1R9TJ

Rna polymerase ii strand separated elongation complex, mismatched nucleotide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA strand
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 10
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1r9tJ00
2YUSA 1FIAA 2EZLA 1Y1WJ 5K7ZA 1RESA 2X6OA 3BG3A 2XGEA 3HOUJ 4JX6A 2GLOA 1ZK8A 1Y1VJ 5GPCA 2M8GX 4CYCA 4BY7J 1MBFA 2B63J 5F27A 1SANA 1H88C 1T33A 1U9NA 3GBGA 2LTPA 5F08A 2QF7A 4RBOA 2IAIA 5F1JA 4MO7A 3E7LA 4MFDA 4AYBN 1ETYA 2CQQA 3TP3A 1P7JA 1FTZA 2M0CA 3GTOJ 2CUEA 1BW6A 5IOZA 2E1OA 4Y52J 2FX0A 3HB9A 4JP0A 4B4CA 3JRAA 2EZIA 4IHXA 3HKZN 2VKEA 3QPLA 5M5YJ 1F43A 1PUFB 1JUMA 1ZQ3P 4M3BA 1W0TA 2JA5J 2K9NA 2VKVA 1MNMC 2XPVA 4A3DJ 5J3LA 2DMPA 2Y0SN 3QQAA 3GTMJ 3IH2A 5BNGA 1IUFA 2LFBA 1JKQC 3LSGA 1WCMJ 1OCTC 1WPKA 1GVDA 3HGYA 3GTJJ 1BW5A 2ME0A 3BQYA 1U8BA 4V2GA 3LOCA 1RPWA 4IEJA 1FJLA 5M5XJ 2CQXA 5GPAA 1R9TJ 5M3FJ 1H89C 1PUFA 1HOMA 2OF7A 2H1KA 3RZDJ 3BR3A 3JRHA 1IV6A 1QVTA 3HOYJ 3RKQA 5EZHA 3ZQLA 3W6VA 2XGDA 2ELKA 2KDZA 1G2HA 1ZR2A 3JREA 2MSYA 3A02A 2COBA 1ZR4A 1ETWA 2O8KA 2CJJA 3CCYA 3NARA 5K7FA 1MH3A 2DA4A 1RR7A 1GV2A 1JUPA 1MH4A 5E3LA 5IP6A 1X2MA 3TW6A 3GTLJ 3ZQIA 3S15J 1ETQA 4LOCA 3G1OA 2ID6A 5EG0B 5J1RA 5EYRA 5FKNA 2MG4A 3GTGJ 2JA7J 4IHYA 3HOXJ 2JA8J 2HOSA 2JA6J 2K9SA 1FIPA 1AHDP 1JKPC 3O8HA 1WI3A 3BTLA 3JRBA 1MBEA 3SJMA 4QTRA 2ECBA 1AU7A 1GT0C 5E3NA 2FD5A 2DA1A 1HF0A 2NVXJ 4A3EJ 1K83J 3VPRA 3G1LA 4JYKA 1TWHJ 4BBRJ 3S1QJ 1B72B 1ENHA 4A69C 3S16J 5EG0A 1EF4A 2NS7A 1B8IB 1ITYA 1SFOJ 4J19A 1AKHB 4DYRA 4XK4A 3HOWJ 2G0EA 3ZQGA 2D5VA 5FJ8J 1A6IA 4C3IJ 4A3BJ 2EBIA 1F36A 2Y31A 1P7IA 1T56A 2EZKA 3GTPJ 1DU0A 5E3MA 1K61A 4FE4A 3K2AA 3CQZJ 2R5YB 4XRSA 5E3OA 5FLMJ 5HODA 4Y7NJ 2R5ZB 2XRLA 2XPUA 2EH3A 2LD5A 1B72A 1WGXA 5FKLA 4A3JJ 4M3GA 2TRTA 2AHQA 3Q0UA 3M4OJ 2GBYA 1I50J 5F0CA 4D5FA 1B8IA 2DJNA 3HGGA 3HM5A 3ZQFA 1JUSA 4C2MJ 1MSFC 1AKHA 2IEKA 3BG5A 1BJZA 2LR8A 2RAEA 3ZQHA 1IC8A 3S2DJ 4XRMA 2DMQA 2WAQN 1ETVA 4S0HB 1IDZA 3DEWA 4ABZA 2M9HA 2QCOA 2CRGA 3B6CA 3OSFA 1ETOA 2R0QC 3C2BA 2IBDA 1I6HJ 2R5YA 1MBKA 2CU7A 1OCPA 5EZGA 1QRYA 3F0CA 2MGQA 4IHVA 2R5ZA 3A01B 1ZTRA 5JLXA 3LSPA 3JRFA 2NS8A 1BL0A 1JGGA 5FKMA 3HEFA 3S1RJ 4DZPA 3PO2J 3BTCA 3IH3A 4UUSB 2Y9YA 3BR1A 2O9LA 4QIWN 2Y9ZA 4M3FA 5F0FA 5DTDA 2R7ZJ 1IJWC 3PO3J 1GV5A 2XB0X 3NAUA 4FE7A 5IYBJ 4C3JJ 1JJ6C 3UKGA 2I10A 1UMQA 3OIOA 3G1MA 1LE8B 5JLWA 3A01A 1CQTA 2H8RA 2K9QA 1Z77A 2DN0A 4G12A 5FKKA 4XIDA 1XS9A 1IGNA 3JRDA 3MKLA 3SFIA 1MBHA 3S17J 3RZOJ 1IRZA 1LFUP 1VFCA 2EQRA 4XICA 2M2EA 4UUSA 3DCFA 3TW7A 3FK6A 1MBJA 1E3OC 1VF9A 3CDLA 3HDDA 5F0HA 1QVUA 3FK7A 5EEAA 3OOUA 2L7ZA 3JRCA 2DMTA 4EEFG 1MBGA 2FJ1A 2ID3A 3TP0A 5M5WJ 1NTCA 1D5YA 2E2JJ 2LLKA 1TC3C 1HLVA 3WHCA 1JKOC 4FCYA 2HXOA 2TCTA 5C3EJ 1XG1A 3H3VK 2XSDC 2JWTA 3FKIJ 3H0GJ 1JKRC 2X9DA 3BR5A 2DA5A 1LE8A 4BY1J 2JN6A 3QPSA 2E2IJ 5C44J 1ZKGA 3BR0A 5J1UA 3JRIA 2ECCA 1QPIA 3A03A 1W0UA 1IG7A 3MN2A 2M34A 3IH4A 2E2HJ 5C4XJ 1NK3P 2LK2A 4M3DA 9ANTA 4MLOA 2O7OA 4D7NA 3HBLA 2Y30A 3LSRA 1NK2P 2WB1N 4A3LJ 2YU9J 5IYDJ 1VNDA 2L0KA 1POGA 3S2HJ 3D1NI 2XB5A 2NVTJ 2OPTA 2HQ5A 1BA5A 2YS9A 2GM4A 1VI0A 4W1UA 3TEDA 1UHSA 4A3GJ 2N8GA 3RQIA 1O4XA 4QSHA 2X48A 2HOTA 4D5CA 3S1MJ 4IHWA 5EF6A 2ZB9A 2DA2A 3LNQA 5J1YA 3BG9A 4V2FA 3B6AA 1APLC 3K7AJ 1U78A 3BR6A 4I76A 2FQ4A 2K40A 5DS9A 3BT9A 3S14J 3S1NJ 4MIMA 2VI6A 4UUTA 3GTQJ 3IV5A 1RKWA 2DA3A 1Q1VA 2CUFA 4X1EA 2HYJA 1RKTA 2E19A 1ETXA 4DYQA 4XRSG 2DA7A 4A3KJ 3JRGA 5F04A 1ETKA 4JX5A 2LY9A 3BTJA 3GTKJ 1JTXA 1WH5A 1X58A 2L9RA 1I3QJ 1XC5A 3FIWA 1RETA 2L7FP 4DZJA 2Y2ZA 2VPRA 5IOYA 2ME6A 2L7MP 1UG2A 2R93J 4JX4A 2JJ7A 4W97A 4A93J 1WH7A 2JK3A 1LFBA 2NVQJ 1DU6A 1JT6A 5IYCJ 4FTHA 3CMYA 1Z0XA 3WHBA 4A3IJ 3JR9A 1GDTA 3BTIA 4BXXJ 1U9OA 1OFCX 4A3FJ 3L1PA 1ORKA 3HOVJ 4C3HJ 1FEXA 1HDPA 1IDYA 2KT0A 2JMWA 3BQZA 2VUMJ 3I4NJ 1TWGJ 5FKOA 4A3CJ 4HNVA 1TWCJ 4BBSJ 2PMZN 4GFBA 3FISA 4M3EA 3I4MJ 3Q0WA 4NDLA 3PM1A 5GP9A 3M3YJ 4B3AA 2WV1A 3Q3SA 5IPAA 1YRNB 4L5EA 5EGOB 2DA6A 5C4JJ 3SDGA 4DW6A 2P81A 2DMNA 3LSJA 3ZOBA 4AUXA 2HI3A 3O8GA 5K7HA 3HOZJ 2DMUA 1JTYA 2DTZA 2MW8A 4A3MJ 4I6ZA 4X6AJ 2EZHA 4D7MA 2AO9A 1ZGWA 1A5JA 4M6VA 2XGCA 1H8AC 1S7EA 2LVSA 2HXIA 2LKXA 1JT0A 2NOGA 4RDUA 3OSGA 2W48A 4FISA 3MVPA 1YRNA 4CYCB 1OJLA 4B1RA 5EGOA 1HDDC 2R92J 2XPWA 2NVYJ 1TWFJ 3Q0VA 4BKXA 1GUUA 1HCRA 5IP7J 1TWAJ 2HOAA 1X2NA 4DYCA 5M3MJ 4MFEA 1MSEC 2HDDA 3BR2A 4AC0A 5IP9J 5FLVA 2LP0A 5EDNA 1JJ8C 1FTTA 3ZQCA
chains in the Genus database with same CATH superfamily
2F5DA 3K4BA 1IF1A 2VBYA 4HF1A 3F22A 2EZLA 4A6DA 1RESA 3N05A 2DK5A 4BS9A 2HR3A 2VQHA 2GLOA 4LFUA 1Y1VJ 3BJOA 5DYMA 3GFJA 5E8IA 4BY7J 2ZJQF 2B63J 3DBRB 1SANA 2M4GA 1FBUA 2JUCA 2ZNYA 4CUGA 1O7LA 1U9NA 3F9KA 2Q8KA 5KAFC 4Q4ZF 5F08A 4HV5A 2A07F 2QF7A 1PP8F 2PI0A 1ZH5A 2D2WA 3E7LA 3TP3A 3ZN1A 2CUEA 2P6TA 1SD5A 5H6RA 4S04A 4M9SA 4B4CA 2VLAA 3DTKA 4IHXA 3HKZN 5A2QZ 2DYSH 3QPLA 1TNSA 1I39A 2M0MA 4M72A 1F43A 2JUGA 4PJNA 4B48A 2X0LA 4GXOA 3DLLF 2K9NA 3MCZA 1E3PA 2HVQA 3I56I 3M8FA 2YU3A 1T0FC 1MNMC 2DOFA 2HZDA 2V1DA 4PGGA 3M07A 1FOYA 2Y0SN 3A4CA 2R7UA 1K6OA 2LFBA 5BQTA 4UY8I 1WCMJ 3HJEA 3P5JA 2KFDA 2V7FA 3DU6A 2QKMB 5CKTA 2GXGA 3CC7I 4S05A 2Z99A 3LOCA 1KU2A 2HWVA 4IEJA 1D3YA 2CQXA 5M5XJ 3CLOA 1N75A 5GPAA 1K7AA 1R9TJ 2MH2A 4UNOA 4II2A 1IV6A 1QVTA 1VQ4I 2BBYA 3LSIA 3W6VA 2ZC2A 4BJTA 4RGRA 3VEPA 3H5NA 5AIQA 4CZCA 1H9TA 4C2TA 4EVIA 3E6DA 2O8KA 4RAYA 2X6XA 3AL0C 2VONA 3CCYA 3NARA 2OZ6A 2KIFA 1IN8A 1Y6IA 1X1DA 1RR7A 3C7JA 1XGNA 1SD6A 1T39A 3GTLJ 2FE3A 1OPCA 2ZO4A 5J6XA 3DWLE 1R5HA 4G6QA 3D5RC 4F52A 2OTLI 3KFWX 1O3RA 3VWBA 5J1RA 2MG4A 4HZFA 2JA7J 4KJZA 1S3JA 2HOSA 1R1VA 4IPAA 2UZKA 2EIMH 5D5WB 2W25A 1YO5C 1O7FA 4QTRA 3R0AA 3ZXSA 1AU7A 1O3SA 1DUXC 2DA1A 2HOEA 1MW7A 4PJMA 1TQPA 4CSWA 2A61A 4JYKA 3S1QJ 5D4SA 1FP1D 1U5TA 2B9SA 3FXKA 2Z5UA 1AKHB 4DYRA 3WTVC 4XK4A 1FOXA 1IV8A 3MEXA 3MKYB 3HOWJ 1VQLI 1Z91A 1HSJA 3HSRA 1WI9A 3LA7A 3R4KA 4EQQA 1A6IA 2IS6A 2K3FA 3ELKA 4KIBA 2EBIA 3NWSA 2P5LC 2A69F 4LJZF 1T56A 5BMZA 2IGOA 3MFKA 3GTPJ 2IGMA 1Y56A 3ASNH 1K61A 3K2AA 3JAMZ 2GWRA 3LAJA 1OLTA 4Y4RA 3FXOA 2R5YB 2W7NA 5E3OA 1TTYA 3KZIC 3WE3A 2KZGA 4Y7NJ 4AD9A 3G6EI 3CF5F 4IJAA 2R5ZB 1J0RA 2Q1ZB 1R36A 2A68F 1R22A 2XPUA 3DKYA 3IAM2 4ITVA 5GADJ 2LD5A 4XN0A 1VQMI 1K4TA 5FKLA 3L7WA 3AG4H 4V19K 2CUZA 1IXRC 1P2FA 4M3GA 2FUG2 2TRTA 3Q0UA 3RPQA 4A3JJ 3M4OJ 4RGSA 3CUQA 3KZZA 5HOOA 1LEAA 1SAXA 4KITB 1B8IA 2DJNA 2KHMA 3HGGA 3L09A 3HSFA 2KLOA 2O8XA 3F8BA 6PAXA 4FETA 2LYCA 1FYLA 2RQPA 3ZQHA 2DMQA 4RLFA 2PLYA 3HTUA 1CF7B 3U9GA 2LG4A 3FX3A 1U2WA 4ABZA 2XF5A 2Z9OA 1ETOA 1HW5A 2R0QC 1I6HJ 4G94A 1MBKA 1OCPA 4ZJZA 4FX4A 1RIOH 4IHVA 3F8CA 2L2OA 1YHQI 1MDMA 2EB7A 1Y8RB 4XBFA 4RB1A 3O2PE 4NC6A 2EILH 1ZRFA 5HS9A 2G7HA 4RM2A 1JGGA 5FKMA 4B43A 2K86A 3S1RJ 3PO2J 1YG2A 3TGNA 1TT5B 1XD7A 4MHGA 2Y9YA 3BOQA 2XKOA 1Z21A 5HLTA 2XAJA 3BR1A 2RQQA 2Y9ZA 1S72I 1BM9A 4NHJA 5FRMA 1UZCA 2O5RA 1R5ID 2IGKA 4AIHA 1QO0D 5IT3A 4UV8A 3NAUA 4Z6YA 2LKSA 5IYBJ 1MIJA 4HOBA 1JJ6C 2XAUA 2WAEA 2I10A 3DV8A 1UMQA 4HNUA 3OIOA 4RS8A 2G9WA 1CQTA 1S7OA 2XUBA 4JOMA 4HAMA 4G12A 5FKKA 3LFUA 4E6KG 4XIDA 2OBPA 1IGNA 3SFIA 1TP4A 3KEYA 3K4CA 5HLIA 1VFCA 2KKOA 5HDKA 3M8EA 2ZFWA 3R6SA 5KNLA 4EGYA 4UUSA 1I27A 3TW7A 4KMFA 3FK6A 1MMAA 2Z1DA 2XSJC 5DDGA 2L7ZA 5L3FA 5DEQA 1MBGA 1X3UA 2FJ1A 2GIVA 2BXZA 4N9IA 1FLIA 1D5VA 2MYSA 2E2JJ 1D5YA 3WHCA 4ZYGA 2JVHA 3G2BA 3OR2C 2JWTA 3H0GJ 5DCMB 4P9UA 3BR5A 3DBLB 4GYIA 5F64A 5HDNA 1YI2I 2IXSA 4XN3A 4IZZA 3IUOA 3SHFA 1IRXA 4TV7A 4LG0A 3U1KA 2BVLA 2FOWA 1IAWA 1X1CA 1U6GA 2PEXA 4B44A 2OA4A 2ICWG 4U87A 4WK8F 4O5VA 4A0ZA 2DXIA 1YS6A 2DFHA 4AIJA 3ZMUA 1X19A 1W0UA 1IG7A 3RTRA 4F7ZA 2HVSA 5C4XJ 1VQKI 3EUHA 1NK3P 2P5VA 2LK2A 5CVUA 3CMAI 4XKWA 3HUGA 1E3HA 3OYNA 1YYVA 2WB1N 5IYDJ 2YU9J 3N4MA 3RPUA 5DM7F 3S2HJ 3QAHA 3UR3C 2OPTA 2HQ5A 2MD5A 2Q2EA 3ABMH 3IWZA 1VI0A 3CD6I 3RI4A 3TEDA 4WF2A 5TRDA 2KRFA 1O4XA 1S9HA 3EDPA 3KP5A 3WTUC 4Y3OA 3KETA 3S1MJ 5J4YA 1P92A 4IX7A 1TQMA 3ZMDA 4L5IA 2X1EA 2H8WA 2MH9A 1A6QA 2GOMA 1DP3A 1RUOA 1TLHB 1P4WA 3GZNB 4CYDA 4I76A 3DU5A 5DS9A 3VOEA 2ESHA 1FOKA 3E97A 5FD6A 2OQGA 4MIMA 2F48A 2VN2A 3FZVA 3FXLA 3OYBA 5KCMA 3V4GA 3OOPA 3TO6A 3IV5A 1PJRA 1T8IA 4Y13A 2FNPA 3OY9A 2DA7A 4HEA2 2LKPA 4HG2A 1SC7A 5FO5A 1WZ2A 4OIQF 1X58A 4YIFA 5ILVA 3U21A 1EJ9A 2YSRA 1XC5A 2KRHA 1P4AA 2Y2ZA 5IOYA 2ME6A 4ASNA 4ESFA 3J7AY 3I9V2 4JX4A 2V1UA 2HGCA 1WH7A 1LFBA 1QZEA 4E7KA 3I4PA 1DU6A 2A5WA 1LPQA 1ZREA 2P0WA 1R23A 2QSFX 2HQAA 4A3IJ 5H2FC 4LMYA 3JR9A 1PDNC 3OYMA 2D1VA 4RLQA 3RYPA 3J80Z 1OFCX 5LLQA 4A0YA 1J09A 5LEJA 4RGXA 2CQ7A 3H35A 2HPMA 2EV0A 4Q47A 3HOVJ 4OINF 3RIRA 2VUMJ 3GW2A 1R1TA 1SFEA 4BBSJ 2H09A 4R8HA 4GFBA 3FISA 1YLFA 1VTNC 3Q0WA 5HNFA 1QQIA 2XV4S 3TKYA 2CQKA 3K4LA 2XAGA 1KGSA 1KONA 3SDGA 2V1NA 2R7DA 1G4DA 4AUXA 2HI3A 5K7HA 1IUYA 4JBAA 3MWMA 3MZ8A 4KICA 5L3CA 4AM3A 4X6AJ 4ZYDA 2EWNA 3GFIA 3CCQI 3P7NA 2XASA 2DU9A 3H1CA 1Z05A 4D7MA 5E1ZB 1XTAA 2JRMA 2GQQA 1WJEA 4M74A 4H0EA 4ANJA 3COAC 1OISA 3GFMA 3SZPA 3PIOF 4IF4A 1K6YA 3AG3H 1H8AC 3L2VA 2WAQA 5GAHJ 3DPLC 2M30A 4KYWA 1T0FA 3KYDB 1XPXA 1JT0A 3KPHA 4ZZLA 2CW8A 1YW7A 4CYCB 5EGOA 2R92J 3HRMA 1WFXA 3JCUC 1ERDA 4XM3A 5ICGA 2R7FA 4IOAF 2NVYJ 3E1SA 3FMSA 1TWFJ 4ZYEA 3JSOA 3RCOA 3OYFA 3RKYA 3TQNA 1TT0A 5IP7J 3L9FA 2VE8A 4E7JA 1TWAJ 1UCRA 2D1HA 5E8GA 2HYFA 1U8RA 1MKMA 2HDDA 3BR2A 4UB6C 5IP9J 1R4NB 3U1DA 5FLVA 3C3WA 4RB2C 2EFWA 1FIAA 5TGTA 3BZKA 3JTGA 1OCZH 3ABKH 4HDUA 2X6OA 2OU2A 3BG3A 4QWQA 2HQRA 4JX6A 3S93A 1ZK8A 1LQ1A 4OAYA 4F93B 2LY1A 3Q5FA 2YX4A 1T33A 2XAFA 5ED4A 4G7HF 1LJ9A 3GBGA 2V6CA 3BP8A 1LVKA 3Q9SA 3V7SA 4UUVA 3KP4A 3WTYC 2ACJA 2KP6A 4RBOA 3QOPA 2GA1A 2ISZA 4PDKA 4L9JA 2RNJA 3LSMA 2W84A 3ECOA 3WTWC 5BPDA 1FTZA 1YFHA 4BAYA 2M0CA 2ZXJA 3GTOJ 2VJ4A 2E1OA 4G9YA 5IOZA 3HB9A 4JP0A 2STTA 2L54A 3H36A 4MGRA 1FY7A 3JRAA 3PUBA 2VKEA 1DDNA 1PUFB 1ZQ3P 2TDXA 3E6MA 2EIKH 1NG6A 2HYGD 4EJTA 3WTTC 4PSWA 4A3DJ 5J3LA 4KA4A 3TOBA 3DEEA 3IH2A 2FSWA 1BI3A 1JKQC 2FF4A 4XMYA 3HOTA 4FT8A 3LSGA 4YFXF 2VBZA 1HW2A 1MJ9A 1WPKA 3TO9A 3ZCOA 1R71A 1BR4A 1KA8A 4G6DA 4RMNA 3GTJJ 1BW5A 3K1MA 3MAJA 2ZJRF 3BQYA 1G3YA 4V2GA 1VQ9I 1Y0NA 2LSOA 1F9NA 2F5EA 4E7IA 3PNVA 1HXDA 5B1BH 1O3TA 3ROUA 2H1KA 2JA2A 3RZDJ 1WSUA 3J81Z 3HOYJ 2DQLA 3OIQA 4NNJA 5EZHA 4JQFA 3CJQB 2PJRB 2CG4A 3O3KA 2ZSHB 2F4OB 2X6WA 3A02A 2COBA 1VQ7I 4L9NA 3NQOA 3SXYA 3VYTB 3HHHA 1MH3A 3W3CA 4RGUA 3QPHA 4BQNA 2BXYA 4CZZA 4ESJA 2HQNA 3DPTA 4I0BA 1X2MA 4IRHA 5E3LA 3TW6A 5IP6A 4JK1X 2ZJPF 5K5OA 2H94A 1ZLKA 2VOPA 2M4KA 4LOCA 3G1OA 2K9LA 4XOTA 2XHKA 2M7BA 1ODDA 3MZHA 3H0DA 5EG0B 1OR7C 3CJRB 5EYRA 5FKNA 3BLYA 3GTGJ 4OIRF 1Z9CA 3BROA 3HOXJ 2JA8J 3JSPA 2Y48A 4OIPF 1FIPA 4HNTA 1JKPC 2CMPA 2QZ8A 2R4GA 1I5ZA 1YJ9I 4XNFA 3JRBA 1MBEA 1YW9A 2W57A 2QBYB 3ASOH 4CGZA 2A3SA 2F5FA 2JVGA 2NOJB 3H5RA 2FBKA 4EJOA 5E3NA 1YIJI 1VQOI 1YS7A 2NVXJ 1HW1A 1K83J 3ABTA 3VPRA 3OS1A 4BBRJ 3GLXA 1B72B 1ENHA 1BC7C 3OS2A 2BHZA 2VC0A 4EGZA 3R60A 1QBJA 1JHHA 1ZHFA 3QU3A 1ITYA 2EPFA 2QGUA 2CW0F 3CCEI 4BYYA 3PL8A 5HS8A 3DFGA 1LUJB 4C3IJ 3LSKA 4KMUX 5J47A 5BPIA 2EIJH 1HKTA 2Y31A 3ZN0A 2EZKA 2GOXB 1FBQA 2QLZA 4M71A 2ELHA 1DU0A 3QP6A 4BHBA 1KQ8A 5E3MA 3K1NA 4XRSA 1FWZA 5FLMJ 2RNGA 3BZ6A 1D1CA 2VIXA 4EM1A 4BDZA 4DQ2A 3FMQA 1HC8A 1ZN2A 2GAUA 5F0CA 4D5FA 3HM5A 4YFNF 4C2MJ 2VXDA 1AKHA 2BZTA 5AIPA 1BI0A 2RKHA 4P55A 3LFKA 2R7XA 1EA3A 1I3AA 1ETVA 3WGGA 4S0HB 2L01A 5B1AH 3DEWA 3DKXA 2Z3YA 1HBXG 1NH3A 2M9HA 3FXRA 3OSFA 1O3QA 2CSOA 1T98A 1WJCA 2IBDA 2R5YA 2CU7A 2EINH 1OCRH 3M1CA 4I98B 1BI2A 2R5ZA 4ZYHA 1D0XA 1WVRA 5JHUA 1MD0A 3JRFA 2NS8A 4UV9A 5CYVA 4LLLA 3W2WA 2XF7A 4CCNA 3EPZA 2LBFA 3OR1C 4DBRA 2O9LA 1XDUA 2H6BA 4DBQA 3I64A 3ZQ7A 1EH7A 1W7PD 5JI6A 5KHDA 2VPLA 1CF7A 1XSDA 2CH0A 3ZMVA 1E2XA 3B73A 3KCCA 4FE7A 2M5WA 4C3JJ 1X3WB 3C2GA 2M45A 1VQ8I 2DCEA 2FBHA 3F21A 1XS9A 3S17J 2BW3B 3RZOJ 1IRZA 1LFUP 2F5VA 3LQQA 4XICA 1AOYA 3F8NA 2PX9A 2GA2A 3DCFA 3LA3A 2F4IA 1JHFA 3KYLA 2QA4I 4IOCF 1J9IA 2QYOA 3EYIA 1E3OC 1VF9A 2LRDA 1R7JA 5F0HA 1QVUA 3FK7A 3RQ4A 2XAQA 3GZ6A 1ZGAA 1V54H 2DMTA 3CJTB 3QP5A 1X3ZB 2VXZA 4EEFG 5FB2A 2FQ3A 2ZXIA 5D8LB 2KJCA 4XR6A 4M9XA 5LEKA 2K7LA 2ZJ2A 2RVCA 5CLSA 5AONA 5C3EJ 1FNNA 4HV6A 1H9GA 1MGTA 3HKZA 2XSDC 1ZELA 3ABUA 4RAFA 1J75A 2NAZA 3BCAA 1G6NA 3E3VA 2MFZA 2DA5A 3L2CA 4HSRA 4U7BA 1YOVB 2JN6A 4KT6A 3WG9A 2IW5A 3BY6A 1G3WA 4PGHA 1ZLJA 2K02A 2COMA 2PMHA 1V4RA 1ZKGA 2Y0SA 5J1UA 4IKFA 3JRIA 1M1EB 2PJPA 2E60A 2XKPA 3IH4A 4BUPA 1ZG3A 3LAPA 2DT7B 4M3DA 2WC2A 2RDPA 3BJAA 9ANTA 2Y30A 3FHNA 4WX9A 5J4VA 3LSRA 1NK2P 3EETA 3TO7A 4E70A 1XMAA 1IO2A 1W7PB 3L2QA 1VNDA 2L0KA 1POGA 3EUAA 4A2UA 5DCMA 2XB5A 3SYTA 4BDYA 2OZUA 1BA5A 2IRFG 2YS9A 2GM4A 2ZKZA 1UHSA 4A3GJ 2ZCWA 3H9JA 2HFHA 4Y33A 3RQIA 1LDJA 4QSHA 2X48A 3KE2A 4XKCA 1ON2A 2M7AA 5CVRA 4IHWA 2IA0A 5EF6A 2ZB9A 5E17F 3LNQA 2K4BA 3WE2A 2NNYA 3BG9A 4XLFA 3IRQA 5LHHA 3GLLA 4H4KC 3VSLA 2WY8Q 4EJWA 1V5GA 4LIUA 1PP7U 1I1GA 1XGMA 2P7CB 1YW8A 3S14J 4RAGA 3ESWB 2VB6A 2VI6A 5LGUA 3GTQJ 3WTSC 1Y39A 2JSPA 4DNCA 3P9KA 4MQVA 2HYJA 2R3SA 1SD7A 2E19A 2BYVE 4MNUA 5HDGA 3J7YJ 2EFNA 4XRSG 2I5UA 3Q9VA 1PUEE 3SEZA 4BEHB 1TZLA 4XONA 2EK5A 2VKHA 1BC8C 3JRGA 5F04A 5LRRA 3BTJA 4OMZA 4NC7A 2L7FP 4I7HA 2XAHA 2CV0A 2VPRA 3EYYA 3M1EA 2R93J 4W97A 3MD2A 2JK3A 4XLNF 2VE9A 4YFKF 4LLGF 3OYLA 2BV6A 5IYCJ 2DO7A 5KVRA 1Z0XA 2VQLA 4XRFA 2FMYA 4WWCA 1GDTA 2EV5A 1U9OA 3VYSB 3G3ZA 2IP2A 3D0SA 4C2UA 4G7OF 1S29A 2EFPA 1TW2A 2ADUA 3PNTA 4C3HJ 3KIOA 1FEXA 1HDPA 5J40A 3I4NJ 4RB0A 2DOEA 5FKOA 3ZRGA 2MLGA 1XDSA 4A3CJ 5JFRA 1TWCJ 1E17A 4QPOA 2PMZN 2HS5A 5L3EA 3RKXA 4N0BA 3L2WA 1W5SA 4M3EA 2HTJA 5D5XB 4NDLA 2OTJI 3PM1A 3OYKA 3LA2A 3M3YJ 1MNDA 1NHAA 3AKZA 1WJDA 4CH7A 2DA6A 5ICFA 5C4JJ 4KFCA 4KIFA 5DD8A 5DV5A 1FYKA 4G8XA 3DEUA 3LSJA 3ZOBA 3CCMI 3HOZJ 2HDCA 3CCSI 2DMUA 4AVZA 1JTYA 2MW8A 4BL0B 1S7AA 2E5NA 4Y15A 4I6ZA 5TISC 3CCJI 5HLHA 2VJ5A 2WADA 4DIQA 3L2UA 3A0HC 1ACIA 4PJ0C 4II3A 2L7KA 4HX7A 4M6VA 4R79A 2EFOA 5EJCA 2VJJA 3FHZA 1QNTA 2LKXA 1ZG5A 1J5YA 2E7XA 1FSEA 1P6RA 3DPUA 3MVPA 1I1SA 4B1RA 1TNTA 1HDDC 4I02A 1OCOH 2IT0A 1IW7F 3I3LA 3Q0VA 4ZZDA 4HYEA 4BKXA 1K78B 3FXQA 2V1XA 4KIGA 2W24A 3S8PA 2O3FA 1RNLA 2PG4A 1KZHA 1YE9A 4MFEA 2UWMA 4PFOA 2AS5F 1TBXA 4AIKA 2LC2A 4U0VA 2FEZA 1BR2A 1FTTA 2YUSA 2Z2SB 5LD2C 1RZ4A 1Y1WJ 2HU9A 2YX7A 1SEUA 2EJRA 3LSTA 5K7ZA 5L3DA 5IT9K 2XGEA 3HOUJ 3G71I 1REPC 5GPCA 3GWZA 2WAFA 2IA2A 2M8GX 2A6HF 3BPXA 3IHUA 4CYCA 1MBFA 2FOKA 5B66C 3F72A 2MLKA 2X85A 4Y17A 2K9MA 2OJED 3H3UA 3ERMA 2DDAA 4BH9A 2CO5A 4DJAA 5F1JA 1ZARA 4NC8A 3CCLI 3PQKA 4L5JA 2H27A 1OR7A 1X1BA 4AYBN 2WBMA 1JI8A 2X4HA 4HF2A 1BW6A 3PNYA 3I59B 4P96A 1KQ9A 4L0ZB 2EZIA 3A1YA 3CLQA 3HYIA 3K69A 4XSZF 3HPGA 2L02A 1Y8QB 5M5YJ 2P7VB 4K2EA 1JUMA 1EH8A 2PN6A 5LFAA 1W0TA 1FSHA 3W6JB 1ZRDA 3VYRB 4ENMA 2OCEA 1WRJA 2DW4A 4NQWB 2IPQX 2XPVA 2Y69H 1UHWA 4XLCA 3E5UA 4I09A 1PYVA 2WA0A 2GXBA 5E1XA 1QHGA 1IUFA 4BXFA 5F1RA 2IVMA 4HW0A 1Y0UA 3GZ5A 4FX0A 4Q5SF 1GVDA 1ON1A 3CF2A 3HGYA 5E1WA 1BIAA 2OV7A 2CS3A 1GLNA 1RPWA 3AFHA 1FJLA 1IRGA 3EUKL 2WB1A 3K4NA 4KN7X 2L9NA 3T8TA 3WU1B 1H89C 1PUFA 1D0YA 4BGDA 2VQCA 4D1QA 1G59A 5D5VB 3RKQA 4YIIA 3ZQLA 1WWXA 2XGDA 3BWGA 2KDZA 3KLOA 4XORA 1ZR2A 1K4SA 5J8CA 2MSYA 1A04A 3CJNA 1RRJA 1LKXA 4EATA 1LB2A 1SMTA 4IQ4A 3MKWB 2CJJA 4U0WA 4ZYAA 2RGVA 5FD5A 5K7FA 4ENNA 1Z7LA 3ZP5A 4XLPF 2DA4A 4ENKA 5F6FA 2KISA 4ZDPA 4GO1A 1LDDA 3S15J 1IZ1A 4O6JA 1XSVA 2JZYA 2OUMA 4HLYA 4M9ZA 5ILUA 1D1BA 3REOA 1MMSA 5FFZA 3MQ0A 2WY7Q 3PSIA 3RYRA 4IHYA 1J59A 4RB3C 2STWA 1XCBA 2PJRA 2M3AA 4UVAA 3DKWA 3CO7C 3O8HA 2Y0MA 2DT6A 2EV6A 1QPMA 4CCOA 3SJMA 4HPQA 2MD0A 1YX5A 2KRCA 4CDGA 1MNEA 5ERIA 2FD5A 3FM5A 2KPMA 5BOXA 2EA2A 3K0LA 3LSHA 2DT5A 1ULYA 1HKQA 2ZMEB 4HRIA 1TWHJ 1QHHD 4A69C 2MC3A 2P5KA 2EFQA 1DQUA 4BACA 5EG0A 1FT9A 1EF4A 3V8KA 2NS7A 2X51A 3FBIB 3SDBA 4J19A 1XGOA 4MEYF 4AVPA 1USSA 4RM3A 3ZQGA 1Z7UA 2D5VA 4A3BJ 1KU9A 1XSXA 1R49A 4AIDA 1P7IA 1OMIA 4QPQA 1YITI 3ZMSA 4YELA 3ABLH 2QBYA 2ESNA 2V6EA 4OMYA 1TQIA 4WXCA 3WODF 2CV1A 2DJIA 3WU0A 5JVTA 1SVLA 3I58A 2LNBA 2V79A 1WGXA 1B72A 3CTAA 3OWTA 2Y75A 2MBFA 2R7SA 3F6VA 1Z3YA 3QOEA 3VB2A 4QLCU 2BEOA 1OKRA 3ZQFA 5D4RA 2IEKA 4PSXA 4Z2YA 1BN5A 3PQJA 4BHCA 1BJZA 2LR8A 2RAEA 1IC8A 3S2DJ 4X0GA 2VT3A 2JPBA 2DQRA 1W1WE 2R7RA 4LK1F 2DFFA 3B6CA 3AAFA 3AG2H 1X4OA 2HKOA 1R58A 1USTA 3DP7A 1QRYA 5EZGA 2MGQA 4PUSA 4EJVA 3A01B 2R7VA 1ZTRA 5JLXA 3LSPA 2OAZA 4B09A 3HEFA 2CGPA 1V5FA 3BTCA 3E5XA 3S3OA 1J7KA 5FRNA 3M8JA 3TOAA 3UNGC 1SD4A 1XMXA 4QIWN 5B5EC 4BXUA 2R7ZJ 2DDBA 3PO3J 3N97A 2RN7A 3HTSB 4CXFA 2IJLA 4IHTA 1MJAA 2UV1A 3F23A 3UKGA 4KUMA 1STZA 1LE8B 5JLWA 3E6CC 2H8RA 3PFIA 3BC8A 3OYDA 2YPRA 4HBLA 2VBWA 3PFYA 1MBHA 2HNHA 2X1CA 4BE1A 1NG7A 3IWFA 2KQRA 2E36A 3DTIA 4IRIA 1MBJA 2A6TA 1GVJA 2ZMEC 3CDLA 4CCJA 3OOUA 1GHCA 5LHGA 3JRCA 4Q48A 2ID3A 2VASA 3TP0A 2LLKA 3OV8A 2J5OA 1HLVA 1FMWA 1KU3A 1B4AA 4I99C 4FCYA 1JKOC 2BY1A 2HXOA 2TCTA 2XF6A 1U0JA 3WU2C 2DI3A 3FKIJ 2VT2A 3WGHA 5KK1A 2L9SA 4PFPA 2H6CA 4HDVA 2GZWA 1IXCA 1LFPA 2P8TA 3F8MA 3HRUA 1Z3XA 3QPSA 1Q1HA 4HLXA 2BW3A 3I55I 1F5TA 5C44J 3BR0A 1D1AA 3HC7A 1A35A 1F1ZA 5DUKA 1GXPA 3DLAA 2QEXI 3S3NA 3TMOA 2V4JC 2BVMA 3OS0A 4LITA 2E2HJ 4ZDOA 4CHUA 4O3MA 1QGPA 1HKSA 1XB4A 4YIRX 4J00A 4D7NA 2PFBA 3HBLA 5CVIA 1FYMA 3HZJA 4ETSA 3K10A 1BI1A 4A3LJ 1RUNA 4BJ6C 3SZTA 2O6GE 1D8JA 2E5ZA 1B59A 1R5GA 5FGMA 2E1CA 2NVTJ 4XLEA 2ZFUA 3PUFA 2K85A 4W1UA 2JQ7A 3MZYA 3TDUC 2N8GA 2LH9A 3W2AA 3KZYA 2Z16A 1D0ZA 4GYGA 1B6AA 4L9VA 4D5CA 3S2WA 2CQNA 1DPRA 2DA2A 5D5UB 5J1YA 3F3XA 4V2FA 1APLC 2CV2A 1UJ8A 1FPQA 3K7AJ 1U78A 4BQAA 2K40A 3BJ6A 3BT9A 2QUFA 2AQFA 4UUTA 3V8JA 5E18F 3SEQA 5EEGA 3M7GA 1BOBA 1RKWA 1UFMA 4U7DA 1W7PA 1RKTA 3WTZA 3T5XA 4DYQA 2CFOA 1N78A 1B9NA 3A0BC 4A3KJ 2F6CA 2O0YA 2LY9A 4D9JA 2GIZA 2L9RA 2VL8A 3H9QA 3ECHA 3JW4A 3FIWA 2ETHA 4ZH4F 3H5AA 4MQ9F 1QZYA 1ZG1A 2Q0OA 2PMUA 3LWFA 1UG2A 1N25A 1MMNA 4G6TB 2JJ7A 1V55H 2MABA 4A93J 1FX7A 3U2RA 1JT6A 3F6OA 3CMYA 1WJFA 1R6RA 1WJAA 3WHBA 4I2OA 1WHUA 2RV8A 3ML6A 3BTIA 2P6SA 1LNWA 2QQAA 3I53A 5DD4A 2AXLA 1SAUA 4LG3A 3L1PA 2VODA 1XX5A 2M1BA 3BG7A 1G3SA 4BEHA 1VQPI 1AWCA 1S5LC 1ORKA 2HKXA 1X1PA 2QQBA 4ZTFA 1YJNI 2ZSIB 2XROA 3BQZA 4PJJA 3E6BA 2I8DA 3J80K 3KP3A 3I4MJ 2IA1A 5GP9A 4IL6C 3Q3SA 5IPAA 1PVEA 1YRNB 2MC4A 3OYCA 4XQFA 2BHYA 5HS7A 2A5YB 1BJAA 3CDIA 2P81A 5J8FA 2J5PA 4P9FA 3O8GA 1SFXA 4MEXF 2DTZA 4A3MJ 1F4KA 3QPTA 2BOLA 3FXMA 2EZHA 4E7HA 1YJWI 3PSFA 1UAAA 1G3TA 1UELB 2L9VA 2PQ8A 2CWEA 1ZGWA 4L9TA 2XGCA 3IP4B 3FM3A 1T2KA 1R1UA 1KYWA 4AWXB 3WTXC 4N4OB 2Z33A 2HXIA 2LDUA 3S32A 3W2VA 2C6YA 2WTEA 2HTSA 2NOGA 1IN7A 2UUZA 2AXTC 4FISA 4BU2A 1DGRM 2NRAC 1OJLA 2ELJA 2HPIA 4U88A 4OAZA 2DAOA 3KP7A 2NVUB 5ICCA 3HOSA 1UG0A 4N9HA 1HSTA 1GUUA 1Z6RA 3V42A 3HRTA 1X2NA 3RKWA 3V7RA 5M3MJ 1RR8C 2LP0A 3K6GA 1JJ8C 1T95A 3K2ZA 3HHGA 3ZQCA 1O57A 4LK0F 2F2EA 4M6YA 4ENJA 2W00A 1A36A 2IS2A 1G8XA 5D6EA 3X2QH 5HLGA 3CCRI 2E1MB 1MMGA 1JGSA 1YTYA 4XOPA 3ONQA 1YIOA 5F27A 2R7QA 2XVCA 1H88C 5FFXA 2G7UA 1B1BA 4EM0B 3L00A 4UVBA 2LTPA 3OYEA 1K78A 3JTHA 1JXSA 3F8FA 3GXOA 2IAIA 4R1HA 4MO7A 2K3PA 4MFDA 1DGWY 1ETYA 2CQQA 1VQ5I 1P7JA 2HDWA 3C18A 3CO6C 3H3ZA 4Y52J 2FX0A 3RJPA 2RC4A 3BCBA 3OMYA 4F55A 1EH6A 4A5MA 3CMEI 2ISYA 3KLNA 2EA4A 3VDXA 2E35A 2LBFB 5ILSA 3CP8A 3CUOA 3M9AA 2GXAA 3ULQB 4I01A 4CCMA 4M3BA 3D5SC 2JA5J 4XKBA 3HIFA 4OIOF 3GCMA 2VKVA 3DF8A 4M6XA 4E7ZA 1P9QC 5CVJA 3OIPA 1S6LA 2XGXA 2DMPA 3QQAA 1B9MA 3GTMJ 3ZR8X 5BNGA 3C1DA 2JPCA 2A05A 1W5TA 3NWTA 4YEJA 1OCTC 4HQEA 3LQRA 1K79A 3T0YA 2FMLA 5GAEJ 2ME0A 2XRNA 3I59A 1U8BA 3K70D 4WCGA 4YRVA 2L3DA 3NRVA 3IKTA 2F5CA 3O6BB 3CMMA 1C0WA 1Z67A 5M3FJ 4LGWA 1HOMA 2OF7A 4EMSA 3MKZA 1Z1DA 3BR3A 4D0PA 3JRHA 1XGSA 3BDDA 5FLXK 4PZJA 2L4MA 2ZNZA 2D45A 2ELKA 3E0JB 1G2HA 3T8RA 3I5UA 3JREA 4NQWA 3OL4A 1XMKA 3K9TA 4CO8A 2DPDA 4GRIA 1ETWA 1ZR4A 2JRTA 5LGNA 4OU0A 2XIGA 1QA6A 3K4JA 2R7OA 3R61A 3FKJA 4DOZA 1GV2A 1JUPA 3J81K 1MH4A 5E20A 4OOIA 3ZQIA 4NUBA 4LB6B 1ETQA 3ERED 2RREA 2ID6A 4LIVA 1U5TB 3DXJF 1FMVA 2CFXA 3KP6A 5CVVA 4HX8A 1W36D 2BY2A 4F92B 4C30A 3I71A 3FF5A 4CA0A 2ZBKA 2IGNA 2JA6J 2K9SA 4A12A 1AHDP 1DPUA 3HRSA 4KISA 4CCKA 5D8KB 4G7ZF 1FZPB 1WI3A 2E1MC 3BTLA 3WGIA 2LMDA 2WV0A 1VQ6I 2ECBA 3H9GA 3BG6A 2QKLB 3CCUI 1GT0C 5B3SH 3ZPLA 5H6QA 3FDYA 3GF2A 5JVGF 4OWRB 2CW7A 4WXDA 1HF0A 2E34A 3DQVC 4NB5A 4A3EJ 1EV7A 1BR1A 1X4PA 3G1LA 3S16J 3OL3A 1IN6A 2BE5F 4IRGA 3T1BA 3G4SI 3FBNB 3CUQB 2MA3A 1B8IB 1SFOJ 2KJBA 1V5EA 2IS1A 2G0EA 3OYGA 1J2XA 2OCCH 2QQ8A 3KEOA 5FJ8J 5H20A 1V3FA 1F36A 2VOOA 2JTVA 1D8KA 3MMYB 5EEHA 2PMZA 3I0TA 1MJBA 2DTRA 2H1LA 4P1WA 4FE4A 3CQZJ 5BS6A 3OYIA 2V26A 5GAGJ 3CESA 4UB8C 5HODA 3CC4I 2XRLA 1MDMB 3W6KB 2EH3A 2ZMEA 3KP2A 4A0XA 1SFKA 3GMEA 2JT1A 2DFIA 4UVCA 2V9VA 2AHQA 2GBYA 1I50J 5DUIA 1IN5A 5HNHA 3QYFA 1JUSA 1P4XA 4F91B 3IL2A 1MSFC 2E7WA 3BG5A 2HEOA 2QVOA 3DTEA 5JR3A 2V9PA 2W1OA 2L4AA 4XRMA 2K4JA 3FWEA 2WAQN 3RPUD 1IDZA 1EKEA 2R7WA 4DGWB 2K5CA 2QCOA 2CRGA 3TL4X 1I6XA 3C2BA 4GCVA 2CUJA 3P9IA 4KN4X 2DBBA 4B8XA 4A5NA 5A2QK 3F0CA 3K4MA 5DCFA 4IXAA 4BE0A 2YR2A 4E7LA 1L3LA 2OD5A 4LB5A 3TDZC 2E1NA 3GUDA 5D6FA 5GTHC 3QWLA 1BL0A 3K4KA 1ZGJA 1YQAA 1T38A 1VQNI 4L0YB 4DZPA 4FASD 3IH3A 3SZGA 4XLHA 4UUSB 1ZYRF 2FNAA 2ZXHA 2WWYA 1W5CC 3IKVA 4FQGA 1U5TC 2QENA 3GEZA 2W85A 4M3FA 5F0FA 2M8EA 5DTDA 2KDOA 1IJWC 2B0LA 4KNYA 1GV5A 1MZBA 5GTIC 5DM6F 1SMYF 4PJLA 2XB0X 3CCVI 5CQEA 3FXJA 3G1MA 1X1AA 3A01A 1U3EM 1ZRCA 5HVQC 3LMMA 2K9QA 1Z77A 2NYXA 2DN0A 1RI7A 2UXXA 2X6YA 3JRDA 3MKLA 4LG0B 1R00A 1KYZA 2F4MB 4E7SA 5LGTA 1JE8A 1T6SA 2EQRA 4NBQA 3PIPF 3OYHA 2NNNA 1DP7P 1QU3A 3BZCA 2M2EA 3V8LA 3GYHX 4AYBA 1SVOA 3HDDA 4B3XA 5EEAA 3HL2A 2R7TA 3J7AO 1WQ2A 3IC7A 4GGGA 3ISPA 2FU4A 5M5WJ 1GXQA 1NTCA 3CUQC 3HG9A 3K1PA 3HUGB 1TC3C 1OCCH 2DFEA 3K70C 3VFZA 1E0EA 1XG1A 1ZAOA 4P5OA 3H3VK 3QYEA 1JKRC 3AG1H 2X9DA 2BGCA 2QM3A 4ESBA 1BBYA 2VKDA 3QU6A 2Q2EB 3IAS2 1LE8A 4BY1J 1TW3A 4HA8A 1WJBA 4C9YA 4BQOA 4BE2A 4BQQA 2QSGX 4BHPA 1OYIA 3VODA 3SQNA 4LD5A 2VC1A 2E2IJ 1S8NA 5TJJA 4IHSA 1IXSB 3FXUA 2ECCA 2QSHX 1Z6TA 3G73A 1QPIA 4B47A 3D5LA 3A03A 4XLAA 1XN7A 2M34A 3MN2A 2KZVA 2CYYA 2VQGA 1FC3A 3PJRA 3CDHA 3KX2A 3RDIA 5IY5H 5CQGA 2K27A 4UXNA 1AA7A 4MLOA 2O7OA 5FROA 2LF7A 2M87A 3KEQA 1H0MA 4HQMA 4ON0A 1WJ5A 3D1NI 2KMUA 2NXNB 1W36C 1FP2A 2KIUA 3WG7H 3R0JA 4PK4A 1HQCA 3P9CA 2VJIA 5CJ9A 3VSKA 4XL9A 2HOTA 2OQRA 5LRSA 2KIMA 2QQ9A 3B02A 3ZMTA 4ZTJA 3E5QA 5CPRB 2DPUA 4I0AA 3B6AA 4IVNA 1LEBA 2FA5A 4RA2A 5K5RA 4ZDLA 3JAMK 1T08B 1L0OC 3BR6A 1A31A 2FQ4A 4MTDA 2A6EF 3FMRA 2XC7A 4PCQA 3S1NJ 2LF8A 2HVRA 3S3MA 3C2HA 1CGPA 4F3QA 1IRFA 4M73A 2NS0A 2P4WA 2DA3A 1Q1VA 2CUFA 4X1EA 2KL4A 1FBSA 3HPHA 2DODA 1OYYA 1ETXA 2HZTA 3QODA 4RAZA 3VYUB 4UHTA 1KU7A 3OYAA 3GTKJ 1ETKA 4JX5A 1FOWA 5L3BA 4J01A 1JTXA 4A6EA 1WH5A 1YX3A 1I3QJ 2DYRH 1QZZA 1RETA 4DZJA 3ZMZA 1HA8A 2L7MP 4N4NB 4CICA 2UXNA 5LHIA 3CZ6A 3GO5A 3DBHB 2NVQJ 2X1DA 3OYJA 4EM2A 2LREA 4AU7A 4FTHA 2FRHA 3ZGKA 2BY3A 4HF0A 1LVAA 5L3GA 4BXXJ 2XDVA 4KDPA 2LY2A 4XSXF 4KT5C 4A3FJ 2JSCA 5FLXZ 1UB9A 4BNCA 4HSTA 3EUHC 2LOOA 1UHMA 1IDYA 1MMDA 2KT0A 2O03A 2JMWA 4L18B 1TWGJ 2B7EA 4HNVA 3IRRA 2DOAA 2KIQA 3J7ZI 3TBIA 1SVMA 2FBIA 4FHTA 2WV1A 4B3AA 5JHFA 2PBIA 4L5EA 5EGOB 3ZQQA 3HSEA 2FXAA 3QYBA 5ICEA 4XKVA 3CC2I 4BJ5C 4DW6A 5K5QA 5LBQA 4U0YA 2DMNA 4CCLA 3RSNA 1WKMA 2DK8A 5K1YA 4EJUA 1KQ0A 5KAIC 3L2RA 2OC6A 4WXHA 1TL8A 2DLLA 1IN4A 1OQYA 2AO9A 1A5JA 3GVAA 4YG2F 4IO9F 1SFUA 4LLNA 4E4HA 4HX4A 1S7EA 1OYWA 2LVSA 3SFZA 2BY0A 3BPVA 1N77A 4RDUA 3GX4X 2W48A 3OSGA 3GFLA 3AL0B 2V9KA 1YRNA 4MTEA 3HXLA 3A2KA 1VZ0A 1XCVA 5E79C 4GDFA 2AQEA 1LDKB 2XPWA 3EQLF 1BOAA 3KYCB 3NEUA 1R4MB 2QWWA 2ZXWH 4EV0A 2O61A 1W4MA 4ZC3A 1HCRA 2W82A 4IQJA 5IT9Z 3V7CA 2IS4A 1ONVA 2HOAA 3QRFF 4DYCA 1MSEC 2L5QA 2VBXA 1RC9A 4AC0A 3I54A 2E71A 3H92A 1BIBA 5EDNA 3LL7A 2W4SA 3CP2A
chains in the Genus database with same CATH topology
2YUSA 1FIAA 2EZLA 1Y1WJ 5K7ZA 1RESA 2X6OA 3BG3A 2XGEA 3HOUJ 4JX6A 2GLOA 1ZK8A 1Y1VJ 5GPCA 2M8GX 4CYCA 4BY7J 1MBFA 2B63J 5F27A 1SANA 1H88C 1T33A 1U9NA 3GBGA 2LTPA 5F08A 2QF7A 4RBOA 2IAIA 5F1JA 4MO7A 3E7LA 4MFDA 4AYBN 1ETYA 2CQQA 3TP3A 1P7JA 1FTZA 2M0CA 3GTOJ 2CUEA 1BW6A 5IOZA 2E1OA 4Y52J 2FX0A 3HB9A 4JP0A 4B4CA 3JRAA 2EZIA 4IHXA 3HKZN 2VKEA 3QPLA 5M5YJ 1F43A 1PUFB 1JUMA 1ZQ3P 4M3BA 1W0TA 2JA5J 2K9NA 2VKVA 1MNMC 2XPVA 4A3DJ 5J3LA 2DMPA 2Y0SN 3QQAA 3GTMJ 3IH2A 5BNGA 1IUFA 2LFBA 1JKQC 3LSGA 1WCMJ 1OCTC 1WPKA 1GVDA 3HGYA 3GTJJ 1BW5A 2ME0A 3BQYA 1U8BA 4V2GA 3LOCA 1RPWA 4IEJA 1FJLA 5M5XJ 2CQXA 5GPAA 1R9TJ 5M3FJ 1H89C 1PUFA 1HOMA 2OF7A 2H1KA 3RZDJ 3BR3A 3JRHA 1IV6A 1QVTA 3HOYJ 3RKQA 5EZHA 3ZQLA 3W6VA 2XGDA 2ELKA 2KDZA 1G2HA 1ZR2A 3JREA 2MSYA 3A02A 2COBA 1ZR4A 1ETWA 2O8KA 2CJJA 3CCYA 3NARA 5K7FA 1MH3A 2DA4A 1RR7A 1GV2A 1JUPA 1MH4A 5E3LA 5IP6A 1X2MA 3TW6A 3GTLJ 3ZQIA 3S15J 1ETQA 4LOCA 3G1OA 2ID6A 5EG0B 5J1RA 5EYRA 5FKNA 2MG4A 3GTGJ 2JA7J 4IHYA 3HOXJ 2JA8J 2HOSA 2JA6J 2K9SA 1FIPA 1AHDP 1JKPC 3O8HA 1WI3A 3BTLA 3JRBA 1MBEA 3SJMA 4QTRA 2ECBA 1AU7A 1GT0C 5E3NA 2FD5A 2DA1A 1HF0A 2NVXJ 4A3EJ 1K83J 3VPRA 3G1LA 4JYKA 1TWHJ 4BBRJ 3S1QJ 1B72B 1ENHA 4A69C 3S16J 5EG0A 1EF4A 2NS7A 1B8IB 1ITYA 1SFOJ 4J19A 1AKHB 4DYRA 4XK4A 3HOWJ 2G0EA 3ZQGA 2D5VA 5FJ8J 1A6IA 4C3IJ 4A3BJ 2EBIA 1F36A 2Y31A 1P7IA 1T56A 2EZKA 3GTPJ 1DU0A 5E3MA 1K61A 4FE4A 3K2AA 3CQZJ 2R5YB 4XRSA 5E3OA 5FLMJ 5HODA 4Y7NJ 2R5ZB 2XRLA 2XPUA 2EH3A 2LD5A 1B72A 1WGXA 5FKLA 4A3JJ 4M3GA 2TRTA 2AHQA 3Q0UA 3M4OJ 2GBYA 1I50J 5F0CA 4D5FA 1B8IA 2DJNA 3HGGA 3HM5A 3ZQFA 1JUSA 4C2MJ 1MSFC 1AKHA 2IEKA 3BG5A 1BJZA 2LR8A 2RAEA 3ZQHA 1IC8A 3S2DJ 4XRMA 2DMQA 2WAQN 1ETVA 4S0HB 1IDZA 3DEWA 4ABZA 2M9HA 2QCOA 2CRGA 3B6CA 3OSFA 1ETOA 2R0QC 3C2BA 2IBDA 1I6HJ 2R5YA 1MBKA 2CU7A 1OCPA 5EZGA 1QRYA 3F0CA 2MGQA 4IHVA 2R5ZA 3A01B 1ZTRA 5JLXA 3LSPA 3JRFA 2NS8A 1BL0A 1JGGA 5FKMA 3HEFA 3S1RJ 4DZPA 3PO2J 3BTCA 3IH3A 4UUSB 2Y9YA 3BR1A 2O9LA 4QIWN 2Y9ZA 4M3FA 5F0FA 5DTDA 2R7ZJ 1IJWC 3PO3J 1GV5A 2XB0X 3NAUA 4FE7A 5IYBJ 4C3JJ 1JJ6C 3UKGA 2I10A 1UMQA 3OIOA 3G1MA 1LE8B 5JLWA 3A01A 1CQTA 2H8RA 2K9QA 1Z77A 2DN0A 4G12A 5FKKA 4XIDA 1XS9A 1IGNA 3JRDA 3MKLA 3SFIA 1MBHA 3S17J 3RZOJ 1IRZA 1LFUP 1VFCA 2EQRA 4XICA 2M2EA 4UUSA 3DCFA 3TW7A 3FK6A 1MBJA 1E3OC 1VF9A 3CDLA 3HDDA 5F0HA 1QVUA 3FK7A 5EEAA 3OOUA 2L7ZA 3JRCA 2DMTA 4EEFG 1MBGA 2FJ1A 2ID3A 3TP0A 5M5WJ 1NTCA 1D5YA 2E2JJ 2LLKA 1TC3C 1HLVA 3WHCA 1JKOC 4FCYA 2HXOA 2TCTA 5C3EJ 1XG1A 3H3VK 2XSDC 2JWTA 3FKIJ 3H0GJ 1JKRC 2X9DA 3BR5A 2DA5A 1LE8A 4BY1J 2JN6A 3QPSA 2E2IJ 5C44J 1ZKGA 3BR0A 5J1UA 3JRIA 2ECCA 1QPIA 3A03A 1W0UA 1IG7A 3MN2A 2M34A 3IH4A 2E2HJ 5C4XJ 1NK3P 2LK2A 4M3DA 9ANTA 4MLOA 2O7OA 4D7NA 3HBLA 2Y30A 3LSRA 1NK2P 2WB1N 4A3LJ 2YU9J 5IYDJ 1VNDA 2L0KA 1POGA 3S2HJ 3D1NI 2XB5A 2NVTJ 2OPTA 2HQ5A 1BA5A 2YS9A 2GM4A 1VI0A 4W1UA 3TEDA 1UHSA 4A3GJ 2N8GA 3RQIA 1O4XA 4QSHA 2X48A 2HOTA 4D5CA 3S1MJ 4IHWA 5EF6A 2ZB9A 2DA2A 3LNQA 5J1YA 3BG9A 4V2FA 3B6AA 1APLC 3K7AJ 1U78A 3BR6A 4I76A 2FQ4A 2K40A 5DS9A 3BT9A 3S14J 3S1NJ 4MIMA 2VI6A 4UUTA 3GTQJ 3IV5A 1RKWA 2DA3A 1Q1VA 2CUFA 4X1EA 2HYJA 1RKTA 2E19A 1ETXA 4DYQA 4XRSG 2DA7A 4A3KJ 3JRGA 5F04A 1ETKA 4JX5A 2LY9A 3BTJA 3GTKJ 1JTXA 1WH5A 1X58A 2L9RA 1I3QJ 1XC5A 3FIWA 1RETA 2L7FP 4DZJA 2Y2ZA 2VPRA 5IOYA 2ME6A 2L7MP 1UG2A 2R93J 4JX4A 2JJ7A 4W97A 4A93J 1WH7A 2JK3A 1LFBA 2NVQJ 1DU6A 1JT6A 5IYCJ 4FTHA 3CMYA 1Z0XA 3WHBA 4A3IJ 3JR9A 1GDTA 3BTIA 4BXXJ 1U9OA 1OFCX 4A3FJ 3L1PA 1ORKA 3HOVJ 4C3HJ 1FEXA 1HDPA 1IDYA 2KT0A 2JMWA 3BQZA 2VUMJ 3I4NJ 1TWGJ 5FKOA 4A3CJ 4HNVA 1TWCJ 4BBSJ 2PMZN 4GFBA 3FISA 4M3EA 3I4MJ 3Q0WA 4NDLA 3PM1A 5GP9A 3M3YJ 4B3AA 2WV1A 3Q3SA 5IPAA 1YRNB 4L5EA 5EGOB 2DA6A 5C4JJ 3SDGA 4DW6A 2P81A 2DMNA 3LSJA 3ZOBA 4AUXA 2HI3A 3O8GA 5K7HA 3HOZJ 2DMUA 1JTYA 2DTZA 2MW8A 4A3MJ 4I6ZA 4X6AJ 2EZHA 4D7MA 2AO9A 1ZGWA 1A5JA 4M6VA 2XGCA 1H8AC 1S7EA 2LVSA 2HXIA 2LKXA 1JT0A 2NOGA 4RDUA 3OSGA 2W48A 4FISA 3MVPA 1YRNA 4CYCB 1OJLA 4B1RA 5EGOA 1HDDC 2R92J 2XPWA 2NVYJ 1TWFJ 3Q0VA 4BKXA 1GUUA 1HCRA 5IP7J 1TWAJ 2HOAA 1X2NA 4DYCA 5M3MJ 4MFEA 1MSEC 2HDDA 3BR2A 4AC0A 5IP9J 5FLVA 2LP0A 5EDNA 1JJ8C 1FTTA 3ZQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUS A;  1FIA A;  2EZL A;  1Y1W J;  5K7Z A;  1RES A;  2X6O A;  3BG3 A;  2XGE A;  3HOU J;  4JX6 A;  2GLO A;  1ZK8 A;  1Y1V J;  5GPC A;  2M8G X;  4CYC A;  4BY7 J;  1MBF A;  2B63 J;  5F27 A;  1SAN A;  1H88 C;  1T33 A;  1U9N A;  3GBG A;  2LTP A;  5F08 A;  2QF7 A;  4RBO A;  2IAI A;  5F1J A;  4MO7 A;  3E7L A;  4MFD A;  4AYB N;  1ETY A;  2CQQ A;  3TP3 A;  1P7J A;  1FTZ A;  2M0C A;  3GTO J;  2CUE A;  1BW6 A;  5IOZ A;  2E1O A;  4Y52 J;  2FX0 A;  3HB9 A;  4JP0 A;  4B4C A;  3JRA A;  2EZI A;  4IHX A;  3HKZ N;  2VKE A;  3QPL A;  5M5Y J;  1F43 A;  1PUF B;  1JUM A;  1ZQ3 P;  4M3B A;  1W0T A;  2JA5 J;  2K9N A;  2VKV A;  1MNM C;  2XPV A;  4A3D J;  5J3L A;  2DMP A;  2Y0S N;  3QQA A;  3GTM J;  3IH2 A;  5BNG A;  1IUF A;  2LFB A;  1JKQ C;  3LSG A;  1WCM J;  1OCT C;  1WPK A;  1GVD A;  3HGY A;  3GTJ J;  1BW5 A;  2ME0 A;  3BQY A;  1U8B A;  4V2G A;  3LOC A;  1RPW A;  4IEJ A;  1FJL A;  5M5X J;  2CQX A;  5GPA A;  1R9T J;  5M3F J;  1H89 C;  1PUF A;  1HOM A;  2OF7 A;  2H1K A;  3RZD J;  3BR3 A;  3JRH A;  1IV6 A;  1QVT A;  3HOY J;  3RKQ A;  5EZH A;  3ZQL A;  3W6V A;  2XGD A;  2ELK A;  2KDZ A;  1G2H A;  1ZR2 A;  3JRE A;  2MSY A;  3A02 A;  2COB A;  1ZR4 A;  1ETW A;  2O8K A;  2CJJ A;  3CCY A;  3NAR A;  5K7F A;  1MH3 A;  2DA4 A;  1RR7 A;  1GV2 A;  1JUP A;  1MH4 A;  5E3L A;  5IP6 A;  1X2M A;  3TW6 A;  3GTL J;  3ZQI A;  3S15 J;  1ETQ A;  4LOC A;  3G1O A;  2ID6 A;  5EG0 B;  5J1R A;  5EYR A;  5FKN A;  2MG4 A;  3GTG J;  2JA7 J;  4IHY A;  3HOX J;  2JA8 J;  2HOS A;  2JA6 J;  2K9S A;  1FIP A;  1AHD P;  1JKP C;  3O8H A;  1WI3 A;  3BTL A;  3JRB A;  1MBE A;  3SJM A;  4QTR A;  2ECB A;  1AU7 A;  1GT0 C;  5E3N A;  2FD5 A;  2DA1 A;  1HF0 A;  2NVX J;  4A3E J;  1K83 J;  3VPR A;  3G1L A;  4JYK A;  1TWH J;  4BBR J;  3S1Q J;  1B72 B;  1ENH A;  4A69 C;  3S16 J;  5EG0 A;  1EF4 A;  2NS7 A;  1B8I B;  1ITY A;  1SFO J;  4J19 A;  1AKH B;  4DYR A;  4XK4 A;  3HOW J;  2G0E A;  3ZQG A;  2D5V A;  5FJ8 J;  1A6I A;  4C3I J;  4A3B J;  2EBI A;  1F36 A;  2Y31 A;  1P7I A;  1T56 A;  2EZK A;  3GTP J;  1DU0 A;  5E3M A;  1K61 A;  4FE4 A;  3K2A A;  3CQZ J;  2R5Y B;  4XRS A;  5E3O A;  5FLM J;  5HOD A;  4Y7N J;  2R5Z B;  2XRL A;  2XPU A;  2EH3 A;  2LD5 A;  1B72 A;  1WGX A;  5FKL A;  4A3J J;  4M3G A;  2TRT A;  2AHQ A;  3Q0U A;  3M4O J;  2GBY A;  1I50 J;  5F0C A;  4D5F A;  1B8I A;  2DJN A;  3HGG A;  3HM5 A;  3ZQF A;  1JUS A;  4C2M J;  1MSF C;  1AKH A;  2IEK A;  3BG5 A;  1BJZ A;  2LR8 A;  2RAE A;  3ZQH A;  1IC8 A;  3S2D J;  4XRM A;  2DMQ A;  2WAQ N;  1ETV A;  4S0H B;  1IDZ A;  3DEW A;  4ABZ A;  2M9H A;  2QCO A;  2CRG A;  3B6C A;  3OSF A;  1ETO A;  2R0Q C;  3C2B A;  2IBD A;  1I6H J;  2R5Y A;  1MBK A;  2CU7 A;  1OCP A;  5EZG A;  1QRY A;  3F0C A;  2MGQ A;  4IHV A;  2R5Z A;  3A01 B;  1ZTR A;  5JLX A;  3LSP A;  3JRF A;  2NS8 A;  1BL0 A;  1JGG A;  5FKM A;  3HEF A;  3S1R J;  4DZP A;  3PO2 J;  3BTC A;  3IH3 A;  4UUS B;  2Y9Y A;  3BR1 A;  2O9L A;  4QIW N;  2Y9Z A;  4M3F A;  5F0F A;  5DTD A;  2R7Z J;  1IJW C;  3PO3 J;  1GV5 A;  2XB0 X;  3NAU A;  4FE7 A;  5IYB J;  4C3J J;  1JJ6 C;  3UKG A;  2I10 A;  1UMQ A;  3OIO A;  3G1M A;  1LE8 B;  5JLW A;  3A01 A;  1CQT A;  2H8R A;  2K9Q A;  1Z77 A;  2DN0 A;  4G12 A;  5FKK A;  4XID A;  1XS9 A;  1IGN A;  3JRD A;  3MKL A;  3SFI A;  1MBH A;  3S17 J;  3RZO J;  1IRZ A;  1LFU P;  1VFC A;  2EQR A;  4XIC A;  2M2E A;  4UUS A;  3DCF A;  3TW7 A;  3FK6 A;  1MBJ A;  1E3O C;  1VF9 A;  3CDL A;  3HDD A;  5F0H A;  1QVU A;  3FK7 A;  5EEA A;  3OOU A;  2L7Z A;  3JRC A;  2DMT A;  4EEF G;  1MBG A;  2FJ1 A;  2ID3 A;  3TP0 A;  5M5W J;  1NTC A;  1D5Y A;  2E2J J;  2LLK A;  1TC3 C;  1HLV A;  3WHC A;  1JKO C;  4FCY A;  2HXO A;  2TCT A;  5C3E J;  1XG1 A;  3H3V K;  2XSD C;  2JWT A;  3FKI J;  3H0G J;  1JKR C;  2X9D A;  3BR5 A;  2DA5 A;  1LE8 A;  4BY1 J;  2JN6 A;  3QPS A;  2E2I J;  5C44 J;  1ZKG A;  3BR0 A;  5J1U A;  3JRI A;  2ECC A;  1QPI A;  3A03 A;  1W0U A;  1IG7 A;  3MN2 A;  2M34 A;  3IH4 A;  2E2H J;  5C4X J;  1NK3 P;  2LK2 A;  4M3D A;  9ANT A;  4MLO A;  2O7O A;  4D7N A;  3HBL A;  2Y30 A;  3LSR A;  1NK2 P;  2WB1 N;  4A3L J;  2YU9 J;  5IYD J;  1VND A;  2L0K A;  1POG A;  3S2H J;  3D1N I;  2XB5 A;  2NVT J;  2OPT A;  2HQ5 A;  1BA5 A;  2YS9 A;  2GM4 A;  1VI0 A;  4W1U A;  3TED A;  1UHS A;  4A3G J;  2N8G A;  3RQI A;  1O4X A;  4QSH A;  2X48 A;  2HOT A;  4D5C A;  3S1M J;  4IHW A;  5EF6 A;  2ZB9 A;  2DA2 A;  3LNQ A;  5J1Y A;  3BG9 A;  4V2F A;  3B6A A;  1APL C;  3K7A J;  1U78 A;  3BR6 A;  4I76 A;  2FQ4 A;  2K40 A;  5DS9 A;  3BT9 A;  3S14 J;  3S1N J;  4MIM A;  2VI6 A;  4UUT A;  3GTQ J;  3IV5 A;  1RKW A;  2DA3 A;  1Q1V A;  2CUF A;  4X1E A;  2HYJ A;  1RKT A;  2E19 A;  1ETX A;  4DYQ A;  4XRS G;  2DA7 A;  4A3K J;  3JRG A;  5F04 A;  1ETK A;  4JX5 A;  2LY9 A;  3BTJ A;  3GTK J;  1JTX A;  1WH5 A;  1X58 A;  2L9R A;  1I3Q J;  1XC5 A;  3FIW A;  1RET A;  2L7F P;  4DZJ A;  2Y2Z A;  2VPR A;  5IOY A;  2ME6 A;  2L7M P;  1UG2 A;  2R93 J;  4JX4 A;  2JJ7 A;  4W97 A;  4A93 J;  1WH7 A;  2JK3 A;  1LFB A;  2NVQ J;  1DU6 A;  1JT6 A;  5IYC J;  4FTH A;  3CMY A;  1Z0X A;  3WHB A;  4A3I J;  3JR9 A;  1GDT A;  3BTI A;  4BXX J;  1U9O A;  1OFC X;  4A3F J;  3L1P A;  1ORK A;  3HOV J;  4C3H J;  1FEX A;  1HDP A;  1IDY A;  2KT0 A;  2JMW A;  3BQZ A;  2VUM J;  3I4N J;  1TWG J;  5FKO A;  4A3C J;  4HNV A;  1TWC J;  4BBS J;  2PMZ N;  4GFB A;  3FIS A;  4M3E A;  3I4M J;  3Q0W A;  4NDL A;  3PM1 A;  5GP9 A;  3M3Y J;  4B3A A;  2WV1 A;  3Q3S A;  5IPA A;  1YRN B;  4L5E A;  5EGO B;  2DA6 A;  5C4J J;  3SDG A;  4DW6 A;  2P81 A;  2DMN A;  3LSJ A;  3ZOB A;  4AUX A;  2HI3 A;  3O8G A;  5K7H A;  3HOZ J;  2DMU A;  1JTY A;  2DTZ A;  2MW8 A;  4A3M J;  4I6Z A;  4X6A J;  2EZH A;  4D7M A;  2AO9 A;  1ZGW A;  1A5J A;  4M6V A;  2XGC A;  1H8A C;  1S7E A;  2LVS A;  2HXI A;  2LKX A;  1JT0 A;  2NOG A;  4RDU A;  3OSG A;  2W48 A;  4FIS A;  3MVP A;  1YRN A;  4CYC B;  1OJL A;  4B1R A;  5EGO A;  1HDD C;  2R92 J;  2XPW A;  2NVY J;  1TWF J;  3Q0V A;  4BKX A;  1GUU A;  1HCR A;  5IP7 J;  1TWA J;  2HOA A;  1X2N A;  4DYC A;  5M3M J;  4MFE A;  1MSE C;  2HDD A;  3BR2 A;  4AC0 A;  5IP9 J;  5FLV A;  2LP0 A;  5EDN A;  1JJ8 C;  1FTT A;  3ZQC A; 
#chains in the Genus database with same CATH topology
 2F5D A;  3K4B A;  1IF1 A;  2VBY A;  4HF1 A;  3F22 A;  2EZL A;  4A6D A;  1RES A;  3N05 A;  2DK5 A;  4BS9 A;  2HR3 A;  2VQH A;  2GLO A;  4LFU A;  1Y1V J;  3BJO A;  5DYM A;  3GFJ A;  5E8I A;  4BY7 J;  2ZJQ F;  2B63 J;  3DBR B;  1SAN A;  2M4G A;  1FBU A;  2JUC A;  2ZNY A;  4CUG A;  1O7L A;  1U9N A;  3F9K A;  2Q8K A;  5KAF C;  4Q4Z F;  5F08 A;  4HV5 A;  2A07 F;  2QF7 A;  1PP8 F;  2PI0 A;  1ZH5 A;  2D2W A;  3E7L A;  3TP3 A;  3ZN1 A;  2CUE A;  2P6T A;  1SD5 A;  5H6R A;  4S04 A;  4M9S A;  4B4C A;  2VLA A;  3DTK A;  4IHX A;  3HKZ N;  5A2Q Z;  2DYS H;  3QPL A;  1TNS A;  1I39 A;  2M0M A;  4M72 A;  1F43 A;  2JUG A;  4PJN A;  4B48 A;  2X0L A;  4GXO A;  3DLL F;  2K9N A;  3MCZ A;  1E3P A;  2HVQ A;  3I56 I;  3M8F A;  2YU3 A;  1T0F C;  1MNM C;  2DOF A;  2HZD A;  2V1D A;  4PGG A;  3M07 A;  1FOY A;  2Y0S N;  3A4C A;  2R7U A;  1K6O A;  2LFB A;  5BQT A;  4UY8 I;  1WCM J;  3HJE A;  3P5J A;  2KFD A;  2V7F A;  3DU6 A;  2QKM B;  5CKT A;  2GXG A;  3CC7 I;  4S05 A;  2Z99 A;  3LOC A;  1KU2 A;  2HWV A;  4IEJ A;  1D3Y A;  2CQX A;  5M5X J;  3CLO A;  1N75 A;  5GPA A;  1K7A A;  1R9T J;  2MH2 A;  4UNO A;  4II2 A;  1IV6 A;  1QVT A;  1VQ4 I;  2BBY A;  3LSI A;  3W6V A;  2ZC2 A;  4BJT A;  4RGR A;  3VEP A;  3H5N A;  5AIQ A;  4CZC A;  1H9T A;  4C2T A;  4EVI A;  3E6D A;  2O8K A;  4RAY A;  2X6X A;  3AL0 C;  2VON A;  3CCY A;  3NAR A;  2OZ6 A;  2KIF A;  1IN8 A;  1Y6I A;  1X1D A;  1RR7 A;  3C7J A;  1XGN A;  1SD6 A;  1T39 A;  3GTL J;  2FE3 A;  1OPC A;  2ZO4 A;  5J6X A;  3DWL E;  1R5H A;  4G6Q A;  3D5R C;  4F52 A;  2OTL I;  3KFW X;  1O3R A;  3VWB A;  5J1R A;  2MG4 A;  4HZF A;  2JA7 J;  4KJZ A;  1S3J A;  2HOS A;  1R1V A;  4IPA A;  2UZK A;  2EIM H;  5D5W B;  2W25 A;  1YO5 C;  1O7F A;  4QTR A;  3R0A A;  3ZXS A;  1AU7 A;  1O3S A;  1DUX C;  2DA1 A;  2HOE A;  1MW7 A;  4PJM A;  1TQP A;  4CSW A;  2A61 A;  4JYK A;  3S1Q J;  5D4S A;  1FP1 D;  1U5T A;  2B9S A;  3FXK A;  2Z5U A;  1AKH B;  4DYR A;  3WTV C;  4XK4 A;  1FOX A;  1IV8 A;  3MEX A;  3MKY B;  3HOW J;  1VQL I;  1Z91 A;  1HSJ A;  3HSR A;  1WI9 A;  3LA7 A;  3R4K A;  4EQQ A;  1A6I A;  2IS6 A;  2K3F A;  3ELK A;  4KIB A;  2EBI A;  3NWS A;  2P5L C;  2A69 F;  4LJZ F;  1T56 A;  5BMZ A;  2IGO A;  3MFK A;  3GTP J;  2IGM A;  1Y56 A;  3ASN H;  1K61 A;  3K2A A;  3JAM Z;  2GWR A;  3LAJ A;  1OLT A;  4Y4R A;  3FXO A;  2R5Y B;  2W7N A;  5E3O A;  1TTY A;  3KZI C;  3WE3 A;  2KZG A;  4Y7N J;  4AD9 A;  3G6E I;  3CF5 F;  4IJA A;  2R5Z B;  1J0R A;  2Q1Z B;  1R36 A;  2A68 F;  1R22 A;  2XPU A;  3DKY A;  3IAM 2;  4ITV A;  5GAD J;  2LD5 A;  4XN0 A;  1VQM I;  1K4T A;  5FKL A;  3L7W A;  3AG4 H;  4V19 K;  2CUZ A;  1IXR C;  1P2F A;  4M3G A;  2FUG 2;  2TRT A;  3Q0U A;  3RPQ A;  4A3J J;  3M4O J;  4RGS A;  3CUQ A;  3KZZ A;  5HOO A;  1LEA A;  1SAX A;  4KIT B;  1B8I A;  2DJN A;  2KHM A;  3HGG A;  3L09 A;  3HSF A;  2KLO A;  2O8X A;  3F8B A;  6PAX A;  4FET A;  2LYC A;  1FYL A;  2RQP A;  3ZQH A;  2DMQ A;  4RLF A;  2PLY A;  3HTU A;  1CF7 B;  3U9G A;  2LG4 A;  3FX3 A;  1U2W A;  4ABZ A;  2XF5 A;  2Z9O A;  1ETO A;  1HW5 A;  2R0Q C;  1I6H J;  4G94 A;  1MBK A;  1OCP A;  4ZJZ A;  4FX4 A;  1RIO H;  4IHV A;  3F8C A;  2L2O A;  1YHQ I;  1MDM A;  2EB7 A;  1Y8R B;  4XBF A;  4RB1 A;  3O2P E;  4NC6 A;  2EIL H;  1ZRF A;  5HS9 A;  2G7H A;  4RM2 A;  1JGG A;  5FKM A;  4B43 A;  2K86 A;  3S1R J;  3PO2 J;  1YG2 A;  3TGN A;  1TT5 B;  1XD7 A;  4MHG A;  2Y9Y A;  3BOQ A;  2XKO A;  1Z21 A;  5HLT A;  2XAJ A;  3BR1 A;  2RQQ A;  2Y9Z A;  1S72 I;  1BM9 A;  4NHJ A;  5FRM A;  1UZC A;  2O5R A;  1R5I D;  2IGK A;  4AIH A;  1QO0 D;  5IT3 A;  4UV8 A;  3NAU A;  4Z6Y A;  2LKS A;  5IYB J;  1MIJ A;  4HOB A;  1JJ6 C;  2XAU A;  2WAE A;  2I10 A;  3DV8 A;  1UMQ A;  4HNU A;  3OIO A;  4RS8 A;  2G9W A;  1CQT A;  1S7O A;  2XUB A;  4JOM A;  4HAM A;  4G12 A;  5FKK A;  3LFU A;  4E6K G;  4XID A;  2OBP A;  1IGN A;  3SFI A;  1TP4 A;  3KEY A;  3K4C A;  5HLI A;  1VFC A;  2KKO A;  5HDK A;  3M8E A;  2ZFW A;  3R6S A;  5KNL A;  4EGY A;  4UUS A;  1I27 A;  3TW7 A;  4KMF A;  3FK6 A;  1MMA A;  2Z1D A;  2XSJ C;  5DDG A;  2L7Z A;  5L3F A;  5DEQ A;  1MBG A;  1X3U A;  2FJ1 A;  2GIV A;  2BXZ A;  4N9I A;  1FLI A;  1D5V A;  2MYS A;  2E2J J;  1D5Y A;  3WHC A;  4ZYG A;  2JVH A;  3G2B A;  3OR2 C;  2JWT A;  3H0G J;  5DCM B;  4P9U A;  3BR5 A;  3DBL B;  4GYI A;  5F64 A;  5HDN A;  1YI2 I;  2IXS A;  4XN3 A;  4IZZ A;  3IUO A;  3SHF A;  1IRX A;  4TV7 A;  4LG0 A;  3U1K A;  2BVL A;  2FOW A;  1IAW A;  1X1C A;  1U6G A;  2PEX A;  4B44 A;  2OA4 A;  2ICW G;  4U87 A;  4WK8 F;  4O5V A;  4A0Z A;  2DXI A;  1YS6 A;  2DFH A;  4AIJ A;  3ZMU A;  1X19 A;  1W0U A;  1IG7 A;  3RTR A;  4F7Z A;  2HVS A;  5C4X J;  1VQK I;  3EUH A;  1NK3 P;  2P5V A;  2LK2 A;  5CVU A;  3CMA I;  4XKW A;  3HUG A;  1E3H A;  3OYN A;  1YYV A;  2WB1 N;  5IYD J;  2YU9 J;  3N4M A;  3RPU A;  5DM7 F;  3S2H J;  3QAH A;  3UR3 C;  2OPT A;  2HQ5 A;  2MD5 A;  2Q2E A;  3ABM H;  3IWZ A;  1VI0 A;  3CD6 I;  3RI4 A;  3TED A;  4WF2 A;  5TRD A;  2KRF A;  1O4X A;  1S9H A;  3EDP A;  3KP5 A;  3WTU C;  4Y3O A;  3KET A;  3S1M J;  5J4Y A;  1P92 A;  4IX7 A;  1TQM A;  3ZMD A;  4L5I A;  2X1E A;  2H8W A;  2MH9 A;  1A6Q A;  2GOM A;  1DP3 A;  1RUO A;  1TLH B;  1P4W A;  3GZN B;  4CYD A;  4I76 A;  3DU5 A;  5DS9 A;  3VOE A;  2ESH A;  1FOK A;  3E97 A;  5FD6 A;  2OQG A;  4MIM A;  2F48 A;  2VN2 A;  3FZV A;  3FXL A;  3OYB A;  5KCM A;  3V4G A;  3OOP A;  3TO6 A;  3IV5 A;  1PJR A;  1T8I A;  4Y13 A;  2FNP A;  3OY9 A;  2DA7 A;  4HEA 2;  2LKP A;  4HG2 A;  1SC7 A;  5FO5 A;  1WZ2 A;  4OIQ F;  1X58 A;  4YIF A;  5ILV A;  3U21 A;  1EJ9 A;  2YSR A;  1XC5 A;  2KRH A;  1P4A A;  2Y2Z A;  5IOY A;  2ME6 A;  4ASN A;  4ESF A;  3J7A Y;  3I9V 2;  4JX4 A;  2V1U A;  2HGC A;  1WH7 A;  1LFB A;  1QZE A;  4E7K A;  3I4P A;  1DU6 A;  2A5W A;  1LPQ A;  1ZRE A;  2P0W A;  1R23 A;  2QSF X;  2HQA A;  4A3I J;  5H2F C;  4LMY A;  3JR9 A;  1PDN C;  3OYM A;  2D1V A;  4RLQ A;  3RYP A;  3J80 Z;  1OFC X;  5LLQ A;  4A0Y A;  1J09 A;  5LEJ A;  4RGX A;  2CQ7 A;  3H35 A;  2HPM A;  2EV0 A;  4Q47 A;  3HOV J;  4OIN F;  3RIR A;  2VUM J;  3GW2 A;  1R1T A;  1SFE A;  4BBS J;  2H09 A;  4R8H A;  4GFB A;  3FIS A;  1YLF A;  1VTN C;  3Q0W A;  5HNF A;  1QQI A;  2XV4 S;  3TKY A;  2CQK A;  3K4L A;  2XAG A;  1KGS A;  1KON A;  3SDG A;  2V1N A;  2R7D A;  1G4D A;  4AUX A;  2HI3 A;  5K7H A;  1IUY A;  4JBA A;  3MWM A;  3MZ8 A;  4KIC A;  5L3C A;  4AM3 A;  4X6A J;  4ZYD A;  2EWN A;  3GFI A;  3CCQ I;  3P7N A;  2XAS A;  2DU9 A;  3H1C A;  1Z05 A;  4D7M A;  5E1Z B;  1XTA A;  2JRM A;  2GQQ A;  1WJE A;  4M74 A;  4H0E A;  4ANJ A;  3COA C;  1OIS A;  3GFM A;  3SZP A;  3PIO F;  4IF4 A;  1K6Y A;  3AG3 H;  1H8A C;  3L2V A;  2WAQ A;  5GAH J;  3DPL C;  2M30 A;  4KYW A;  1T0F A;  3KYD B;  1XPX A;  1JT0 A;  3KPH A;  4ZZL A;  2CW8 A;  1YW7 A;  4CYC B;  5EGO A;  2R92 J;  3HRM A;  1WFX A;  3JCU C;  1ERD A;  4XM3 A;  5ICG A;  2R7F A;  4IOA F;  2NVY J;  3E1S A;  3FMS A;  1TWF J;  4ZYE A;  3JSO A;  3RCO A;  3OYF A;  3RKY A;  3TQN A;  1TT0 A;  5IP7 J;  3L9F A;  2VE8 A;  4E7J A;  1TWA J;  1UCR A;  2D1H A;  5E8G A;  2HYF A;  1U8R A;  1MKM A;  2HDD A;  3BR2 A;  4UB6 C;  5IP9 J;  1R4N B;  3U1D A;  5FLV A;  3C3W A;  4RB2 C;  2EFW A;  1FIA A;  5TGT A;  3BZK A;  3JTG A;  1OCZ H;  3ABK H;  4HDU A;  2X6O A;  2OU2 A;  3BG3 A;  4QWQ A;  2HQR A;  4JX6 A;  3S93 A;  1ZK8 A;  1LQ1 A;  4OAY A;  4F93 B;  2LY1 A;  3Q5F A;  2YX4 A;  1T33 A;  2XAF A;  5ED4 A;  4G7H F;  1LJ9 A;  3GBG A;  2V6C A;  3BP8 A;  1LVK A;  3Q9S A;  3V7S A;  4UUV A;  3KP4 A;  3WTY C;  2ACJ A;  2KP6 A;  4RBO A;  3QOP A;  2GA1 A;  2ISZ A;  4PDK A;  4L9J A;  2RNJ A;  3LSM A;  2W84 A;  3ECO A;  3WTW C;  5BPD A;  1FTZ A;  1YFH A;  4BAY A;  2M0C A;  2ZXJ A;  3GTO J;  2VJ4 A;  2E1O A;  4G9Y A;  5IOZ A;  3HB9 A;  4JP0 A;  2STT A;  2L54 A;  3H36 A;  4MGR A;  1FY7 A;  3JRA A;  3PUB A;  2VKE A;  1DDN A;  1PUF B;  1ZQ3 P;  2TDX A;  3E6M A;  2EIK H;  1NG6 A;  2HYG D;  4EJT A;  3WTT C;  4PSW A;  4A3D J;  5J3L A;  4KA4 A;  3TOB A;  3DEE A;  3IH2 A;  2FSW A;  1BI3 A;  1JKQ C;  2FF4 A;  4XMY A;  3HOT A;  4FT8 A;  3LSG A;  4YFX F;  2VBZ A;  1HW2 A;  1MJ9 A;  1WPK A;  3TO9 A;  3ZCO A;  1R71 A;  1BR4 A;  1KA8 A;  4G6D A;  4RMN A;  3GTJ J;  1BW5 A;  3K1M A;  3MAJ A;  2ZJR F;  3BQY A;  1G3Y A;  4V2G A;  1VQ9 I;  1Y0N A;  2LSO A;  1F9N A;  2F5E A;  4E7I A;  3PNV A;  1HXD A;  5B1B H;  1O3T A;  3ROU A;  2H1K A;  2JA2 A;  3RZD J;  1WSU A;  3J81 Z;  3HOY J;  2DQL A;  3OIQ A;  4NNJ A;  5EZH A;  4JQF A;  3CJQ B;  2PJR B;  2CG4 A;  3O3K A;  2ZSH B;  2F4O B;  2X6W A;  3A02 A;  2COB A;  1VQ7 I;  4L9N A;  3NQO A;  3SXY A;  3VYT B;  3HHH A;  1MH3 A;  3W3C A;  4RGU A;  3QPH A;  4BQN A;  2BXY A;  4CZZ A;  4ESJ A;  2HQN A;  3DPT A;  4I0B A;  1X2M A;  4IRH A;  5E3L A;  3TW6 A;  5IP6 A;  4JK1 X;  2ZJP F;  5K5O A;  2H94 A;  1ZLK A;  2VOP A;  2M4K A;  4LOC A;  3G1O A;  2K9L A;  4XOT A;  2XHK A;  2M7B A;  1ODD A;  3MZH A;  3H0D A;  5EG0 B;  1OR7 C;  3CJR B;  5EYR A;  5FKN A;  3BLY A;  3GTG J;  4OIR F;  1Z9C A;  3BRO A;  3HOX J;  2JA8 J;  3JSP A;  2Y48 A;  4OIP F;  1FIP A;  4HNT A;  1JKP C;  2CMP A;  2QZ8 A;  2R4G A;  1I5Z A;  1YJ9 I;  4XNF A;  3JRB A;  1MBE A;  1YW9 A;  2W57 A;  2QBY B;  3ASO H;  4CGZ A;  2A3S A;  2F5F A;  2JVG A;  2NOJ B;  3H5R A;  2FBK A;  4EJO A;  5E3N A;  1YIJ I;  1VQO I;  1YS7 A;  2NVX J;  1HW1 A;  1K83 J;  3ABT A;  3VPR A;  3OS1 A;  4BBR J;  3GLX A;  1B72 B;  1ENH A;  1BC7 C;  3OS2 A;  2BHZ A;  2VC0 A;  4EGZ A;  3R60 A;  1QBJ A;  1JHH A;  1ZHF A;  3QU3 A;  1ITY A;  2EPF A;  2QGU A;  2CW0 F;  3CCE I;  4BYY A;  3PL8 A;  5HS8 A;  3DFG A;  1LUJ B;  4C3I J;  3LSK A;  4KMU X;  5J47 A;  5BPI A;  2EIJ H;  1HKT A;  2Y31 A;  3ZN0 A;  2EZK A;  2GOX B;  1FBQ A;  2QLZ A;  4M71 A;  2ELH A;  1DU0 A;  3QP6 A;  4BHB A;  1KQ8 A;  5E3M A;  3K1N A;  4XRS A;  1FWZ A;  5FLM J;  2RNG A;  3BZ6 A;  1D1C A;  2VIX A;  4EM1 A;  4BDZ A;  4DQ2 A;  3FMQ A;  1HC8 A;  1ZN2 A;  2GAU A;  5F0C A;  4D5F A;  3HM5 A;  4YFN F;  4C2M J;  2VXD A;  1AKH A;  2BZT A;  5AIP A;  1BI0 A;  2RKH A;  4P55 A;  3LFK A;  2R7X A;  1EA3 A;  1I3A A;  1ETV A;  3WGG A;  4S0H B;  2L01 A;  5B1A H;  3DEW A;  3DKX A;  2Z3Y A;  1HBX G;  1NH3 A;  2M9H A;  3FXR A;  3OSF A;  1O3Q A;  2CSO A;  1T98 A;  1WJC A;  2IBD A;  2R5Y A;  2CU7 A;  2EIN H;  1OCR H;  3M1C A;  4I98 B;  1BI2 A;  2R5Z A;  4ZYH A;  1D0X A;  1WVR A;  5JHU A;  1MD0 A;  3JRF A;  2NS8 A;  4UV9 A;  5CYV A;  4LLL A;  3W2W A;  2XF7 A;  4CCN A;  3EPZ A;  2LBF A;  3OR1 C;  4DBR A;  2O9L A;  1XDU A;  2H6B A;  4DBQ A;  3I64 A;  3ZQ7 A;  1EH7 A;  1W7P D;  5JI6 A;  5KHD A;  2VPL A;  1CF7 A;  1XSD A;  2CH0 A;  3ZMV A;  1E2X A;  3B73 A;  3KCC A;  4FE7 A;  2M5W A;  4C3J J;  1X3W B;  3C2G A;  2M45 A;  1VQ8 I;  2DCE A;  2FBH A;  3F21 A;  1XS9 A;  3S17 J;  2BW3 B;  3RZO J;  1IRZ A;  1LFU P;  2F5V A;  3LQQ A;  4XIC A;  1AOY A;  3F8N A;  2PX9 A;  2GA2 A;  3DCF A;  3LA3 A;  2F4I A;  1JHF A;  3KYL A;  2QA4 I;  4IOC F;  1J9I A;  2QYO A;  3EYI A;  1E3O C;  1VF9 A;  2LRD A;  1R7J A;  5F0H A;  1QVU A;  3FK7 A;  3RQ4 A;  2XAQ A;  3GZ6 A;  1ZGA A;  1V54 H;  2DMT A;  3CJT B;  3QP5 A;  1X3Z B;  2VXZ A;  4EEF G;  5FB2 A;  2FQ3 A;  2ZXI A;  5D8L B;  2KJC A;  4XR6 A;  4M9X A;  5LEK A;  2K7L A;  2ZJ2 A;  2RVC A;  5CLS A;  5AON A;  5C3E J;  1FNN A;  4HV6 A;  1H9G A;  1MGT A;  3HKZ A;  2XSD C;  1ZEL A;  3ABU A;  4RAF A;  1J75 A;  2NAZ A;  3BCA A;  1G6N A;  3E3V A;  2MFZ A;  2DA5 A;  3L2C A;  4HSR A;  4U7B A;  1YOV B;  2JN6 A;  4KT6 A;  3WG9 A;  2IW5 A;  3BY6 A;  1G3W A;  4PGH A;  1ZLJ A;  2K02 A;  2COM A;  2PMH A;  1V4R A;  1ZKG A;  2Y0S A;  5J1U A;  4IKF A;  3JRI A;  1M1E B;  2PJP A;  2E60 A;  2XKP A;  3IH4 A;  4BUP A;  1ZG3 A;  3LAP A;  2DT7 B;  4M3D A;  2WC2 A;  2RDP A;  3BJA A;  9ANT A;  2Y30 A;  3FHN A;  4WX9 A;  5J4V A;  3LSR A;  1NK2 P;  3EET A;  3TO7 A;  4E70 A;  1XMA A;  1IO2 A;  1W7P B;  3L2Q A;  1VND A;  2L0K A;  1POG A;  3EUA A;  4A2U A;  5DCM A;  2XB5 A;  3SYT A;  4BDY A;  2OZU A;  1BA5 A;  2IRF G;  2YS9 A;  2GM4 A;  2ZKZ A;  1UHS A;  4A3G J;  2ZCW A;  3H9J A;  2HFH A;  4Y33 A;  3RQI A;  1LDJ A;  4QSH A;  2X48 A;  3KE2 A;  4XKC A;  1ON2 A;  2M7A A;  5CVR A;  4IHW A;  2IA0 A;  5EF6 A;  2ZB9 A;  5E17 F;  3LNQ A;  2K4B A;  3WE2 A;  2NNY A;  3BG9 A;  4XLF A;  3IRQ A;  5LHH A;  3GLL A;  4H4K C;  3VSL A;  2WY8 Q;  4EJW A;  1V5G A;  4LIU A;  1PP7 U;  1I1G A;  1XGM A;  2P7C B;  1YW8 A;  3S14 J;  4RAG A;  3ESW B;  2VB6 A;  2VI6 A;  5LGU A;  3GTQ J;  3WTS C;  1Y39 A;  2JSP A;  4DNC A;  3P9K A;  4MQV A;  2HYJ A;  2R3S A;  1SD7 A;  2E19 A;  2BYV E;  4MNU A;  5HDG A;  3J7Y J;  2EFN A;  4XRS G;  2I5U A;  3Q9V A;  1PUE E;  3SEZ A;  4BEH B;  1TZL A;  4XON A;  2EK5 A;  2VKH A;  1BC8 C;  3JRG A;  5F04 A;  5LRR A;  3BTJ A;  4OMZ A;  4NC7 A;  2L7F P;  4I7H A;  2XAH A;  2CV0 A;  2VPR A;  3EYY A;  3M1E A;  2R93 J;  4W97 A;  3MD2 A;  2JK3 A;  4XLN F;  2VE9 A;  4YFK F;  4LLG F;  3OYL A;  2BV6 A;  5IYC J;  2DO7 A;  5KVR A;  1Z0X A;  2VQL A;  4XRF A;  2FMY A;  4WWC A;  1GDT A;  2EV5 A;  1U9O A;  3VYS B;  3G3Z A;  2IP2 A;  3D0S A;  4C2U A;  4G7O F;  1S29 A;  2EFP A;  1TW2 A;  2ADU A;  3PNT A;  4C3H J;  3KIO A;  1FEX A;  1HDP A;  5J40 A;  3I4N J;  4RB0 A;  2DOE A;  5FKO A;  3ZRG A;  2MLG A;  1XDS A;  4A3C J;  5JFR A;  1TWC J;  1E17 A;  4QPO A;  2PMZ N;  2HS5 A;  5L3E A;  3RKX A;  4N0B A;  3L2W A;  1W5S A;  4M3E A;  2HTJ A;  5D5X B;  4NDL A;  2OTJ I;  3PM1 A;  3OYK A;  3LA2 A;  3M3Y J;  1MND A;  1NHA A;  3AKZ A;  1WJD A;  4CH7 A;  2DA6 A;  5ICF A;  5C4J J;  4KFC A;  4KIF A;  5DD8 A;  5DV5 A;  1FYK A;  4G8X A;  3DEU A;  3LSJ A;  3ZOB A;  3CCM I;  3HOZ J;  2HDC A;  3CCS I;  2DMU A;  4AVZ A;  1JTY A;  2MW8 A;  4BL0 B;  1S7A A;  2E5N A;  4Y15 A;  4I6Z A;  5TIS C;  3CCJ I;  5HLH A;  2VJ5 A;  2WAD A;  4DIQ A;  3L2U A;  3A0H C;  1ACI A;  4PJ0 C;  4II3 A;  2L7K A;  4HX7 A;  4M6V A;  4R79 A;  2EFO A;  5EJC A;  2VJJ A;  3FHZ A;  1QNT A;  2LKX A;  1ZG5 A;  1J5Y A;  2E7X A;  1FSE A;  1P6R A;  3DPU A;  3MVP A;  1I1S A;  4B1R A;  1TNT A;  1HDD C;  4I02 A;  1OCO H;  2IT0 A;  1IW7 F;  3I3L A;  3Q0V A;  4ZZD A;  4HYE A;  4BKX A;  1K78 B;  3FXQ A;  2V1X A;  4KIG A;  2W24 A;  3S8P A;  2O3F A;  1RNL A;  2PG4 A;  1KZH A;  1YE9 A;  4MFE A;  2UWM A;  4PFO A;  2AS5 F;  1TBX A;  4AIK A;  2LC2 A;  4U0V A;  2FEZ A;  1BR2 A;  1FTT A;  2YUS A;  2Z2S B;  5LD2 C;  1RZ4 A;  1Y1W J;  2HU9 A;  2YX7 A;  1SEU A;  2EJR A;  3LST A;  5K7Z A;  5L3D A;  5IT9 K;  2XGE A;  3HOU J;  3G71 I;  1REP C;  5GPC A;  3GWZ A;  2WAF A;  2IA2 A;  2M8G X;  2A6H F;  3BPX A;  3IHU A;  4CYC A;  1MBF A;  2FOK A;  5B66 C;  3F72 A;  2MLK A;  2X85 A;  4Y17 A;  2K9M A;  2OJE D;  3H3U A;  3ERM A;  2DDA A;  4BH9 A;  2CO5 A;  4DJA A;  5F1J A;  1ZAR A;  4NC8 A;  3CCL I;  3PQK A;  4L5J A;  2H27 A;  1OR7 A;  1X1B A;  4AYB N;  2WBM A;  1JI8 A;  2X4H A;  4HF2 A;  1BW6 A;  3PNY A;  3I59 B;  4P96 A;  1KQ9 A;  4L0Z B;  2EZI A;  3A1Y A;  3CLQ A;  3HYI A;  3K69 A;  4XSZ F;  3HPG A;  2L02 A;  1Y8Q B;  5M5Y J;  2P7V B;  4K2E A;  1JUM A;  1EH8 A;  2PN6 A;  5LFA A;  1W0T A;  1FSH A;  3W6J B;  1ZRD A;  3VYR B;  4ENM A;  2OCE A;  1WRJ A;  2DW4 A;  4NQW B;  2IPQ X;  2XPV A;  2Y69 H;  1UHW A;  4XLC A;  3E5U A;  4I09 A;  1PYV A;  2WA0 A;  2GXB A;  5E1X A;  1QHG A;  1IUF A;  4BXF A;  5F1R A;  2IVM A;  4HW0 A;  1Y0U A;  3GZ5 A;  4FX0 A;  4Q5S F;  1GVD A;  1ON1 A;  3CF2 A;  3HGY A;  5E1W A;  1BIA A;  2OV7 A;  2CS3 A;  1GLN A;  1RPW A;  3AFH A;  1FJL A;  1IRG A;  3EUK L;  2WB1 A;  3K4N A;  4KN7 X;  2L9N A;  3T8T A;  3WU1 B;  1H89 C;  1PUF A;  1D0Y A;  4BGD A;  2VQC A;  4D1Q A;  1G59 A;  5D5V B;  3RKQ A;  4YII A;  3ZQL A;  1WWX A;  2XGD A;  3BWG A;  2KDZ A;  3KLO A;  4XOR A;  1ZR2 A;  1K4S A;  5J8C A;  2MSY A;  1A04 A;  3CJN A;  1RRJ A;  1LKX A;  4EAT A;  1LB2 A;  1SMT A;  4IQ4 A;  3MKW B;  2CJJ A;  4U0W A;  4ZYA A;  2RGV A;  5FD5 A;  5K7F A;  4ENN A;  1Z7L A;  3ZP5 A;  4XLP F;  2DA4 A;  4ENK A;  5F6F A;  2KIS A;  4ZDP A;  4GO1 A;  1LDD A;  3S15 J;  1IZ1 A;  4O6J A;  1XSV A;  2JZY A;  2OUM A;  4HLY A;  4M9Z A;  5ILU A;  1D1B A;  3REO A;  1MMS A;  5FFZ A;  3MQ0 A;  2WY7 Q;  3PSI A;  3RYR A;  4IHY A;  1J59 A;  4RB3 C;  2STW A;  1XCB A;  2PJR A;  2M3A A;  4UVA A;  3DKW A;  3CO7 C;  3O8H A;  2Y0M A;  2DT6 A;  2EV6 A;  1QPM A;  4CCO A;  3SJM A;  4HPQ A;  2MD0 A;  1YX5 A;  2KRC A;  4CDG A;  1MNE A;  5ERI A;  2FD5 A;  3FM5 A;  2KPM A;  5BOX A;  2EA2 A;  3K0L A;  3LSH A;  2DT5 A;  1ULY A;  1HKQ A;  2ZME B;  4HRI A;  1TWH J;  1QHH D;  4A69 C;  2MC3 A;  2P5K A;  2EFQ A;  1DQU A;  4BAC A;  5EG0 A;  1FT9 A;  1EF4 A;  3V8K A;  2NS7 A;  2X51 A;  3FBI B;  3SDB A;  4J19 A;  1XGO A;  4MEY F;  4AVP A;  1USS A;  4RM3 A;  3ZQG A;  1Z7U A;  2D5V A;  4A3B J;  1KU9 A;  1XSX A;  1R49 A;  4AID A;  1P7I A;  1OMI A;  4QPQ A;  1YIT I;  3ZMS A;  4YEL A;  3ABL H;  2QBY A;  2ESN A;  2V6E A;  4OMY A;  1TQI A;  4WXC A;  3WOD F;  2CV1 A;  2DJI A;  3WU0 A;  5JVT A;  1SVL A;  3I58 A;  2LNB A;  2V79 A;  1WGX A;  1B72 A;  3CTA A;  3OWT A;  2Y75 A;  2MBF A;  2R7S A;  3F6V A;  1Z3Y A;  3QOE A;  3VB2 A;  4QLC U;  2BEO A;  1OKR A;  3ZQF A;  5D4R A;  2IEK A;  4PSX A;  4Z2Y A;  1BN5 A;  3PQJ A;  4BHC A;  1BJZ A;  2LR8 A;  2RAE A;  1IC8 A;  3S2D J;  4X0G A;  2VT3 A;  2JPB A;  2DQR A;  1W1W E;  2R7R A;  4LK1 F;  2DFF A;  3B6C A;  3AAF A;  3AG2 H;  1X4O A;  2HKO A;  1R58 A;  1UST A;  3DP7 A;  1QRY A;  5EZG A;  2MGQ A;  4PUS A;  4EJV A;  3A01 B;  2R7V A;  1ZTR A;  5JLX A;  3LSP A;  2OAZ A;  4B09 A;  3HEF A;  2CGP A;  1V5F A;  3BTC A;  3E5X A;  3S3O A;  1J7K A;  5FRN A;  3M8J A;  3TOA A;  3UNG C;  1SD4 A;  1XMX A;  4QIW N;  5B5E C;  4BXU A;  2R7Z J;  2DDB A;  3PO3 J;  3N97 A;  2RN7 A;  3HTS B;  4CXF A;  2IJL A;  4IHT A;  1MJA A;  2UV1 A;  3F23 A;  3UKG A;  4KUM A;  1STZ A;  1LE8 B;  5JLW A;  3E6C C;  2H8R A;  3PFI A;  3BC8 A;  3OYD A;  2YPR A;  4HBL A;  2VBW A;  3PFY A;  1MBH A;  2HNH A;  2X1C A;  4BE1 A;  1NG7 A;  3IWF A;  2KQR A;  2E36 A;  3DTI A;  4IRI A;  1MBJ A;  2A6T A;  1GVJ A;  2ZME C;  3CDL A;  4CCJ A;  3OOU A;  1GHC A;  5LHG A;  3JRC A;  4Q48 A;  2ID3 A;  2VAS A;  3TP0 A;  2LLK A;  3OV8 A;  2J5O A;  1HLV A;  1FMW A;  1KU3 A;  1B4A A;  4I99 C;  4FCY A;  1JKO C;  2BY1 A;  2HXO A;  2TCT A;  2XF6 A;  1U0J A;  3WU2 C;  2DI3 A;  3FKI J;  2VT2 A;  3WGH A;  5KK1 A;  2L9S A;  4PFP A;  2H6C A;  4HDV A;  2GZW A;  1IXC A;  1LFP A;  2P8T A;  3F8M A;  3HRU A;  1Z3X A;  3QPS A;  1Q1H A;  4HLX A;  2BW3 A;  3I55 I;  1F5T A;  5C44 J;  3BR0 A;  1D1A A;  3HC7 A;  1A35 A;  1F1Z A;  5DUK A;  1GXP A;  3DLA A;  2QEX I;  3S3N A;  3TMO A;  2V4J C;  2BVM A;  3OS0 A;  4LIT A;  2E2H J;  4ZDO A;  4CHU A;  4O3M A;  1QGP A;  1HKS A;  1XB4 A;  4YIR X;  4J00 A;  4D7N A;  2PFB A;  3HBL A;  5CVI A;  1FYM A;  3HZJ A;  4ETS A;  3K10 A;  1BI1 A;  4A3L J;  1RUN A;  4BJ6 C;  3SZT A;  2O6G E;  1D8J A;  2E5Z A;  1B59 A;  1R5G A;  5FGM A;  2E1C A;  2NVT J;  4XLE A;  2ZFU A;  3PUF A;  2K85 A;  4W1U A;  2JQ7 A;  3MZY A;  3TDU C;  2N8G A;  2LH9 A;  3W2A A;  3KZY A;  2Z16 A;  1D0Z A;  4GYG A;  1B6A A;  4L9V A;  4D5C A;  3S2W A;  2CQN A;  1DPR A;  2DA2 A;  5D5U B;  5J1Y A;  3F3X A;  4V2F A;  1APL C;  2CV2 A;  1UJ8 A;  1FPQ A;  3K7A J;  1U78 A;  4BQA A;  2K40 A;  3BJ6 A;  3BT9 A;  2QUF A;  2AQF A;  4UUT A;  3V8J A;  5E18 F;  3SEQ A;  5EEG A;  3M7G A;  1BOB A;  1RKW A;  1UFM A;  4U7D A;  1W7P A;  1RKT A;  3WTZ A;  3T5X A;  4DYQ A;  2CFO A;  1N78 A;  1B9N A;  3A0B C;  4A3K J;  2F6C A;  2O0Y A;  2LY9 A;  4D9J A;  2GIZ A;  2L9R A;  2VL8 A;  3H9Q A;  3ECH A;  3JW4 A;  3FIW A;  2ETH A;  4ZH4 F;  3H5A A;  4MQ9 F;  1QZY A;  1ZG1 A;  2Q0O A;  2PMU A;  3LWF A;  1UG2 A;  1N25 A;  1MMN A;  4G6T B;  2JJ7 A;  1V55 H;  2MAB A;  4A93 J;  1FX7 A;  3U2R A;  1JT6 A;  3F6O A;  3CMY A;  1WJF A;  1R6R A;  1WJA A;  3WHB A;  4I2O A;  1WHU A;  2RV8 A;  3ML6 A;  3BTI A;  2P6S A;  1LNW A;  2QQA A;  3I53 A;  5DD4 A;  2AXL A;  1SAU A;  4LG3 A;  3L1P A;  2VOD A;  1XX5 A;  2M1B A;  3BG7 A;  1G3S A;  4BEH A;  1VQP I;  1AWC A;  1S5L C;  1ORK A;  2HKX A;  1X1P A;  2QQB A;  4ZTF A;  1YJN I;  2ZSI B;  2XRO A;  3BQZ A;  4PJJ A;  3E6B A;  2I8D A;  3J80 K;  3KP3 A;  3I4M J;  2IA1 A;  5GP9 A;  4IL6 C;  3Q3S A;  5IPA A;  1PVE A;  1YRN B;  2MC4 A;  3OYC A;  4XQF A;  2BHY A;  5HS7 A;  2A5Y B;  1BJA A;  3CDI A;  2P81 A;  5J8F A;  2J5P A;  4P9F A;  3O8G A;  1SFX A;  4MEX F;  2DTZ A;  4A3M J;  1F4K A;  3QPT A;  2BOL A;  3FXM A;  2EZH A;  4E7H A;  1YJW I;  3PSF A;  1UAA A;  1G3T A;  1UEL B;  2L9V A;  2PQ8 A;  2CWE A;  1ZGW A;  4L9T A;  2XGC A;  3IP4 B;  3FM3 A;  1T2K A;  1R1U A;  1KYW A;  4AWX B;  3WTX C;  4N4O B;  2Z33 A;  2HXI A;  2LDU A;  3S32 A;  3W2V A;  2C6Y A;  2WTE A;  2HTS A;  2NOG A;  1IN7 A;  2UUZ A;  2AXT C;  4FIS A;  4BU2 A;  1DGR M;  2NRA C;  1OJL A;  2ELJ A;  2HPI A;  4U88 A;  4OAZ A;  2DAO A;  3KP7 A;  2NVU B;  5ICC A;  3HOS A;  1UG0 A;  4N9H A;  1HST A;  1GUU A;  1Z6R A;  3V42 A;  3HRT A;  1X2N A;  3RKW A;  3V7R A;  5M3M J;  1RR8 C;  2LP0 A;  3K6G A;  1JJ8 C;  1T95 A;  3K2Z A;  3HHG A;  3ZQC A;  1O57 A;  4LK0 F;  2F2E A;  4M6Y A;  4ENJ A;  2W00 A;  1A36 A;  2IS2 A;  1G8X A;  5D6E A;  3X2Q H;  5HLG A;  3CCR I;  2E1M B;  1MMG A;  1JGS A;  1YTY A;  4XOP A;  3ONQ A;  1YIO A;  5F27 A;  2R7Q A;  2XVC A;  1H88 C;  5FFX A;  2G7U A;  1B1B A;  4EM0 B;  3L00 A;  4UVB A;  2LTP A;  3OYE A;  1K78 A;  3JTH A;  1JXS A;  3F8F A;  3GXO A;  2IAI A;  4R1H A;  4MO7 A;  2K3P A;  4MFD A;  1DGW Y;  1ETY A;  2CQQ A;  1VQ5 I;  1P7J A;  2HDW A;  3C18 A;  3CO6 C;  3H3Z A;  4Y52 J;  2FX0 A;  3RJP A;  2RC4 A;  3BCB A;  3OMY A;  4F55 A;  1EH6 A;  4A5M A;  3CME I;  2ISY A;  3KLN A;  2EA4 A;  3VDX A;  2E35 A;  2LBF B;  5ILS A;  3CP8 A;  3CUO A;  3M9A A;  2GXA A;  3ULQ B;  4I01 A;  4CCM A;  4M3B A;  3D5S C;  2JA5 J;  4XKB A;  3HIF A;  4OIO F;  3GCM A;  2VKV A;  3DF8 A;  4M6X A;  4E7Z A;  1P9Q C;  5CVJ A;  3OIP A;  1S6L A;  2XGX A;  2DMP A;  3QQA A;  1B9M A;  3GTM J;  3ZR8 X;  5BNG A;  3C1D A;  2JPC A;  2A05 A;  1W5T A;  3NWT A;  4YEJ A;  1OCT C;  4HQE A;  3LQR A;  1K79 A;  3T0Y A;  2FML A;  5GAE J;  2ME0 A;  2XRN A;  3I59 A;  1U8B A;  3K70 D;  4WCG A;  4YRV A;  2L3D A;  3NRV A;  3IKT A;  2F5C A;  3O6B B;  3CMM A;  1C0W A;  1Z67 A;  5M3F J;  4LGW A;  1HOM A;  2OF7 A;  4EMS A;  3MKZ A;  1Z1D A;  3BR3 A;  4D0P A;  3JRH A;  1XGS A;  3BDD A;  5FLX K;  4PZJ A;  2L4M A;  2ZNZ A;  2D45 A;  2ELK A;  3E0J B;  1G2H A;  3T8R A;  3I5U A;  3JRE A;  4NQW A;  3OL4 A;  1XMK A;  3K9T A;  4CO8 A;  2DPD A;  4GRI A;  1ETW A;  1ZR4 A;  2JRT A;  5LGN A;  4OU0 A;  2XIG A;  1QA6 A;  3K4J A;  2R7O A;  3R61 A;  3FKJ A;  4DOZ A;  1GV2 A;  1JUP A;  3J81 K;  1MH4 A;  5E20 A;  4OOI A;  3ZQI A;  4NUB A;  4LB6 B;  1ETQ A;  3ERE D;  2RRE A;  2ID6 A;  4LIV A;  1U5T B;  3DXJ F;  1FMV A;  2CFX A;  3KP6 A;  5CVV A;  4HX8 A;  1W36 D;  2BY2 A;  4F92 B;  4C30 A;  3I71 A;  3FF5 A;  4CA0 A;  2ZBK A;  2IGN A;  2JA6 J;  2K9S A;  4A12 A;  1AHD P;  1DPU A;  3HRS A;  4KIS A;  4CCK A;  5D8K B;  4G7Z F;  1FZP B;  1WI3 A;  2E1M C;  3BTL A;  3WGI A;  2LMD A;  2WV0 A;  1VQ6 I;  2ECB A;  3H9G A;  3BG6 A;  2QKL B;  3CCU I;  1GT0 C;  5B3S H;  3ZPL A;  5H6Q A;  3FDY A;  3GF2 A;  5JVG F;  4OWR B;  2CW7 A;  4WXD A;  1HF0 A;  2E34 A;  3DQV C;  4NB5 A;  4A3E J;  1EV7 A;  1BR1 A;  1X4P A;  3G1L A;  3S16 J;  3OL3 A;  1IN6 A;  2BE5 F;  4IRG A;  3T1B A;  3G4S I;  3FBN B;  3CUQ B;  2MA3 A;  1B8I B;  1SFO J;  2KJB A;  1V5E A;  2IS1 A;  2G0E A;  3OYG A;  1J2X A;  2OCC H;  2QQ8 A;  3KEO A;  5FJ8 J;  5H20 A;  1V3F A;  1F36 A;  2VOO A;  2JTV A;  1D8K A;  3MMY B;  5EEH A;  2PMZ A;  3I0T A;  1MJB A;  2DTR A;  2H1L A;  4P1W A;  4FE4 A;  3CQZ J;  5BS6 A;  3OYI A;  2V26 A;  5GAG J;  3CES A;  4UB8 C;  5HOD A;  3CC4 I;  2XRL A;  1MDM B;  3W6K B;  2EH3 A;  2ZME A;  3KP2 A;  4A0X A;  1SFK A;  3GME A;  2JT1 A;  2DFI A;  4UVC A;  2V9V A;  2AHQ A;  2GBY A;  1I50 J;  5DUI A;  1IN5 A;  5HNH A;  3QYF A;  1JUS A;  1P4X A;  4F91 B;  3IL2 A;  1MSF C;  2E7W A;  3BG5 A;  2HEO A;  2QVO A;  3DTE A;  5JR3 A;  2V9P A;  2W1O A;  2L4A A;  4XRM A;  2K4J A;  3FWE A;  2WAQ N;  3RPU D;  1IDZ A;  1EKE A;  2R7W A;  4DGW B;  2K5C A;  2QCO A;  2CRG A;  3TL4 X;  1I6X A;  3C2B A;  4GCV A;  2CUJ A;  3P9I A;  4KN4 X;  2DBB A;  4B8X A;  4A5N A;  5A2Q K;  3F0C A;  3K4M A;  5DCF A;  4IXA A;  4BE0 A;  2YR2 A;  4E7L A;  1L3L A;  2OD5 A;  4LB5 A;  3TDZ C;  2E1N A;  3GUD A;  5D6F A;  5GTH C;  3QWL A;  1BL0 A;  3K4K A;  1ZGJ A;  1YQA A;  1T38 A;  1VQN I;  4L0Y B;  4DZP A;  4FAS D;  3IH3 A;  3SZG A;  4XLH A;  4UUS B;  1ZYR F;  2FNA A;  2ZXH A;  2WWY A;  1W5C C;  3IKV A;  4FQG A;  1U5T C;  2QEN A;  3GEZ A;  2W85 A;  4M3F A;  5F0F A;  2M8E A;  5DTD A;  2KDO A;  1IJW C;  2B0L A;  4KNY A;  1GV5 A;  1MZB A;  5GTI C;  5DM6 F;  1SMY F;  4PJL A;  2XB0 X;  3CCV I;  5CQE A;  3FXJ A;  3G1M A;  1X1A A;  3A01 A;  1U3E M;  1ZRC A;  5HVQ C;  3LMM A;  2K9Q A;  1Z77 A;  2NYX A;  2DN0 A;  1RI7 A;  2UXX A;  2X6Y A;  3JRD A;  3MKL A;  4LG0 B;  1R00 A;  1KYZ A;  2F4M B;  4E7S A;  5LGT A;  1JE8 A;  1T6S A;  2EQR A;  4NBQ A;  3PIP F;  3OYH A;  2NNN A;  1DP7 P;  1QU3 A;  3BZC A;  2M2E A;  3V8L A;  3GYH X;  4AYB A;  1SVO A;  3HDD A;  4B3X A;  5EEA A;  3HL2 A;  2R7T A;  3J7A O;  1WQ2 A;  3IC7 A;  4GGG A;  3ISP A;  2FU4 A;  5M5W J;  1GXQ A;  1NTC A;  3CUQ C;  3HG9 A;  3K1P A;  3HUG B;  1TC3 C;  1OCC H;  2DFE A;  3K70 C;  3VFZ A;  1E0E A;  1XG1 A;  1ZAO A;  4P5O A;  3H3V K;  3QYE A;  1JKR C;  3AG1 H;  2X9D A;  2BGC A;  2QM3 A;  4ESB A;  1BBY A;  2VKD A;  3QU6 A;  2Q2E B;  3IAS 2;  1LE8 A;  4BY1 J;  1TW3 A;  4HA8 A;  1WJB A;  4C9Y A;  4BQO A;  4BE2 A;  4BQQ A;  2QSG X;  4BHP A;  1OYI A;  3VOD A;  3SQN A;  4LD5 A;  2VC1 A;  2E2I J;  1S8N A;  5TJJ A;  4IHS A;  1IXS B;  3FXU A;  2ECC A;  2QSH X;  1Z6T A;  3G73 A;  1QPI A;  4B47 A;  3D5L A;  3A03 A;  4XLA A;  1XN7 A;  2M34 A;  3MN2 A;  2KZV A;  2CYY A;  2VQG A;  1FC3 A;  3PJR A;  3CDH A;  3KX2 A;  3RDI A;  5IY5 H;  5CQG A;  2K27 A;  4UXN A;  1AA7 A;  4MLO A;  2O7O A;  5FRO A;  2LF7 A;  2M87 A;  3KEQ A;  1H0M A;  4HQM A;  4ON0 A;  1WJ5 A;  3D1N I;  2KMU A;  2NXN B;  1W36 C;  1FP2 A;  2KIU A;  3WG7 H;  3R0J A;  4PK4 A;  1HQC A;  3P9C A;  2VJI A;  5CJ9 A;  3VSK A;  4XL9 A;  2HOT A;  2OQR A;  5LRS A;  2KIM A;  2QQ9 A;  3B02 A;  3ZMT A;  4ZTJ A;  3E5Q A;  5CPR B;  2DPU A;  4I0A A;  3B6A A;  4IVN A;  1LEB A;  2FA5 A;  4RA2 A;  5K5R A;  4ZDL A;  3JAM K;  1T08 B;  1L0O C;  3BR6 A;  1A31 A;  2FQ4 A;  4MTD A;  2A6E F;  3FMR A;  2XC7 A;  4PCQ A;  3S1N J;  2LF8 A;  2HVR A;  3S3M A;  3C2H A;  1CGP A;  4F3Q A;  1IRF A;  4M73 A;  2NS0 A;  2P4W A;  2DA3 A;  1Q1V A;  2CUF A;  4X1E A;  2KL4 A;  1FBS A;  3HPH A;  2DOD A;  1OYY A;  1ETX A;  2HZT A;  3QOD A;  4RAZ A;  3VYU B;  4UHT A;  1KU7 A;  3OYA A;  3GTK J;  1ETK A;  4JX5 A;  1FOW A;  5L3B A;  4J01 A;  1JTX A;  4A6E A;  1WH5 A;  1YX3 A;  1I3Q J;  2DYR H;  1QZZ A;  1RET A;  4DZJ A;  3ZMZ A;  1HA8 A;  2L7M P;  4N4N B;  4CIC A;  2UXN A;  5LHI A;  3CZ6 A;  3GO5 A;  3DBH B;  2NVQ J;  2X1D A;  3OYJ A;  4EM2 A;  2LRE A;  4AU7 A;  4FTH A;  2FRH A;  3ZGK A;  2BY3 A;  4HF0 A;  1LVA A;  5L3G A;  4BXX J;  2XDV A;  4KDP A;  2LY2 A;  4XSX F;  4KT5 C;  4A3F J;  2JSC A;  5FLX Z;  1UB9 A;  4BNC A;  4HST A;  3EUH C;  2LOO A;  1UHM A;  1IDY A;  1MMD A;  2KT0 A;  2O03 A;  2JMW A;  4L18 B;  1TWG J;  2B7E A;  4HNV A;  3IRR A;  2DOA A;  2KIQ A;  3J7Z I;  3TBI A;  1SVM A;  2FBI A;  4FHT A;  2WV1 A;  4B3A A;  5JHF A;  2PBI A;  4L5E A;  5EGO B;  3ZQQ A;  3HSE A;  2FXA A;  3QYB A;  5ICE A;  4XKV A;  3CC2 I;  4BJ5 C;  4DW6 A;  5K5Q A;  5LBQ A;  4U0Y A;  2DMN A;  4CCL A;  3RSN A;  1WKM A;  2DK8 A;  5K1Y A;  4EJU A;  1KQ0 A;  5KAI C;  3L2R A;  2OC6 A;  4WXH A;  1TL8 A;  2DLL A;  1IN4 A;  1OQY A;  2AO9 A;  1A5J A;  3GVA A;  4YG2 F;  4IO9 F;  1SFU A;  4LLN A;  4E4H A;  4HX4 A;  1S7E A;  1OYW A;  2LVS A;  3SFZ A;  2BY0 A;  3BPV A;  1N77 A;  4RDU A;  3GX4 X;  2W48 A;  3OSG A;  3GFL A;  3AL0 B;  2V9K A;  1YRN A;  4MTE A;  3HXL A;  3A2K A;  1VZ0 A;  1XCV A;  5E79 C;  4GDF A;  2AQE A;  1LDK B;  2XPW A;  3EQL F;  1BOA A;  3KYC B;  3NEU A;  1R4M B;  2QWW A;  2ZXW H;  4EV0 A;  2O61 A;  1W4M A;  4ZC3 A;  1HCR A;  2W82 A;  4IQJ A;  5IT9 Z;  3V7C A;  2IS4 A;  1ONV A;  2HOA A;  3QRF F;  4DYC A;  1MSE C;  2L5Q A;  2VBX A;  1RC9 A;  4AC0 A;  3I54 A;  2E71 A;  3H92 A;  1BIB A;  5EDN A;  3LL7 A;  2W4S A;  3CP2 A; 
#chains in the Genus database with same CATH homology
 2YUS A;  1FIA A;  2EZL A;  1Y1W J;  5K7Z A;  1RES A;  2X6O A;  3BG3 A;  2XGE A;  3HOU J;  4JX6 A;  2GLO A;  1ZK8 A;  1Y1V J;  5GPC A;  2M8G X;  4CYC A;  4BY7 J;  1MBF A;  2B63 J;  5F27 A;  1SAN A;  1H88 C;  1T33 A;  1U9N A;  3GBG A;  2LTP A;  5F08 A;  2QF7 A;  4RBO A;  2IAI A;  5F1J A;  4MO7 A;  3E7L A;  4MFD A;  4AYB N;  1ETY A;  2CQQ A;  3TP3 A;  1P7J A;  1FTZ A;  2M0C A;  3GTO J;  2CUE A;  1BW6 A;  5IOZ A;  2E1O A;  4Y52 J;  2FX0 A;  3HB9 A;  4JP0 A;  4B4C A;  3JRA A;  2EZI A;  4IHX A;  3HKZ N;  2VKE A;  3QPL A;  5M5Y J;  1F43 A;  1PUF B;  1JUM A;  1ZQ3 P;  4M3B A;  1W0T A;  2JA5 J;  2K9N A;  2VKV A;  1MNM C;  2XPV A;  4A3D J;  5J3L A;  2DMP A;  2Y0S N;  3QQA A;  3GTM J;  3IH2 A;  5BNG A;  1IUF A;  2LFB A;  1JKQ C;  3LSG A;  1WCM J;  1OCT C;  1WPK A;  1GVD A;  3HGY A;  3GTJ J;  1BW5 A;  2ME0 A;  3BQY A;  1U8B A;  4V2G A;  3LOC A;  1RPW A;  4IEJ A;  1FJL A;  5M5X J;  2CQX A;  5GPA A;  1R9T J;  5M3F J;  1H89 C;  1PUF A;  1HOM A;  2OF7 A;  2H1K A;  3RZD J;  3BR3 A;  3JRH A;  1IV6 A;  1QVT A;  3HOY J;  3RKQ A;  5EZH A;  3ZQL A;  3W6V A;  2XGD A;  2ELK A;  2KDZ A;  1G2H A;  1ZR2 A;  3JRE A;  2MSY A;  3A02 A;  2COB A;  1ZR4 A;  1ETW A;  2O8K A;  2CJJ A;  3CCY A;  3NAR A;  5K7F A;  1MH3 A;  2DA4 A;  1RR7 A;  1GV2 A;  1JUP A;  1MH4 A;  5E3L A;  5IP6 A;  1X2M A;  3TW6 A;  3GTL J;  3ZQI A;  3S15 J;  1ETQ A;  4LOC A;  3G1O A;  2ID6 A;  5EG0 B;  5J1R A;  5EYR A;  5FKN A;  2MG4 A;  3GTG J;  2JA7 J;  4IHY A;  3HOX J;  2JA8 J;  2HOS A;  2JA6 J;  2K9S A;  1FIP A;  1AHD P;  1JKP C;  3O8H A;  1WI3 A;  3BTL A;  3JRB A;  1MBE A;  3SJM A;  4QTR A;  2ECB A;  1AU7 A;  1GT0 C;  5E3N A;  2FD5 A;  2DA1 A;  1HF0 A;  2NVX J;  4A3E J;  1K83 J;  3VPR A;  3G1L A;  4JYK A;  1TWH J;  4BBR J;  3S1Q J;  1B72 B;  1ENH A;  4A69 C;  3S16 J;  5EG0 A;  1EF4 A;  2NS7 A;  1B8I B;  1ITY A;  1SFO J;  4J19 A;  1AKH B;  4DYR A;  4XK4 A;  3HOW J;  2G0E A;  3ZQG A;  2D5V A;  5FJ8 J;  1A6I A;  4C3I J;  4A3B J;  2EBI A;  1F36 A;  2Y31 A;  1P7I A;  1T56 A;  2EZK A;  3GTP J;  1DU0 A;  5E3M A;  1K61 A;  4FE4 A;  3K2A A;  3CQZ J;  2R5Y B;  4XRS A;  5E3O A;  5FLM J;  5HOD A;  4Y7N J;  2R5Z B;  2XRL A;  2XPU A;  2EH3 A;  2LD5 A;  1B72 A;  1WGX A;  5FKL A;  4A3J J;  4M3G A;  2TRT A;  2AHQ A;  3Q0U A;  3M4O J;  2GBY A;  1I50 J;  5F0C A;  4D5F A;  1B8I A;  2DJN A;  3HGG A;  3HM5 A;  3ZQF A;  1JUS A;  4C2M J;  1MSF C;  1AKH A;  2IEK A;  3BG5 A;  1BJZ A;  2LR8 A;  2RAE A;  3ZQH A;  1IC8 A;  3S2D J;  4XRM A;  2DMQ A;  2WAQ N;  1ETV A;  4S0H B;  1IDZ A;  3DEW A;  4ABZ A;  2M9H A;  2QCO A;  2CRG A;  3B6C A;  3OSF A;  1ETO A;  2R0Q C;  3C2B A;  2IBD A;  1I6H J;  2R5Y A;  1MBK A;  2CU7 A;  1OCP A;  5EZG A;  1QRY A;  3F0C A;  2MGQ A;  4IHV A;  2R5Z A;  3A01 B;  1ZTR A;  5JLX A;  3LSP A;  3JRF A;  2NS8 A;  1BL0 A;  1JGG A;  5FKM A;  3HEF A;  3S1R J;  4DZP A;  3PO2 J;  3BTC A;  3IH3 A;  4UUS B;  2Y9Y A;  3BR1 A;  2O9L A;  4QIW N;  2Y9Z A;  4M3F A;  5F0F A;  5DTD A;  2R7Z J;  1IJW C;  3PO3 J;  1GV5 A;  2XB0 X;  3NAU A;  4FE7 A;  5IYB J;  4C3J J;  1JJ6 C;  3UKG A;  2I10 A;  1UMQ A;  3OIO A;  3G1M A;  1LE8 B;  5JLW A;  3A01 A;  1CQT A;  2H8R A;  2K9Q A;  1Z77 A;  2DN0 A;  4G12 A;  5FKK A;  4XID A;  1XS9 A;  1IGN A;  3JRD A;  3MKL A;  3SFI A;  1MBH A;  3S17 J;  3RZO J;  1IRZ A;  1LFU P;  1VFC A;  2EQR A;  4XIC A;  2M2E A;  4UUS A;  3DCF A;  3TW7 A;  3FK6 A;  1MBJ A;  1E3O C;  1VF9 A;  3CDL A;  3HDD A;  5F0H A;  1QVU A;  3FK7 A;  5EEA A;  3OOU A;  2L7Z A;  3JRC A;  2DMT A;  4EEF G;  1MBG A;  2FJ1 A;  2ID3 A;  3TP0 A;  5M5W J;  1NTC A;  1D5Y A;  2E2J J;  2LLK A;  1TC3 C;  1HLV A;  3WHC A;  1JKO C;  4FCY A;  2HXO A;  2TCT A;  5C3E J;  1XG1 A;  3H3V K;  2XSD C;  2JWT A;  3FKI J;  3H0G J;  1JKR C;  2X9D A;  3BR5 A;  2DA5 A;  1LE8 A;  4BY1 J;  2JN6 A;  3QPS A;  2E2I J;  5C44 J;  1ZKG A;  3BR0 A;  5J1U A;  3JRI A;  2ECC A;  1QPI A;  3A03 A;  1W0U A;  1IG7 A;  3MN2 A;  2M34 A;  3IH4 A;  2E2H J;  5C4X J;  1NK3 P;  2LK2 A;  4M3D A;  9ANT A;  4MLO A;  2O7O A;  4D7N A;  3HBL A;  2Y30 A;  3LSR A;  1NK2 P;  2WB1 N;  4A3L J;  2YU9 J;  5IYD J;  1VND A;  2L0K A;  1POG A;  3S2H J;  3D1N I;  2XB5 A;  2NVT J;  2OPT A;  2HQ5 A;  1BA5 A;  2YS9 A;  2GM4 A;  1VI0 A;  4W1U A;  3TED A;  1UHS A;  4A3G J;  2N8G A;  3RQI A;  1O4X A;  4QSH A;  2X48 A;  2HOT A;  4D5C A;  3S1M J;  4IHW A;  5EF6 A;  2ZB9 A;  2DA2 A;  3LNQ A;  5J1Y A;  3BG9 A;  4V2F A;  3B6A A;  1APL C;  3K7A J;  1U78 A;  3BR6 A;  4I76 A;  2FQ4 A;  2K40 A;  5DS9 A;  3BT9 A;  3S14 J;  3S1N J;  4MIM A;  2VI6 A;  4UUT A;  3GTQ J;  3IV5 A;  1RKW A;  2DA3 A;  1Q1V A;  2CUF A;  4X1E A;  2HYJ A;  1RKT A;  2E19 A;  1ETX A;  4DYQ A;  4XRS G;  2DA7 A;  4A3K J;  3JRG A;  5F04 A;  1ETK A;  4JX5 A;  2LY9 A;  3BTJ A;  3GTK J;  1JTX A;  1WH5 A;  1X58 A;  2L9R A;  1I3Q J;  1XC5 A;  3FIW A;  1RET A;  2L7F P;  4DZJ A;  2Y2Z A;  2VPR A;  5IOY A;  2ME6 A;  2L7M P;  1UG2 A;  2R93 J;  4JX4 A;  2JJ7 A;  4W97 A;  4A93 J;  1WH7 A;  2JK3 A;  1LFB A;  2NVQ J;  1DU6 A;  1JT6 A;  5IYC J;  4FTH A;  3CMY A;  1Z0X A;  3WHB A;  4A3I J;  3JR9 A;  1GDT A;  3BTI A;  4BXX J;  1U9O A;  1OFC X;  4A3F J;  3L1P A;  1ORK A;  3HOV J;  4C3H J;  1FEX A;  1HDP A;  1IDY A;  2KT0 A;  2JMW A;  3BQZ A;  2VUM J;  3I4N J;  1TWG J;  5FKO A;  4A3C J;  4HNV A;  1TWC J;  4BBS J;  2PMZ N;  4GFB A;  3FIS A;  4M3E A;  3I4M J;  3Q0W A;  4NDL A;  3PM1 A;  5GP9 A;  3M3Y J;  4B3A A;  2WV1 A;  3Q3S A;  5IPA A;  1YRN B;  4L5E A;  5EGO B;  2DA6 A;  5C4J J;  3SDG A;  4DW6 A;  2P81 A;  2DMN A;  3LSJ A;  3ZOB A;  4AUX A;  2HI3 A;  3O8G A;  5K7H A;  3HOZ J;  2DMU A;  1JTY A;  2DTZ A;  2MW8 A;  4A3M J;  4I6Z A;  4X6A J;  2EZH A;  4D7M A;  2AO9 A;  1ZGW A;  1A5J A;  4M6V A;  2XGC A;  1H8A C;  1S7E A;  2LVS A;  2HXI A;  2LKX A;  1JT0 A;  2NOG A;  4RDU A;  3OSG A;  2W48 A;  4FIS A;  3MVP A;  1YRN A;  4CYC B;  1OJL A;  4B1R A;  5EGO A;  1HDD C;  2R92 J;  2XPW A;  2NVY J;  1TWF J;  3Q0V A;  4BKX A;  1GUU A;  1HCR A;  5IP7 J;  1TWA J;  2HOA A;  1X2N A;  4DYC A;  5M3M J;  4MFE A;  1MSE C;  2HDD A;  3BR2 A;  4AC0 A;  5IP9 J;  5FLV A;  2LP0 A;  5EDN A;  1JJ8 C;  1FTT A;  3ZQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...