1RA4A

Crystal structure of the methanococcus jannaschii l7ae protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
117
structure length
117
Chain Sequence
MAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L7Ae
publication title The crystal structure of the Methanocaldococcus jannaschii multifunctional L7Ae RNA-binding protein reveals an induced-fit interaction with the box C/D RNAs.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Structural protein
total genus 36
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1ra4A00
4X3MA 2CZWA 1W42A 2KTUA 1W41A 2OZBA 3CCUF 5EWRA 1KC8H 2I6DA 1W2BF 3SIVA 1M1KH 3V7QA 1VQNF 1VQ8F 1SDSA 1RA4A 3CXCF 5FLXM 1X7PA 1CK2A 1QVFF 3LFOA 3OBWA 3CCVF 1K73H 3HAXD 3N4ZA 3OBYA 1S72F 1YIJF 3CCLF 3CCJF 2BO1A 1Q86H 3CCSF 3SIUA 1M90H 2JNBA 5G4VC 3J7AR 1VQOF 2KG4A 1VQ7F 1XBIA 1YI2F 2QA4F 3NVIB 3LWRC 3VMFB 1NJIH 1NMUB 1JJ2F 5GIOC 3WXMB 3E20B 1X52A 1X7OA 1VQ6F 3GYQA 4X3LA 3CC4F 2OHWA 1KD1H 5A2QM 1VQMF 3LWPC 3CD6F 3CCEF 5GINC 3J80M 3LWVC 1K8AH 1N8RH 3G4SF 3V7EA 2QEXF 1E7KA 3JCMM 1H7MA 3LWOC 4BY9D 4LCKA 1YJWF 2AIFA 2VGMA 3CCQF 1YJNF 3NK6A 5IT9M 1CN7A 3J81M 3CPQA 3G6EF 4NUTA 3O85A 1PXWA 3CC7F 3CPWF 3G71F 2KTVA 1Q82H 1VQKF 4BW0B 5GIPC 3OW2F 3LWQC 1DT9A 5DCVA 1GZ0A 5EO3A 3N4YA 1QVGF 3VI6A 3MCAB 3I56F 2QI2A 3CG6A 3CCRF 1VQ9F 3PAFA 3PLAC 1GO1A 3NMUC 1VQ4F 3AGKA 1YHQF 4C4WC 1ZWZA 2LBWA 3CMEF 1YJ9F 1Q7YH 1K9MH 3RA5A 5GAPK 1YITF 3CMAF 1IPAA 3JAMM 2OTLF 1VQ5F 3RA6A 3CCMF 5GANK 3I55F 2OTJF 3NVKE 2FC3A 1W3EX 1GO0A 3ON1A 1RLGA 3HJWC 1T0KB 2VGNA 5FJ4C 1VQPF 3FFMA 2ALEA 1W40A 1Q81H 1KQSF 2LBXA 2HVYD 3CC2F 5G4UC 4TZZA 3IR9A 3NK7A 3E1YA 2WALA 1VQLF
chains in the Genus database with same CATH superfamily
4X3MA 5LP6C 1W42A 1Q8RA 4ZI7A 3CCUF 4X1KB 3P10A 1W2BF 3V7QA 1M1KH 3RYHA 3WJQA 3SIVA 3CXCF 2DT4A 3S02A 1X7PA 2HS3A 1U43A 1QVFF 2P6YA 1QD9A 3HKEB 5HY1A 5J2TB 5ITZA 3WGLA 1S72F 3C9TA 3CCLF 3CCJF 5HP7A 3CCSF 1H47A 3E22A 3RYFB 1M90H 3SIUA 4G4XA 3J7AR 3GHZA 1VQOF 2KG4A 2ZF8A 4M8IA 4C82A 1IV3A 1RQ2A 4O4HA 3WJPA 4ZHQB 5EYPA 2L26A 3S0YA 2VAWA 3VMFB 1NJIH 3E20B 4U39A 3V4DA 1YQNA 1X52A 4TV9A 1VQ6F 4PWTA 3GYQA 4EB6A 4B62A 1KD1H 4X1IB 4IIJA 3LWPC 3CCEF 4U3JB 5EIBC 4ZHYB 4G4WA 1QU9A 4DXDA 2HS0A 5FNVA 3S0HA 3C9UA 3V7EA 4WBNA 4DRXB 1T0AA 1H7MA 2LCAA 3IEQA 3JCMM 1YJWF 3KIZA 3NK6A 5IT9M 2BTUA 2VAMA 1CN7A 4HNAA 3CPQA 3ESJA 3JASB 4NUTA 3G71F 5IJ0A 4IHJB 4C81A 4BW0B 3RYIB 2VXYA 5EO3A 3F0EA 3VI6A 3I56F 1JFFB 2AMTA 3HKDB 1VQ9F 1JD1A 3PAFA 5KMGB 3NMUC 1W5EA 3HKCA 1PF5A 1VQVA 2UYNA 4C4WC 4I55A 1Q7YH 1VHAA 5IYZA 5GAPK 3CYPB 4G4ZA 4FFBA 4KWEA 3CMAF 4ZHWA 3JAMM 3WPWA 2OTLF 5EB1B 5GANK 4YJ2A 5BMVA 1FFXB 2ZAUA 4O4IA 4BT6A 4BT4A 2PHNA 4O4JB 3D00A 1RLGA 3KHNA 4BT7A 4RHAA 4YJ3A 3K2XA 3QTYA 5J2UB 3EORA 5IJ9B 4O4LA 1H48A 2AIZP 5JCOC 2BTQB 2BTOA 5JVDB 3N2GA 5LP6A 4LNUA 5G4UC 2VAPA 4TZZA 1ONIA 3IR9A 2QA4F 4NQ3A 2OZBA 5EWRA 3VO8A 2I6DA 5JQGA 3BYQA 2H6LA 4X1YA 3V3TA 5FLXM 2IG8A 2Z1FA 3OBWA 3CCVF 5MN6A 2ZVYA 3HWUA 3HAXD 1SZQA 4O2AB 2FGYA 4TUYB 4F6RB 2YYEA 2HS4A 3JALB 5EZYA 3WGNA 2Q1YA 4ZI7B 4RQOA 2JNBA 1XRGA 2HQSC 3RYHB 4I4TB 1VQ7F 5JH7A 3FD6A 3MCQA 5LYJB 2Q1XA 2QTPA 1W5AA 2HRYA 3LDTA 5ITZB 3IMPA 2RHJA 5GIOC 1U3LA 2ZVZA 4TV8B 1FNKA 1X7OA 2HP3A 3ZOPA 4X3LA 5B8FA 5A2QM 4X20A 5GINC 5HWEA 3FBAA 2RHLA 4BVQA 3JAKA 3LWVC 2IAFA 2CVLA 1E7KA 3LWOC 4TV9B 4LCKA 3FPIA 5HXUA 3RYCB 1YJNF 1W57A 2UYKA 4IIJB 3J81M 3FD5A 5EIBD 3G6EF 5CA0A 5LXTA 5EB0A 3CPWF 3HTNA 1VQKF 3ERNA 4G4YA 5GIPC 5FNVB 3L7QA 5EAZA 2Z1EA 3LWQC 1DT9A 1GZ0A 5CB4A 1QVGF 1VK3A 2QI2A 3CCRF 3VCZA 5IJ0B 3AGKA 5LOVB 1ZWZA 4ZOLA 5MN5A 1UFYA 5J2TA 1DBFA 4O2BA 3F6MA 3RYFA 4I50A 3CCMF 2UYNB 1TVKA 1TUBA 4I55B 3NVKE 1GO0A 3ON1A 4EI9A 3K0TA 4FFBB 5JCOA 3LYBA 3HJWC 2CHSA 1JN1A 3D54A 2VGNA 5FJ4C 3UT5A 3N2KA 3WPXA 4YJ2B 3I7TA 2H8EA 5BMVB 2H8CA 2ZOVA 2Z1TA 3QHDA 4X1IA 3S03A 2F9ZC 1KQSF 4U3JA 3IKFA 3DDNA 3S0WA 3CC2F 3E1YA 1VQLF 1W41A 4DRXA 4O4LB 1Z5VA 2V9YA 3C8LA 1SA0B 5HY0A 1VQNF 1VQ8F 1SDSA 1RA4A 2UZHA 4B45A 3N2GB 1CK2A 4BT2A 4C8IA 5LP6B 2YXZA 3F0FA 1K73H 3WGMA 1QAHA 2HRUA 1KNJA 5GONB 2BO1A 1Q86H 1COMA 1JY8A 3QUWA 1XBIA 4ZHVA 1JFFA 5CA1B 1YI2F 1W55A 3NVIB 2G9IA 3WGKA 2RHOA 3CYQA 3JAWA 1JJ2F 3R0PA 5EZYB 1UI9A 4BT5A 3CC4F 2OHWA 3F0DA 1VQMF 3J80M 3IEWA 2HP0B 1FFXA 3LMEA 1YGYA 3G4SF 2B33A 2PMPA 3M4SA 1W5BA 3JVHA 4O4JA 4BY9D 2AIFA 5LA6A 3CCQF 1R1MA 3JATA 1X25A 3K12A 3TD4A 3O85A 5IJ9A 1PXWA 2OTMA 3CC7F 2Z1UA 2KTVA 1Q82H 3OW2F 1W581 3U0OA 3F0GA 4B46A 3HKBA 3E22B 2R751 5DCVA 2MQEA 3VYUC 3N4YA 4BVTA 1Z5WA 2IQQA 4O4HB 2LBTA 5EYPB 3C9SA 5C8YA 2DYYA 5CA0B 3PLAC 1GO1A 1VQ4F 3VOBA 1YHQF 3D01A 1YJ9F 1IV4A 4XCQA 5KX5A 4EB6B 5CB4B 3JALA 2EWCA 5HY4A 3DC2A 3RA6A 3KE1A 4I4TA 2KGWA 3JARA 4E6EA 3MQWA 3OONA 3I55F 4WBNB 2CWJA 4ZOLB 5LYJA 2FC3A 3RE3A 1VH8A 1W3EX 3Q8HA 4O2BB 4HNAB 4TV8A 2GVIA 3MDOA 3M84A 1FNJA 4I50B 4X1KA 1VQPF 1RQ7A 4BT3A 2ZODA 1W5FA 1W40A 2Z01A 1TVKB 1TUBB 1W59A 2LBXA 2HVYD 2R6R1 4R40B 3HKEA 4B5CA 1KNKA 2WALA 2CZWA 2KTUA 3VOAA 3P4EA 3UT5B 3VYTC 1GX1A 1KC8H 3N2KB 3RYCA 3HKCB 3S06A 3M1XA 5IYZB 3LFOA 4ZHQA 1NQ3A 3N4ZA 3OBYA 3I3FA 1YIJF 1IV1A 5G4VC 3CB2A 2HX0A 4O4IB 1ODEA 3ZP7A 4EI7A 3TD5A 3LWRC 3TD3A 4ERHA 1NMUB 5LOVA 1FSZA 4YJ3B 4NWOB 3P0ZA 2CHTA 2RB9A 3WJRA 3WXMB 4BVRA 2GZLA 3VIUA 3CD6F 2UYPA 3JASA 2CSLA 4LNUB 4IHJA 4ZK7A 1N8RH 1K8AH 3JAWB 3VYSC 3RYIA 4G88A 2QEXF 4BVSA 1RLUA 5JQGB 4X1YB 2VGMA 4EI8A 3VTIC 3HKDA 5KMGA 2K1SA 5LA6B 3WGJA 5JH7B 3JATB 3MCAB 3CG6A 1U3PA 2I6RA 1SA0A 5MN4A 3KJKA 1IV2A 2LBWA 2N48A 3CMEF 4C8EA 1K9MH 2GLZA 1OFUA 3HKBB 3RA5A 4G4VA 1YITF 2W8BC 3MBMA 4X20B 3ZP4A 1IPAA 5GONA 5J2UA 1VQ5F 3KJJA 5C8YB 3IKEA 3JAKB 1J7HA 3ELCA 1CLIA 5JVDA 3C9RA 5CA1A 2UYJA 2OTJF 2NMUA 5KX5B 1XV2A 4C8GA 3T80A 1XHOA 3B6NA 1T0KB 1U40A 5HY2A 5LXTB 3K14A 3GTZA 5HXZA 1OAPA 3FFMA 2ALEA 3JARB 1Q81H 2CW4A 3ZO8A 5HP8A 2HP0A 5AVMA 2RHHA 4O2AA 4TUYA 4F6RA 3NK7A
chains in the Genus database with same CATH topology
4NQ3A 4X3MA 2CZWA 1W42A 2KTUA 1W41A 2OZBA 3CCUF 5EWRA 1KC8H 2I6DA 1W2BF 3SIVA 1M1KH 3V7QA 5HY0A 1VQNF 1VQ8F 3V3TA 1SDSA 1RA4A 3CXCF 5FLXM 1X7PA 1CK2A 1QVFF 3LFOA 3OBWA 3CCVF 1K73H 3HAXD 5HY1A 3N4ZA 3OBYA 2FGYA 1S72F 1YIJF 3CCLF 3CCJF 2BO1A 1Q86H 3CCSF 3SIUA 1M90H 2JNBA 5G4VC 3J7AR 1VQOF 2KG4A 1VQ7F 1XBIA 1YI2F 4EI7A 2QA4F 3NVIB 3LWRC 3VMFB 1NJIH 1NMUB 1JJ2F 5GIOC 3WXMB 3E20B 1X52A 1X7OA 1VQ6F 4BVRA 3GYQA 4X3LA 3CC4F 2OHWA 1KD1H 5A2QM 1VQMF 3LWPC 3CD6F 3CCEF 5GINC 5HWEA 3J80M 4BVQA 3LWVC 1K8AH 1N8RH 3G4SF 3V7EA 2QEXF 4BVSA 3JCMM 1H7MA 3LWOC 4BY9D 1E7KA 5HXUA 1YJWF 2AIFA 4LCKA 2VGMA 3CCQF 1YJNF 3NK6A 4EI8A 5IT9M 1CN7A 3J81M 3CPQA 3G6EF 4NUTA 3O85A 1PXWA 3CC7F 3CPWF 3G71F 2KTVA 1Q82H 1VQKF 4BW0B 5GIPC 3OW2F 3LWQC 1DT9A 5DCVA 1GZ0A 5EO3A 3N4YA 1QVGF 4BVTA 3VI6A 3MCAB 3I56F 2QI2A 3CG6A 3CCRF 1VQ9F 3PAFA 3PLAC 1GO1A 3NMUC 1VQ4F 3AGKA 1YHQF 4C4WC 1ZWZA 2LBWA 3CMEF 1YJ9F 1Q7YH 1K9MH 2GLZA 3RA5A 5GAPK 4XCQA 1YITF 3CMAF 1IPAA 3JAMM 2OTLF 5HY4A 1VQ5F 3RA6A 3CCMF 5GANK 3I55F 2OTJF 3NVKE 2FC3A 3D00A 1W3EX 1GO0A 3ON1A 1RLGA 4EI9A 3HJWC 1T0KB 2VGNA 5HY2A 5FJ4C 5HXZA 1VQPF 3FFMA 2ALEA 1W40A 1Q81H 1KQSF 2F9ZC 2LBXA 2HVYD 3CC2F 5G4UC 4TZZA 3IR9A 3NK7A 3E1YA 2WALA 1VQLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3M A;  2CZW A;  1W42 A;  2KTU A;  1W41 A;  2OZB A;  3CCU F;  5EWR A;  1KC8 H;  2I6D A;  1W2B F;  3SIV A;  1M1K H;  3V7Q A;  1VQN F;  1VQ8 F;  1SDS A;  1RA4 A;  3CXC F;  5FLX M;  1X7P A;  1CK2 A;  1QVF F;  3LFO A;  3OBW A;  3CCV F;  1K73 H;  3HAX D;  3N4Z A;  3OBY A;  1S72 F;  1YIJ F;  3CCL F;  3CCJ F;  2BO1 A;  1Q86 H;  3CCS F;  3SIU A;  1M90 H;  2JNB A;  5G4V C;  3J7A R;  1VQO F;  2KG4 A;  1VQ7 F;  1XBI A;  1YI2 F;  2QA4 F;  3NVI B;  3LWR C;  3VMF B;  1NJI H;  1NMU B;  1JJ2 F;  5GIO C;  3WXM B;  3E20 B;  1X52 A;  1X7O A;  1VQ6 F;  3GYQ A;  4X3L A;  3CC4 F;  2OHW A;  1KD1 H;  5A2Q M;  1VQM F;  3LWP C;  3CD6 F;  3CCE F;  5GIN C;  3J80 M;  3LWV C;  1K8A H;  1N8R H;  3G4S F;  3V7E A;  2QEX F;  1E7K A;  3JCM M;  1H7M A;  3LWO C;  4BY9 D;  4LCK A;  1YJW F;  2AIF A;  2VGM A;  3CCQ F;  1YJN F;  3NK6 A;  5IT9 M;  1CN7 A;  3J81 M;  3CPQ A;  3G6E F;  4NUT A;  3O85 A;  1PXW A;  3CC7 F;  3CPW F;  3G71 F;  2KTV A;  1Q82 H;  1VQK F;  4BW0 B;  5GIP C;  3OW2 F;  3LWQ C;  1DT9 A;  5DCV A;  1GZ0 A;  5EO3 A;  3N4Y A;  1QVG F;  3VI6 A;  3MCA B;  3I56 F;  2QI2 A;  3CG6 A;  3CCR F;  1VQ9 F;  3PAF A;  3PLA C;  1GO1 A;  3NMU C;  1VQ4 F;  3AGK A;  1YHQ F;  4C4W C;  1ZWZ A;  2LBW A;  3CME F;  1YJ9 F;  1Q7Y H;  1K9M H;  3RA5 A;  5GAP K;  1YIT F;  3CMA F;  1IPA A;  3JAM M;  2OTL F;  1VQ5 F;  3RA6 A;  3CCM F;  5GAN K;  3I55 F;  2OTJ F;  3NVK E;  2FC3 A;  1W3E X;  1GO0 A;  3ON1 A;  1RLG A;  3HJW C;  1T0K B;  2VGN A;  5FJ4 C;  1VQP F;  3FFM A;  2ALE A;  1W40 A;  1Q81 H;  1KQS F;  2LBX A;  2HVY D;  3CC2 F;  5G4U C;  4TZZ A;  3IR9 A;  3NK7 A;  3E1Y A;  2WAL A;  1VQL F; 
#chains in the Genus database with same CATH topology
 4X3M A;  5LP6 C;  1W42 A;  1Q8R A;  4ZI7 A;  3CCU F;  4X1K B;  3P10 A;  1W2B F;  3V7Q A;  1M1K H;  3RYH A;  3WJQ A;  3SIV A;  3CXC F;  2DT4 A;  3S02 A;  1X7P A;  2HS3 A;  1U43 A;  1QVF F;  2P6Y A;  1QD9 A;  3HKE B;  5HY1 A;  5J2T B;  5ITZ A;  3WGL A;  1S72 F;  3C9T A;  3CCL F;  3CCJ F;  5HP7 A;  3CCS F;  1H47 A;  3E22 A;  3RYF B;  1M90 H;  3SIU A;  4G4X A;  3J7A R;  3GHZ A;  1VQO F;  2KG4 A;  2ZF8 A;  4M8I A;  4C82 A;  1IV3 A;  1RQ2 A;  4O4H A;  3WJP A;  4ZHQ B;  5EYP A;  2L26 A;  3S0Y A;  2VAW A;  3VMF B;  1NJI H;  3E20 B;  4U39 A;  3V4D A;  1YQN A;  1X52 A;  4TV9 A;  1VQ6 F;  4PWT A;  3GYQ A;  4EB6 A;  4B62 A;  1KD1 H;  4X1I B;  4IIJ A;  3LWP C;  3CCE F;  4U3J B;  5EIB C;  4ZHY B;  4G4W A;  1QU9 A;  4DXD A;  2HS0 A;  5FNV A;  3S0H A;  3C9U A;  3V7E A;  4WBN A;  4DRX B;  1T0A A;  1H7M A;  2LCA A;  3IEQ A;  3JCM M;  1YJW F;  3KIZ A;  3NK6 A;  5IT9 M;  2BTU A;  2VAM A;  1CN7 A;  4HNA A;  3CPQ A;  3ESJ A;  3JAS B;  4NUT A;  3G71 F;  5IJ0 A;  4IHJ B;  4C81 A;  4BW0 B;  3RYI B;  2VXY A;  5EO3 A;  3F0E A;  3VI6 A;  3I56 F;  1JFF B;  2AMT A;  3HKD B;  1VQ9 F;  1JD1 A;  3PAF A;  5KMG B;  3NMU C;  1W5E A;  3HKC A;  1PF5 A;  1VQV A;  2UYN A;  4C4W C;  4I55 A;  1Q7Y H;  1VHA A;  5IYZ A;  5GAP K;  3CYP B;  4G4Z A;  4FFB A;  4KWE A;  3CMA F;  4ZHW A;  3JAM M;  3WPW A;  2OTL F;  5EB1 B;  5GAN K;  4YJ2 A;  5BMV A;  1FFX B;  2ZAU A;  4O4I A;  4BT6 A;  4BT4 A;  2PHN A;  4O4J B;  3D00 A;  1RLG A;  3KHN A;  4BT7 A;  4RHA A;  4YJ3 A;  3K2X A;  3QTY A;  5J2U B;  3EOR A;  5IJ9 B;  4O4L A;  1H48 A;  2AIZ P;  5JCO C;  2BTQ B;  2BTO A;  5JVD B;  3N2G A;  5LP6 A;  4LNU A;  5G4U C;  2VAP A;  4TZZ A;  1ONI A;  3IR9 A;  2QA4 F;  4NQ3 A;  2OZB A;  5EWR A;  3VO8 A;  2I6D A;  5JQG A;  3BYQ A;  2H6L A;  4X1Y A;  3V3T A;  5FLX M;  2IG8 A;  2Z1F A;  3OBW A;  3CCV F;  5MN6 A;  2ZVY A;  3HWU A;  3HAX D;  1SZQ A;  4O2A B;  2FGY A;  4TUY B;  4F6R B;  2YYE A;  2HS4 A;  3JAL B;  5EZY A;  3WGN A;  2Q1Y A;  4ZI7 B;  4RQO A;  2JNB A;  1XRG A;  2HQS C;  3RYH B;  4I4T B;  1VQ7 F;  5JH7 A;  3FD6 A;  3MCQ A;  5LYJ B;  2Q1X A;  2QTP A;  1W5A A;  2HRY A;  3LDT A;  5ITZ B;  3IMP A;  2RHJ A;  5GIO C;  1U3L A;  2ZVZ A;  4TV8 B;  1FNK A;  1X7O A;  2HP3 A;  3ZOP A;  4X3L A;  5B8F A;  5A2Q M;  4X20 A;  5GIN C;  5HWE A;  3FBA A;  2RHL A;  4BVQ A;  3JAK A;  3LWV C;  2IAF A;  2CVL A;  1E7K A;  3LWO C;  4TV9 B;  4LCK A;  3FPI A;  5HXU A;  3RYC B;  1YJN F;  1W57 A;  2UYK A;  4IIJ B;  3J81 M;  3FD5 A;  5EIB D;  3G6E F;  5CA0 A;  5LXT A;  5EB0 A;  3CPW F;  3HTN A;  1VQK F;  3ERN A;  4G4Y A;  5GIP C;  5FNV B;  3L7Q A;  5EAZ A;  2Z1E A;  3LWQ C;  1DT9 A;  1GZ0 A;  5CB4 A;  1QVG F;  1VK3 A;  2QI2 A;  3CCR F;  3VCZ A;  5IJ0 B;  3AGK A;  5LOV B;  1ZWZ A;  4ZOL A;  5MN5 A;  1UFY A;  5J2T A;  1DBF A;  4O2B A;  3F6M A;  3RYF A;  4I50 A;  3CCM F;  2UYN B;  1TVK A;  1TUB A;  4I55 B;  3NVK E;  1GO0 A;  3ON1 A;  4EI9 A;  3K0T A;  4FFB B;  5JCO A;  3LYB A;  3HJW C;  2CHS A;  1JN1 A;  3D54 A;  2VGN A;  5FJ4 C;  3UT5 A;  3N2K A;  3WPX A;  4YJ2 B;  3I7T A;  2H8E A;  5BMV B;  2H8C A;  2ZOV A;  2Z1T A;  3QHD A;  4X1I A;  3S03 A;  2F9Z C;  1KQS F;  4U3J A;  3IKF A;  3DDN A;  3S0W A;  3CC2 F;  3E1Y A;  1VQL F;  1W41 A;  4DRX A;  4O4L B;  1Z5V A;  2V9Y A;  3C8L A;  1SA0 B;  5HY0 A;  1VQN F;  1VQ8 F;  1SDS A;  1RA4 A;  2UZH A;  4B45 A;  3N2G B;  1CK2 A;  4BT2 A;  4C8I A;  5LP6 B;  2YXZ A;  3F0F A;  1K73 H;  3WGM A;  1QAH A;  2HRU A;  1KNJ A;  5GON B;  2BO1 A;  1Q86 H;  1COM A;  1JY8 A;  3QUW A;  1XBI A;  4ZHV A;  1JFF A;  5CA1 B;  1YI2 F;  1W55 A;  3NVI B;  2G9I A;  3WGK A;  2RHO A;  3CYQ A;  3JAW A;  1JJ2 F;  3R0P A;  5EZY B;  1UI9 A;  4BT5 A;  3CC4 F;  2OHW A;  3F0D A;  1VQM F;  3J80 M;  3IEW A;  2HP0 B;  1FFX A;  3LME A;  1YGY A;  3G4S F;  2B33 A;  2PMP A;  3M4S A;  1W5B A;  3JVH A;  4O4J A;  4BY9 D;  2AIF A;  5LA6 A;  3CCQ F;  1R1M A;  3JAT A;  1X25 A;  3K12 A;  3TD4 A;  3O85 A;  5IJ9 A;  1PXW A;  2OTM A;  3CC7 F;  2Z1U A;  2KTV A;  1Q82 H;  3OW2 F;  1W58 1;  3U0O A;  3F0G A;  4B46 A;  3HKB A;  3E22 B;  2R75 1;  5DCV A;  2MQE A;  3VYU C;  3N4Y A;  4BVT A;  1Z5W A;  2IQQ A;  4O4H B;  2LBT A;  5EYP B;  3C9S A;  5C8Y A;  2DYY A;  5CA0 B;  3PLA C;  1GO1 A;  1VQ4 F;  3VOB A;  1YHQ F;  3D01 A;  1YJ9 F;  1IV4 A;  4XCQ A;  5KX5 A;  4EB6 B;  5CB4 B;  3JAL A;  2EWC A;  5HY4 A;  3DC2 A;  3RA6 A;  3KE1 A;  4I4T A;  2KGW A;  3JAR A;  4E6E A;  3MQW A;  3OON A;  3I55 F;  4WBN B;  2CWJ A;  4ZOL B;  5LYJ A;  2FC3 A;  3RE3 A;  1VH8 A;  1W3E X;  3Q8H A;  4O2B B;  4HNA B;  4TV8 A;  2GVI A;  3MDO A;  3M84 A;  1FNJ A;  4I50 B;  4X1K A;  1VQP F;  1RQ7 A;  4BT3 A;  2ZOD A;  1W5F A;  1W40 A;  2Z01 A;  1TVK B;  1TUB B;  1W59 A;  2LBX A;  2HVY D;  2R6R 1;  4R40 B;  3HKE A;  4B5C A;  1KNK A;  2WAL A;  2CZW A;  2KTU A;  3VOA A;  3P4E A;  3UT5 B;  3VYT C;  1GX1 A;  1KC8 H;  3N2K B;  3RYC A;  3HKC B;  3S06 A;  3M1X A;  5IYZ B;  3LFO A;  4ZHQ A;  1NQ3 A;  3N4Z A;  3OBY A;  3I3F A;  1YIJ F;  1IV1 A;  5G4V C;  3CB2 A;  2HX0 A;  4O4I B;  1ODE A;  3ZP7 A;  4EI7 A;  3TD5 A;  3LWR C;  3TD3 A;  4ERH A;  1NMU B;  5LOV A;  1FSZ A;  4YJ3 B;  4NWO B;  3P0Z A;  2CHT A;  2RB9 A;  3WJR A;  3WXM B;  4BVR A;  2GZL A;  3VIU A;  3CD6 F;  2UYP A;  3JAS A;  2CSL A;  4LNU B;  4IHJ A;  4ZK7 A;  1N8R H;  1K8A H;  3JAW B;  3VYS C;  3RYI A;  4G88 A;  2QEX F;  4BVS A;  1RLU A;  5JQG B;  4X1Y B;  2VGM A;  4EI8 A;  3VTI C;  3HKD A;  5KMG A;  2K1S A;  5LA6 B;  3WGJ A;  5JH7 B;  3JAT B;  3MCA B;  3CG6 A;  1U3P A;  2I6R A;  1SA0 A;  5MN4 A;  3KJK A;  1IV2 A;  2LBW A;  2N48 A;  3CME F;  4C8E A;  1K9M H;  2GLZ A;  1OFU A;  3HKB B;  3RA5 A;  4G4V A;  1YIT F;  2W8B C;  3MBM A;  4X20 B;  3ZP4 A;  1IPA A;  5GON A;  5J2U A;  1VQ5 F;  3KJJ A;  5C8Y B;  3IKE A;  3JAK B;  1J7H A;  3ELC A;  1CLI A;  5JVD A;  3C9R A;  5CA1 A;  2UYJ A;  2OTJ F;  2NMU A;  5KX5 B;  1XV2 A;  4C8G A;  3T80 A;  1XHO A;  3B6N A;  1T0K B;  1U40 A;  5HY2 A;  5LXT B;  3K14 A;  3GTZ A;  5HXZ A;  1OAP A;  3FFM A;  2ALE A;  3JAR B;  1Q81 H;  2CW4 A;  3ZO8 A;  5HP8 A;  2HP0 A;  5AVM A;  2RHH A;  4O2A A;  4TUY A;  4F6R A;  3NK7 A; 
#chains in the Genus database with same CATH homology
 4NQ3 A;  4X3M A;  2CZW A;  1W42 A;  2KTU A;  1W41 A;  2OZB A;  3CCU F;  5EWR A;  1KC8 H;  2I6D A;  1W2B F;  3SIV A;  1M1K H;  3V7Q A;  5HY0 A;  1VQN F;  1VQ8 F;  3V3T A;  1SDS A;  1RA4 A;  3CXC F;  5FLX M;  1X7P A;  1CK2 A;  1QVF F;  3LFO A;  3OBW A;  3CCV F;  1K73 H;  3HAX D;  5HY1 A;  3N4Z A;  3OBY A;  2FGY A;  1S72 F;  1YIJ F;  3CCL F;  3CCJ F;  2BO1 A;  1Q86 H;  3CCS F;  3SIU A;  1M90 H;  2JNB A;  5G4V C;  3J7A R;  1VQO F;  2KG4 A;  1VQ7 F;  1XBI A;  1YI2 F;  4EI7 A;  2QA4 F;  3NVI B;  3LWR C;  3VMF B;  1NJI H;  1NMU B;  1JJ2 F;  5GIO C;  3WXM B;  3E20 B;  1X52 A;  1X7O A;  1VQ6 F;  4BVR A;  3GYQ A;  4X3L A;  3CC4 F;  2OHW A;  1KD1 H;  5A2Q M;  1VQM F;  3LWP C;  3CD6 F;  3CCE F;  5GIN C;  5HWE A;  3J80 M;  4BVQ A;  3LWV C;  1K8A H;  1N8R H;  3G4S F;  3V7E A;  2QEX F;  4BVS A;  3JCM M;  1H7M A;  3LWO C;  4BY9 D;  1E7K A;  5HXU A;  1YJW F;  2AIF A;  4LCK A;  2VGM A;  3CCQ F;  1YJN F;  3NK6 A;  4EI8 A;  5IT9 M;  1CN7 A;  3J81 M;  3CPQ A;  3G6E F;  4NUT A;  3O85 A;  1PXW A;  3CC7 F;  3CPW F;  3G71 F;  2KTV A;  1Q82 H;  1VQK F;  4BW0 B;  5GIP C;  3OW2 F;  3LWQ C;  1DT9 A;  5DCV A;  1GZ0 A;  5EO3 A;  3N4Y A;  1QVG F;  4BVT A;  3VI6 A;  3MCA B;  3I56 F;  2QI2 A;  3CG6 A;  3CCR F;  1VQ9 F;  3PAF A;  3PLA C;  1GO1 A;  3NMU C;  1VQ4 F;  3AGK A;  1YHQ F;  4C4W C;  1ZWZ A;  2LBW A;  3CME F;  1YJ9 F;  1Q7Y H;  1K9M H;  2GLZ A;  3RA5 A;  5GAP K;  4XCQ A;  1YIT F;  3CMA F;  1IPA A;  3JAM M;  2OTL F;  5HY4 A;  1VQ5 F;  3RA6 A;  3CCM F;  5GAN K;  3I55 F;  2OTJ F;  3NVK E;  2FC3 A;  3D00 A;  1W3E X;  1GO0 A;  3ON1 A;  1RLG A;  4EI9 A;  3HJW C;  1T0K B;  2VGN A;  5HY2 A;  5FJ4 C;  5HXZ A;  1VQP F;  3FFM A;  2ALE A;  1W40 A;  1Q81 H;  1KQS F;  2F9Z C;  2LBX A;  2HVY D;  3CC2 F;  5G4U C;  4TZZ A;  3IR9 A;  3NK7 A;  3E1Y A;  2WAL A;  1VQL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...