1RA4A

Crystal structure of the methanococcus jannaschii l7ae protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
117
structure length
117
Chain Sequence
MAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the Methanocaldococcus jannaschii multifunctional L7Ae RNA-binding protein reveals an induced-fit interaction with the box C/D RNAs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Structural protein
molecule keywords 50S ribosomal protein L7Ae
total genus 36
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1ra4A00
1DT9A 2KG4A 3CC7F 3NVKE 1VQ5F 4C4WC 1RA4A 3E1YA 3RA5A 2JNBA 3SIVA 1VQMF 2WALA 3N4ZA 3NMUC 2QI2A 3NVIB 1QVFF 5EWRA 2OHWA 5GINC 3HJWC 3CCRF 1VQLF 3VMFB 1KD1H 3CC4F 2I6DA 3G6EF 4X3LA 2QEXF 3V7EA 1YJ9F 1YJWF 3CC2F 1VQKF 3CCUF 1RLGA 4X3MA 2VGNA 3NK6A 3AGKA 1X7PA 1K9MH 1NMUB 2CZWA 3HAXD 1VQ7F 3IR9A 5GIPC 5G4UC 3CD6F 1N8RH 1YIJF 1VQ9F 3CCQF 3LFOA 3ON1A 5GAPK 1VQ4F 1YJNF 3J7AR 3LWOC 5FJ4C 3E20B 1KQSF 1S72F 5G4VC 2QA4F 2OZBA 1CN7A 1W3EX 2OTLF 2OTJF 1GO0A 2HVYD 4BY9D 1VQ6F 3G71F 1Q81H 1JJ2F 3JAMM 1XBIA 2ALEA 3CCLF 5A2QM 3MCAB 3CCEF 1X7OA 1YHQF 1K8AH 1GO1A 3I56F 1W40A 3G4SF 3OBYA 3LWQC 3NK7A 1VQOF 1Q7YH 5DCVA 1K73H 5IT9M 2VGMA 5EO3A 1W42A 3CCMF 2LBWA 5FLXM 3J80M 1E7KA 1QVGF 4LCKA 5GIOC 3VI6A 2LBXA 1Q82H 2FC3A 3PAFA 2KTVA 3CPQA 3PLAC 3J81M 3O85A 3CMEF 4BW0B 1X52A 3N4YA 1W41A 3FFMA 3LWPC 3LWRC 1H7MA 3JCMM 3RA6A 4NUTA 3V7QA 5GANK 1VQNF 3OBWA 1M1KH 3CMAF 3CCSF 3OW2F 3CXCF 1VQPF 1W2BF 3GYQA 1ZWZA 3CPWF 3CCJF 3CCVF 1PXWA 1Q86H 3CG6A 1VQ8F 1YI2F 1SDSA 1YITF 3LWVC 1T0KB 1KC8H 2AIFA 1GZ0A 1CK2A 1IPAA 2BO1A 1M90H 3SIUA 2KTUA 3WXMB 3I55F 4TZZA 1NJIH
chains in the Genus database with same CATH superfamily
1DT9A 5JCOC 2P6YA 1PF5A 2QTPA 1SA0B 3HKBA 3S0HA 2JNBA 2ZVYA 2UZHA 3SIVA 3JARB 2G9IA 5LYJA 3HKCB 3IKFA 1IV4A 5LOVA 1QVFF 2HRUA 5HP7A 1SA0A 3K12A 2Q1XA 4FFBB 4NWOB 1JFFB 3F0DA 4X3LA 2VAMA 4G4VA 3G6EF 1YJ9F 5HWEA 1VQKF 1W5BA 4R40B 1RLGA 5C8YA 3N2KA 2UYPA 4TV8B 1W57A 3WGNA 5IJ9A 1SZQA 3HWUA 3I7TA 4O2BA 4X1YB 4O2AB 1W5EA 3IMPA 3QUWA 1VK3A 2LBTA 3VYTC 3N2KB 5HP8A 4IHJB 2Z1UA 4G4ZA 4ERHA 5BMVA 5JH7B 3CCQF 4X1YA 2RHLA 3UT5B 4YJ2A 3J7AR 4LNUB 1ODEA 3GHZA 3V4DA 4ZOLB 1KQSF 4U3JA 1W3EX 2OTLF 2OTJF 4BT5A 2OTMA 4TV9B 1VQ6F 2BTQB 1XV2A 3K14A 1JJ2F 2FGYA 1NQ3A 3CCLF 3WGMA 3RYIB 5LA6B 3S0YA 4I50A 5CA1A 4ZK7A 1U43A 3I56F 3P10A 3MCQA 4TV9A 3ZP4A 1VQOF 3EORA 1Q7YH 1H48A 2Z01A 5EO3A 3M1XA 4DRXA 2B33A 3ELCA 4RHAA 4F6RB 4B5CA 4HNAB 5GIOC 5ITZB 5FNVB 2LBXA 3VI6A 1UFYA 2FC3A 5JVDB 4G4XA 1XHOA 3CPQA 3CYQA 1UI9A 2Z1FA 3O85A 2ZVZA 3N2GA 4BW0B 5LOVB 1RLUA 4EI9A 3VTIC 4RQOA 5IYZA 3N4YA 4X1IB 5LXTB 3LWPC 3LWRC 1W5FA 5KX5A 3FPIA 2PMPA 1JN1A 2CW4A 2ZAUA 2UYNA 3B6NA 4BVRA 1M1KH 5EYPA 3CCSF 3HKBB 1R1MA 5CA0A 3WGKA 3K2XA 1IV3A 1FFXB 1OFUA 3JALB 3VYUC 1VQ8F 3V3TA 4ZHQA 1SDSA 1COMA 1T0KB 5HXZA 1CK2A 3JATA 3WXMB 4ZI7A 3I55F 4B45A 4TZZA 3LDTA 3T80A 4C4WC 1T0AA 1RA4A 3VIUA 4WBNA 2WALA 2QI2A 3NVIB 4BT2A 2K1SA 5EWRA 3JAWA 4X1KA 2CWJA 4U3JB 2PHNA 5GINC 5LP6C 4C8EA 1W55A 2CVLA 1U3PA 4O4LB 3P0ZA 3WJRA 3WGLA 1CLIA 2HP0A 1KD1H 2I6DA 2QEXF 4G4WA 1YJWF 3D54A 3CC2F 5EAZA 4U39A 4G4YA 5IJ0B 1U40A 2YYEA 1KNKA 2HRYA 2HS0A 3HAXD 5GIPC 1N8RH 1YIJF 4EI8A 2V9YA 5HXUA 2CSLA 1Q8RA 2Z1EA 3M4SA 3Q8HA 3HKEA 2AIZP 3F0EA 3LWOC 2H8CA 3S0WA 1CN7A 2DT4A 3C9UA 3K0TA 1ONIA 3ZP7A 3HKDB 1GO0A 4DRXB 2HP3A 5KX5B 2Q1YA 2R751 5MN4A 3JAMM 2Z1TA 1YHQF 1RQ2A 3JAKB 3JVHA 4EB6B 2LCAA 3VOBA 3G4SF 1JY8A 3JALA 4FFBA 3KIZA 3L7QA 3LWQC 5EZYB 3S06A 3E22A 4O4JB 4O4IB 5DCVA 1W42A 3I3FA 5FLXM 1E7KA 4BT3A 3TD4A 3WJQA 5IJ9B 4KWEA 1Q82H 3PAFA 4X1IA 5LXTA 4ZHQB 3CMEF 2RB9A 3MQWA 1FNJA 5EB1B 1W41A 3FFMA 4C82A 2GLZA 3RA6A 1TVKB 2GVIA 3S02A 4NUTA 3BYQA 3CYPB 1VQNF 2IQQA 3OBWA 1W59A 2EWCA 1W581 4O2BB 3CXCF 3GYQA 1ZWZA 3CPWF 2DYYA 4I4TB 1TVKA 4C81A 3LWVC 2UYJA 1KC8H 1GZ0A 5GONA 3DC2A 4BT6A 1IPAA 3SIUA 3MBMA 2BTUA 4X20B 4YJ2B 2KTUA 4I50B 5CA1B 4EI7A 5MN6A 3RYHA 1VQ5F 2MQEA 2VAWA 1VQMF 3QTYA 5J2UB 3DDNA 4F6RA 2I6RA 1GX1A 3IEWA 5HY1A 1X25A 5HY2A 1KNJA 4M8IA 3HJWC 3VCZA 2H6LA 5AVMA 1VHAA 3VOAA 1VQLF 3FD5A 3F0GA 4I55A 5CB4B 3UT5A 2F9ZC 3JASB 3KHNA 3V7EA 3RYCB 1TUBA 2RHHA 2CHSA 1DBFA 1H47A 2RHJA 3HKCA 2W8BC 3AGKA 1X7PA 4HNAA 4I55B 5EYPB 2VXYA 1NMUB 3MDOA 1Z5VA 4BVTA 2CZWA 5MN5A 1VQ7F 5G4UC 4B46A 3CD6F 1JFFA 5IYZB 3OONA 5LA6A 5JVDA 3KJJA 3LFOA 3ON1A 3CB2A 3ZO8A 5GAPK 1VQ4F 5FJ4C 5C8YB 3E20B 4G88A 3LMEA 1S72F 2OZBA 3C8LA 4O2AA 3R0PA 5LYJB 4BY9D 3G71F 2H8EA 3E22B 2R6R1 3RYFA 5BMVB 5A2QM 3MCAB 1K8AH 1IV1A 4ZHVA 1FSZA 3OBYA 3NK7A 5B8FA 5LP6A 5HY4A 3F6MA 5IT9M 2VGMA 2ZODA 4PWTA 4BT7A 1U3LA 1YGYA 5HY0A 4LCKA 5LP6B 2CHTA 2HX0A 3PLAC 3J81M 1FNKA 4IHJA 5EIBD 4ZHYB 1X52A 2RHOA 5JQGB 2UYKA 3JCMM 3VYSC 3V7QA 5EB0A 3WGJA 5GANK 3WPWA 1QAHA 3OW2F 1W2BF 1YQNA 3JASA 4X20A 1XRGA 3CG6A 5KMGA 4TUYB 3C9SA 4ZHWA 2AIFA 3RYHB 5JH7A 4YJ3A 3HKEB 3KE1A 3RYIA 3TD3A 4B62A 4TUYA 3C9TA 1NJIH 2KG4A 4YJ3B 2VAPA 3IKEA 3TD5A 3CC7F 3NVKE 5J2TB 5EIBC 3E1YA 1RQ7A 3RA5A 4BVSA 1QD9A 3N4ZA 3NMUC 2N48A 1OAPA 3D00A 2OHWA 3FD6A 2L26A 3D01A 4DXDA 3WPXA 4ZI7B 2AMTA 3CCRF 3IEQA 4E6EA 2ZF8A 3VMFB 3CC4F 4XCQA 1FFXA 3CCUF 2IAFA 4X3MA 2VGNA 3QHDA 3NK6A 3FBAA 1K9MH 3ZOPA 4O4JA 4O4IA 4O4HA 3HKDA 3IR9A 3WJPA 3U0OA 1VQ9F 2KGWA 3RYFB 4C8IA 4O4HB 1W5AA 3JATB 3ESJA 3JARA 1YJNF 4IIJB 3C9RA 3JAWB 4X1KB 5G4VC 2QA4F 4TV8A 5CA0B 4C8GA 3HTNA 4I4TA 5JQGA 4LNUA 4IIJA 4ZOLA 2HVYD 1Q81H 5GONB 3LYBA 1XBIA 2ALEA 1QU9A 3RE3A 3CCEF 1X7OA 4NQ3A 1GO1A 1W40A 5KMGB 3F0FA 2YXZA 1K73H 4WBNB 3CCMF 2LBWA 3J80M 1TUBB 1QVGF 5IJ0A 5JCOA 1VH8A 5J2TA 2GZLA 3M84A 3S03A 1Z5WA 2KTVA 2NMUA 4O4LA 2BTOA 2HS3A 2HP0B 5ITZA 2ZOVA 2HQSC 4BT4A 1H7MA 3KJKA 2IG8A 1VQVA 2HS4A 3CMAF 1VQPF 5CB4A 5FNVA 1JD1A 3CCJF 1IV2A 3CCVF 1PXWA 1Q86H 5J2UA 3RYCA 4BVQA 3ERNA 1YI2F 1YITF 5EZYA 2UYNB 3N2GB 3GTZA 3VO8A 2BO1A 3P4EA 1M90H 3JAKA 4EB6A 1J7HA
chains in the Genus database with same CATH topology
1DT9A 2KG4A 3CC7F 3NVKE 1VQ5F 4C4WC 1RA4A 3E1YA 3RA5A 2JNBA 3SIVA 1VQMF 4BVSA 2WALA 3N4ZA 3NMUC 2QI2A 3NVIB 1QVFF 5EWRA 3D00A 5HY1A 2OHWA 5HY2A 5GINC 3HJWC 3CCRF 1VQLF 3VMFB 1KD1H 3CC4F 2I6DA 3G6EF 4X3LA 2F9ZC 2QEXF 4XCQA 3V7EA 1YJ9F 5HWEA 3CC2F 1YJWF 1VQKF 3CCUF 1RLGA 4X3MA 2VGNA 3NK6A 3AGKA 1X7PA 1K9MH 1NMUB 4BVTA 2CZWA 3HAXD 1VQ7F 3IR9A 5GIPC 5G4UC 3CD6F 1N8RH 1YIJF 4EI8A 1VQ9F 5HXUA 3CCQF 3LFOA 3ON1A 5GAPK 1VQ4F 1YJNF 3J7AR 3LWOC 5FJ4C 3E20B 1KQSF 1S72F 5G4VC 2QA4F 2OZBA 1CN7A 1W3EX 2OTLF 2OTJF 1GO0A 2HVYD 4BY9D 1VQ6F 3G71F 1Q81H 1JJ2F 3JAMM 1XBIA 2ALEA 2FGYA 3CCLF 5A2QM 3MCAB 3CCEF 1X7OA 1YHQF 1K8AH 4NQ3A 1GO1A 3I56F 1W40A 3G4SF 3OBYA 3LWQC 3NK7A 1VQOF 5HY4A 1Q7YH 5DCVA 1K73H 5IT9M 2VGMA 5EO3A 1W42A 3CCMF 2LBWA 5FLXM 3J80M 1E7KA 5HY0A 1QVGF 4LCKA 5GIOC 3VI6A 2LBXA 1Q82H 2FC3A 3PAFA 2KTVA 3CPQA 3PLAC 3J81M 3O85A 3CMEF 4BW0B 4EI9A 1X52A 3N4YA 1W41A 3FFMA 3LWPC 1H7MA 2GLZA 3JCMM 3RA6A 3LWRC 4NUTA 3V7QA 5GANK 1VQNF 4BVRA 3OBWA 1M1KH 3CMAF 3CCSF 3OW2F 3CXCF 1VQPF 1W2BF 3GYQA 1ZWZA 3CPWF 3CCJF 3CCVF 1PXWA 1Q86H 3CG6A 4BVQA 1VQ8F 3V3TA 1YI2F 1YITF 3LWVC 1SDSA 5HXZA 1T0KB 1KC8H 2AIFA 1GZ0A 1CK2A 1IPAA 2BO1A 1M90H 3SIUA 2KTUA 3WXMB 3I55F 4TZZA 1NJIH 4EI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DT9 A;  2KG4 A;  3CC7 F;  3NVK E;  1VQ5 F;  4C4W C;  1RA4 A;  3E1Y A;  3RA5 A;  2JNB A;  3SIV A;  1VQM F;  2WAL A;  3N4Z A;  3NMU C;  2QI2 A;  3NVI B;  1QVF F;  5EWR A;  2OHW A;  5GIN C;  3HJW C;  3CCR F;  1VQL F;  3VMF B;  1KD1 H;  3CC4 F;  2I6D A;  3G6E F;  4X3L A;  2QEX F;  3V7E A;  1YJ9 F;  1YJW F;  3CC2 F;  1VQK F;  3CCU F;  1RLG A;  4X3M A;  2VGN A;  3NK6 A;  3AGK A;  1X7P A;  1K9M H;  1NMU B;  2CZW A;  3HAX D;  1VQ7 F;  3IR9 A;  5GIP C;  5G4U C;  3CD6 F;  1N8R H;  1YIJ F;  1VQ9 F;  3CCQ F;  3LFO A;  3ON1 A;  5GAP K;  1VQ4 F;  1YJN F;  3J7A R;  3LWO C;  5FJ4 C;  3E20 B;  1KQS F;  1S72 F;  5G4V C;  2QA4 F;  2OZB A;  1CN7 A;  1W3E X;  2OTL F;  2OTJ F;  1GO0 A;  2HVY D;  4BY9 D;  1VQ6 F;  3G71 F;  1Q81 H;  1JJ2 F;  3JAM M;  1XBI A;  2ALE A;  3CCL F;  5A2Q M;  3MCA B;  3CCE F;  1X7O A;  1YHQ F;  1K8A H;  1GO1 A;  3I56 F;  1W40 A;  3G4S F;  3OBY A;  3LWQ C;  3NK7 A;  1VQO F;  1Q7Y H;  5DCV A;  1K73 H;  5IT9 M;  2VGM A;  5EO3 A;  1W42 A;  3CCM F;  2LBW A;  5FLX M;  3J80 M;  1E7K A;  1QVG F;  4LCK A;  5GIO C;  3VI6 A;  2LBX A;  1Q82 H;  2FC3 A;  3PAF A;  2KTV A;  3CPQ A;  3PLA C;  3J81 M;  3O85 A;  3CME F;  4BW0 B;  1X52 A;  3N4Y A;  1W41 A;  3FFM A;  3LWP C;  3LWR C;  1H7M A;  3JCM M;  3RA6 A;  4NUT A;  3V7Q A;  5GAN K;  1VQN F;  3OBW A;  1M1K H;  3CMA F;  3CCS F;  3OW2 F;  3CXC F;  1VQP F;  1W2B F;  3GYQ A;  1ZWZ A;  3CPW F;  3CCJ F;  3CCV F;  1PXW A;  1Q86 H;  3CG6 A;  1VQ8 F;  1YI2 F;  1SDS A;  1YIT F;  3LWV C;  1T0K B;  1KC8 H;  2AIF A;  1GZ0 A;  1CK2 A;  1IPA A;  2BO1 A;  1M90 H;  3SIU A;  2KTU A;  3WXM B;  3I55 F;  4TZZ A;  1NJI H; 
#chains in the Genus database with same CATH topology
 1DT9 A;  5JCO C;  2P6Y A;  1PF5 A;  2QTP A;  1SA0 B;  3HKB A;  3S0H A;  2JNB A;  2ZVY A;  2UZH A;  3SIV A;  3JAR B;  2G9I A;  5LYJ A;  3HKC B;  3IKF A;  1IV4 A;  5LOV A;  1QVF F;  2HRU A;  5HP7 A;  1SA0 A;  3K12 A;  2Q1X A;  4FFB B;  4NWO B;  1JFF B;  3F0D A;  4X3L A;  2VAM A;  4G4V A;  3G6E F;  1YJ9 F;  5HWE A;  1VQK F;  1W5B A;  4R40 B;  1RLG A;  5C8Y A;  3N2K A;  2UYP A;  4TV8 B;  1W57 A;  3WGN A;  5IJ9 A;  1SZQ A;  3HWU A;  3I7T A;  4O2B A;  4X1Y B;  4O2A B;  1W5E A;  3IMP A;  3QUW A;  1VK3 A;  2LBT A;  3VYT C;  3N2K B;  5HP8 A;  4IHJ B;  2Z1U A;  4G4Z A;  4ERH A;  5BMV A;  5JH7 B;  3CCQ F;  4X1Y A;  2RHL A;  3UT5 B;  4YJ2 A;  3J7A R;  4LNU B;  1ODE A;  3GHZ A;  3V4D A;  4ZOL B;  1KQS F;  4U3J A;  1W3E X;  2OTL F;  2OTJ F;  4BT5 A;  2OTM A;  4TV9 B;  1VQ6 F;  2BTQ B;  1XV2 A;  3K14 A;  1JJ2 F;  2FGY A;  1NQ3 A;  3CCL F;  3WGM A;  3RYI B;  5LA6 B;  3S0Y A;  4I50 A;  5CA1 A;  4ZK7 A;  1U43 A;  3I56 F;  3P10 A;  3MCQ A;  4TV9 A;  3ZP4 A;  1VQO F;  3EOR A;  1Q7Y H;  1H48 A;  2Z01 A;  5EO3 A;  3M1X A;  4DRX A;  2B33 A;  3ELC A;  4RHA A;  4F6R B;  4B5C A;  4HNA B;  5GIO C;  5ITZ B;  5FNV B;  2LBX A;  3VI6 A;  1UFY A;  2FC3 A;  5JVD B;  4G4X A;  1XHO A;  3CPQ A;  3CYQ A;  1UI9 A;  2Z1F A;  3O85 A;  2ZVZ A;  3N2G A;  4BW0 B;  5LOV B;  1RLU A;  4EI9 A;  3VTI C;  4RQO A;  5IYZ A;  3N4Y A;  4X1I B;  5LXT B;  3LWP C;  3LWR C;  1W5F A;  5KX5 A;  3FPI A;  2PMP A;  1JN1 A;  2CW4 A;  2ZAU A;  2UYN A;  3B6N A;  4BVR A;  1M1K H;  5EYP A;  3CCS F;  3HKB B;  1R1M A;  5CA0 A;  3WGK A;  3K2X A;  1IV3 A;  1FFX B;  1OFU A;  3JAL B;  3VYU C;  1VQ8 F;  3V3T A;  4ZHQ A;  1SDS A;  1COM A;  1T0K B;  5HXZ A;  1CK2 A;  3JAT A;  3WXM B;  4ZI7 A;  3I55 F;  4B45 A;  4TZZ A;  3LDT A;  3T80 A;  4C4W C;  1T0A A;  1RA4 A;  3VIU A;  4WBN A;  2WAL A;  2QI2 A;  3NVI B;  4BT2 A;  2K1S A;  5EWR A;  3JAW A;  4X1K A;  2CWJ A;  4U3J B;  2PHN A;  5GIN C;  5LP6 C;  4C8E A;  1W55 A;  2CVL A;  1U3P A;  4O4L B;  3P0Z A;  3WJR A;  3WGL A;  1CLI A;  2HP0 A;  1KD1 H;  2I6D A;  2QEX F;  4G4W A;  1YJW F;  3D54 A;  3CC2 F;  5EAZ A;  4U39 A;  4G4Y A;  5IJ0 B;  1U40 A;  2YYE A;  1KNK A;  2HRY A;  2HS0 A;  3HAX D;  5GIP C;  1N8R H;  1YIJ F;  4EI8 A;  2V9Y A;  5HXU A;  2CSL A;  1Q8R A;  2Z1E A;  3M4S A;  3Q8H A;  3HKE A;  2AIZ P;  3F0E A;  3LWO C;  2H8C A;  3S0W A;  1CN7 A;  2DT4 A;  3C9U A;  3K0T A;  1ONI A;  3ZP7 A;  3HKD B;  1GO0 A;  4DRX B;  2HP3 A;  5KX5 B;  2Q1Y A;  2R75 1;  5MN4 A;  3JAM M;  2Z1T A;  1YHQ F;  1RQ2 A;  3JAK B;  3JVH A;  4EB6 B;  2LCA A;  3VOB A;  3G4S F;  1JY8 A;  3JAL A;  4FFB A;  3KIZ A;  3L7Q A;  3LWQ C;  5EZY B;  3S06 A;  3E22 A;  4O4J B;  4O4I B;  5DCV A;  1W42 A;  3I3F A;  5FLX M;  1E7K A;  4BT3 A;  3TD4 A;  3WJQ A;  5IJ9 B;  4KWE A;  1Q82 H;  3PAF A;  4X1I A;  5LXT A;  4ZHQ B;  3CME F;  2RB9 A;  3MQW A;  1FNJ A;  5EB1 B;  1W41 A;  3FFM A;  4C82 A;  2GLZ A;  3RA6 A;  1TVK B;  2GVI A;  3S02 A;  4NUT A;  3BYQ A;  3CYP B;  1VQN F;  2IQQ A;  3OBW A;  1W59 A;  2EWC A;  1W58 1;  4O2B B;  3CXC F;  3GYQ A;  1ZWZ A;  3CPW F;  2DYY A;  4I4T B;  1TVK A;  4C81 A;  3LWV C;  2UYJ A;  1KC8 H;  1GZ0 A;  5GON A;  3DC2 A;  4BT6 A;  1IPA A;  3SIU A;  3MBM A;  2BTU A;  4X20 B;  4YJ2 B;  2KTU A;  4I50 B;  5CA1 B;  4EI7 A;  5MN6 A;  3RYH A;  1VQ5 F;  2MQE A;  2VAW A;  1VQM F;  3QTY A;  5J2U B;  3DDN A;  4F6R A;  2I6R A;  1GX1 A;  3IEW A;  5HY1 A;  1X25 A;  5HY2 A;  1KNJ A;  4M8I A;  3HJW C;  3VCZ A;  2H6L A;  5AVM A;  1VHA A;  3VOA A;  1VQL F;  3FD5 A;  3F0G A;  4I55 A;  5CB4 B;  3UT5 A;  2F9Z C;  3JAS B;  3KHN A;  3V7E A;  3RYC B;  1TUB A;  2RHH A;  2CHS A;  1DBF A;  1H47 A;  2RHJ A;  3HKC A;  2W8B C;  3AGK A;  1X7P A;  4HNA A;  4I55 B;  5EYP B;  2VXY A;  1NMU B;  3MDO A;  1Z5V A;  4BVT A;  2CZW A;  5MN5 A;  1VQ7 F;  5G4U C;  4B46 A;  3CD6 F;  1JFF A;  5IYZ B;  3OON A;  5LA6 A;  5JVD A;  3KJJ A;  3LFO A;  3ON1 A;  3CB2 A;  3ZO8 A;  5GAP K;  1VQ4 F;  5FJ4 C;  5C8Y B;  3E20 B;  4G88 A;  3LME A;  1S72 F;  2OZB A;  3C8L A;  4O2A A;  3R0P A;  5LYJ B;  4BY9 D;  3G71 F;  2H8E A;  3E22 B;  2R6R 1;  3RYF A;  5BMV B;  5A2Q M;  3MCA B;  1K8A H;  1IV1 A;  4ZHV A;  1FSZ A;  3OBY A;  3NK7 A;  5B8F A;  5LP6 A;  5HY4 A;  3F6M A;  5IT9 M;  2VGM A;  2ZOD A;  4PWT A;  4BT7 A;  1U3L A;  1YGY A;  5HY0 A;  4LCK A;  5LP6 B;  2CHT A;  2HX0 A;  3PLA C;  3J81 M;  1FNK A;  4IHJ A;  5EIB D;  4ZHY B;  1X52 A;  2RHO A;  5JQG B;  2UYK A;  3JCM M;  3VYS C;  3V7Q A;  5EB0 A;  3WGJ A;  5GAN K;  3WPW A;  1QAH A;  3OW2 F;  1W2B F;  1YQN A;  3JAS A;  4X20 A;  1XRG A;  3CG6 A;  5KMG A;  4TUY B;  3C9S A;  4ZHW A;  2AIF A;  3RYH B;  5JH7 A;  4YJ3 A;  3HKE B;  3KE1 A;  3RYI A;  3TD3 A;  4B62 A;  4TUY A;  3C9T A;  1NJI H;  2KG4 A;  4YJ3 B;  2VAP A;  3IKE A;  3TD5 A;  3CC7 F;  3NVK E;  5J2T B;  5EIB C;  3E1Y A;  1RQ7 A;  3RA5 A;  4BVS A;  1QD9 A;  3N4Z A;  3NMU C;  2N48 A;  1OAP A;  3D00 A;  2OHW A;  3FD6 A;  2L26 A;  3D01 A;  4DXD A;  3WPX A;  4ZI7 B;  2AMT A;  3CCR F;  3IEQ A;  4E6E A;  2ZF8 A;  3VMF B;  3CC4 F;  4XCQ A;  1FFX A;  3CCU F;  2IAF A;  4X3M A;  2VGN A;  3QHD A;  3NK6 A;  3FBA A;  1K9M H;  3ZOP A;  4O4J A;  4O4I A;  4O4H A;  3HKD A;  3IR9 A;  3WJP A;  3U0O A;  1VQ9 F;  2KGW A;  3RYF B;  4C8I A;  4O4H B;  1W5A A;  3JAT B;  3ESJ A;  3JAR A;  1YJN F;  4IIJ B;  3C9R A;  3JAW B;  4X1K B;  5G4V C;  2QA4 F;  4TV8 A;  5CA0 B;  4C8G A;  3HTN A;  4I4T A;  5JQG A;  4LNU A;  4IIJ A;  4ZOL A;  2HVY D;  1Q81 H;  5GON B;  3LYB A;  1XBI A;  2ALE A;  1QU9 A;  3RE3 A;  3CCE F;  1X7O A;  4NQ3 A;  1GO1 A;  1W40 A;  5KMG B;  3F0F A;  2YXZ A;  1K73 H;  4WBN B;  3CCM F;  2LBW A;  3J80 M;  1TUB B;  1QVG F;  5IJ0 A;  5JCO A;  1VH8 A;  5J2T A;  2GZL A;  3M84 A;  3S03 A;  1Z5W A;  2KTV A;  2NMU A;  4O4L A;  2BTO A;  2HS3 A;  2HP0 B;  5ITZ A;  2ZOV A;  2HQS C;  4BT4 A;  1H7M A;  3KJK A;  2IG8 A;  1VQV A;  2HS4 A;  3CMA F;  1VQP F;  5CB4 A;  5FNV A;  1JD1 A;  3CCJ F;  1IV2 A;  3CCV F;  1PXW A;  1Q86 H;  5J2U A;  3RYC A;  4BVQ A;  3ERN A;  1YI2 F;  1YIT F;  5EZY A;  2UYN B;  3N2G B;  3GTZ A;  3VO8 A;  2BO1 A;  3P4E A;  1M90 H;  3JAK A;  4EB6 A;  1J7H A; 
#chains in the Genus database with same CATH homology
 1DT9 A;  2KG4 A;  3CC7 F;  3NVK E;  1VQ5 F;  4C4W C;  1RA4 A;  3E1Y A;  3RA5 A;  2JNB A;  3SIV A;  1VQM F;  4BVS A;  2WAL A;  3N4Z A;  3NMU C;  2QI2 A;  3NVI B;  1QVF F;  5EWR A;  3D00 A;  5HY1 A;  2OHW A;  5HY2 A;  5GIN C;  3HJW C;  3CCR F;  1VQL F;  3VMF B;  1KD1 H;  3CC4 F;  2I6D A;  3G6E F;  4X3L A;  2F9Z C;  2QEX F;  4XCQ A;  3V7E A;  1YJ9 F;  5HWE A;  3CC2 F;  1YJW F;  1VQK F;  3CCU F;  1RLG A;  4X3M A;  2VGN A;  3NK6 A;  3AGK A;  1X7P A;  1K9M H;  1NMU B;  4BVT A;  2CZW A;  3HAX D;  1VQ7 F;  3IR9 A;  5GIP C;  5G4U C;  3CD6 F;  1N8R H;  1YIJ F;  4EI8 A;  1VQ9 F;  5HXU A;  3CCQ F;  3LFO A;  3ON1 A;  5GAP K;  1VQ4 F;  1YJN F;  3J7A R;  3LWO C;  5FJ4 C;  3E20 B;  1KQS F;  1S72 F;  5G4V C;  2QA4 F;  2OZB A;  1CN7 A;  1W3E X;  2OTL F;  2OTJ F;  1GO0 A;  2HVY D;  4BY9 D;  1VQ6 F;  3G71 F;  1Q81 H;  1JJ2 F;  3JAM M;  1XBI A;  2ALE A;  2FGY A;  3CCL F;  5A2Q M;  3MCA B;  3CCE F;  1X7O A;  1YHQ F;  1K8A H;  4NQ3 A;  1GO1 A;  3I56 F;  1W40 A;  3G4S F;  3OBY A;  3LWQ C;  3NK7 A;  1VQO F;  5HY4 A;  1Q7Y H;  5DCV A;  1K73 H;  5IT9 M;  2VGM A;  5EO3 A;  1W42 A;  3CCM F;  2LBW A;  5FLX M;  3J80 M;  1E7K A;  5HY0 A;  1QVG F;  4LCK A;  5GIO C;  3VI6 A;  2LBX A;  1Q82 H;  2FC3 A;  3PAF A;  2KTV A;  3CPQ A;  3PLA C;  3J81 M;  3O85 A;  3CME F;  4BW0 B;  4EI9 A;  1X52 A;  3N4Y A;  1W41 A;  3FFM A;  3LWP C;  1H7M A;  2GLZ A;  3JCM M;  3RA6 A;  3LWR C;  4NUT A;  3V7Q A;  5GAN K;  1VQN F;  4BVR A;  3OBW A;  1M1K H;  3CMA F;  3CCS F;  3OW2 F;  3CXC F;  1VQP F;  1W2B F;  3GYQ A;  1ZWZ A;  3CPW F;  3CCJ F;  3CCV F;  1PXW A;  1Q86 H;  3CG6 A;  4BVQ A;  1VQ8 F;  3V3T A;  1YI2 F;  1YIT F;  3LWV C;  1SDS A;  5HXZ A;  1T0K B;  1KC8 H;  2AIF A;  1GZ0 A;  1CK2 A;  1IPA A;  2BO1 A;  1M90 H;  3SIU A;  2KTU A;  3WXM B;  3I55 F;  4TZZ A;  1NJI H;  4EI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...