;  4AYB N;  4AD9 A;  3E6B A;  1H8A C;  2KIU A;  4MNU A;  2EZH A;  1QHG A;  4BE2 A;  1BIB A;  5HLI A;  1TLH B;  1IGN A;  2DOE A;  3P9K A;  3RPU A;  1X2N A;  3FXK A;  4YFN F;  1OFC X;  3A1Y A;  5DCM B;  5FJ8 J;  4EJV A;  3ASO H;  3L2R A;  4RAY A;  1IO2 A;  1LDJ A;  3SYT A;  5HDN A;  5IT9 K;  4BEH A;  5HLG A;  2OQG A;  3G1M A;  2IA0 A;  2FU4 A;  1W1W E;  2ID6 A;  5M3M J;  1ZGA A;  2CMP A;  3KZY A;  4XOT A;  2QKL B;  2PFB A;  2VPR A;  3P5J A;  4U88 A;  1BIA A;  3FHN A;  3WGG A;  3GTG J;  3HL2 A;  2OQR A;  2B7E A;  4XKB A;  1D1A A;  5J47 A;  4PGG A;  2R7O A;  5FO5 A;  4DNC A;  4C3H J;  5C4J J;  2Q0O A;  3BLY A;  2YU9 J;  5K5R A;  4FHT A;  4B1R A;  2JRM A;  1ZGW A;  3MVP A;  2HKO A;  2FA5 A;  2MBF A;  4I09 A;  5H2F C;  2RDP A;  4AIK A;  1K78 B;  5A2Q Z;  3FK7 A;  5C3E J;  1REP C;  3ECH A;  3KEY A;  4GO1 A;  1KU3 A;  3LFK A;  2V7F A;  2ZNY A;  2HVQ A;  1WH7 A;  5FLX Z;  1R49 A;  3F9K A;  3E1S A;  1YJ9 I;  2LP0 A;  4LLG F;  2VBZ A;  2XC7 A;  4ZTF A;  2R4G A;  1KZH A;  1OIS A;  3VSK A;  5K7H A;  4I6Z A;  1ITY A;  4B09 A;  5DS9 A;  3FM3 A;  2DMP A;  4CXF A;  1UG2 A;  3REO A;  4BE0 A;  3EET A;  2X6O A;  4UB8 C;  3A03 A;  4PFP A;  3I56 I;  5CVJ A;  1J0R A;  5EEH A;  4BBR J;  1DPU A;  5GTI C;  1O3Q A;  2BBY A;  2Y69 H;  1QHH D;  1PUF A;  2TDX A;  2NVQ J;  1GHC A;  2P4W A;  5B1B H;  4L9V A;  3TDZ C;  4ANJ A;  3HOS A;  3HDD A;  2L54 A;  3LQR A;  3FBN B;  2STW A;  2CWE A;  1UG0 A;  2HTS A;  5F1J A;  1J2X A;  2KZV A;  3OYE A;  5ICC A;  4X6A J;  1WZ2 A;  4LIT A;  2L3D A;  2AO9 A;  3F6V A;  3V4G A;  2M8G X;  2GOM A;  3FZV A;  2HTJ A;  1ZR4 A;  1TWF J;  2VKH A;  4MQV A;  3OYA A;  4HPQ A;  3OYJ A;  3J7Y J;  5EZH A;  5DUK A;  1KU9 A;  2IA1 A;  1L0O C;  3FXM A;  5B3S H;  2R7S A;  5E3O A;  5J4Y A;  3K1P A;  4P5O A;  4KFC A;  1JKP C;  4GGG A;  2HZT A;  2NS8 A;  2NOG A;  4A3M J;  2Z5U A;  2CQ7 A;  5BOX A;  2GXG A;  1AKH A;  2JA7 J;  4NC6 A;  3K69 A;  1YFH A;  1LVK A;  4MHG A;  4D5C A;  2PQ8 A;  2ZB9 A;  2ICW G;  3J81 K;  3K70 D;  3MEX A;  4F91 B;  2VB6 A;  2LRD A;  3BG3 A;  1X1A A;  2PEX A;  3LSH A;  4IQJ A;  2L4M A;  3HSF A;  5EF6 A;  2QM3 A;  1K6Y A;  2O03 A;  2DTR A;  3QPL A;  3JRC A;  2HYG D;  1I27 A;  3S1M J;  3OR2 C;  1ON2 A;  1MMA A;  3QYE A;  4OOI A;  1YLF A;  3ZMZ A;  1ZGJ A;  1IZ1 A;  3CCV I;  3H92 A;  4GXO A;  3ZOB A;  4IZZ A;  2EIM H;  1HST A;  5J6X A;  3G6E I;  4II3 A;  4ABZ A;  2CUJ A;  1R22 A;  2R7Q A;  3MAJ A;  4I7H A;  5CPR B;  5H6Q A;  1I1G A;  2BHY A;  4E6K G;  4OAZ A;  4LIU A;  1FIA A;  2KP6 A;  4FE4 A;  5BS6 A;  1ZTR A;  4M72 A;  2VBW A;  4CYD A;  1Q1V A;  3FXJ A;  3HZJ A;  2FF4 A;  3R6S A;  1FPQ A;  3A4C A;  1WVR A;  2EPF A;  2Y0S N;  3ONQ A;  2L4A A;  1E3P A;  4M6Y A;  4ZDL A;  5B66 C;  4ZYG A;  2NAZ A;  1ORK A;  3P7N A;  4WK8 F;  1QVU A;  1U5T C;  4D5F A;  4AUX A;  2K02 A;  4Y17 A;  2DN0 A;  2M9H A;  5F08 A;  3H0D A;  3F8B A;  3TDU C;  3M8E A;  1O3T A;  3RZD J;  4HF1 A;  3E5X A;  3F23 A;  2VQL A;  2XGE A;  4CCJ A;  2ZXH A;  4RBO A;  4M3E A;  5FB2 A;  4HEA 2;  2MC4 A;  2H6B A;  1P7I A;  3QPH A;  4JX4 A;  4UUS A;  2L7M P;  4RM3 A;  5E18 F;  1Z67 A;  3BTC A;  3PFY A;  3GO5 A;  4LGW A;  4OIP F;  1FTT A;  1RC9 A;  5HS7 A;  2DMQ A;  1I6H J;  3BR5 A;  5F27 A;  3LSI A;  2Y0M A;  4M3G A;  3W6J B;  3ZR8 X;  3WE3 A;  3V7C A;  4QTR A;  4FT8 A;  3T5X A;  1FBQ A;  5GTH C;  2RNJ A;  2BHZ A;  5D8L B;  1MMN A;  2KMU A;  5DDG A;  3I0T A;  3OYG A;  1G3T A;  3BZK A;  2K4J A;  1IDY A;  4LK1 F;  5J3L A;  4WXH A;  3F8N A;  4NQW B;  2ZJQ F;  1ZLK A;  2M45 A;  4IHS A;  3QQA A;  1RET A;  2FQ4 A;  2ELH A;  4K2E A;  1X3U A;  1BI1 A;  2FEZ A;  4W1U A;  1IXR C;  1MW7 A;  4LG3 A;  1QZZ A;  2EB7 A;  3N97 A;  4CIC A;  3E6M A;  3CJN A;  1UFM A;  2HU9 A;  2QGU A;  4R1H A;  4G6T B;  3WG9 A;  2HGC A;  3DTE A;  3CCQ I;  2IT0 A;  3DPL C;  2K3P A;  3SEZ A;  2EIK H;  2BV6 A;  2M0C A;  5L3G A;  1APL C;  3FXU A;  5KCM A;  1OCC H;  2PLY A;  4X0G A;  5LHI A;  2LK2 A;  1LDK B;  1VQK I;  5DTD A;  5IT9 Z;  1B72 B;  4HAM A;  2WB1 A;  1H9G A;  1I5Z A;  3S2H J;  2H27 A;  2K27 A;  3PNV A;  4Y52 J;  4I76 A;  5IYB J;  1TTY A;  2QZ8 A;  3DBR B;  2DA7 A;  4MIM A;  4NC7 A;  4Y15 A;  3K4C A;  3TO7 A;  1R71 A;  2ETH A;  3ZRG A;  2K3F A;  4E7Z A;  3DFG A;  3I4M J;  1JUM A;  5E1Z B;  1R9T J;  1CGP A;  1JHF A;  1R1U A;  3L00 A;  4RS8 A;  4CO8 A;  2JA8 J;  1JGS A;  1SAU A;  2X4H A;  2YS9 A;  4BXX J;  2DMT A;  2R7D A;  2BY3 A;  3CZ6 A;  4BH9 A;  1X3Z B;  3CC4 I;  3IC7 A;  2CGP A;  2Z99 A;  5H6R A;  3ZQQ A;  3WOD F;  5CLS A;  2GIV A;  5FRM A;  4IHT A;  2OCC H;  1VI0 A;  3JCU C;  3OMY A;  2JMW A;  3SQN A;  2NNY A;  2CQX A;  1LUJ B;  4E7H A;  4LMY A;  1GXQ A;  3BTL A;  1LPQ A;  2L9N A;  5IPA A;  3FKI J;  3CTA A;  3BCA A;  1U78 A;  3A02 A;  4DGW B;  1HW2 A;  5JVG F;  2FOK A;  1K83 J;  2XAG A;  2BYV E;  3FXO A;  3KP6 A;  2WY8 Q;  5TJJ A;  3G4S I;  4ZZD A;  2D45 A;  2J5O A;  1U5T A;  1FX7 A;  2V26 A;  3P9I A;  2HOS A;  5M5W J;  1UCR A;  2OF7 A;  3ZQF A;  2EZK A;  1IRX A;  2OUM A;  4HF2 A;  1PDN C;  1JKO C;  4A2U A;  2M0M A;  2X0L A;  3Q5F A;  3S15 J;  3Q9V A;  4BBS J;  1W5C C;  3FIW A;  3JTG A;  3TOB A;  1XGN A;  2VXD A;  3K4K A;  4G12 A;  2P7C B;  2BXZ A;  3CJQ B;  2XAS A;  1WPK A;  1STZ A;  2HQN A;  3H3Z A;  4DZJ A;  4L5J A;  4AWX B;  2HYF A;  1I1S A;  5E8I A;  4BHB A;  3HG9 A;  1RUN A;  2V79 A;  2K9Q A;  2E1M C;  2EV0 A;  1BI3 A;  2KIF A;  3CCR I;  3M1C A;  1JTX A;  1KU2 A;  5FKO A;  4KDP A;  1ZAO A;  5DD4 A;  2AQF A;  3NRV A;  4Z6Y A;  1IRZ A;  2LDU A;  3ZGK A;  2E5N A;  2W57 A;  3CMM A;  1Y0U A;  3V42 A;  2F48 A;  1UST A;  3KZZ A;  2F5F A;  2XAF A;  2D2W A;  5BNG A;  4F92 B;  2XVC A;  1W7P A;  2ZME B;  1W5T A;  4IHW A;  4G6Q A;  3HJE A;  1D8K A;  4LB6 B;  4FIS A;  3RZO J;  4RB0 A;  3K4M A;  2EBI A;  4JK1 X;  3BT9 A;  1VF9 A;  3KP7 A;  1MDM A;  2ELK A;  2HOA A;  3PQK A;  2FNP A;  2DCE A;  2QF7 A;  3HM5 A;  1W4M A;  2P6S A;  2A68 F;  4WX9 A;  3GZ6 A;  3RPQ A;  2JN6 A;  1T2K A;  3TO6 A;  1IXC A;  2P0W A;  1G3W A;  1MBG A;  2EA4 A;  1WH5 A;  1BA5 A;  2W48 A;  4JBA A;  4N9H A;  3SDB A;  2QLZ A;  1ON1 A;  1W0U A;  2GQQ A;  4IRH A;  2K40 A;  1DGR M;  4A6E A;  2BXY A;  4OU0 A;  4HX7 A;  3ISP A;  2H6C A;  3PUB A;  1ZK8 A;  3CC2 I;  1I6X A;  4I98 B;  2V1X A;  2DW4 A;  2BW3 B;  2M87 A;  2ZFU A;  4V2G A;  2EV6 A;  4A0Y A;  2Y9Z A;  4OIR F;  2LR8 A;  3QYF A;  1TQP A;  3BR3 A;  4KIC A;  5D6E A;  1SD7 A;  5CKT A;  2CYY A;  2VIX A;  4A3J J;  2HQR A;  2X6W A;  5CQG A;  4ZDP A;  2A69 F;  3I55 I;  4UUV A;  1Y56 A;  4IF4 A;  3OOU A;  5A2Q K;  2VQC A;  3L9F A;  5D5X B;  4XBF A;  2NRA C;  3H5R A;  3VFZ A;  4XM3 A;  3MFK A;  2JZY A;  2BGC A;  2VBX A;  5FLX K;  4UVC A;  4XLC A;  4WXD A;  1MD0 A;  1LQ1 A;  3I54 A;  3U1D A;  2P5V A;  1E17 A;  1F1Z A;  1XGO A;  2WAF A;  3LSJ A;  3OYD A;  5K1Y A;  3N05 A;  4KJZ A;  1YJW I;  4CZZ A;  5CJ9 A;  4PZJ A;  3HOT A;  1BR4 A;  1SFX A;  2F5C A;  1BW6 A;  3LNQ A;  1IC8 A;  3D0S A;  4EM1 A;  3ZMD A;  3IWF A;  3QU6 A;  2OD5 A;  3HTU A;  4BAY A;  3A2K A;  5C4X J;  1MNM C;  2M8E A;  2LKS A;  3B6A A;  2M4K A;  2Y9Y A;  4AVZ A;  1TQM A;  3NQO A;  1G2H A;  4RB1 A;  1MMS A;  1U9N A;  3A0B C;  2XKO A;  4DOZ A;  3SFZ A;  2DT7 B;  1TWA J;  2BZT A;  3C7J A;  5J40 A;  5ILV A;  2IA2 A;  3DBH B;  4HST A;  4OMZ A;  1H9T A;  3OOP A;  4KIG A;  3WE2 A;  2NYX A;  4DYQ A;  4XOR A;  1LEB A;  5JFR A;  4LIV A;  3PIO F;  1IDZ A;  4EGZ A;  2PJR B;  2TRT A;  2V1D A;  4UV9 A;  5D4S A;  3AG2 H;  3X2Q H;  2DI3 A;  2XKP A;  2CQK A;  2Q2E B;  3HC7 A;  2C6Y A;  5J1R A;  5H20 A;  1O57 A;  4EJT A;  3DKW A;  5DV5 A;  2B9S A;  2PX9 A;  2HKX A;  4EJO A;  4I0A A;  1SMT A;  2B0L A;  2EFP A;  2Z1D A;  3GEZ A;  4IXA A;  4B4C A;  3H5N A;  4DYC A;  4CH7 A;  4O5V A;  4E7J A;  2IXS A;  4OMY A;  1AOY A;  1S29 A;  3O3K A;  4L5E A;  2IGO A;  2WB1 N;  4B44 A;  4A3F J;  1FIP A;  2B63 J;  5L3D A;  2R7R A;  3N4M A;  4NC8 A;  2IAI A;  1SVM A;  4JX5 A;  1M1E B;  4PUS A;  3S2W A;  3LMM A;  1PP7 U;  2DOA A;  1SFE A;  2L9V A;  4TV7 A;  3LSR A;  4LG0 A;  1MH3 A;  2A61 A;  3PJR A;  4IHX A;  5EG0 B;  1IN7 A;  4UVB A;  2MW8 A;  2OBP A;  4BJT A;  1B1B A;  5HDG A;  2FE3 A;  4J19 A;  1ETX A;  2LYC A;  2KDO A;  1VQ9 I;  3E5U A;  3E6C C;  2X6Y A;  3H0G J;  1KON A;  4PJJ A;  3G1L A;  3ZMU A;  3BR2 A;  2CJJ A;  1ZH5 A;  1ZN2 A;  2R7X A;  2CV1 A;  3QP6 A;  4U0W A;  2UUZ A;  5LFA A;  1TWC J;  3EPZ A;  2MGQ A;  1UJ8 A;  1RIO H;  4FQG A;  2LG4 A;  5LEJ A;  3DKY A;  2UV1 A;  3DPU A;  3LAP A;  2VQG A;  3C2H A;  3S3N A;  1N77 A;  2X85 A;  1EH7 A;  2XRN A;  2HR3 A;  2P7V B;  3OV8 A;  2E36 A;  2FSW A;  3C3W A;  1JTY A;  1LJ9 A;  3D1N I;  4HLY A;  2VE9 A;  2P5K A;  2D1H A;  3SZG A;  1N75 A;  2Y0S A;  4I99 C;  5DCM A;  3TP0 A;  4XR6 A;  1XPX A;  1MKM A;  3G1O A;  1Z91 A;  3BQY A;  2DBB A;  4NUB A;  1HLV A;  4NHJ A;  2G7H A;  1Z0X A;  5LRR A;  4PDK A;  2DA4 A;  3JW4 A;  4A5M A;  1IV6 A;  2OAZ A;  3TOA A;  2LC2 A;  3GCM A;  5M5Y J;  1HCR A;  4BXU A;  1WKM A;  2FX0 A;  4OWR B;  5HLH A;  2EA2 A;  1HKQ A;  3LWF A;  2QBY B;  1B6A A;  2QQ8 A;  4EEF G;  2LH9 A;  3GUD A;  2KRH A;  1SD6 A;  2CUF A;  3R0A A;  2XV4 S;  2MD5 A;  3DWL E;  3KZI C;  2VJ5 A;  1D1C A;  3HOU J;  1K78 A;  3J7Z I;  2CQQ A;  2ISY A;  2K9M A;  3VDX A;  2O0Y A;  3OYF A;  2M2E A;  3CMY A;  3BTJ A;  1R1T A;  1IF1 A;  1PJR A;  2AXT C;  4S05 A;  4FX4 A;  4YIF A;  4C3J J;  5HDK A;  4HV6 A;  3S93 A;  1S7O A;  4XSX F;  1QO0 D;  3SHF A;  3W2W A;  2DFE A;  2QVO A;  1X1B A;  3U2R A;  4BQN A;  2QKM B;  4CDG A;  1K6O A;  2VLA A;  2JVG A;  3BTI A;  3H9G A;  1KU7 A;  4BJ5 C;  5HS8 A;  3OYI A;  4XK4 A;  4BHC A;  2MAB A;  4HZF A;  2F2E A;  3OWT A;  4WXC A;  4EQQ A;  5FLV A;  2PMU A;  5HOO A;  3OYC A;  2FML A;  1K4S A;  2DFF A;  3BJA A;  3FX3 A;  4R8H A;  4UVA A;  3F72 A;  2NVY J;  2G7U A;  3RPU D;  3DCF A;  5IP9 J;  5K7Z A;  3CF5 F;  3WTY C;  1PP8 F;  2ZC2 A;  2F5E A;  3L1P A;  2R5Z B;  3DTI A;  1QPI A;  1G3Y A;  5ILS A;  5GAH J;  5LGN A;  2IPQ X;  1KA8 A;  2DFH A;  3JRG A;  1QZY A;  4GYG A;  1FTZ A;  1DDN A;  1XDU A;  4PJL A;  3JRI A;  3AAF A;  2LKX A;  2LVS A;  4PCQ A;  4B3X A;  3K70 C;  1D3Y A;  3NWS A;  1R5H A;  2DU9 A;  1VTN C;  3GZ5 A;  3D5S C;  4M3F A;  2Q8K A;  4JYK A;  1IJW C;  1CF7 B;  4X1E A;  1T6S A;  1LKX A;  2L02 A;  4EVI A;  5FKN A;  3HOX J;  3J7A Y;  1OMI A;  1BOA A;  1DPR A;  3QOE A;  2GXB A;  1FEX A;  3PO3 J;  3FF5 A;  2DDB A;  5GPA A;  1YYV A;  3FMS A;  4RA2 A;  2A5W A;  3L2V A;  3O2P E;  2NVX J;  1XCB A;  4Q47 A;  9ANT A;  2Y75 A;  4KT5 C;  2H8R A;  2V1U A;  5B5E C;  1U9O A;  4NB5 A;  5DEQ A;  1A5J A;  3JR9 A;  4A3C J;  3CCY A;  3CCE I;  2DLL A;  1RNL A;  2W4S A;  2DQL A;  1D0Y A;  5EGO B;  1ACI A;  4CA0 A;  1HSJ A;  5E3N A;  4HDU A;  2LMD A;  1GV5 A;  1WJD A;  1FBS A;  4ETS A;  3Q0W A;  1F9N A;  2DMU A;  4P1W A;  3MKL A;  4G7O F;  2QSG X;  2CW0 F;  2W85 A;  2GBY A;  3K4B A;  4KIS A;  2JA2 A;  3CQZ J;  1S9H A;  1JKR C;  4ENM A;  1TNT A;  3FXR A;  2GOX B;  2OA4 A;  4Y13 A;  1VQP I;  3CCL I;  2VN2 A;  3M4O J;  2KFD A;  4A3D J;  1QQI A;  3Q0V A;  4YFX F;  4L5I A;  3OYB A;  2X48 A;  1USS A;  2CO5 A;  3PNY A;  4U7D A;  1JUP A;  1L3L A;  2FQ3 A;  1VQM I;  1S7E A;  1X1D A;  3PSI A;  2NS7 A;  3HRS A;  4BEH B;  2AHQ A;  3PM1 A;  4IKF A;  2JVH A;  3M7G A;  3FBI B;  2KKO A;  3S2D J;  3RYR A;  1E3O C;  1ZQ3 P;  4XKW A;  1Z3Y A;  3OS2 A;  4F3Q A;  1H88 C;  3RKQ A;  2ISZ A;  4Z2Y A;  5CVV A;  2XRL A;  1MIJ A;  3RSN A;  1YO5 C;  2XIG A;  1YIT I;  4XLF A;  4BAC A;  5FRN A;  1UHW A;  1GXP A;  1HW5 A;  3DLL F;  2IS2 A;  3EQL F;  3FMR A;  2VI6 A;  2V1N A;  3VYU B;  1HKS A;  3NWT A;  2VUM J;  2XGD A;  1SFU A;  2QSF X;  1TWG J;  2E35 A;  1P9Q C;  4YIR X;  3KX2 A;  4PJN A;  2OZU A;  1J59 A;  2BEO A;  1OQY A;  1OYI A;  4C2U A;  1BI2 A;  3HTS B;  1R58 A;  2L7Z A;  2F4O B;  2VJ4 A;  4EM0 B;  2ZME C;  1JHH A;  1RZ4 A;  4QWQ A;  4P9F A;  5FLM J;  3M8J A;  4WWC A;  2Y30 A;  1F43 A;  1POG A;  3FKJ A;  3KLO A;  3AL0 B;  2YX7 A;  5LGT A;  2YUS A;  3I59 A;  4CZC A;  5IYD J;  3EUH C;  1X4P A;  3PL8 A;  1WJC A;  1VQ6 I;  2KL4 A;  3HPH A;  3I5U A;  3OIO A;  2L7F P;  2XF6 A;  1MGT A;  3DTK A;  3CCJ I;  3J7A O;  5FFX A;  2JJ7 A;  3CP8 A;  4ZC3 A;  2MH9 A;  3S1R J;  3HOZ J;  3Q9S A;  2H1K A;  4CYC A;  3ASN H;  2HOT A;  2VKE A;  3SDG A;  1IV8 A;  5HOD A;  3DV8 A;  3U21 A;  3MKY B;  3A0H C;  1VQ7 I;  2ESN A;  2DJN A;  4AIH A;  1A04 A;  4IRG A;  2CV2 A;  4LB5 A;  3HHH A;  2FBH A;  3RCO A;  2JK3 A;  1MH4 A;  3FWE A;  2EJR A;  2R93 J;  4HW0 A;  2RVC A;  1ZRF A;  1LB2 A;  1JT0 A;  3WG7 H;  2RQQ A;  1W36 C;  2IW5 A;  1D5Y A;  3DEE A;  3HOY J;  5FFZ A;  3M9A A;  2GLO A;  1T38 A;  3OL3 A;  3TGN A;  1AKH B;  5IOZ A;  1JJ8 C;  1ZAR A;  3FIS A;  3D5R C;  1OCP A;  5JR3 A;  1BC7 C;  4HNT A;  1VQL I;  5EZG A;  5JHU A;  2IS4 A;  1YW9 A;  5J4V A;  3JSP A;  3SFI A;  4YRV A;  4RLF A;  1WRJ A;  4RAF A;  3CME I;  2EIJ H;  3T8T A;  3VYR B;  4RGS A;  3S3M A;  2GWR A;  1WJB A;  3I64 A;  1T0F C;  3E6D A;  4HQE A;  4I01 A;  1XB4 A;  4IRI A;  3JAM Z;  1QRY A;  3EYY A;  4FAS D;  2VT3 A;  1ONV A;  4FTH A;  4MEX F;  2NXN B;  4WCG A;  4L18 B;  3RJP A;  1ETV A;  2MG4 A;  2COB A;  3GFM A;  3CUQ C;  4KIB A;  4F52 A;  3S17 J;  4U87 A;  4EJW A;  2ESH A;  1OLT A;  2R5Y A;  1IUF A;  3K4L A;  2IGK A;  2IEK A;  2HDD A;  3HEF A;  2J5P A;  1QVT A;  2HPI A;  4QSH A;  3RI4 A;  1MJ9 A;  2UWM A;  3F8C A;  4KIF A;  4DJA A;  4E4H A;  1HC8 A;  1E3H A;  1PVE A;  1NHA A;  3HSE A;  2EFQ A;  1FBU A;  2A6E F;  2A5Y B;  2I5U A;  2K9N A;  1HXD A;  1TNS A;  2RN7 A;  3GW2 A;  2HQA A;  1X3W B;  3S1N J;  1ZRE A;  3E7L A;  4JOM A;  1YRN A;  2E5Z A;  3OS0 A;  4RB2 C;  1FSH A;  4BQA A;  1JXS A;  1YS7 A;  4RGR A;  4KNY A;  4YG2 F;  1J9I A;  1D0X A;  3WGI A;  2ZME A;  3BPX A;  3CUO A;  3C2G A;  4UV8 A;  5IP6 A;  3JRF A;  2A07 F;  6PAX A;  4DQ2 A;  3GLX A;  4E7I A;  3J80 Z;  3OS1 A;  5LHG A;  3I9V 2;  1XMX A;  2L9S A;  3B02 A;  2ZSH B;  2QUF A;  2VBY A;  4UUS B;  3EUH A;  3QAH A;  1FOY A;  2OZ6 A;  2AQE A;  4QPO A;  1F4K A;  2YU3 A;  2I10 A;  3PFI A;  4ZJZ A;  4A93 J;  1TW3 A;  5LLQ A;  3RKW A;  5K5O A;  1D1B A;  4ZZL A;  4C3I J;  2YX4 A;  3JSO A;  3ZN1 A;  2YSR A;  1K79 A;  3GTK J;  4JX6 A;  2EV5 A;  4B3A A;  1G3S A;  5HVQ C;  1FOW A;  1U6G A;  2DPU A;  2Z9O A;  1OYW A;  2VPL A;  1OCZ H;  3VSL A;  2KRF A;  2DA5 A;  4FCY A;  3FHZ A;  2JPC A;  4OIO F;  1ZKG A;  2MH2 A;  2Z33 A;  4M9S A;  5BPI A;  1W0T A;  3CLQ A;  1A35 A;  5DM6 F;  5GPC A;  4PK4 A;  3M3Y J;  5IY5 H;  3TP3 A;  5E1X A;  2R92 J;  2ELJ A;  4D9J A;  3DKX A;  2VOD A;  3A01 A;  5KNL A;  2XB0 X;  2XGX A;  3IH2 A;  4BDZ A;  4AID A;  3ABK H;  1W5S A;  3T8R A;  3WTU C;  4ZTJ A;  1GDT A;  4KMU X;  1AU7 A;  1O4X A;  3WTS C;  2KZG A;  5KK1 A;  4C2T A;  3WGH A;  4EAT A;  4ZYH A;  5FGM A;  1W7P D;  1U0J A;  2ZO4 A;  3TL4 X;  4F93 B;  1U3E M;  3U9G A;  2XPU A;  3GLL A;  3IV5 A;  2X51 A;  3CD6 I;  1KQ8 A;  1T0F A;  2M3A A;  3OSF A;  3EUK L;  1LDD A;  2HXI A;  1QA6 A;  1QU3 A;  4JP0 A;  2LY2 A;  3AFH A;  2LD5 A;  2XAH A;  2NVU B;  3WU1 B;  3RQ4 A;  3JRD A;  4FX0 A;  4RGU A;  1LE8 B;  1EV7 A;  2EIN H;  4OIN F;  4BNC A;  4U0Y A;  3V8L A;  1R23 A;  3CUQ A;  1TQI A;  3ELK A;  2AXL A;  2MD0 A;  3HRT A;  1HOM A;  2MC3 A;  4BE1 A;  1FC3 A;  2QQB A;  5C44 J;  1WGX A;  2X6X A;  2OC6 A;  4P55 A;  1S8N A;  3WHB A;  1JUS A;  2LKP A;  1GLN A;  1BN5 A;  2DJI A;  2XSD C;  2PMZ A;  4GRI A;  4EJU A;  1H0M A;  5HS9 A;  2DO7 A;  5JLX A;  3MZH A;  3HOW J;  5HNH A;  2XAU A;  1SFK A;  3LAJ A;  1P4W A;  3DQV C;  3NAR A;  1WWX A;  2QEN A;  3H36 A;  5GP9 A;  2FBI A;  2UXN A;  3KP4 A;  4B48 A;  4ENN A;  5E79 C;  3GTO J;  4HG2 A;  3HUG A;  3P9C A;  2XAQ A;  1RRJ A;  2O61 A;  3QRF F;  1MBH A;  4BJ6 C;  4Y4R A;  2EH3 A;  1U5T B;  2WWY A;  2NS0 A;  3RIR A;  4XQF A;  3KCC A;  2DDA A;  2IRF G;  3WTX C;  2ZXJ A;  3CLO A;  4KT6 A;  1G6N A;  2KLO A;  3BG9 A;  1MMG A;  2P8T A;  2JT1 A;  4W97 A;  3ULQ B;  4CSW A;  3B73 A;  3K2A A;  5M5X J;  4O6J A;  2FMY A;  4RB3 C;  4IPA A;  4N4O B;  2XSJ C;  3O6B B;  2VQH A;  1FZP B;  3HHG A;  2VAS A;  2HOE A;  3AG4 H;  4FE7 A;  1FP2 A;  1N78 A;  1R1V A;  4GCV A;  3SZP A;  4GYI A;  5CYV A;  2VE8 A;  4HF0 A;  3ZQI A;  3I4P A;  1VQ5 I;  4HQM A;  2PBI A;  2Y31 A;  4E7S A;  3F6O A;  3GYH X;  3ABU A;  4XLH A;  1NG7 A;  3ZCO A;  2F4M B;  5BMZ A;  3Q0U A;  4XLA A;  4HBL A;  3HSR A;  4AU7 A;  4IX7 A;  1HW1 A;  1W7P B;  5AON A;  4RGX A;  5EYR A;  1O3S A;  1FOK A;  1B8I B;  1WJE A;  1YOV B;  2BY0 A;  3O8H A;  4LLL A;  1UHM A;  2L7K A;  3BZ6 A;  3WU0 A;  4L9N A;  2CSO A;  4ENJ A;  4CCL A;  1E2X A;  4MGR A;  4PJ0 C;  5E3L A;  2PI0 A;  2W7N A;  1ETQ A;  1MMD A;  3LOC A;  1CQT A;  2K85 A;  4HYE A;  1MDM B;  3K4J A;  2EIL H;  4XON A;  4BU2 A;  2DA2 A;  3BG6 A;  3K0L A;  1MND A;  2ME6 A;  2BVL A;  4L0Y B;  2IBD A;  4A3G J;  3F3X A;  2ME0 A;  4A69 C;  3OIP A;  4BL0 B;  4GDF A;  1GVD A;  4M9X A;  3CCM I;  3GTL J;  1X19 A;  3NAU A;  5IP7 J;  2HEO A;  3FXL A;  2CH0 A;  1R4N B;  2Q1Z B;  2TCT A;  2KDZ A;  3UNG C;  2H8W A;  2DTZ A;  4G6D A;  4ESJ A;  1SC7 A;  2KJB A;  1BM9 A;  1EH6 A;  3VOD A;  3BPV A;  1SEU A;  1TZL A;  1S3J A;  2L2O A;  4LJZ F;  5LGU A;  4HV5 A;  4UHT A;  3S1Q J;  2E71 A;  3IP4 B;  2W84 A;  1G59 A;  1XMA A;  1R5I D;  1J09 A;  2FBK A;  1U8B A;  3LA7 A;  5EEA A;  1JGG A;  2QYO A;  3V7R A;  1NH3 A;  2JPB A;  2JRT A;  3FK6 A;  2DMN A;  1K61 A;  4AC0 A;  3ABM H;  1P4A A;  1Y1V J;  2IP2 A;  5D5V B;  1F5T A;  3VYS B;  3I53 A;  1TT5 B;  2ZBK A;  3AG1 H;  4N9I A;  2XAJ A;  1UMQ A;  3V8J A;  1XSD A;  2HQ5 A;  3ABT A;  1OJL A;  1XS9 A;  2E1N A;  2QQ9 A;  2AS5 F;  3GFL A;  4UY8 I;  1KQ9 A;  3VYT B;  4KN4 X;  5F0F A;  4EM2 A;  2E2J J;  2FJ1 A;  2LBF B;  3L09 A;  5HLT A;  1ZG1 A;  3BZC A;  3K4N A;  1KYW A;  5E1W A;  5TRD A;  4BY1 J;  1XD7 A;  1XMK A;  3IAM 2;  4XRS A;  3GF2 A;  3ZN0 A;  2X9D A;  2R3S A;  4PSW A;  3V7S A;  4I02 A;  2PJP A;  2JSP A;  2M30 A;  1NTC A;  4QPQ A;  3GTJ J;  1MSE C;  4L0Z B;  3AKZ A;  4RMN A;  3ZMV A;  2JQ7 A;  1CF7 A;  2WV0 A;  2E1M B;  3D5L A;  3DEW A;  2K4B A;  1GVJ A;  3W6K B;  1WI3 A;  4V19 K;  2E34 A;  2W24 A;  2E7X A;  2VJJ A;  4BQO A;  3OSG A;  2EFO A;  5F0H A;  3BG5 A;  5L3C A;  3LQQ A;  1V3F A;  3M8F A;  4HRI A;  2VC0 A;  5J8C A;  4DBR A;  3KIO A;  4GFB A;  3OYH A;  2A3S A;  5ILU A;  1A6I A;  1Y39 A;  1Z77 A;  4ITV A;  2LOO A;  3MWM A;  2P6T A;  4IEJ A;  3JAM K;  1SD5 A;  4LG0 B;  3WHC A;  1FP1 D;  4IL6 C;  3VPR A;  5EGO A;  1MNE A;  3S8P A;  4NDL A;  2FUG 2;  5E3M A;  3F8F A;  4ZH4 F;  1YS6 A;  3CJR B;  4NNJ A;  1ZRC A; 
#chains in the Genus database with same CATH homology
 2L7Z A;  1U78 A;  1RPW A;  3A02 A;  2XB5 A;  5FLM J;  1JJ6 C;  1K83 J;  2Y30 A;  3HKZ N;  1F43 A;  1POG A;  2RAE A;  2YUS A;  2HOS A;  2PMZ N;  5M5W J;  4BKX A;  2R7Z J;  5IYD J;  2OF7 A;  3ZQF A;  2EZK A;  5IYC J;  1JKO C;  2LLK A;  3QPS A;  3S15 J;  3OIO A;  2L7F P;  3LSG A;  2OPT A;  2WAQ N;  1I3Q J;  2EZL A;  4BBS J;  2JJ7 A;  5F0C A;  3TED A;  2MSY A;  2WV1 A;  3FIW A;  3MN2 A;  4M3B A;  4DW6 A;  3S1R J;  4MO7 A;  3HOZ J;  1OCT C;  2H1K A;  2P81 A;  4MLO A;  4CYC A;  2HOT A;  4G12 A;  2VKE A;  4BY7 J;  3SDG A;  5HOD A;  1X58 A;  4A3K J;  1WPK A;  3ZQH A;  4DZJ A;  1MSF C;  2DJN A;  2EZI A;  1SAN A;  4A3E J;  1JKQ C;  2K9Q A;  2ECB A;  1JTX A;  5FKO A;  2JK3 A;  1MH4 A;  2GM4 A;  2KT0 A;  1IRZ A;  3JRB A;  1TWH J;  2R93 J;  3S16 J;  5BNG A;  1HDP A;  1MBJ A;  3BR6 A;  1JT0 A;  1D5Y A;  4IHW A;  3HOY J;  2XGC A;  1AKH B;  2GLO A;  3GTM J;  5IOZ A;  1JJ8 C;  4D7N A;  3FIS A;  1OCP A;  4FIS A;  1T33 A;  3RZO J;  5EZG A;  1ETO A;  2EBI A;  3SFI A;  3BT9 A;  1VF9 A;  2HI3 A;  3Q3S A;  4XRS G;  2ELK A;  2HOA A;  2R5Z A;  2QF7 A;  3HM5 A;  2Y2Z A;  3JRE A;  2JN6 A;  1UHS A;  1BL0 A;  1QRY A;  3HGY A;  5K7F A;  1T56 A;  4FTH A;  1MBG A;  1WH5 A;  1BA5 A;  2W48 A;  2QCO A;  1Y1W J;  2EQR A;  1ETV A;  2MG4 A;  2COB A;  1W0U A;  3S17 J;  2K40 A;  2R0Q C;  3JRH A;  2R5Y A;  1ZK8 A;  3IH4 A;  1IUF A;  1HF0 A;  4A3I J;  2IEK A;  1RR7 A;  1VND A;  4V2G A;  2HDD A;  3HEF A;  2Y9Z A;  1QVT A;  2LR8 A;  3BR3 A;  3GBG A;  4QSH A;  3ZQC A;  4LOC A;  4A3J J;  2O9L A;  2JA5 J;  1XC5 A;  2ID3 A;  2XPW A;  4IHY A;  1WCM J;  3OOU A;  2LFB A;  2K9N A;  2K9S A;  1ZR2 A;  3S1N J;  3E7L A;  2M34 A;  1DU0 A;  1YRN A;  1RKW A;  1GUU A;  1TC3 C;  1DU6 A;  1GV2 A;  1MBF A;  3LSJ A;  5IP6 A;  5IOY A;  3JRF A;  2E2H J;  2XPV A;  2HXO A;  1BW6 A;  2O7O A;  3LNQ A;  1IC8 A;  1JT6 A;  4A3L J;  5C4X J;  4UUS B;  3LSP A;  1MNM C;  3PO2 J;  3B6A A;  1XG1 A;  1NK3 P;  2Y9Y A;  2O8K A;  2I10 A;  1G2H A;  4A93 J;  3HOV J;  2L0K A;  1ENH A;  1U9N A;  4C3I J;  1TWA J;  3GTK J;  4JX6 A;  4B3A A;  3BR0 A;  1LFB A;  4AYB N;  4DYQ A;  1H8A C;  2DA5 A;  2EZH A;  4FCY A;  2JA6 J;  4DZP A;  4XIC A;  1IDZ A;  1ZKG A;  1IGN A;  2TRT A;  1GT0 C;  1W0T A;  1X2N A;  1OFC X;  3HB9 A;  5FJ8 J;  1PUF B;  1B72 A;  5GPC A;  1LFU P;  3M3Y J;  5J1R A;  2JWT A;  3TP3 A;  2R92 J;  3H3V K;  3G1M A;  3K7A J;  2ID6 A;  3A01 A;  2XB0 X;  3IH2 A;  5M3M J;  3TW7 A;  2VPR A;  1GDT A;  1AU7 A;  4M6V A;  1O4X A;  4B4C A;  3GTG J;  1F36 A;  2DA1 A;  4DYC A;  4IHV A;  3ZQG A;  4C3H J;  5C4J J;  4L5E A;  2YU9 J;  2WB1 N;  4A3F J;  1AHD P;  1FIP A;  4B1R A;  2B63 J;  5J1U A;  3C2B A;  2IAI A;  3CDL A;  4JX5 A;  1ZGW A;  2XPU A;  3IV5 A;  2CRG A;  3MVP A;  3LSR A;  3OSF A;  1MH3 A;  4IHX A;  2HXI A;  5EG0 B;  4JP0 A;  2MW8 A;  2LD5 A;  3FK7 A;  5C3E J;  4J19 A;  3JRD A;  1ETX A;  2ECC A;  1LE8 B;  3H0G J;  1MBE A;  3G1L A;  3BR2 A;  2CJJ A;  1WH7 A;  4MFD A;  1HOM A;  4XID A;  2LP0 A;  1TWC J;  1WGX A;  5C44 J;  2NVT J;  2MGQ A;  5K7H A;  4I6Z A;  1ITY A;  3WHB A;  5DS9 A;  1JUS A;  2DMP A;  1UG2 A;  2XSD C;  3UKG A;  2X6O A;  3A03 A;  4DYR A;  3HOW J;  5JLX A;  1JTY A;  3D1N I;  5M3F J;  1MBK A;  4BBR J;  1BW5 A;  3GTQ J;  2E19 A;  4RDU A;  1PUF A;  3NAR A;  5GP9 A;  3TP0 A;  2NVQ J;  3G1O A;  3BQY A;  3GTO J;  3GTP J;  1HLV A;  3HDD A;  2FD5 A;  1MBH A;  1Z0X A;  2EH3 A;  2DA4 A;  4V2F A;  5F1J A;  1IV6 A;  1H89 C;  2D5V A;  1NK2 P;  4X6A J;  1HDD C;  1RES A;  2DA3 A;  3BG9 A;  2AO9 A;  5M5Y J;  4W97 A;  2M8G X;  4C2M J;  1HCR A;  2FX0 A;  3K2A A;  4HNV A;  5M5X J;  1ZR4 A;  1TWF J;  5EZH A;  2N8G A;  4EEF G;  1ETY A;  2CU7 A;  5E3O A;  4FE7 A;  1JKP C;  2NS8 A;  2CUF A;  4CYC B;  1SFO J;  2NOG A;  4A3M J;  1AKH A;  2JA7 J;  3HOU J;  2CQQ A;  2M2E A;  4D5C A;  2VKV A;  3ZQI A;  3CMY A;  1LE8 A;  5JLW A;  2ZB9 A;  3BTJ A;  2Y31 A;  3BG3 A;  4C3J J;  5EF6 A;  3Q0U A;  3QPL A;  3JRC A;  4UUT A;  3BTI A;  3S14 J;  4XK4 A;  3S1M J;  5EYR A;  1RKT A;  1B8I B;  3O8H A;  5FLV A;  2CUE A;  5E3L A;  1ETW A;  1ETQ A;  3LOC A;  2NVY J;  3ZOB A;  1CQT A;  5K7Z A;  5IP9 J;  3DCF A;  1IG7 A;  4ABZ A;  3SJM A;  4XRM A;  3L1P A;  2R5Z B;  1QPI A;  2DA2 A;  2ME6 A;  2IBD A;  3JRG A;  4A3G J;  1FTZ A;  1VFC A;  4Y7N J;  2ME0 A;  1FIA A;  4A69 C;  3JRI A;  3IH3 A;  1GVD A;  2LKX A;  2LVS A;  4FE4 A;  3GTL J;  1ZTR A;  3NAU A;  5IP7 J;  2TCT A;  2KDZ A;  1Q1V A;  5F04 A;  3B6C A;  2DTZ A;  2Y0S N;  2R5Y B;  4M3F A;  1IJW C;  4JYK A;  1ORK A;  4X1E A;  2E2I J;  5FKL A;  1QVU A;  4D5F A;  4AUX A;  3F0C A;  3RQI A;  2DN0 A;  2M9H A;  5F08 A;  4M3D A;  5FKN A;  3HOX J;  1FEX A;  2HYJ A;  3S1Q J;  3RZD J;  2G0E A;  3PO3 J;  3O8G A;  2XGE A;  5GPA A;  1U8B A;  4RBO A;  4M3E A;  5EEA A;  1P7I A;  4JX4 A;  1JGG A;  4UUS A;  2L7M P;  3BTC A;  2NVX J;  3FK6 A;  2DMN A;  1K61 A;  1FTT A;  9ANT A;  1I6H J;  2DMQ A;  3BR5 A;  5F27 A;  4AC0 A;  2H8R A;  1YRN B;  5FKK A;  1U9O A;  4M3G A;  1Y1V J;  4QTR A;  1A5J A;  3JR9 A;  1B8I A;  1UMQ A;  2HQ5 A;  3CCY A;  1OJL A;  4A3C J;  1XS9 A;  1FJL A;  5EGO B;  1IDY A;  3JRA A;  5J3L A;  5E3N A;  5F0F A;  2LY9 A;  1GV5 A;  1ETK A;  2E2J J;  2FJ1 A;  3Q0W A;  3QQA A;  4S0H B;  2DMU A;  1RET A;  2FQ4 A;  3MKL A;  4BY1 J;  2GBY A;  4W1U A;  3CQZ J;  4XRS A;  1JKR C;  2X9D A;  3M4O J;  4A3D J;  3Q0V A;  5EDN A;  2L9R A;  2M0C A;  1NTC A;  1APL C;  3GTJ J;  1MSE C;  2X48 A;  4QIW N;  3HBL A;  1JUP A;  2LK2 A;  3DEW A;  5DTD A;  1BJZ A;  1B72 B;  1S7E A;  1WI3 A;  1X2M A;  2NS7 A;  3S2H J;  1P7J A;  2DA6 A;  2E1O A;  4Y52 J;  4I76 A;  3OSG A;  5EG0 A;  5IYB J;  2AHQ A;  3PM1 A;  5F0H A;  3A01 B;  3BG5 A;  2DA7 A;  5J1Y A;  3BQZ A;  4MIM A;  4MFE A;  1E3O C;  3S2D J;  4D7M A;  1ZQ3 P;  3HGG A;  3BR1 A;  1I50 J;  4A3B J;  4GFB A;  3I4M J;  1EF4 A;  1JUM A;  5FKM A;  1R9T J;  1H88 C;  3RKQ A;  2XRL A;  1A6I A;  2JA8 J;  2LTP A;  2YS9 A;  4BXX J;  1Z77 A;  2DMT A;  3ZQL A;  4IEJ A;  2VI6 A;  2VUM J;  2XGD A;  3WHC A;  3VPR A;  1VI0 A;  5EGO A;  1TWG J;  2JMW A;  4NDL A;  5E3M A;  3TW6 A;  3W6V A;  3I4N J;  2CQX A;  3BTL A;  5IPA A;  3FKI J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...