1R9TK

Rna polymerase ii strand separated elongation complex, mismatched nucleotide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA strand
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 21
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2003-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1r9tK00
4A3FC 1TWCK 3M3YK 1R9TC 4ZH4A 2E2JK 5TMFA 5C4JC 4A3CK 2CW0A 3RZOK 2NVTC 5C4XC 4YFXA 4A3KK 3S14K 1XPPA 2R7ZC 4A3FK 4A93K 2JA8C 4QJVB 5M5WK 1R9TK 1SFOC 2PPBA 2B63C 4Y7NK 3PO2K 3HOVC 4A3DC 5C4XK 3RZDC 1SMYA 2E2HK 2A6HA 5M3FK 4BY7K 1I3QK 2NVQC 2WB1D 4BBRK 4Q5SA 4A3JC 1K83K 3S17C 3HOYK 1IW7A 3M4OC 3GTKC 4QIWD 2R93C 4A3IC 5IYDK 4Y52C 4LK0A 3K7AC 5C3EC 1Y1WC 5FJ8K 3M3YC 1TWCC 1I6VA 2E2JC 4X6AK 4LJZA 4QJVA 4A3CC 3RZOC 3S17K 1TWFK 2Y0SL 1I50C 1YNJA 1BDFA 3S1QK 2PA8L 4A3KC 3S14C 2PMZL 4BXXK 4A93C 5IP7K 5M5YK 3PO2C 4Y7NC 3H3VL 1I50K 4A3MK 2WAQD 3GTLC 1TWHK 4XSZA 4AYBL 2E2HC 4OIQA 1I3QC 4BY7C 5IYBK 4BBRC 3GTGK 1K83C 2E2IC 2JA6K 3I4NK 3HOYC 4LK1A 5TMCA 3GTJK 5IYDC 3GTLK 3HOUK 3GTOK 3EQLA 3H0GK 4X6AC 2E2IK 1TWGC 1TWFC 3HKZD 3HOXC 3S1RK 4A3GK 3S1QC 4MQ9A 3S16K 4C3HK 4BXXC 5IP7C 3S2DK 2A6EA 4A3EK 1TWGK 3HOXK 5C44K 4G7HA 4BY1K 4A3MC 4A3BK 1TWHC 2JA5K 3GTMK 5IYCK 2VUMK 5IYBC 2NVYK 3GTGC 2JA6C 3I4MK 3I4NC 4OINA 4BBSK 1YNNA 4KN4A 3GTJC 3S15K 3S1MK 3HOUC 3GTOC 1TWAK 3WODA 3H0GC 2YU9K 2WB1L 5IP9K 4XLPA 3S1RC 5FLMK 4GZYA 4A3GC 3HOZK 3S16C 3CQZK 4KMUA 3GTQK 4YFNA 2NVXK 3HOWK 4A3EC 3S2DC 4A3LK 2A68A 2O5JA 5C44C 1Y1WK 4BY1C 4A3BC 4Q4ZA 3DXJA 3GTPK 1HQMA 2JA5C 3GTMC 2JA7C 4NOIA 5IYCC 2R92K 2VUMC 3S1NK 1Y1VK 2NVYC 2Y0SD 3I4MC 3PO3K 1ZYRA 4LLGA 4BBSC 2PA8D 3S15C 3S1MC 4XSXA 2PMZD 2JA7K 3S2HC 4YG2A 1TWAC 3FKIK 2WAQL 2YU9C 3H3VD 1I6HK 2BE5A 4KN7A 5D4DA 4C2MK 1WCMC 5IP9C 4OIPA 4AYBD 4C3JK 4JK1A 5FLMC 4XLNA 5C4JK 4OIRA 2O5IA 2NVTK 3HOZC 4G7ZA 3S2HK 3CQZC 4YFKA 4G7OA 4MEXA 3GTQC 2R7ZK 2NVXC 3HOWC 2JA8K 4MEYA 1WCMK 1SFOK 4A3LC 2A69A 2B63K 3GTPC 3HOVK 4A3DK 3RZDK 3HKZL 2R92C 4C3IK 4QIWL 5M5XK 1Y1VC 3S1NC 2NVQK 4A3JK 3PO3C 5M3MK 3M4OK 4OIOA 3GTKK 2R93K 4A3IK 4Y52K 3K7AK 3FKIC 5C3EK 1I6HC
chains in the Genus database with same CATH superfamily
4ZH4A 1EK8A 2W7VA 4YFXA 1TWHA 3NUHA 4GFQA 2JA8C 4QJVB 5M5WK 1DD5A 3PO2K 2B63C 4KMHA 4O2DA 2E2HK 4LQYA 2PHCB 3G4CA 4A3JC 1K83K 5L46A 4QIWD 3N0CA 5C3EC 3BP3A 1Y1WC 1TWCC 2E2JC 3SZZA 1Y1VA 3ADAC 4LJZA 2Y0SL 1PJ5A 1BDFA 2XCRB 4M1XA 4BKWA 1IBAA 3A8JA 4KARA 4WILA 5IOQA 4KATA 5M5YK 3H3VL 1O25A 2JA6K 3I4NK 1WCMA 3GTJK 1JQWA 3GSIA 3GTOK 1O2BA 3EQLA 1XZQA 2NVXA 3HKZD 1EQRA 4A3GK 3S1QC 3S16K 1EFWA 3CAGA 5IP7C 3AD8C 4A3MC 3GTMK 1DCPA 4FM9A 5IYBC 1VRQC 2WB1L 1EH1A 4PABA 4GZYA 1O29A 3CQZK 4KMUA 3GTQK 3S2DC 4A3EC 2O5JA 5C44C 4A3BC 4Q4ZA 1HQMA 3AD7C 1BJTA 5IYCC 2VUMC 3S1NK 1Y1WA 1TWCA 2RGRA 4LLGA 4G0WA 3S15C 2ZUEA 4YG2A 1TWAC 3L4JA 4XLNA 4AYBD 1USMA 3HOZC 4BLBA 3GTJA 3FOEA 1O28A 2R7ZK 4MEYA 4A3LC 4C45A 3GTPC 2CFAB 2GAHC 1Y1VC 4PAAA 3AQPA 3GEEA 3PO3C 2XCQA 3AQOA 4GTLA 2R93K 3FKIC 1R9TC 1VGXA 4ILDA 2CW0A 4P5BA 5C4XC 1ZVUA 1R9TK 4Y7NK 3HOVC 4A3DC 1IE0A 5C4XK 5M3FK 4C3IC 4BY7K 1YX2A 2NVQC 3CQZA 4BBRK 4GTFA 5EGHA 3Q3QA 1IW7A 1XXCA 2P5MA 5IYDK 4Y52C 3HXAA 1F93A 5FJ8K 1I6VA 3LPXA 1DCHA 1TWFK 1WQFA 4GTDA 2PA8L 2EBBA 2PMZL 4BXXK 2VUMA 1XZQB 3PO2C 2JH3A 1V5VA 4XSZA 2E2HC 2CFAA 4OIQA 1TWAA 1DCOA 3GTGK 2R7ZA 1K83C 4KMDA 3HOUK 2GSUA 1J6WA 3G4AA 4GTCA 1TWGC 5IOSA 4MQ9A 3GTPA 4C3HK 1INNA 2A6EA 1TWGK 4G7HA 4BY1K 3T00A 2JA5K 3FKIA 1XXAA 2JA6C 3I4MK 1WQHA 1R9TA 4OINA 1YNNA 3I4NC 3GTJC 3S1MK 1F9NA 3GTOC 3WODA 2YU9K 2FQTA 3OPFA 4XCHA 5FLMK 4A3GC 3S16C 1EI6A 4KAWX 5CHPA 3HOWK 2A68A 4G0UA 1TWFA 3GTMC 2JA7C 4NOIA 2R92K 1PJ7A 2Y0SD 3T01A 1ZYRA 4XSXA 2JA7K 2WAQL 3H3VD 2BE5A 1KQ4A 4C2MK 5C4JK 3GTGA 4JK1A 2GSNA 2NVTK 3TFHA 1O26A 3CQZC 4G7OA 2E2HA 4MEXA 3GTQC 3JSTA 1SFOK 2A69A 1K83A 4WJ3M 3RZDK 3S1NC 5M5XK 4G0VA 1XZPA 5M3MK 1TWGA 3M4OK 3GTKK 4A3IK 3QX3A 3K7AK 2JA5A 1X31C 3M3YK 2V6UA 3IPJA 4A3CK 3BUEA 3RZOK 1G51A 4A3KK 3S14K 2R7ZC 3V4GA 1PJ6A 4A93K 4KASA 3L4KA 2PPBA 1IS1A 2JA6A 4P5AA 1SMYA 2A6HA 1I3QK 2WB1D 3GTOA 3S17C 1J6VA 3HOYK 3GEHA 2R93C 4X6AK 1O2AA 3S17K 1VH2A 4RMFA 3GTMA 2JA7A 4Y7NC 1TWHK 4BY7C 1O2FB 3OREA 4BBRC 2E2IC 4LK1A 5TMCA 5IYDC 4LR2A 3H0GK 3GTQA 2E2IK 3HOXC 1TWFC 3S1RK 5HL8A 1ISEA 4BXXC 4P9SA 3HOXK 1BS2A 2NVYK 3GTGC 1IL2A 3N0BA 4BBSK 3HOUC 4FZBA 1B4BA 2FQOA 5IP9K 1XXBA 4C3HC 5TJ3A 1WSVA 3TFIA 2NVXK 1JOEA 4BY1C 3SZYA 1WIHA 2XCOA 2JA5C 2R93A 1F7VA 1ZBSA 3I4MC 4C3JC 2PA8D 3S1MC 2PMZD 1O27A 2YU9C 1I6HK 4KN7A 5D4DA 3LAJA 1XZPB 4C3JK 5FLMC 4OIRA 4G7ZA 4LOWA 4YFKA 1C0AA 3HOWC 2JA8K 1J98A 3H0GA 1J6XA 2B63K 2E2IA 4KB4A 3HKZL 2R92C 1VJEA 4A3JK 1L0WA 3A8KA 3MMLB 5CJ9A 4DDQA 4KM8A 3N3YA 5C3EK 1Y1WK 3FOFA 4A3FC 1TWCK 2V6SA 2E2JK 4C2MC 5TMFA 2NVYA 5C4JC 2GSOA 1WSRA 2NVTC 3LAPA 1XPPA 4A3FK 1SFOC 3VA7A 3BP8C 3A8IA 3OEPA 3RZDC 1GE9A 4GT9A 4Q5SA 3M4OC 3GTKC 4A3IC 4LK0A 3K7AC 3GIRA 3M3YC 1AB4A 4QJVA 4A3CC 4GTBA 3RZOC 4GTAA 1I50C 4AH6A 1YNJA 3S1QK 3T02A 4A3KC 3S14C 5JFEA 4A93C 2V6TA 5IP7K 5JVOA 1I50K 3TFJA 2WAQD 1WORA 1USOA 3GDZA 1IQ0A 1ZXOA 4AYBL 4A3MK 3GTLC 1VLOA 1I3QC 1WOOA 5IYBK 2YU9A 3HOYC 2B63A 3GTLK 3AH5A 2D6FC 1BGWA 3TTGA 1O24A 2Y3PA 4X6AC 4J3NA 3GEIA 2R92A 5E68A 3S2DK 4A3EK 5C44K 2ZUFA 1JVIA 1WOSA 4A3BK 1TWHC 5IYCK 2VUMK 5IOTA 1RU0A 3ERED 2ZFZA 4KN4A 1HI9A 3S15K 1ZQ1C 2KWAA 1TWAK 3H0GC 2P8TA 4WJ4A 5IORA 4XLPA 3S1RC 1SFOA 3HOZK 1WQGA 4YFNA 4KDDA 4A3LK 3DXJA 3GTPK 3GTKA 4KM9A 1Y1VK 2NVYC 4BLAA 3PO3K 4BBSC 4GTEA 2RH6A 1I50A 3S2HC 4KC6A 3FKIK 2GAGC 1WCMC 5IP9C 4OIPA 3S0XA 1F7UA 3AD9C 2O5IA 3S2HK 3GTLA 1UV7A 1I3QA 2NVXC 1WCMK 1YCLA 1B4AA 3HOVK 4A3DK 1WOPA 4KB2A 4C3IK 4QIWL 2NVQK 5EGEA 4KMAA 4OIOA 3FHZA 4Y52K 1I6HC
chains in the Genus database with same CATH topology
4A3FC 1TWCK 3M3YK 1R9TC 4ZH4A 2E2JK 5TMFA 5C4JC 4A3CK 2CW0A 3RZOK 2NVTC 5C4XC 4YFXA 4A3KK 3S14K 1XPPA 2R7ZC 4A3FK 4A93K 2JA8C 4QJVB 5M5WK 1R9TK 1SFOC 2PPBA 2B63C 4Y7NK 3PO2K 3HOVC 4A3DC 5C4XK 3RZDC 1SMYA 2E2HK 2A6HA 5M3FK 4BY7K 1I3QK 2NVQC 2WB1D 4BBRK 4Q5SA 4A3JC 1K83K 3S17C 3HOYK 1IW7A 3M4OC 3GTKC 4QIWD 2R93C 4A3IC 5IYDK 4Y52C 4LK0A 3K7AC 5C3EC 1Y1WC 5FJ8K 3M3YC 1TWCC 1I6VA 2E2JC 4X6AK 4LJZA 4QJVA 4A3CC 3RZOC 3S17K 1TWFK 2Y0SL 1I50C 1YNJA 1BDFA 3S1QK 2PA8L 4A3KC 3S14C 2PMZL 4BXXK 4A93C 5IP7K 5M5YK 3PO2C 4Y7NC 3H3VL 1I50K 4A3MK 2WAQD 3GTLC 1TWHK 4XSZA 4AYBL 2E2HC 4OIQA 1I3QC 4BY7C 5IYBK 4BBRC 3GTGK 1K83C 2E2IC 2JA6K 3I4NK 3HOYC 4LK1A 5TMCA 3GTJK 5IYDC 3GTLK 3HOUK 3GTOK 3EQLA 3H0GK 4X6AC 2E2IK 1TWGC 1TWFC 3HKZD 3HOXC 3S1RK 4A3GK 3S1QC 4MQ9A 3S16K 4C3HK 4BXXC 5IP7C 3S2DK 2A6EA 4A3EK 1TWGK 3HOXK 5C44K 4G7HA 4BY1K 4A3MC 4A3BK 1TWHC 2JA5K 3GTMK 5IYCK 2VUMK 5IYBC 2NVYK 3GTGC 2JA6C 3I4MK 3I4NC 4OINA 4BBSK 1YNNA 4KN4A 3GTJC 3S15K 3S1MK 3HOUC 3GTOC 1TWAK 3WODA 3H0GC 2YU9K 2WB1L 5IP9K 4XLPA 3S1RC 5FLMK 4GZYA 4A3GC 3HOZK 3S16C 3CQZK 4KMUA 3GTQK 4YFNA 2NVXK 3HOWK 4A3EC 3S2DC 4A3LK 2A68A 2O5JA 5C44C 1Y1WK 4BY1C 4A3BC 4Q4ZA 3DXJA 3GTPK 1HQMA 2JA5C 3GTMC 2JA7C 4NOIA 5IYCC 2R92K 2VUMC 3S1NK 1Y1VK 2NVYC 2Y0SD 3I4MC 3PO3K 1ZYRA 4LLGA 4BBSC 2PA8D 3S15C 3S1MC 4XSXA 2PMZD 2JA7K 3S2HC 4YG2A 1TWAC 3FKIK 2WAQL 2YU9C 3H3VD 1I6HK 2BE5A 4KN7A 5D4DA 4C2MK 1WCMC 5IP9C 4OIPA 4AYBD 4C3JK 4JK1A 5FLMC 4XLNA 5C4JK 4OIRA 2O5IA 2NVTK 3HOZC 4G7ZA 3S2HK 3CQZC 4YFKA 4G7OA 4MEXA 3GTQC 2R7ZK 2NVXC 3HOWC 2JA8K 4MEYA 1WCMK 1SFOK 4A3LC 2A69A 2B63K 3GTPC 3HOVK 4A3DK 3RZDK 3HKZL 2R92C 4C3IK 4QIWL 5M5XK 1Y1VC 3S1NC 2NVQK 4A3JK 3PO3C 5M3MK 3M4OK 4OIOA 3GTKK 2R93K 4A3IK 4Y52K 3K7AK 3FKIC 5C3EK 1I6HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3F C;  1TWC K;  3M3Y K;  1R9T C;  4ZH4 A;  2E2J K;  5TMF A;  5C4J C;  4A3C K;  2CW0 A;  3RZO K;  2NVT C;  5C4X C;  4YFX A;  4A3K K;  3S14 K;  1XPP A;  2R7Z C;  4A3F K;  4A93 K;  2JA8 C;  4QJV B;  5M5W K;  1R9T K;  1SFO C;  2PPB A;  2B63 C;  4Y7N K;  3PO2 K;  3HOV C;  4A3D C;  5C4X K;  3RZD C;  1SMY A;  2E2H K;  2A6H A;  5M3F K;  4BY7 K;  1I3Q K;  2NVQ C;  2WB1 D;  4BBR K;  4Q5S A;  4A3J C;  1K83 K;  3S17 C;  3HOY K;  1IW7 A;  3M4O C;  3GTK C;  4QIW D;  2R93 C;  4A3I C;  5IYD K;  4Y52 C;  4LK0 A;  3K7A C;  5C3E C;  1Y1W C;  5FJ8 K;  3M3Y C;  1TWC C;  1I6V A;  2E2J C;  4X6A K;  4LJZ A;  4QJV A;  4A3C C;  3RZO C;  3S17 K;  1TWF K;  2Y0S L;  1I50 C;  1YNJ A;  1BDF A;  3S1Q K;  2PA8 L;  4A3K C;  3S14 C;  2PMZ L;  4BXX K;  4A93 C;  5IP7 K;  5M5Y K;  3PO2 C;  4Y7N C;  3H3V L;  1I50 K;  4A3M K;  2WAQ D;  3GTL C;  1TWH K;  4XSZ A;  4AYB L;  2E2H C;  4OIQ A;  1I3Q C;  4BY7 C;  5IYB K;  4BBR C;  3GTG K;  1K83 C;  2E2I C;  2JA6 K;  3I4N K;  3HOY C;  4LK1 A;  5TMC A;  3GTJ K;  5IYD C;  3GTL K;  3HOU K;  3GTO K;  3EQL A;  3H0G K;  4X6A C;  2E2I K;  1TWG C;  1TWF C;  3HKZ D;  3HOX C;  3S1R K;  4A3G K;  3S1Q C;  4MQ9 A;  3S16 K;  4C3H K;  4BXX C;  5IP7 C;  3S2D K;  2A6E A;  4A3E K;  1TWG K;  3HOX K;  5C44 K;  4G7H A;  4BY1 K;  4A3M C;  4A3B K;  1TWH C;  2JA5 K;  3GTM K;  5IYC K;  2VUM K;  5IYB C;  2NVY K;  3GTG C;  2JA6 C;  3I4M K;  3I4N C;  4OIN A;  4BBS K;  1YNN A;  4KN4 A;  3GTJ C;  3S15 K;  3S1M K;  3HOU C;  3GTO C;  1TWA K;  3WOD A;  3H0G C;  2YU9 K;  2WB1 L;  5IP9 K;  4XLP A;  3S1R C;  5FLM K;  4GZY A;  4A3G C;  3HOZ K;  3S16 C;  3CQZ K;  4KMU A;  3GTQ K;  4YFN A;  2NVX K;  3HOW K;  4A3E C;  3S2D C;  4A3L K;  2A68 A;  2O5J A;  5C44 C;  1Y1W K;  4BY1 C;  4A3B C;  4Q4Z A;  3DXJ A;  3GTP K;  1HQM A;  2JA5 C;  3GTM C;  2JA7 C;  4NOI A;  5IYC C;  2R92 K;  2VUM C;  3S1N K;  1Y1V K;  2NVY C;  2Y0S D;  3I4M C;  3PO3 K;  1ZYR A;  4LLG A;  4BBS C;  2PA8 D;  3S15 C;  3S1M C;  4XSX A;  2PMZ D;  2JA7 K;  3S2H C;  4YG2 A;  1TWA C;  3FKI K;  2WAQ L;  2YU9 C;  3H3V D;  1I6H K;  2BE5 A;  4KN7 A;  5D4D A;  4C2M K;  1WCM C;  5IP9 C;  4OIP A;  4AYB D;  4C3J K;  4JK1 A;  5FLM C;  4XLN A;  5C4J K;  4OIR A;  2O5I A;  2NVT K;  3HOZ C;  4G7Z A;  3S2H K;  3CQZ C;  4YFK A;  4G7O A;  4MEX A;  3GTQ C;  2R7Z K;  2NVX C;  3HOW C;  2JA8 K;  4MEY A;  1WCM K;  1SFO K;  4A3L C;  2A69 A;  2B63 K;  3GTP C;  3HOV K;  4A3D K;  3RZD K;  3HKZ L;  2R92 C;  4C3I K;  4QIW L;  5M5X K;  1Y1V C;  3S1N C;  2NVQ K;  4A3J K;  3PO3 C;  5M3M K;  3M4O K;  4OIO A;  3GTK K;  2R93 K;  4A3I K;  4Y52 K;  3K7A K;  3FKI C;  5C3E K;  1I6H C; 
#chains in the Genus database with same CATH topology
 4ZH4 A;  1EK8 A;  2W7V A;  4YFX A;  1TWH A;  3NUH A;  4GFQ A;  2JA8 C;  4QJV B;  5M5W K;  1DD5 A;  3PO2 K;  2B63 C;  4KMH A;  4O2D A;  2E2H K;  4LQY A;  2PHC B;  3G4C A;  4A3J C;  1K83 K;  5L46 A;  4QIW D;  3N0C A;  5C3E C;  3BP3 A;  1Y1W C;  1TWC C;  2E2J C;  3SZZ A;  1Y1V A;  3ADA C;  4LJZ A;  2Y0S L;  1PJ5 A;  1BDF A;  2XCR B;  4M1X A;  4BKW A;  1IBA A;  3A8J A;  4KAR A;  4WIL A;  5IOQ A;  4KAT A;  5M5Y K;  3H3V L;  1O25 A;  2JA6 K;  3I4N K;  1WCM A;  3GTJ K;  1JQW A;  3GSI A;  3GTO K;  1O2B A;  3EQL A;  1XZQ A;  2NVX A;  3HKZ D;  1EQR A;  4A3G K;  3S1Q C;  3S16 K;  1EFW A;  3CAG A;  5IP7 C;  3AD8 C;  4A3M C;  3GTM K;  1DCP A;  4FM9 A;  5IYB C;  1VRQ C;  2WB1 L;  1EH1 A;  4PAB A;  4GZY A;  1O29 A;  3CQZ K;  4KMU A;  3GTQ K;  3S2D C;  4A3E C;  2O5J A;  5C44 C;  4A3B C;  4Q4Z A;  1HQM A;  3AD7 C;  1BJT A;  5IYC C;  2VUM C;  3S1N K;  1Y1W A;  1TWC A;  2RGR A;  4LLG A;  4G0W A;  3S15 C;  2ZUE A;  4YG2 A;  1TWA C;  3L4J A;  4XLN A;  4AYB D;  1USM A;  3HOZ C;  4BLB A;  3GTJ A;  3FOE A;  1O28 A;  2R7Z K;  4MEY A;  4A3L C;  4C45 A;  3GTP C;  2CFA B;  2GAH C;  1Y1V C;  4PAA A;  3AQP A;  3GEE A;  3PO3 C;  2XCQ A;  3AQO A;  4GTL A;  2R93 K;  3FKI C;  1R9T C;  1VGX A;  4ILD A;  2CW0 A;  4P5B A;  5C4X C;  1ZVU A;  1R9T K;  4Y7N K;  3HOV C;  4A3D C;  1IE0 A;  5C4X K;  5M3F K;  4C3I C;  4BY7 K;  1YX2 A;  2NVQ C;  3CQZ A;  4BBR K;  4GTF A;  5EGH A;  3Q3Q A;  1IW7 A;  1XXC A;  2P5M A;  5IYD K;  4Y52 C;  3HXA A;  1F93 A;  5FJ8 K;  1I6V A;  3LPX A;  1DCH A;  1TWF K;  1WQF A;  4GTD A;  2PA8 L;  2EBB A;  2PMZ L;  4BXX K;  2VUM A;  1XZQ B;  3PO2 C;  2JH3 A;  1V5V A;  4XSZ A;  2E2H C;  2CFA A;  4OIQ A;  1TWA A;  1DCO A;  3GTG K;  2R7Z A;  1K83 C;  4KMD A;  3HOU K;  2GSU A;  1J6W A;  3G4A A;  4GTC A;  1TWG C;  5IOS A;  4MQ9 A;  3GTP A;  4C3H K;  1INN A;  2A6E A;  1TWG K;  4G7H A;  4BY1 K;  3T00 A;  2JA5 K;  3FKI A;  1XXA A;  2JA6 C;  3I4M K;  1WQH A;  1R9T A;  4OIN A;  1YNN A;  3I4N C;  3GTJ C;  3S1M K;  1F9N A;  3GTO C;  3WOD A;  2YU9 K;  2FQT A;  3OPF A;  4XCH A;  5FLM K;  4A3G C;  3S16 C;  1EI6 A;  4KAW X;  5CHP A;  3HOW K;  2A68 A;  4G0U A;  1TWF A;  3GTM C;  2JA7 C;  4NOI A;  2R92 K;  1PJ7 A;  2Y0S D;  3T01 A;  1ZYR A;  4XSX A;  2JA7 K;  2WAQ L;  3H3V D;  2BE5 A;  1KQ4 A;  4C2M K;  5C4J K;  3GTG A;  4JK1 A;  2GSN A;  2NVT K;  3TFH A;  1O26 A;  3CQZ C;  4G7O A;  2E2H A;  4MEX A;  3GTQ C;  3JST A;  1SFO K;  2A69 A;  1K83 A;  4WJ3 M;  3RZD K;  3S1N C;  5M5X K;  4G0V A;  1XZP A;  5M3M K;  1TWG A;  3M4O K;  3GTK K;  4A3I K;  3QX3 A;  3K7A K;  2JA5 A;  1X31 C;  3M3Y K;  2V6U A;  3IPJ A;  4A3C K;  3BUE A;  3RZO K;  1G51 A;  4A3K K;  3S14 K;  2R7Z C;  3V4G A;  1PJ6 A;  4A93 K;  4KAS A;  3L4K A;  2PPB A;  1IS1 A;  2JA6 A;  4P5A A;  1SMY A;  2A6H A;  1I3Q K;  2WB1 D;  3GTO A;  3S17 C;  1J6V A;  3HOY K;  3GEH A;  2R93 C;  4X6A K;  1O2A A;  3S17 K;  1VH2 A;  4RMF A;  3GTM A;  2JA7 A;  4Y7N C;  1TWH K;  4BY7 C;  1O2F B;  3ORE A;  4BBR C;  2E2I C;  4LK1 A;  5TMC A;  5IYD C;  4LR2 A;  3H0G K;  3GTQ A;  2E2I K;  3HOX C;  1TWF C;  3S1R K;  5HL8 A;  1ISE A;  4BXX C;  4P9S A;  3HOX K;  1BS2 A;  2NVY K;  3GTG C;  1IL2 A;  3N0B A;  4BBS K;  3HOU C;  4FZB A;  1B4B A;  2FQO A;  5IP9 K;  1XXB A;  4C3H C;  5TJ3 A;  1WSV A;  3TFI A;  2NVX K;  1JOE A;  4BY1 C;  3SZY A;  1WIH A;  2XCO A;  2JA5 C;  2R93 A;  1F7V A;  1ZBS A;  3I4M C;  4C3J C;  2PA8 D;  3S1M C;  2PMZ D;  1O27 A;  2YU9 C;  1I6H K;  4KN7 A;  5D4D A;  3LAJ A;  1XZP B;  4C3J K;  5FLM C;  4OIR A;  4G7Z A;  4LOW A;  4YFK A;  1C0A A;  3HOW C;  2JA8 K;  1J98 A;  3H0G A;  1J6X A;  2B63 K;  2E2I A;  4KB4 A;  3HKZ L;  2R92 C;  1VJE A;  4A3J K;  1L0W A;  3A8K A;  3MML B;  5CJ9 A;  4DDQ A;  4KM8 A;  3N3Y A;  5C3E K;  1Y1W K;  3FOF A;  4A3F C;  1TWC K;  2V6S A;  2E2J K;  4C2M C;  5TMF A;  2NVY A;  5C4J C;  2GSO A;  1WSR A;  2NVT C;  3LAP A;  1XPP A;  4A3F K;  1SFO C;  3VA7 A;  3BP8 C;  3A8I A;  3OEP A;  3RZD C;  1GE9 A;  4GT9 A;  4Q5S A;  3M4O C;  3GTK C;  4A3I C;  4LK0 A;  3K7A C;  3GIR A;  3M3Y C;  1AB4 A;  4QJV A;  4A3C C;  4GTB A;  3RZO C;  4GTA A;  1I50 C;  4AH6 A;  1YNJ A;  3S1Q K;  3T02 A;  4A3K C;  3S14 C;  5JFE A;  4A93 C;  2V6T A;  5IP7 K;  5JVO A;  1I50 K;  3TFJ A;  2WAQ D;  1WOR A;  1USO A;  3GDZ A;  1IQ0 A;  1ZXO A;  4AYB L;  4A3M K;  3GTL C;  1VLO A;  1I3Q C;  1WOO A;  5IYB K;  2YU9 A;  3HOY C;  2B63 A;  3GTL K;  3AH5 A;  2D6F C;  1BGW A;  3TTG A;  1O24 A;  2Y3P A;  4X6A C;  4J3N A;  3GEI A;  2R92 A;  5E68 A;  3S2D K;  4A3E K;  5C44 K;  2ZUF A;  1JVI A;  1WOS A;  4A3B K;  1TWH C;  5IYC K;  2VUM K;  5IOT A;  1RU0 A;  3ERE D;  2ZFZ A;  4KN4 A;  1HI9 A;  3S15 K;  1ZQ1 C;  2KWA A;  1TWA K;  3H0G C;  2P8T A;  4WJ4 A;  5IOR A;  4XLP A;  3S1R C;  1SFO A;  3HOZ K;  1WQG A;  4YFN A;  4KDD A;  4A3L K;  3DXJ A;  3GTP K;  3GTK A;  4KM9 A;  1Y1V K;  2NVY C;  4BLA A;  3PO3 K;  4BBS C;  4GTE A;  2RH6 A;  1I50 A;  3S2H C;  4KC6 A;  3FKI K;  2GAG C;  1WCM C;  5IP9 C;  4OIP A;  3S0X A;  1F7U A;  3AD9 C;  2O5I A;  3S2H K;  3GTL A;  1UV7 A;  1I3Q A;  2NVX C;  1WCM K;  1YCL A;  1B4A A;  3HOV K;  4A3D K;  1WOP A;  4KB2 A;  4C3I K;  4QIW L;  2NVQ K;  5EGE A;  4KMA A;  4OIO A;  3FHZ A;  4Y52 K;  1I6H C; 
#chains in the Genus database with same CATH homology
 4A3F C;  1TWC K;  3M3Y K;  1R9T C;  4ZH4 A;  2E2J K;  5TMF A;  5C4J C;  4A3C K;  2CW0 A;  3RZO K;  2NVT C;  5C4X C;  4YFX A;  4A3K K;  3S14 K;  1XPP A;  2R7Z C;  4A3F K;  4A93 K;  2JA8 C;  4QJV B;  5M5W K;  1R9T K;  1SFO C;  2PPB A;  2B63 C;  4Y7N K;  3PO2 K;  3HOV C;  4A3D C;  5C4X K;  3RZD C;  1SMY A;  2E2H K;  2A6H A;  5M3F K;  4BY7 K;  1I3Q K;  2NVQ C;  2WB1 D;  4BBR K;  4Q5S A;  4A3J C;  1K83 K;  3S17 C;  3HOY K;  1IW7 A;  3M4O C;  3GTK C;  4QIW D;  2R93 C;  4A3I C;  5IYD K;  4Y52 C;  4LK0 A;  3K7A C;  5C3E C;  1Y1W C;  5FJ8 K;  3M3Y C;  1TWC C;  1I6V A;  2E2J C;  4X6A K;  4LJZ A;  4QJV A;  4A3C C;  3RZO C;  3S17 K;  1TWF K;  2Y0S L;  1I50 C;  1YNJ A;  1BDF A;  3S1Q K;  2PA8 L;  4A3K C;  3S14 C;  2PMZ L;  4BXX K;  4A93 C;  5IP7 K;  5M5Y K;  3PO2 C;  4Y7N C;  3H3V L;  1I50 K;  4A3M K;  2WAQ D;  3GTL C;  1TWH K;  4XSZ A;  4AYB L;  2E2H C;  4OIQ A;  1I3Q C;  4BY7 C;  5IYB K;  4BBR C;  3GTG K;  1K83 C;  2E2I C;  2JA6 K;  3I4N K;  3HOY C;  4LK1 A;  5TMC A;  3GTJ K;  5IYD C;  3GTL K;  3HOU K;  3GTO K;  3EQL A;  3H0G K;  4X6A C;  2E2I K;  1TWG C;  1TWF C;  3HKZ D;  3HOX C;  3S1R K;  4A3G K;  3S1Q C;  4MQ9 A;  3S16 K;  4C3H K;  4BXX C;  5IP7 C;  3S2D K;  2A6E A;  4A3E K;  1TWG K;  3HOX K;  5C44 K;  4G7H A;  4BY1 K;  4A3M C;  4A3B K;  1TWH C;  2JA5 K;  3GTM K;  5IYC K;  2VUM K;  5IYB C;  2NVY K;  3GTG C;  2JA6 C;  3I4M K;  3I4N C;  4OIN A;  4BBS K;  1YNN A;  4KN4 A;  3GTJ C;  3S15 K;  3S1M K;  3HOU C;  3GTO C;  1TWA K;  3WOD A;  3H0G C;  2YU9 K;  2WB1 L;  5IP9 K;  4XLP A;  3S1R C;  5FLM K;  4GZY A;  4A3G C;  3HOZ K;  3S16 C;  3CQZ K;  4KMU A;  3GTQ K;  4YFN A;  2NVX K;  3HOW K;  4A3E C;  3S2D C;  4A3L K;  2A68 A;  2O5J A;  5C44 C;  1Y1W K;  4BY1 C;  4A3B C;  4Q4Z A;  3DXJ A;  3GTP K;  1HQM A;  2JA5 C;  3GTM C;  2JA7 C;  4NOI A;  5IYC C;  2R92 K;  2VUM C;  3S1N K;  1Y1V K;  2NVY C;  2Y0S D;  3I4M C;  3PO3 K;  1ZYR A;  4LLG A;  4BBS C;  2PA8 D;  3S15 C;  3S1M C;  4XSX A;  2PMZ D;  2JA7 K;  3S2H C;  4YG2 A;  1TWA C;  3FKI K;  2WAQ L;  2YU9 C;  3H3V D;  1I6H K;  2BE5 A;  4KN7 A;  5D4D A;  4C2M K;  1WCM C;  5IP9 C;  4OIP A;  4AYB D;  4C3J K;  4JK1 A;  5FLM C;  4XLN A;  5C4J K;  4OIR A;  2O5I A;  2NVT K;  3HOZ C;  4G7Z A;  3S2H K;  3CQZ C;  4YFK A;  4G7O A;  4MEX A;  3GTQ C;  2R7Z K;  2NVX C;  3HOW C;  2JA8 K;  4MEY A;  1WCM K;  1SFO K;  4A3L C;  2A69 A;  2B63 K;  3GTP C;  3HOV K;  4A3D K;  3RZD K;  3HKZ L;  2R92 C;  4C3I K;  4QIW L;  5M5X K;  1Y1V C;  3S1N C;  2NVQ K;  4A3J K;  3PO3 C;  5M3M K;  3M4O K;  4OIO A;  3GTK K;  2R93 K;  4A3I K;  4Y52 K;  3K7A K;  3FKI C;  5C3E K;  1I6H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...