1R9TK

Rna polymerase ii strand separated elongation complex, mismatched nucleotide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA strand
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 21
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2003-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1r9tK00
1TWGK 1R9TC 4XLNA 5C3EC 2NVQC 4Q4ZA 5TMFA 3RZDK 4A3IC 3PO2C 3S1RC 3CQZC 4AYBD 2NVTC 3GTJK 1K83K 2WB1L 3S16K 4Y7NK 3GTOC 2B63C 3HOXK 5IYCK 1I6HC 4KN7A 3EQLA 1IW7A 3H3VD 3GTPC 4A3MK 2Y0SD 5IP7K 2E2IC 2VUMK 4LK0A 1I3QK 1WCMC 2WAQD 5IYBC 4BY7K 2B63K 4G7ZA 3HOZC 1Y1WC 4A3LC 1Y1VC 3M3YC 2WB1D 4QJVB 4A3KK 4Y52K 4LLGA 3S14K 3HOWC 5FJ8K 3S2DK 2R92C 2E2JC 3RZOK 4OIPA 4MEYA 3GTLC 4NOIA 4ZH4A 4BY1C 2PMZL 2YU9C 4A3DC 4GZYA 2O5JA 1SFOC 3I4NK 4X6AK 4KN4A 4LK1A 1TWCC 4YFKA 3S1QC 4XSXA 5FLMC 4QJVA 1HQMA 2E2HC 3GTQK 1TWAC 3GTMC 3GTKK 5C4XK 4YG2A 1TWHK 2E2JK 1I50C 1TWFC 1ZYRA 4BBSC 3HOUK 2CW0A 4A3JK 2NVQK 3I4MK 3S1NC 5D4DA 4JK1A 1R9TK 5C3EK 4QIWD 5C4JC 4A3IK 3PO2K 3S1RK 4A3CC 3CQZK 4A93C 3S1QK 2NVTK 3GTOK 4A3GC 2NVXC 1XPPA 2PPBA 4G7OA 2NVYC 3S2HC 1I6HK 5IYDC 3H0GC 4XSZA 3HOVC 3GTPK 4XLPA 2E2IK 4QIWL 2JA6C 1I6VA 1YNJA 1WCMK 2O5IA 2R7ZK 5IYBK 5C44C 4BBRC 5M5WK 4A3EC 2JA8C 2PA8D 2A69A 3S17C 5M5XK 3HOZK 4OIOA 1Y1WK 4A3LK 3PO3C 1Y1VK 3M3YK 3S15C 4BXXC 3K7AC 3HOWK 4KMUA 2A6HA 2R92K 3GTLK 5IP9C 4A3BC 3HOYC 1SMYA 2JA7C 4OIQA 2BE5A 4BY1K 2JA5C 1TWGC 2YU9K 4OIRA 2R7ZC 4BBRK 3GTGC 3S1MC 4MQ9A 1SFOK 4A3DK 4G7HA 2PA8L 3I4MC 1TWCK 3FKIC 4A3FC 4MEXA 3GTJC 5FLMK 3S16C 4Y7NC 4YFXA 2E2HK 1TWAK 3K7AK 3GTMK 3HOXC 5IYCC 2A68A 4Q5SA 1I50K 1TWFK 4BBSK 3M4OC 3S1NK 4A3MC 4C3JK 5IP7C 2VUMC 4LJZA 1I3QC 1BDFA 5C4JK 4C3HK 4A3CK 3FKIK 4A3FK 4A93K 4BY7C 4A3GK 2NVXK 4OINA 4A3KC 4Y52C 2NVYK 3S2HK 3M4OK 3S14C 3H0GK 2A6EA 4C2MK 3S2DC 5IYDK 3HKZD 3HOVK 3RZOC 4YFNA 2R93C 2PMZD 2JA6K 4C3IK 5M3MK 5M5YK 4AYBL 5M3FK 4A3EK 5C44K 3I4NC 4X6AC 5TMCA 3RZDC 2JA8K 3S17K 3DXJA 3PO3K 1K83C 1YNNA 3S15K 3GTQC 3WODA 3GTKC 4BXXK 5C4XC 1TWHC 3HKZL 3H3VL 2Y0SL 2R93K 5IP9K 4A3BK 3HOUC 4A3JC 3HOYK 2WAQL 2JA7K 3GTGK 3S1MK 2JA5K
chains in the Genus database with same CATH superfamily
1TWGK 1R9TC 5C3EC 4Q4ZA 5TMFA 1EI6A 3S1RC 4AYBD 1K83K 2WB1L 3GTOC 4AH6A 4GTDA 1PJ7A 3QX3A 2JA6A 2GAGC 4P5BA 4LK0A 1XXBA 4KATA 1WCMC 4GTLA 2CFAA 5IYBC 1ZQ1C 3GIRA 3A8IA 2B63K 3N0BA 3HOZC 1Y1WC 2WB1D 5FJ8K 2R7ZA 3GTGA 3RZOK 4MEYA 1O26A 4ZH4A 2YU9C 3SZZA 3I4NK 2KWAA 4KN4A 1VGXA 3JSTA 4YFKA 5FLMC 4QJVA 2E2HC 2XCQA 1TWAC 2EBBA 3GTMC 3GTKK 3GSIA 4YG2A 2E2JK 3HOUK 4C3JC 1IBAA 1ZVUA 1F93A 4QIWD 1DCHA 3PO2K 4KMHA 3CQZK 3OREA 2RH6A 4KB2A 4A3GC 1WOOA 2NVXC 2PHCB 5IYDC 2GSNA 3HOVC 4XLPA 2E2IK 4C3IC 1YNJA 4G0UA 5C44C 3S17C 1J6VA 1O24A 4OIOA 4BKWA 5IOSA 4A3LK 3PO3C 1Y1VK 3M3YK 4BXXC 1YX2A 3HOWK 2A6HA 2ZUFA 5IP9C 3AD9C 1TWGC 4KARA 2JA5C 3TTGA 4MQ9A 1SFOK 2PA8L 2P5MA 1ZBSA 4YFXA 1F7VA 4C45A 3AD8C 1WOSA 2A68A 1O25A 1TWFK 3FOEA 3L4KA 4LJZA 5C4JK 1PJ5A 1J98A 4A93K 4KM8A 2V6UA 3GTLA 2NVYK 3M4OK 4KMDA 3L4JA 4KB4A 5IOTA 3RZOC 5EGHA 3AQPA 4KAWX 2R93C 2PMZD 1TWCA 5M3FK 4A3EK 3I4NC 3DXJA 4DDQA 4KC6A 1BGWA 5CJ9A 3LAJA 1I50A 3GTKC 3H3VL 3HKZL 2Y0SL 3GTPA 3TFIA 4A3BK 3HOUC 2WAQL 3LAPA 3S1MK 3PO2C 3CQZC 1L0WA 3GDZA 2CFAB 1EK8A 3VA7A 3H0GA 1VLOA 4FM9A 3H3VD 1ZXOA 2Y0SD 2E2IC 3CAGA 2WAQD 1BJTA 3Q3QA 4BY7K 4G7ZA 4A3LC 1Y1VC 3M3YC 4QJVB 4A3KK 4RMFA 2GSUA 2Y3PA 4GT9A 1ISEA 3HOWC 2JA7A 1G51A 4NOIA 3FKIA 4GZYA 3GTJA 1SFOC 4LK1A 3S1QC 1HQMA 1WQFA 3GTQK 3T00A 1RU0A 1WOPA 1TWFC 1ZYRA 2VUMA 1I3QA 2NVQK 1EFWA 5C4JC 4A3IK 4WILA 4A93C 2NVTK 4ILDA 1XPPA 2PPBA 2NVYC 1YCLA 1DD5A 4G0WA 3GTPK 1VH2A 4QIWL 1O28A 2GAHC 3ERED 4WJ3M 4A3EC 2XCOA 2A69A 3IPJA 5M5XK 3K7AC 2XCRB 2R92K 1R9TA 2GSOA 4A3BC 4KDDA 1SMYA 4OIRA 4BY1K 3S1MC 4A3DK 4BBRK 4LOWA 4G7HA 3GTOA 4LQYA 4A3FC 3GEIA 3BP3A 1WCMA 4KMAA 1BDFA 1XXCA 4A3CK 3FKIK 5JFEA 4GTFA 4BY7C 4OINA 1TWHA 5TJ3A 1XZQA 4A3KC 3S2HK 4C2MK 1V5VA 2YU9A 4YFNA 3FOFA 1WSVA 4LR2A 2JA6K 1PJ6A 5JVOA 2JA8K 1IE0A 2E2HA 1XZPA 3LPXA 1DCPA 1K83C 3S15K 2P8TA 3GTQC 3WODA 3V4GA 2PMZL 2NVQC 2R7ZK 3GTGK 2FQOA 4XLNA 1F9NA 2ZUEA 3RZDK 4A3IC 2NVXA 2NVTC 4Y7NK 2B63C 3HOXK 4WJ4A 3EQLA 1O29A 3GTPC 1USOA 3A8JA 3A8KA 1IL2A 1USMA 4LLGA 3S14K 3S2DK 2R92C 1O27A 1TWGA 2E2JC 2JA5A 1UV7A 4OIPA 4BY1C 4A3DC 1B4AA 2O5JA 3NUHA 4XSXA 3OPFA 5C4XK 1TWHK 1WIHA 4A3JK 3N3YA 3I4MK 5D4DA 3ADAC 4A3CC 3BUEA 1JQWA 1I6HK 3S2HC 2R93A 4C2MC 1WSRA 4J3NA 3BP8C 2JA6C 1I6VA 2JA8C 1GE9A 3GTKA 1J6WA 1JOEA 3S15C 4P9SA 4KMUA 4O2DA 3AQOA 3GTLK 1DCOA 2R7ZC 2BE5A 3GTGC 5CHPA 1TWCK 4GFQA 4Y7NC 1O2FB 3AH5A 3HOXC 4Q5SA 1I50K 4BBSK 5IOQA 2E2IA 2D6FC 3M4OC 3GEHA 3GEEA 3S1NK 1INNA 2JH3A 4BLBA 3AD7C 3SZYA 4C3HK 1Y1VA 1O2AA 1XXAA 1XZPB 3S14C 3H0GK 5IORA 3S2DC 1BS2A 1SFOA 5M3MK 5M5YK 3S0XA 3G4CA 5E68A 1TWFA 1WQGA 5C4XC 1TWHC 4GTAA 2ZFZA 3FHZA 2R93K 4A3JC 4GTEA 4XCHA 2JA7K 3HOYK 3I4MC 1O2BA 1WORA 1Y1WA 3GTJK 3S16K 2NVYA 1EH1A 5IYCK 1I6HC 4KN7A 2W7VA 1KQ4A 1IW7A 3TFJA 4A3MK 5IP7K 2VUMK 1I3QK 2RGRA 4PAAA 1X31C 4M1XA 1TWAA 3N0CA 3GTMA 1B4BA 4Y52K 3G4AA 3GTLC 4X6AK 1TWCC 1IS1A 1VJEA 1I50C 4BBSC 1AB4A 2FQTA 2CW0A 3S1NC 4JK1A 1EQRA 1R9TK 5C3EK 3T02A 1HI9A 4C3HC 3S1RK 3S1QK 5HL8A 1XZQB 3GTOK 4G0VA 4G7OA 3TFHA 3H0GC 4XSZA 3OEPA 2O5IA 1WCMK 4GTCA 5IYBK 2V6SA 4BBRC 5M5WK 2PA8D 1K83A 4FZBA 3GTQA 3HOZK 1Y1WK 3HOYC 2JA7C 4OIQA 1IQ0A 2YU9K 2B63A 3FKIC 4GTBA 4MEXA 3GTJC 5FLMK 3S16C 2E2HK 1TWAK 3K7AK 3GTMK 1J6XA 5IYCC 2V6TA 3HXAA 4C3JK 4A3MC 5IP7C 2VUMC 1I3QC 4PABA 4A3FK 1JVIA 3T01A 4A3GK 2NVXK 2R92A 4KM9A 1C0AA 4Y52C 1VRQC 5IYDK 2A6EA 3HKZD 3HOVK 1WQHA 4C3IK 4AYBL 3CQZA 4BLAA 5C44K 4X6AC 5TMCA 3RZDC 3S17K 3MMLB 5EGEA 3PO3K 1YNNA 4BXXK 1F7UA 5IP9K 5L46A 4KASA 4P5AA 2JA5K
chains in the Genus database with same CATH topology
1TWGK 1R9TC 4XLNA 5C3EC 2NVQC 4Q4ZA 5TMFA 3RZDK 4A3IC 3PO2C 3S1RC 3CQZC 4AYBD 2NVTC 3GTJK 1K83K 2WB1L 3S16K 4Y7NK 3GTOC 2B63C 3HOXK 5IYCK 1I6HC 4KN7A 3EQLA 1IW7A 3H3VD 3GTPC 4A3MK 2Y0SD 5IP7K 2E2IC 2VUMK 4LK0A 1I3QK 1WCMC 2WAQD 5IYBC 4BY7K 2B63K 4G7ZA 3HOZC 1Y1WC 4A3LC 1Y1VC 3M3YC 2WB1D 4QJVB 4A3KK 4Y52K 4LLGA 3S14K 3HOWC 5FJ8K 3S2DK 2R92C 2E2JC 3RZOK 4OIPA 4MEYA 3GTLC 4NOIA 4ZH4A 4BY1C 2PMZL 2YU9C 4A3DC 4GZYA 2O5JA 1SFOC 3I4NK 4X6AK 4KN4A 4LK1A 1TWCC 4YFKA 3S1QC 4XSXA 5FLMC 4QJVA 1HQMA 2E2HC 3GTQK 1TWAC 3GTMC 3GTKK 5C4XK 4YG2A 1TWHK 2E2JK 1I50C 1TWFC 1ZYRA 4BBSC 3HOUK 2CW0A 4A3JK 2NVQK 3I4MK 3S1NC 5D4DA 4JK1A 1R9TK 5C3EK 4QIWD 5C4JC 4A3IK 3PO2K 3S1RK 4A3CC 3CQZK 4A93C 3S1QK 2NVTK 3GTOK 4A3GC 2NVXC 1XPPA 2PPBA 4G7OA 2NVYC 3S2HC 1I6HK 5IYDC 3H0GC 4XSZA 3HOVC 3GTPK 4XLPA 2E2IK 4QIWL 2JA6C 1I6VA 1YNJA 1WCMK 2O5IA 2R7ZK 5IYBK 5C44C 4BBRC 5M5WK 4A3EC 2JA8C 2PA8D 2A69A 3S17C 5M5XK 3HOZK 4OIOA 1Y1WK 4A3LK 3PO3C 1Y1VK 3M3YK 3S15C 4BXXC 3K7AC 3HOWK 4KMUA 2A6HA 2R92K 3GTLK 5IP9C 4A3BC 3HOYC 1SMYA 2JA7C 4OIQA 2BE5A 4BY1K 2JA5C 1TWGC 2YU9K 4OIRA 2R7ZC 4BBRK 3GTGC 3S1MC 4MQ9A 1SFOK 4A3DK 4G7HA 2PA8L 3I4MC 1TWCK 3FKIC 4A3FC 4MEXA 3GTJC 5FLMK 3S16C 4Y7NC 4YFXA 2E2HK 1TWAK 3K7AK 3GTMK 3HOXC 5IYCC 2A68A 4Q5SA 1I50K 1TWFK 4BBSK 3M4OC 3S1NK 4A3MC 4C3JK 5IP7C 2VUMC 4LJZA 1I3QC 1BDFA 5C4JK 4C3HK 4A3CK 3FKIK 4A3FK 4A93K 4BY7C 4A3GK 2NVXK 4OINA 4A3KC 4Y52C 2NVYK 3S2HK 3M4OK 3S14C 3H0GK 2A6EA 4C2MK 3S2DC 5IYDK 3HKZD 3HOVK 3RZOC 4YFNA 2R93C 2PMZD 2JA6K 4C3IK 5M3MK 5M5YK 4AYBL 5M3FK 4A3EK 5C44K 3I4NC 4X6AC 5TMCA 3RZDC 2JA8K 3S17K 3DXJA 3PO3K 1K83C 1YNNA 3S15K 3GTQC 3WODA 3GTKC 4BXXK 5C4XC 1TWHC 3HKZL 3H3VL 2Y0SL 2R93K 5IP9K 4A3BK 3HOUC 4A3JC 3HOYK 2WAQL 2JA7K 3GTGK 3S1MK 2JA5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWG K;  1R9T C;  4XLN A;  5C3E C;  2NVQ C;  4Q4Z A;  5TMF A;  3RZD K;  4A3I C;  3PO2 C;  3S1R C;  3CQZ C;  4AYB D;  2NVT C;  3GTJ K;  1K83 K;  2WB1 L;  3S16 K;  4Y7N K;  3GTO C;  2B63 C;  3HOX K;  5IYC K;  1I6H C;  4KN7 A;  3EQL A;  1IW7 A;  3H3V D;  3GTP C;  4A3M K;  2Y0S D;  5IP7 K;  2E2I C;  2VUM K;  4LK0 A;  1I3Q K;  1WCM C;  2WAQ D;  5IYB C;  4BY7 K;  2B63 K;  4G7Z A;  3HOZ C;  1Y1W C;  4A3L C;  1Y1V C;  3M3Y C;  2WB1 D;  4QJV B;  4A3K K;  4Y52 K;  4LLG A;  3S14 K;  3HOW C;  5FJ8 K;  3S2D K;  2R92 C;  2E2J C;  3RZO K;  4OIP A;  4MEY A;  3GTL C;  4NOI A;  4ZH4 A;  4BY1 C;  2PMZ L;  2YU9 C;  4A3D C;  4GZY A;  2O5J A;  1SFO C;  3I4N K;  4X6A K;  4KN4 A;  4LK1 A;  1TWC C;  4YFK A;  3S1Q C;  4XSX A;  5FLM C;  4QJV A;  1HQM A;  2E2H C;  3GTQ K;  1TWA C;  3GTM C;  3GTK K;  5C4X K;  4YG2 A;  1TWH K;  2E2J K;  1I50 C;  1TWF C;  1ZYR A;  4BBS C;  3HOU K;  2CW0 A;  4A3J K;  2NVQ K;  3I4M K;  3S1N C;  5D4D A;  4JK1 A;  1R9T K;  5C3E K;  4QIW D;  5C4J C;  4A3I K;  3PO2 K;  3S1R K;  4A3C C;  3CQZ K;  4A93 C;  3S1Q K;  2NVT K;  3GTO K;  4A3G C;  2NVX C;  1XPP A;  2PPB A;  4G7O A;  2NVY C;  3S2H C;  1I6H K;  5IYD C;  3H0G C;  4XSZ A;  3HOV C;  3GTP K;  4XLP A;  2E2I K;  4QIW L;  2JA6 C;  1I6V A;  1YNJ A;  1WCM K;  2O5I A;  2R7Z K;  5IYB K;  5C44 C;  4BBR C;  5M5W K;  4A3E C;  2JA8 C;  2PA8 D;  2A69 A;  3S17 C;  5M5X K;  3HOZ K;  4OIO A;  1Y1W K;  4A3L K;  3PO3 C;  1Y1V K;  3M3Y K;  3S15 C;  4BXX C;  3K7A C;  3HOW K;  4KMU A;  2A6H A;  2R92 K;  3GTL K;  5IP9 C;  4A3B C;  3HOY C;  1SMY A;  2JA7 C;  4OIQ A;  2BE5 A;  4BY1 K;  2JA5 C;  1TWG C;  2YU9 K;  4OIR A;  2R7Z C;  4BBR K;  3GTG C;  3S1M C;  4MQ9 A;  1SFO K;  4A3D K;  4G7H A;  2PA8 L;  3I4M C;  1TWC K;  3FKI C;  4A3F C;  4MEX A;  3GTJ C;  5FLM K;  3S16 C;  4Y7N C;  4YFX A;  2E2H K;  1TWA K;  3K7A K;  3GTM K;  3HOX C;  5IYC C;  2A68 A;  4Q5S A;  1I50 K;  1TWF K;  4BBS K;  3M4O C;  3S1N K;  4A3M C;  4C3J K;  5IP7 C;  2VUM C;  4LJZ A;  1I3Q C;  1BDF A;  5C4J K;  4C3H K;  4A3C K;  3FKI K;  4A3F K;  4A93 K;  4BY7 C;  4A3G K;  2NVX K;  4OIN A;  4A3K C;  4Y52 C;  2NVY K;  3S2H K;  3M4O K;  3S14 C;  3H0G K;  2A6E A;  4C2M K;  3S2D C;  5IYD K;  3HKZ D;  3HOV K;  3RZO C;  4YFN A;  2R93 C;  2PMZ D;  2JA6 K;  4C3I K;  5M3M K;  5M5Y K;  4AYB L;  5M3F K;  4A3E K;  5C44 K;  3I4N C;  4X6A C;  5TMC A;  3RZD C;  2JA8 K;  3S17 K;  3DXJ A;  3PO3 K;  1K83 C;  1YNN A;  3S15 K;  3GTQ C;  3WOD A;  3GTK C;  4BXX K;  5C4X C;  1TWH C;  3HKZ L;  3H3V L;  2Y0S L;  2R93 K;  5IP9 K;  4A3B K;  3HOU C;  4A3J C;  3HOY K;  2WAQ L;  2JA7 K;  3GTG K;  3S1M K;  2JA5 K; 
#chains in the Genus database with same CATH topology
 1TWG K;  1R9T C;  5C3E C;  4Q4Z A;  5TMF A;  1EI6 A;  3S1R C;  4AYB D;  1K83 K;  2WB1 L;  3GTO C;  4AH6 A;  4GTD A;  1PJ7 A;  3QX3 A;  2JA6 A;  2GAG C;  4P5B A;  4LK0 A;  1XXB A;  4KAT A;  1WCM C;  4GTL A;  2CFA A;  5IYB C;  1ZQ1 C;  3GIR A;  3A8I A;  2B63 K;  3N0B A;  3HOZ C;  1Y1W C;  2WB1 D;  5FJ8 K;  2R7Z A;  3GTG A;  3RZO K;  4MEY A;  1O26 A;  4ZH4 A;  2YU9 C;  3SZZ A;  3I4N K;  2KWA A;  4KN4 A;  1VGX A;  3JST A;  4YFK A;  5FLM C;  4QJV A;  2E2H C;  2XCQ A;  1TWA C;  2EBB A;  3GTM C;  3GTK K;  3GSI A;  4YG2 A;  2E2J K;  3HOU K;  4C3J C;  1IBA A;  1ZVU A;  1F93 A;  4QIW D;  1DCH A;  3PO2 K;  4KMH A;  3CQZ K;  3ORE A;  2RH6 A;  4KB2 A;  4A3G C;  1WOO A;  2NVX C;  2PHC B;  5IYD C;  2GSN A;  3HOV C;  4XLP A;  2E2I K;  4C3I C;  1YNJ A;  4G0U A;  5C44 C;  3S17 C;  1J6V A;  1O24 A;  4OIO A;  4BKW A;  5IOS A;  4A3L K;  3PO3 C;  1Y1V K;  3M3Y K;  4BXX C;  1YX2 A;  3HOW K;  2A6H A;  2ZUF A;  5IP9 C;  3AD9 C;  1TWG C;  4KAR A;  2JA5 C;  3TTG A;  4MQ9 A;  1SFO K;  2PA8 L;  2P5M A;  1ZBS A;  4YFX A;  1F7V A;  4C45 A;  3AD8 C;  1WOS A;  2A68 A;  1O25 A;  1TWF K;  3FOE A;  3L4K A;  4LJZ A;  5C4J K;  1PJ5 A;  1J98 A;  4A93 K;  4KM8 A;  2V6U A;  3GTL A;  2NVY K;  3M4O K;  4KMD A;  3L4J A;  4KB4 A;  5IOT A;  3RZO C;  5EGH A;  3AQP A;  4KAW X;  2R93 C;  2PMZ D;  1TWC A;  5M3F K;  4A3E K;  3I4N C;  3DXJ A;  4DDQ A;  4KC6 A;  1BGW A;  5CJ9 A;  3LAJ A;  1I50 A;  3GTK C;  3H3V L;  3HKZ L;  2Y0S L;  3GTP A;  3TFI A;  4A3B K;  3HOU C;  2WAQ L;  3LAP A;  3S1M K;  3PO2 C;  3CQZ C;  1L0W A;  3GDZ A;  2CFA B;  1EK8 A;  3VA7 A;  3H0G A;  1VLO A;  4FM9 A;  3H3V D;  1ZXO A;  2Y0S D;  2E2I C;  3CAG A;  2WAQ D;  1BJT A;  3Q3Q A;  4BY7 K;  4G7Z A;  4A3L C;  1Y1V C;  3M3Y C;  4QJV B;  4A3K K;  4RMF A;  2GSU A;  2Y3P A;  4GT9 A;  1ISE A;  3HOW C;  2JA7 A;  1G51 A;  4NOI A;  3FKI A;  4GZY A;  3GTJ A;  1SFO C;  4LK1 A;  3S1Q C;  1HQM A;  1WQF A;  3GTQ K;  3T00 A;  1RU0 A;  1WOP A;  1TWF C;  1ZYR A;  2VUM A;  1I3Q A;  2NVQ K;  1EFW A;  5C4J C;  4A3I K;  4WIL A;  4A93 C;  2NVT K;  4ILD A;  1XPP A;  2PPB A;  2NVY C;  1YCL A;  1DD5 A;  4G0W A;  3GTP K;  1VH2 A;  4QIW L;  1O28 A;  2GAH C;  3ERE D;  4WJ3 M;  4A3E C;  2XCO A;  2A69 A;  3IPJ A;  5M5X K;  3K7A C;  2XCR B;  2R92 K;  1R9T A;  2GSO A;  4A3B C;  4KDD A;  1SMY A;  4OIR A;  4BY1 K;  3S1M C;  4A3D K;  4BBR K;  4LOW A;  4G7H A;  3GTO A;  4LQY A;  4A3F C;  3GEI A;  3BP3 A;  1WCM A;  4KMA A;  1BDF A;  1XXC A;  4A3C K;  3FKI K;  5JFE A;  4GTF A;  4BY7 C;  4OIN A;  1TWH A;  5TJ3 A;  1XZQ A;  4A3K C;  3S2H K;  4C2M K;  1V5V A;  2YU9 A;  4YFN A;  3FOF A;  1WSV A;  4LR2 A;  2JA6 K;  1PJ6 A;  5JVO A;  2JA8 K;  1IE0 A;  2E2H A;  1XZP A;  3LPX A;  1DCP A;  1K83 C;  3S15 K;  2P8T A;  3GTQ C;  3WOD A;  3V4G A;  2PMZ L;  2NVQ C;  2R7Z K;  3GTG K;  2FQO A;  4XLN A;  1F9N A;  2ZUE A;  3RZD K;  4A3I C;  2NVX A;  2NVT C;  4Y7N K;  2B63 C;  3HOX K;  4WJ4 A;  3EQL A;  1O29 A;  3GTP C;  1USO A;  3A8J A;  3A8K A;  1IL2 A;  1USM A;  4LLG A;  3S14 K;  3S2D K;  2R92 C;  1O27 A;  1TWG A;  2E2J C;  2JA5 A;  1UV7 A;  4OIP A;  4BY1 C;  4A3D C;  1B4A A;  2O5J A;  3NUH A;  4XSX A;  3OPF A;  5C4X K;  1TWH K;  1WIH A;  4A3J K;  3N3Y A;  3I4M K;  5D4D A;  3ADA C;  4A3C C;  3BUE A;  1JQW A;  1I6H K;  3S2H C;  2R93 A;  4C2M C;  1WSR A;  4J3N A;  3BP8 C;  2JA6 C;  1I6V A;  2JA8 C;  1GE9 A;  3GTK A;  1J6W A;  1JOE A;  3S15 C;  4P9S A;  4KMU A;  4O2D A;  3AQO A;  3GTL K;  1DCO A;  2R7Z C;  2BE5 A;  3GTG C;  5CHP A;  1TWC K;  4GFQ A;  4Y7N C;  1O2F B;  3AH5 A;  3HOX C;  4Q5S A;  1I50 K;  4BBS K;  5IOQ A;  2E2I A;  2D6F C;  3M4O C;  3GEH A;  3GEE A;  3S1N K;  1INN A;  2JH3 A;  4BLB A;  3AD7 C;  3SZY A;  4C3H K;  1Y1V A;  1O2A A;  1XXA A;  1XZP B;  3S14 C;  3H0G K;  5IOR A;  3S2D C;  1BS2 A;  1SFO A;  5M3M K;  5M5Y K;  3S0X A;  3G4C A;  5E68 A;  1TWF A;  1WQG A;  5C4X C;  1TWH C;  4GTA A;  2ZFZ A;  3FHZ A;  2R93 K;  4A3J C;  4GTE A;  4XCH A;  2JA7 K;  3HOY K;  3I4M C;  1O2B A;  1WOR A;  1Y1W A;  3GTJ K;  3S16 K;  2NVY A;  1EH1 A;  5IYC K;  1I6H C;  4KN7 A;  2W7V A;  1KQ4 A;  1IW7 A;  3TFJ A;  4A3M K;  5IP7 K;  2VUM K;  1I3Q K;  2RGR A;  4PAA A;  1X31 C;  4M1X A;  1TWA A;  3N0C A;  3GTM A;  1B4B A;  4Y52 K;  3G4A A;  3GTL C;  4X6A K;  1TWC C;  1IS1 A;  1VJE A;  1I50 C;  4BBS C;  1AB4 A;  2FQT A;  2CW0 A;  3S1N C;  4JK1 A;  1EQR A;  1R9T K;  5C3E K;  3T02 A;  1HI9 A;  4C3H C;  3S1R K;  3S1Q K;  5HL8 A;  1XZQ B;  3GTO K;  4G0V A;  4G7O A;  3TFH A;  3H0G C;  4XSZ A;  3OEP A;  2O5I A;  1WCM K;  4GTC A;  5IYB K;  2V6S A;  4BBR C;  5M5W K;  2PA8 D;  1K83 A;  4FZB A;  3GTQ A;  3HOZ K;  1Y1W K;  3HOY C;  2JA7 C;  4OIQ A;  1IQ0 A;  2YU9 K;  2B63 A;  3FKI C;  4GTB A;  4MEX A;  3GTJ C;  5FLM K;  3S16 C;  2E2H K;  1TWA K;  3K7A K;  3GTM K;  1J6X A;  5IYC C;  2V6T A;  3HXA A;  4C3J K;  4A3M C;  5IP7 C;  2VUM C;  1I3Q C;  4PAB A;  4A3F K;  1JVI A;  3T01 A;  4A3G K;  2NVX K;  2R92 A;  4KM9 A;  1C0A A;  4Y52 C;  1VRQ C;  5IYD K;  2A6E A;  3HKZ D;  3HOV K;  1WQH A;  4C3I K;  4AYB L;  3CQZ A;  4BLA A;  5C44 K;  4X6A C;  5TMC A;  3RZD C;  3S17 K;  3MML B;  5EGE A;  3PO3 K;  1YNN A;  4BXX K;  1F7U A;  5IP9 K;  5L46 A;  4KAS A;  4P5A A;  2JA5 K; 
#chains in the Genus database with same CATH homology
 1TWG K;  1R9T C;  4XLN A;  5C3E C;  2NVQ C;  4Q4Z A;  5TMF A;  3RZD K;  4A3I C;  3PO2 C;  3S1R C;  3CQZ C;  4AYB D;  2NVT C;  3GTJ K;  1K83 K;  2WB1 L;  3S16 K;  4Y7N K;  3GTO C;  2B63 C;  3HOX K;  5IYC K;  1I6H C;  4KN7 A;  3EQL A;  1IW7 A;  3H3V D;  3GTP C;  4A3M K;  2Y0S D;  5IP7 K;  2E2I C;  2VUM K;  4LK0 A;  1I3Q K;  1WCM C;  2WAQ D;  5IYB C;  4BY7 K;  2B63 K;  4G7Z A;  3HOZ C;  1Y1W C;  4A3L C;  1Y1V C;  3M3Y C;  2WB1 D;  4QJV B;  4A3K K;  4Y52 K;  4LLG A;  3S14 K;  3HOW C;  5FJ8 K;  3S2D K;  2R92 C;  2E2J C;  3RZO K;  4OIP A;  4MEY A;  3GTL C;  4NOI A;  4ZH4 A;  4BY1 C;  2PMZ L;  2YU9 C;  4A3D C;  4GZY A;  2O5J A;  1SFO C;  3I4N K;  4X6A K;  4KN4 A;  4LK1 A;  1TWC C;  4YFK A;  3S1Q C;  4XSX A;  5FLM C;  4QJV A;  1HQM A;  2E2H C;  3GTQ K;  1TWA C;  3GTM C;  3GTK K;  5C4X K;  4YG2 A;  1TWH K;  2E2J K;  1I50 C;  1TWF C;  1ZYR A;  4BBS C;  3HOU K;  2CW0 A;  4A3J K;  2NVQ K;  3I4M K;  3S1N C;  5D4D A;  4JK1 A;  1R9T K;  5C3E K;  4QIW D;  5C4J C;  4A3I K;  3PO2 K;  3S1R K;  4A3C C;  3CQZ K;  4A93 C;  3S1Q K;  2NVT K;  3GTO K;  4A3G C;  2NVX C;  1XPP A;  2PPB A;  4G7O A;  2NVY C;  3S2H C;  1I6H K;  5IYD C;  3H0G C;  4XSZ A;  3HOV C;  3GTP K;  4XLP A;  2E2I K;  4QIW L;  2JA6 C;  1I6V A;  1YNJ A;  1WCM K;  2O5I A;  2R7Z K;  5IYB K;  5C44 C;  4BBR C;  5M5W K;  4A3E C;  2JA8 C;  2PA8 D;  2A69 A;  3S17 C;  5M5X K;  3HOZ K;  4OIO A;  1Y1W K;  4A3L K;  3PO3 C;  1Y1V K;  3M3Y K;  3S15 C;  4BXX C;  3K7A C;  3HOW K;  4KMU A;  2A6H A;  2R92 K;  3GTL K;  5IP9 C;  4A3B C;  3HOY C;  1SMY A;  2JA7 C;  4OIQ A;  2BE5 A;  4BY1 K;  2JA5 C;  1TWG C;  2YU9 K;  4OIR A;  2R7Z C;  4BBR K;  3GTG C;  3S1M C;  4MQ9 A;  1SFO K;  4A3D K;  4G7H A;  2PA8 L;  3I4M C;  1TWC K;  3FKI C;  4A3F C;  4MEX A;  3GTJ C;  5FLM K;  3S16 C;  4Y7N C;  4YFX A;  2E2H K;  1TWA K;  3K7A K;  3GTM K;  3HOX C;  5IYC C;  2A68 A;  4Q5S A;  1I50 K;  1TWF K;  4BBS K;  3M4O C;  3S1N K;  4A3M C;  4C3J K;  5IP7 C;  2VUM C;  4LJZ A;  1I3Q C;  1BDF A;  5C4J K;  4C3H K;  4A3C K;  3FKI K;  4A3F K;  4A93 K;  4BY7 C;  4A3G K;  2NVX K;  4OIN A;  4A3K C;  4Y52 C;  2NVY K;  3S2H K;  3M4O K;  3S14 C;  3H0G K;  2A6E A;  4C2M K;  3S2D C;  5IYD K;  3HKZ D;  3HOV K;  3RZO C;  4YFN A;  2R93 C;  2PMZ D;  2JA6 K;  4C3I K;  5M3M K;  5M5Y K;  4AYB L;  5M3F K;  4A3E K;  5C44 K;  3I4N C;  4X6A C;  5TMC A;  3RZD C;  2JA8 K;  3S17 K;  3DXJ A;  3PO3 K;  1K83 C;  1YNN A;  3S15 K;  3GTQ C;  3WOD A;  3GTK C;  4BXX K;  5C4X C;  1TWH C;  3HKZ L;  3H3V L;  2Y0S L;  2R93 K;  5IP9 K;  4A3B K;  3HOU C;  4A3J C;  3HOY K;  2WAQ L;  2JA7 K;  3GTG K;  3S1M K;  2JA5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...