1RA4A

Crystal structure of the methanococcus jannaschii l7ae protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
117
structure length
117
Chain Sequence
MAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L7Ae
publication title The crystal structure of the Methanocaldococcus jannaschii multifunctional L7Ae RNA-binding protein reveals an induced-fit interaction with the box C/D RNAs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Structural protein
total genus 36
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1ra4A00
3G71F 1VQMF 1YJ9F 1K8AH 4NUTA 1NJIH 1RLGA 2CZWA 3PAFA 1DT9A 3E1YA 3CC2F 1VQ8F 3SIVA 1VQ4F 1K73H 3NMUC 2BO1A 1M90H 1VQ9F 3FFMA 2AIFA 3I56F 2ALEA 1YITF 3LWOC 2QEXF 1VQ6F 2OZBA 1QVGF 2VGNA 3CMAF 2OHWA 3CCJF 2OTLF 5GINC 1GO0A 1W42A 2KTVA 3CCEF 1GO1A 3ON1A 3OW2F 3VMFB 3NK7A 1XBIA 5FLXM 1Q82H 2HVYD 3AGKA 3CC4F 3JCMM 1YJWF 4C4WC 1YI2F 1X7OA 2KG4A 1VQOF 1N8RH 2I6DA 2VGMA 3CCQF 3SIUA 1VQNF 3CG6A 3I55F 3J7AR 1W3EX 1Q86H 3V7EA 3N4YA 3J81M 3CCMF 2QA4F 1YIJF 3CD6F 4TZZA 3MCAB 3NK6A 1K9MH 1IPAA 3CCVF 3NVKE 2LBXA 3HJWC 2OTJF 5FJ4C 3LWRC 3HAXD 1W41A 2WALA 1KD1H 5G4VC 1CN7A 2KTUA 3RA5A 3PLAC 5IT9M 1M1KH 1Q7YH 1VQPF 1ZWZA 3IR9A 2LBWA 5GANK 1JJ2F 3O85A 1YJNF 1VQLF 3GYQA 3J80M 4BY9D 1VQ7F 1E7KA 3N4ZA 1H7MA 3OBWA 1YHQF 4BW0B 3G6EF 1Q81H 3LFOA 3CCLF 1S72F 1KQSF 1VQKF 3LWQC 3JAMM 1VQ5F 4X3LA 3CPQA 4X3MA 5G4UC 4LCKA 5GIPC 5EWRA 5GIOC 3RA6A 3E20B 1W40A 3G4SF 3CCRF 1GZ0A 1RA4A 1W2BF 3VI6A 1QVFF 3NVIB 3CCSF 3V7QA 1X7PA 2QI2A 5GAPK 1T0KB 1PXWA 3OBYA 1X52A 1CK2A 1SDSA 3CMEF 3LWVC 5DCVA 3CPWF 5A2QM 3WXMB 3CXCF 2JNBA 1KC8H 2FC3A 5EO3A 3CC7F 3CCUF 3LWPC 1NMUB
chains in the Genus database with same CATH superfamily
3P4EA 4TV8A 5J2TA 2L26A 1W5EA 3G71F 3C9RA 1RQ2A 1XV2A 1NJIH 4BVSA 4RQOA 2W8BC 3DDNA 3PAFA 2LBTA 5LYJB 2KGWA 3D01A 5JQGB 2CW4A 1DT9A 2VAWA 5KMGB 1VQ8F 2RHOA 4I4TB 5LA6B 2ZOVA 4O4JA 1K73H 3WGJA 2BO1A 5KX5A 3VOBA 3FFMA 5EB0A 4DRXB 1U43A 5CA1B 1YITF 3JARB 4TV8B 2FGYA 3WPWA 3DC2A 3VYUC 1QVGF 4G4VA 2OHWA 3HKCA 3D00A 5GINC 4C8GA 1U3PA 2KTVA 4O4JB 3V4DA 1IV2A 3LYBA 3WGLA 3WJQA 4F6RA 3F0GA 4ERHA 1SZQA 2ZAUA 3RYIA 5J2UA 2LCAA 2Z1TA 5LOVA 3V7EA 3HKCB 1PF5A 2QA4F 4B45A 2Z1UA 1COMA 3NK6A 4F6RB 3T80A 2WALA 5G4VC 3U0OA 5EAZA 3HKDB 3RYIB 2KTUA 3RA5A 3WGMA 3MQWA 3PLAC 3JALA 5IT9M 1JD1A 3GHZA 3Q8HA 1UFYA 2RHJA 3IKEA 4ZI7A 3C9TA 1W581 3GYQA 4BY9D 4O2BB 3CYPB 1IV1A 3P0ZA 5ITZB 1RLUA 1VQ7F 1X25A 4PWTA 4G4YA 1S72F 1Z5WA 3CB2A 3RE3A 2ZF8A 2DYYA 1VH8A 2K1SA 1VQ5F 4G4WA 4IIJB 5GONB 4BT6A 5GIPC 5EWRA 4ZHQB 5GIOC 3ERNA 3P10A 2Z01A 5EYPA 1W40A 4ZOLA 4ZI7B 1W2BF 3FD6A 2Z1FA 4ZK7A 3C8LA 3RYHB 1VHAA 2NMUA 1U3LA 2QI2A 4TV9A 1T0KB 3OBYA 1X52A 3ZP4A 4BT5A 3ZO8A 1JN1A 3QHDA 5C8YB 3LWVC 3IMPA 5A2QM 3WXMB 3CXCF 2HP0B 2HRUA 2IG8A 2JNBA 3LDTA 4U39A 3VOAA 5EYPB 1XHOA 3VIUA 3LWPC 3TD3A 3ZOPA 1NMUB 3L7QA 4U3JA 4EB6B 1FNJA 4X1KA 2UYKA 1RLGA 2HX0A 2H8EA 5CA0A 3E1YA 4ZHWA 3SIVA 2YXZA 2GZLA 1VQ9F 3F0EA 5LYJA 5JQGA 1FFXA 2AMTA 2AIFA 3S0WA 1XRGA 2UYPA 1Z5VA 3JAWB 4U3JB 1VQ6F 4R40B 2HS4A 3GTZA 3MDOA 4B46A 3CMAF 5JVDB 5CA0B 4EI8A 3S0HA 2HRYA 5CA1A 1U40A 3JARA 1GO0A 1J7HA 5MN4A 3OW2F 1KNJA 2RHHA 1Q82H 3WGKA 4M8IA 1YJWF 3CC4F 1FFXB 4C4WC 1YI2F 1DBFA 2CWJA 2KG4A 3MBMA 4C8IA 3IEQA 2UYNA 3JASB 5JH7B 2UZHA 3SIUA 5LP6C 2RB9A 1Q86H 5CB4A 3OONA 3VYTC 1IPAA 3NVKE 3FPIA 2LBXA 5MN5A 3LWRC 3HAXD 1W41A 5HP7A 5FNVB 1FNKA 5LP6A 2UYNB 1W5AA 3M4SA 1M1KH 3IKFA 1Q7YH 1VQPF 3IR9A 3EORA 3KHNA 2LBWA 5CB4B 5GANK 1JJ2F 1QAHA 1W59A 3HKDA 4BT2A 1KNKA 5IYZA 3OBWA 3D54A 3G6EF 3S06A 3CCLF 1VQKF 1TVKB 5HY2A 4WBNB 1Q8RA 4BVRA 4YJ3B 2YYEA 4O2BA 3K2XA 4O4LB 5ITZA 5LP6B 5IJ0A 5G4UC 3HTNA 3RA6A 1CLIA 2AIZP 2BTOA 3VI6A 1QVFF 1W5BA 2IAFA 2CVLA 2V9YA 4IIJA 3KJKA 5GONA 5IYZB 3I3FA 4ZHQA 2UYJA 3V7QA 3TD4A 2EWCA 3JVHA 1X7PA 4NWOB 1H47A 3F6MA 5EIBD 3CPWF 5IJ0B 3VYSC 3RYHA 2FC3A 1QD9A 4HNAA 4C82A 4RHAA 5C8YA 1VQMF 1K8AH 2HP0A 1UI9A 3M1XA 4NUTA 2MQEA 3QTYA 3S03A 3CC2F 4EI9A 2H6LA 4EB6A 1VQ4F 1OFUA 3NMUC 2ZVYA 3RYFB 2HP3A 3C9SA 4HNAB 4YJ2B 4O4IB 3I56F 2ALEA 4X1IB 2BTQB 1ONIA 3JATA 4ZHVA 2QEXF 1W5FA 2P6YA 2Z1EA 1W42A 1VQVA 3JAWA 3CCEF 1GO1A 3ON1A 3NK7A 3RYCB 2HVYD 3AGKA 5JVDA 3UT5A 3F0FA 1FSZA 3JATB 3LMEA 1N8RH 2I6DA 2HS3A 4C81A 2VGMA 3V3TA 3K12A 1VQNF 3CG6A 3J7AR 1W3EX 1ODEA 2IQQA 2Q1XA 3N4YA 4IHJB 3S0YA 3CD6F 4TZZA 3HKBB 3MCAB 5EZYB 3JASA 2VAPA 5JH7A 1K9MH 4X1YB 5FJ4C 4G4ZA 3UT5B 3S02A 1TUBA 1KD1H 4O4HB 3ELCA 3F0DA 3M84A 4FFBA 4BVTA 1CN7A 3QUWA 1YGYA 1NQ3A 4O2AA 1IV4A 3ESJA 5FNVA 1YJNF 3I7TA 4DXDA 3J80M 1E7KA 1YQNA 3N4ZA 3K14A 1YHQF 4BW0B 1TUBB 3N2KA 5HY4A 1KQSF 4FFBB 1RQ7A 4XCQA 3JAMM 3LWQC 3KIZA 1QU9A 5HXUA 3CPQA 4ZHYB 2OTMA 5HP8A 2CSLA 2F9ZC 4LCKA 4O2AB 1TVKA 3JAKB 4WBNA 4YJ3A 5HXZA 3CCRF 1RA4A 4X20A 4O4LA 5JCOC 3N2KB 4E6EA 1PXWA 1CK2A 1SDSA 5J2TB 2Q1YA 1KC8H 2ZODA 2PHNA 5EO3A 3CC7F 3CCUF 4G88A 4X20B 2BTUA 1YJ9F 3KJJA 5JCOA 3WGNA 2CZWA 1GX1A 4G4XA 5KX5B 1VK3A 2DT4A 2G9IA 2H8CA 3C9UA 3VTIC 4BT3A 4I55A 5HY0A 4TUYA 1M90H 5HWEA 4KWEA 4I50A 1W57A 3LWOC 5LXTA 3RYFA 2OZBA 4YJ2A 2VGNA 3CCJF 3CYQA 4O4IA 2OTLF 3VCZA 4X1IA 5EIBC 1JFFA 3E22A 4I55B 5J2UB 4TUYB 5AVMA 3VMFB 1XBIA 2VXYA 5FLXM 1H48A 3WJRA 3K0TA 3JCMM 2B33A 5LOVB 1X7OA 4I50B 3BYQA 1VQOF 2VAMA 4B5CA 4BT4A 5LXTB 3CCQF 3WJPA 3RYCA 3B6NA 3FD5A 3I55F 4B62A 3J81M 3CCMF 1YIJF 1W55A 1JFFB 3E22B 1R1MA 2I6RA 3N2GA 4BVQA 3CCVF 3MCQA 3JALB 3HJWC 2OTJF 5HY1A 1JY8A 3HKEA 4LNUA 4IHJA 2CHTA 3HKBA 5EZYA 3TD5A 2ZVZA 4X1YA 1IV3A 1ZWZA 3R0PA 4O4HA 4EI7A 2GLZA 2HQSC 3O85A 1VQLF 5B8FA 3N2GB 2HS0A 3WPXA 5IJ9A 1H7MA 2QTPA 1Q81H 2RHLA 3LFOA 4NQ3A 2GVIA 5EB1B 4LNUB 3HKEB 3KE1A 5BMVA 3IEWA 2CHSA 4ZOLB 4X3LA 2R751 2PMPA 4X3MA 3VO8A 3E20B 1SA0A 3G4SF 4TV9B 1GZ0A 3ZP7A 4BT7A 2R6R1 5IJ9B 3NVIB 3CCSF 3FBAA 3JAKA 5BMVB 5GAPK 5DCVA 5KMGA 3CMEF 4I4TA 5LA6A 3HWUA 2N48A 4X1KB 1T0AA 1OAPA 1SA0B 4C8EA 5MN6A 4DRXA
chains in the Genus database with same CATH topology
3G71F 1VQMF 1YJ9F 1K8AH 4NUTA 1NJIH 4BVSA 1RLGA 2CZWA 3PAFA 1DT9A 3E1YA 3CC2F 4EI9A 1VQ8F 3SIVA 1VQ4F 5HY0A 1K73H 3NMUC 2BO1A 1M90H 1VQ9F 3FFMA 5HWEA 2AIFA 3I56F 2ALEA 1YITF 3LWOC 2QEXF 2FGYA 1VQ6F 2OZBA 1QVGF 2VGNA 3CMAF 2OHWA 4EI8A 3CCJF 2OTLF 3D00A 5GINC 1GO0A 1W42A 2KTVA 3CCEF 1GO1A 3ON1A 3OW2F 3VMFB 3NK7A 1XBIA 5FLXM 1Q82H 2HVYD 3AGKA 3CC4F 3JCMM 1YJWF 4C4WC 1YI2F 1X7OA 2KG4A 1VQOF 1N8RH 2I6DA 2VGMA 3CCQF 3V3TA 3SIUA 1VQNF 3CG6A 3I55F 3J7AR 1W3EX 1Q86H 3V7EA 3N4YA 3J81M 3CCMF 2QA4F 1YIJF 3CD6F 4TZZA 3MCAB 3NK6A 1K9MH 4BVQA 1IPAA 3CCVF 3NVKE 2LBXA 3HJWC 2OTJF 5FJ4C 3LWRC 3HAXD 1W41A 5HY1A 2WALA 1KD1H 5G4VC 4BVTA 1CN7A 2KTUA 3RA5A 3PLAC 5IT9M 1M1KH 1Q7YH 1VQPF 1ZWZA 3IR9A 4EI7A 2LBWA 2GLZA 5GANK 1JJ2F 3O85A 1YJNF 1VQLF 3GYQA 3J80M 4BY9D 1VQ7F 1E7KA 3N4ZA 1H7MA 3OBWA 1YHQF 4BW0B 3G6EF 1Q81H 3LFOA 4NQ3A 3CCLF 1S72F 5HY4A 1KQSF 1VQKF 5HY2A 4XCQA 3LWQC 3JAMM 4BVRA 1VQ5F 4X3LA 5HXUA 3CPQA 4X3MA 2F9ZC 4LCKA 5G4UC 5GIPC 5EWRA 5GIOC 3RA6A 3E20B 1W40A 5HXZA 3G4SF 3CCRF 1GZ0A 1RA4A 1W2BF 3VI6A 1QVFF 3NVIB 3CCSF 3V7QA 1X7PA 2QI2A 5GAPK 1T0KB 1PXWA 3OBYA 1X52A 1CK2A 1SDSA 3CMEF 3LWVC 5DCVA 3CPWF 5A2QM 3WXMB 3CXCF 2JNBA 1KC8H 2FC3A 5EO3A 3CC7F 3CCUF 3LWPC 1NMUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 F;  1VQM F;  1YJ9 F;  1K8A H;  4NUT A;  1NJI H;  1RLG A;  2CZW A;  3PAF A;  1DT9 A;  3E1Y A;  3CC2 F;  1VQ8 F;  3SIV A;  1VQ4 F;  1K73 H;  3NMU C;  2BO1 A;  1M90 H;  1VQ9 F;  3FFM A;  2AIF A;  3I56 F;  2ALE A;  1YIT F;  3LWO C;  2QEX F;  1VQ6 F;  2OZB A;  1QVG F;  2VGN A;  3CMA F;  2OHW A;  3CCJ F;  2OTL F;  5GIN C;  1GO0 A;  1W42 A;  2KTV A;  3CCE F;  1GO1 A;  3ON1 A;  3OW2 F;  3VMF B;  3NK7 A;  1XBI A;  5FLX M;  1Q82 H;  2HVY D;  3AGK A;  3CC4 F;  3JCM M;  1YJW F;  4C4W C;  1YI2 F;  1X7O A;  2KG4 A;  1VQO F;  1N8R H;  2I6D A;  2VGM A;  3CCQ F;  3SIU A;  1VQN F;  3CG6 A;  3I55 F;  3J7A R;  1W3E X;  1Q86 H;  3V7E A;  3N4Y A;  3J81 M;  3CCM F;  2QA4 F;  1YIJ F;  3CD6 F;  4TZZ A;  3MCA B;  3NK6 A;  1K9M H;  1IPA A;  3CCV F;  3NVK E;  2LBX A;  3HJW C;  2OTJ F;  5FJ4 C;  3LWR C;  3HAX D;  1W41 A;  2WAL A;  1KD1 H;  5G4V C;  1CN7 A;  2KTU A;  3RA5 A;  3PLA C;  5IT9 M;  1M1K H;  1Q7Y H;  1VQP F;  1ZWZ A;  3IR9 A;  2LBW A;  5GAN K;  1JJ2 F;  3O85 A;  1YJN F;  1VQL F;  3GYQ A;  3J80 M;  4BY9 D;  1VQ7 F;  1E7K A;  3N4Z A;  1H7M A;  3OBW A;  1YHQ F;  4BW0 B;  3G6E F;  1Q81 H;  3LFO A;  3CCL F;  1S72 F;  1KQS F;  1VQK F;  3LWQ C;  3JAM M;  1VQ5 F;  4X3L A;  3CPQ A;  4X3M A;  5G4U C;  4LCK A;  5GIP C;  5EWR A;  5GIO C;  3RA6 A;  3E20 B;  1W40 A;  3G4S F;  3CCR F;  1GZ0 A;  1RA4 A;  1W2B F;  3VI6 A;  1QVF F;  3NVI B;  3CCS F;  3V7Q A;  1X7P A;  2QI2 A;  5GAP K;  1T0K B;  1PXW A;  3OBY A;  1X52 A;  1CK2 A;  1SDS A;  3CME F;  3LWV C;  5DCV A;  3CPW F;  5A2Q M;  3WXM B;  3CXC F;  2JNB A;  1KC8 H;  2FC3 A;  5EO3 A;  3CC7 F;  3CCU F;  3LWP C;  1NMU B; 
#chains in the Genus database with same CATH topology
 3P4E A;  4TV8 A;  5J2T A;  2L26 A;  1W5E A;  3G71 F;  3C9R A;  1RQ2 A;  1XV2 A;  1NJI H;  4BVS A;  4RQO A;  2W8B C;  3DDN A;  3PAF A;  2LBT A;  5LYJ B;  2KGW A;  3D01 A;  5JQG B;  2CW4 A;  1DT9 A;  2VAW A;  5KMG B;  1VQ8 F;  2RHO A;  4I4T B;  5LA6 B;  2ZOV A;  4O4J A;  1K73 H;  3WGJ A;  2BO1 A;  5KX5 A;  3VOB A;  3FFM A;  5EB0 A;  4DRX B;  1U43 A;  5CA1 B;  1YIT F;  3JAR B;  4TV8 B;  2FGY A;  3WPW A;  3DC2 A;  3VYU C;  1QVG F;  4G4V A;  2OHW A;  3HKC A;  3D00 A;  5GIN C;  4C8G A;  1U3P A;  2KTV A;  4O4J B;  3V4D A;  1IV2 A;  3LYB A;  3WGL A;  3WJQ A;  4F6R A;  3F0G A;  4ERH A;  1SZQ A;  2ZAU A;  3RYI A;  5J2U A;  2LCA A;  2Z1T A;  5LOV A;  3V7E A;  3HKC B;  1PF5 A;  2QA4 F;  4B45 A;  2Z1U A;  1COM A;  3NK6 A;  4F6R B;  3T80 A;  2WAL A;  5G4V C;  3U0O A;  5EAZ A;  3HKD B;  3RYI B;  2KTU A;  3RA5 A;  3WGM A;  3MQW A;  3PLA C;  3JAL A;  5IT9 M;  1JD1 A;  3GHZ A;  3Q8H A;  1UFY A;  2RHJ A;  3IKE A;  4ZI7 A;  3C9T A;  1W58 1;  3GYQ A;  4BY9 D;  4O2B B;  3CYP B;  1IV1 A;  3P0Z A;  5ITZ B;  1RLU A;  1VQ7 F;  1X25 A;  4PWT A;  4G4Y A;  1S72 F;  1Z5W A;  3CB2 A;  3RE3 A;  2ZF8 A;  2DYY A;  1VH8 A;  2K1S A;  1VQ5 F;  4G4W A;  4IIJ B;  5GON B;  4BT6 A;  5GIP C;  5EWR A;  4ZHQ B;  5GIO C;  3ERN A;  3P10 A;  2Z01 A;  5EYP A;  1W40 A;  4ZOL A;  4ZI7 B;  1W2B F;  3FD6 A;  2Z1F A;  4ZK7 A;  3C8L A;  3RYH B;  1VHA A;  2NMU A;  1U3L A;  2QI2 A;  4TV9 A;  1T0K B;  3OBY A;  1X52 A;  3ZP4 A;  4BT5 A;  3ZO8 A;  1JN1 A;  3QHD A;  5C8Y B;  3LWV C;  3IMP A;  5A2Q M;  3WXM B;  3CXC F;  2HP0 B;  2HRU A;  2IG8 A;  2JNB A;  3LDT A;  4U39 A;  3VOA A;  5EYP B;  1XHO A;  3VIU A;  3LWP C;  3TD3 A;  3ZOP A;  1NMU B;  3L7Q A;  4U3J A;  4EB6 B;  1FNJ A;  4X1K A;  2UYK A;  1RLG A;  2HX0 A;  2H8E A;  5CA0 A;  3E1Y A;  4ZHW A;  3SIV A;  2YXZ A;  2GZL A;  1VQ9 F;  3F0E A;  5LYJ A;  5JQG A;  1FFX A;  2AMT A;  2AIF A;  3S0W A;  1XRG A;  2UYP A;  1Z5V A;  3JAW B;  4U3J B;  1VQ6 F;  4R40 B;  2HS4 A;  3GTZ A;  3MDO A;  4B46 A;  3CMA F;  5JVD B;  5CA0 B;  4EI8 A;  3S0H A;  2HRY A;  5CA1 A;  1U40 A;  3JAR A;  1GO0 A;  1J7H A;  5MN4 A;  3OW2 F;  1KNJ A;  2RHH A;  1Q82 H;  3WGK A;  4M8I A;  1YJW F;  3CC4 F;  1FFX B;  4C4W C;  1YI2 F;  1DBF A;  2CWJ A;  2KG4 A;  3MBM A;  4C8I A;  3IEQ A;  2UYN A;  3JAS B;  5JH7 B;  2UZH A;  3SIU A;  5LP6 C;  2RB9 A;  1Q86 H;  5CB4 A;  3OON A;  3VYT C;  1IPA A;  3NVK E;  3FPI A;  2LBX A;  5MN5 A;  3LWR C;  3HAX D;  1W41 A;  5HP7 A;  5FNV B;  1FNK A;  5LP6 A;  2UYN B;  1W5A A;  3M4S A;  1M1K H;  3IKF A;  1Q7Y H;  1VQP F;  3IR9 A;  3EOR A;  3KHN A;  2LBW A;  5CB4 B;  5GAN K;  1JJ2 F;  1QAH A;  1W59 A;  3HKD A;  4BT2 A;  1KNK A;  5IYZ A;  3OBW A;  3D54 A;  3G6E F;  3S06 A;  3CCL F;  1VQK F;  1TVK B;  5HY2 A;  4WBN B;  1Q8R A;  4BVR A;  4YJ3 B;  2YYE A;  4O2B A;  3K2X A;  4O4L B;  5ITZ A;  5LP6 B;  5IJ0 A;  5G4U C;  3HTN A;  3RA6 A;  1CLI A;  2AIZ P;  2BTO A;  3VI6 A;  1QVF F;  1W5B A;  2IAF A;  2CVL A;  2V9Y A;  4IIJ A;  3KJK A;  5GON A;  5IYZ B;  3I3F A;  4ZHQ A;  2UYJ A;  3V7Q A;  3TD4 A;  2EWC A;  3JVH A;  1X7P A;  4NWO B;  1H47 A;  3F6M A;  5EIB D;  3CPW F;  5IJ0 B;  3VYS C;  3RYH A;  2FC3 A;  1QD9 A;  4HNA A;  4C82 A;  4RHA A;  5C8Y A;  1VQM F;  1K8A H;  2HP0 A;  1UI9 A;  3M1X A;  4NUT A;  2MQE A;  3QTY A;  3S03 A;  3CC2 F;  4EI9 A;  2H6L A;  4EB6 A;  1VQ4 F;  1OFU A;  3NMU C;  2ZVY A;  3RYF B;  2HP3 A;  3C9S A;  4HNA B;  4YJ2 B;  4O4I B;  3I56 F;  2ALE A;  4X1I B;  2BTQ B;  1ONI A;  3JAT A;  4ZHV A;  2QEX F;  1W5F A;  2P6Y A;  2Z1E A;  1W42 A;  1VQV A;  3JAW A;  3CCE F;  1GO1 A;  3ON1 A;  3NK7 A;  3RYC B;  2HVY D;  3AGK A;  5JVD A;  3UT5 A;  3F0F A;  1FSZ A;  3JAT B;  3LME A;  1N8R H;  2I6D A;  2HS3 A;  4C81 A;  2VGM A;  3V3T A;  3K12 A;  1VQN F;  3CG6 A;  3J7A R;  1W3E X;  1ODE A;  2IQQ A;  2Q1X A;  3N4Y A;  4IHJ B;  3S0Y A;  3CD6 F;  4TZZ A;  3HKB B;  3MCA B;  5EZY B;  3JAS A;  2VAP A;  5JH7 A;  1K9M H;  4X1Y B;  5FJ4 C;  4G4Z A;  3UT5 B;  3S02 A;  1TUB A;  1KD1 H;  4O4H B;  3ELC A;  3F0D A;  3M84 A;  4FFB A;  4BVT A;  1CN7 A;  3QUW A;  1YGY A;  1NQ3 A;  4O2A A;  1IV4 A;  3ESJ A;  5FNV A;  1YJN F;  3I7T A;  4DXD A;  3J80 M;  1E7K A;  1YQN A;  3N4Z A;  3K14 A;  1YHQ F;  4BW0 B;  1TUB B;  3N2K A;  5HY4 A;  1KQS F;  4FFB B;  1RQ7 A;  4XCQ A;  3JAM M;  3LWQ C;  3KIZ A;  1QU9 A;  5HXU A;  3CPQ A;  4ZHY B;  2OTM A;  5HP8 A;  2CSL A;  2F9Z C;  4LCK A;  4O2A B;  1TVK A;  3JAK B;  4WBN A;  4YJ3 A;  5HXZ A;  3CCR F;  1RA4 A;  4X20 A;  4O4L A;  5JCO C;  3N2K B;  4E6E A;  1PXW A;  1CK2 A;  1SDS A;  5J2T B;  2Q1Y A;  1KC8 H;  2ZOD A;  2PHN A;  5EO3 A;  3CC7 F;  3CCU F;  4G88 A;  4X20 B;  2BTU A;  1YJ9 F;  3KJJ A;  5JCO A;  3WGN A;  2CZW A;  1GX1 A;  4G4X A;  5KX5 B;  1VK3 A;  2DT4 A;  2G9I A;  2H8C A;  3C9U A;  3VTI C;  4BT3 A;  4I55 A;  5HY0 A;  4TUY A;  1M90 H;  5HWE A;  4KWE A;  4I50 A;  1W57 A;  3LWO C;  5LXT A;  3RYF A;  2OZB A;  4YJ2 A;  2VGN A;  3CCJ F;  3CYQ A;  4O4I A;  2OTL F;  3VCZ A;  4X1I A;  5EIB C;  1JFF A;  3E22 A;  4I55 B;  5J2U B;  4TUY B;  5AVM A;  3VMF B;  1XBI A;  2VXY A;  5FLX M;  1H48 A;  3WJR A;  3K0T A;  3JCM M;  2B33 A;  5LOV B;  1X7O A;  4I50 B;  3BYQ A;  1VQO F;  2VAM A;  4B5C A;  4BT4 A;  5LXT B;  3CCQ F;  3WJP A;  3RYC A;  3B6N A;  3FD5 A;  3I55 F;  4B62 A;  3J81 M;  3CCM F;  1YIJ F;  1W55 A;  1JFF B;  3E22 B;  1R1M A;  2I6R A;  3N2G A;  4BVQ A;  3CCV F;  3MCQ A;  3JAL B;  3HJW C;  2OTJ F;  5HY1 A;  1JY8 A;  3HKE A;  4LNU A;  4IHJ A;  2CHT A;  3HKB A;  5EZY A;  3TD5 A;  2ZVZ A;  4X1Y A;  1IV3 A;  1ZWZ A;  3R0P A;  4O4H A;  4EI7 A;  2GLZ A;  2HQS C;  3O85 A;  1VQL F;  5B8F A;  3N2G B;  2HS0 A;  3WPX A;  5IJ9 A;  1H7M A;  2QTP A;  1Q81 H;  2RHL A;  3LFO A;  4NQ3 A;  2GVI A;  5EB1 B;  4LNU B;  3HKE B;  3KE1 A;  5BMV A;  3IEW A;  2CHS A;  4ZOL B;  4X3L A;  2R75 1;  2PMP A;  4X3M A;  3VO8 A;  3E20 B;  1SA0 A;  3G4S F;  4TV9 B;  1GZ0 A;  3ZP7 A;  4BT7 A;  2R6R 1;  5IJ9 B;  3NVI B;  3CCS F;  3FBA A;  3JAK A;  5BMV B;  5GAP K;  5DCV A;  5KMG A;  3CME F;  4I4T A;  5LA6 A;  3HWU A;  2N48 A;  4X1K B;  1T0A A;  1OAP A;  1SA0 B;  4C8E A;  5MN6 A;  4DRX A; 
#chains in the Genus database with same CATH homology
 3G71 F;  1VQM F;  1YJ9 F;  1K8A H;  4NUT A;  1NJI H;  4BVS A;  1RLG A;  2CZW A;  3PAF A;  1DT9 A;  3E1Y A;  3CC2 F;  4EI9 A;  1VQ8 F;  3SIV A;  1VQ4 F;  5HY0 A;  1K73 H;  3NMU C;  2BO1 A;  1M90 H;  1VQ9 F;  3FFM A;  5HWE A;  2AIF A;  3I56 F;  2ALE A;  1YIT F;  3LWO C;  2QEX F;  2FGY A;  1VQ6 F;  2OZB A;  1QVG F;  2VGN A;  3CMA F;  2OHW A;  4EI8 A;  3CCJ F;  2OTL F;  3D00 A;  5GIN C;  1GO0 A;  1W42 A;  2KTV A;  3CCE F;  1GO1 A;  3ON1 A;  3OW2 F;  3VMF B;  3NK7 A;  1XBI A;  5FLX M;  1Q82 H;  2HVY D;  3AGK A;  3CC4 F;  3JCM M;  1YJW F;  4C4W C;  1YI2 F;  1X7O A;  2KG4 A;  1VQO F;  1N8R H;  2I6D A;  2VGM A;  3CCQ F;  3V3T A;  3SIU A;  1VQN F;  3CG6 A;  3I55 F;  3J7A R;  1W3E X;  1Q86 H;  3V7E A;  3N4Y A;  3J81 M;  3CCM F;  2QA4 F;  1YIJ F;  3CD6 F;  4TZZ A;  3MCA B;  3NK6 A;  1K9M H;  4BVQ A;  1IPA A;  3CCV F;  3NVK E;  2LBX A;  3HJW C;  2OTJ F;  5FJ4 C;  3LWR C;  3HAX D;  1W41 A;  5HY1 A;  2WAL A;  1KD1 H;  5G4V C;  4BVT A;  1CN7 A;  2KTU A;  3RA5 A;  3PLA C;  5IT9 M;  1M1K H;  1Q7Y H;  1VQP F;  1ZWZ A;  3IR9 A;  4EI7 A;  2LBW A;  2GLZ A;  5GAN K;  1JJ2 F;  3O85 A;  1YJN F;  1VQL F;  3GYQ A;  3J80 M;  4BY9 D;  1VQ7 F;  1E7K A;  3N4Z A;  1H7M A;  3OBW A;  1YHQ F;  4BW0 B;  3G6E F;  1Q81 H;  3LFO A;  4NQ3 A;  3CCL F;  1S72 F;  5HY4 A;  1KQS F;  1VQK F;  5HY2 A;  4XCQ A;  3LWQ C;  3JAM M;  4BVR A;  1VQ5 F;  4X3L A;  5HXU A;  3CPQ A;  4X3M A;  2F9Z C;  4LCK A;  5G4U C;  5GIP C;  5EWR A;  5GIO C;  3RA6 A;  3E20 B;  1W40 A;  5HXZ A;  3G4S F;  3CCR F;  1GZ0 A;  1RA4 A;  1W2B F;  3VI6 A;  1QVF F;  3NVI B;  3CCS F;  3V7Q A;  1X7P A;  2QI2 A;  5GAP K;  1T0K B;  1PXW A;  3OBY A;  1X52 A;  1CK2 A;  1SDS A;  3CME F;  3LWV C;  5DCV A;  3CPW F;  5A2Q M;  3WXM B;  3CXC F;  2JNB A;  1KC8 H;  2FC3 A;  5EO3 A;  3CC7 F;  3CCU F;  3LWP C;  1NMU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...