1RA4A

Crystal structure of the methanococcus jannaschii l7ae protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
117
structure length
117
Chain Sequence
b'MAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the Methanocaldococcus jannaschii multifunctional L7Ae RNA-binding protein reveals an induced-fit interaction with the box C/D RNAs.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L7Ae
source organism Methanocaldococcus jannaschii
molecule tags Structural protein
total genus 36
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1ra4A00
4X3MA 1NMUB 1Q86H 3AGKA 1Q81H 2KTUA 4LCKA 5G4VC 3RA5A 1YITF 1W2BF 1M1KH 4TZZA 3SIVA 4BY9D 2LBXA 5EWRA 3CCLF 3CCMF 1YHQF 1YJWF 1QVGF 2HVYD 2WALA 3N4YA 1M90H 2AIFA 5GIPC 1YI2F 1GO1A 1W41A 1CK2A 3CC7F 1K8AH 3J80M 1DT9A 2QI2A 5A2QM 1X7PA 2JNBA 5GIOC 1KC8H 3J7AR 2OZBA 1VQ6F 3CCJF 2OTJF 3J81M 3CCEF 1X52A 3CCVF 2CZWA 3G4SF 3CMEF 1YJ9F 1KD1H 1JJ2F 2OTLF 1GZ0A 3CC2F 1NJIH 3CCQF 2KG4A 4BW0B 2VGNA 1VQMF 3RA6A 1VQ4F 3I56F 1YIJF 3PLAC 3LWQC 3G71F 2OHWA 3NK6A 2I6DA 1Q7YH 3CCRF 3NK7A 2LBWA 1XBIA 3CG6A 1VQPF 1K9MH 1SDSA 3SIUA 4X3LA 2ALEA 1VQKF 3I55F 5IT9M 3FFMA 1VQ5F 1E7KA 3CPQA 3N4ZA 3LWOC 3V7EA 3NMUC 3OBYA 1VQNF 5G4UC 2FC3A 4C4WC 3CXCF 3E20B 3OBWA 1RA4A 3LWPC 2QEXF 1VQ8F 3VI6A 5FLXM 1W3EX 2BO1A 1Q82H 3HAXD 3JAMM 2KTVA 1H7MA 5GINC 3IR9A 1IPAA 3LFOA 5GANK 2QA4F 3GYQA 3CPWF 3O85A 1W42A 1GO0A 3JCMM 3MCAB 5GAPK 3CMAF 5EO3A 3OW2F 1ZWZA 3V7QA 1K73H 3G6EF 3LWRC 1X7OA 5DCVA 3NVIB 3CD6F 3VMFB 1N8RH 3HJWC 5FJ4C 1QVFF 1PXWA 3ON1A 1VQLF 1KQSF 3PAFA 3CCUF 1T0KB 3CC4F 1VQOF 3NVKE 1W40A 4NUTA 1RLGA 1CN7A 1YJNF 3E1YA 3WXMB 3LWVC 1VQ7F 1VQ9F 2VGMA 1S72F 3CCSF
chains in the Genus database with same CATH superfamily
1OFUA 4FFBA 5JQGA 3GHZA 2KTUA 4X1KA 4F6RA 4LCKA 1YITF 2OTMA 2Q1XA 3ELCA 4FFBB 5HXZA 5JQGB 4BY9D 3CCMF 2UYJA 4X1KB 4F6RB 2FGYA 1M90H 5FNVA 4O2AA 2GVIA 3C9UA 3ERNA 1GO1A 2HP0A 3F0FA 5IYZA 3J80M 5FNVB 4O2AB 1KC8H 5GIOC 2RB9A 2HP0B 5EYPA 1DBFA 3R0PA 5IYZB 1CLIA 3I3FA 1IV3A 3J81M 3QHDA 3K0TA 3LDTA 1GZ0A 3KHNA 5EYPB 4BT4A 2HP3A 3P0ZA 1VH8A 3CCQF 3TD4A 3D54A 5MN4A 5HY1A 3B6NA 5HWEA 1FNJA 1Q7YH 1W5FA 2LBWA 2HRUA 1H47A 1OAPA 5J2TA 1J7HA 4X3LA 3ZOPA 4O4HA 1W5BA 4ZHVA 2YYEA 3K14A 4G4ZA 5J2TB 4X1YA 4M8IA 2GZLA 3N4ZA 3LWOC 3NMUC 4O4HB 4NQ3A 4E6EA 2FC3A 3E20B 3OBWA 4X1YB 3WGMA 1XV2A 1VQ8F 2V9YA 3N2KB 3VI6A 1W3EX 3T80A 4B5CA 2KTVA 1SA0A 2ZOVA 2ZVZA 3WGNA 3V3TA 2HRYA 5GANK 1W59A 3RYFB 3JAWB 5KMGB 3O85A 1TUBA 4EI8A 2Z1FA 3L7QA 2ZF8A 3DDNA 3IKFA 3F0DA 1FNKA 2IG8A 3UT5B 4G4XA 3VYSC 5EZYB 3OW2F 4LNUA 1TUBB 3V7QA 3G6EF 1X7OA 5DCVA 2UYPA 1JN1A 4EB6A 5AVMA 3V4DA 3VMFB 4LNUB 1RLUA 3WGLA 4BT7A 2I6RA 3HJWC 3WGKA 4TUYA 3JARA 3M4SA 1QVFF 1PXWA 1U43A 4BVTA 3MBMA 2BTUA 4BT5A 3VIUA 3RE3A 3N2GA 3JARB 3CB2A 3FBAA 1W40A 4XCQA 3E22A 2BTOA 1QAHA 1Z5VA 3N2GB 1T0AA 3Q8HA 1VQ7F 3HWUA 2VGMA 4G4YA 2ZODA 1YGYA 3E22B 4B62A 1Q86H 3AGKA 4BVRA 3VCZA 5G4VC 3RA5A 3QTYA 3TD3A 4TZZA 5CA0A 4U39A 3CCLF 1YJWF 3JATA 2WALA 2AIFA 2Z1UA 3C9RA 5EIBD 5JVDA 5CA0B 3C8LA 3JATB 1RQ7A 1K8AH 1IV1A 2QI2A 1NQ3A 4YJ3A 3JASB 2JNBA 3BYQA 3KIZA 3CYQA 1VQ6F 2DT4A 1UFYA 4YJ2A 1VK3A 4O2BA 1YJ9F 1KD1H 4YJ3B 2ZAUA 3CC2F 2KG4A 4X1IB 1XHOA 4BW0B 5MN5A 2Z01A 4YJ2B 5EIBC 2HX0A 4HNAA 4O2BB 1W57A 2IAFA 2I6DA 5CB4A 4I50A 4BT3A 5B8FA 1K9MH 1VQPF 4HNAB 3S03A 3MDOA 2ALEA 5CB4B 4I50B 3I55F 4TV8A 5IT9M 2PHNA 2HS0A 1E7KA 3CPQA 2N48A 3V7EA 4IHJB 1VQNF 4TV8B 3F6MA 5GONA 4ERHA 1RA4A 2QEXF 5HP8A 4I55A 3HKCA 5KX5A 2BO1A 2G9IA 5HP7A 1JFFA 2HS3A 3C9TA 5GONB 3LFOA 4WBNA 2QA4F 4I55B 3HKCB 5KX5B 3WJPA 4B45A 3EORA 1JFFB 3RYHB 3ZP7A 2IQQA 5HY4A 4WBNB 5GAPK 3CMAF 3RYIA 2YXZA 3K12A 1K73H 5C8YA 4DRXA 3N2KA 3LWRC 1YQNA 2CSLA 4IIJA 1COMA 3NVIB 3RYIB 2VXYA 2P6YA 3QUWA 5C8YB 4EI9A 4DRXB 5FJ4C 4IIJB 3RYFA 3JAWA 4B46A 5KMGA 2R6R1 1KQSF 4O4LA 3CYPB 3CCUF 5LA6A 4ZHWA 3NVKE 1CN7A 3UT5A 5EZYA 2CW4A 1YJNF 3M84A 4O4LB 1X25A 3FD5A 5LA6B 1VQ9F 3S0WA 1JY8A 2RHJA 2KGWA 3P4EA 3SIVA 1ODEA 2QTPA 2LBXA 1YHQF 2HVYD 3N4YA 2K1SA 2EWCA 1PF5A 4RHAA 1Z5WA 4C8EA 2UYKA 1UI9A 1CK2A 2BTQB 2UZHA 4NWOB 3CC7F 4BVSA 1FFXA 2Q1YA 5A2QM 3KJKA 2CVLA 2MQEA 3J7AR 3S0HA 2OZBA 3K2XA 1FFXB 2OTJF 3JVHA 2DYYA 3TD5A 1X52A 3CCVF 4G4WA 3CMEF 3KE1A 1JJ2F 4C81A 1NJIH 2W8BC 2VGNA 5HY0A 1VQMF 2GLZA 1W5AA 1VQ4F 3G71F 2OHWA 3NK6A 3CCRF 3NK7A 1IV4A 3CG6A 4G4VA 1SDSA 2UYNB 3JASA 3SIUA 3VOBA 5LYJA 5BMVA 1JD1A 5IJ9A 3JALA 1VQKF 4ZOLA 3HTNA 3FFMA 5LP6C 5LYJB 4PWTA 5BMVB 4X1IA 4X20A 4BT2A 1ONIA 3OBYA 5IJ9B 3JALB 3HKDA 5G4UC 4ZOLB 2VAMA 3WGJA 3CXCF 5LP6A 3ESJA 1KNJA 3WJQA 4EI7A 4X20B 5FLXM 3HKEA 1Q82H 3HKDB 1QD9A 1VHAA 4C8GA 2VAWA 4C8IA 3JAMM 4BVQA 1TVKA 5LP6B 1H7MA 3IR9A 1IPAA 5CA1A 4KWEA 1GX1A 4BT6A 3HKEB 3D01A 1W42A 1TVKB 1IV2A 3M1XA 4IHJA 5CA1B 3MCAB 3U0OA 3P10A 5J2UA 2CWJA 3VTIC 3VYUC 5J2UB 1H48A 2LCAA 3GTZA 3ON1A 1KNKA 1U3LA 4I4TA 3PAFA 3S02A 3RYHA 1T0KB 5JCOC 3IEWA 2H8CA 1VQOF 5HY2A 4NUTA 4C82A 1R1MA 3I7TA 4I4TB 5HXUA 3IEQA 5JCOA 3E1YA 2RHLA 2AIZP 4TV9A 3IMPA 5ITZA 4X3MA 1NMUB 3LYBA 1QU9A 1Q81H 4U3JA 4ZHQA 3RYCA 1XRGA 4TV9B 1W2BF 5IJ0A 1M1KH 5ITZB 5LXTA 5EB0A 5EWRA 4DXDA 3WPXA 1QVGF 4U3JB 4ZHQB 3RYCB 1W5EA 5GIPC 1YI2F 5IJ0B 5LXTB 1W55A 2CHSA 1W41A 3ZO8A 3LMEA 1DT9A 1U3PA 1X7PA 3S0YA 2F9ZC 3FD6A 3HKBA 3CCJF 2NMUA 3VOAA 3CCEF 2RHOA 3MCQA 2CZWA 2AMTA 3G4SF 2OTLF 3FPIA 5LOVA 3HKBB 2H6LA 1Q8RA 3RA6A 3S06A 3VYTC 3I56F 1YIJF 3PLAC 3LWQC 5LOVB 1XBIA 4O4JA 2VAPA 1SA0B 4R40B 3C9SA 2HS4A 4O4JB 4RQOA 1VQ5F 3F0GA 4ZI7A 2ZVYA 3DC2A 2L26A 4O4IA 4C4WC 5MN6A 1FSZA 2CHTA 2HQSC 3LWPC 5JH7A 4ZI7B 4O4IB 3HAXD 3MQWA 2UYNA 4EB6B 2H8EA 3D00A 2PMPA 1RQ2A 5GINC 3JAKA 4TUYB 5JH7B 3GYQA 2B33A 3CPWF 2Z1EA 3WJRA 1GO0A 3JCMM 3JAKB 3F0EA 5EO3A 1ZWZA 3OONA 5EAZA 3WPWA 1W581 2RHHA 3CD6F 1SZQA 3VO8A 1VQLF 3ZP4A 4G88A 4ZHYB 2LBTA 1U40A 3IKEA 3CC4F 1RLGA 3KJJA 2Z1TA 1VQVA 5JVDB 5EB1B 4ZK7A 3WXMB 3LWVC 2R751 1N8RH 1S72F 3CCSF
chains in the Genus database with same CATH topology
4X3MA 1NMUB 1Q86H 3AGKA 4BVRA 1Q81H 2KTUA 4LCKA 5G4VC 3RA5A 1YITF 1W2BF 1M1KH 4TZZA 3SIVA 5HXZA 4BY9D 2LBXA 5EWRA 3CCLF 3CCMF 1YHQF 1YJWF 1QVGF 2HVYD 2WALA 3N4YA 2FGYA 1M90H 2AIFA 5GIPC 1YI2F 1GO1A 1W41A 1CK2A 3CC7F 4BVSA 1K8AH 3J80M 1DT9A 2QI2A 5A2QM 1X7PA 2JNBA 2F9ZC 5GIOC 1KC8H 3J7AR 2OZBA 1VQ6F 3CCJF 2OTJF 3J81M 3CCEF 1X52A 3CCVF 2CZWA 3G4SF 3CMEF 1YJ9F 1KD1H 1JJ2F 2OTLF 1GZ0A 3CC2F 1NJIH 3CCQF 2KG4A 4BW0B 2VGNA 5HY0A 1VQMF 2GLZA 3RA6A 5HY1A 3I56F 1YIJF 5HWEA 3LWQC 3G71F 2OHWA 3NK6A 2I6DA 1Q7YH 3PLAC 3CCRF 3NK7A 2LBWA 1XBIA 3CG6A 1VQPF 1K9MH 1SDSA 3SIUA 1VQ4F 4X3LA 2ALEA 1VQKF 3I55F 5IT9M 3FFMA 1VQ5F 1E7KA 3CPQA 3N4ZA 3LWOC 3V7EA 3NMUC 3OBYA 1VQNF 4NQ3A 5G4UC 2FC3A 4C4WC 3CXCF 3E20B 3OBWA 4EI7A 1RA4A 3LWPC 2QEXF 1VQ8F 3VI6A 5FLXM 1W3EX 2BO1A 1Q82H 3HAXD 3D00A 3JAMM 4BVQA 2KTVA 1H7MA 5GINC 3IR9A 1IPAA 3V3TA 3LFOA 5GANK 2QA4F 3GYQA 3CPWF 3O85A 4EI8A 1W42A 1GO0A 3JCMM 5HY4A 3MCAB 5GAPK 3CMAF 5EO3A 3OW2F 1ZWZA 3V7QA 1K73H 3G6EF 3LWRC 1X7OA 5DCVA 3NVIB 3CD6F 3VMFB 1N8RH 3HJWC 4EI9A 5FJ4C 1QVFF 1PXWA 3ON1A 1VQLF 4BVTA 1KQSF 3PAFA 3CCUF 1T0KB 3CC4F 1VQOF 5HY2A 1W40A 4NUTA 1RLGA 3NVKE 1CN7A 4XCQA 1YJNF 5HXUA 3E1YA 3WXMB 3LWVC 1VQ7F 1VQ9F 2VGMA 1S72F 3CCSF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3M A;  1NMU B;  1Q86 H;  3AGK A;  1Q81 H;  2KTU A;  4LCK A;  5G4V C;  3RA5 A;  1YIT F;  1W2B F;  1M1K H;  4TZZ A;  3SIV A;  4BY9 D;  2LBX A;  5EWR A;  3CCL F;  3CCM F;  1YHQ F;  1YJW F;  1QVG F;  2HVY D;  2WAL A;  3N4Y A;  1M90 H;  2AIF A;  5GIP C;  1YI2 F;  1GO1 A;  1W41 A;  1CK2 A;  3CC7 F;  1K8A H;  3J80 M;  1DT9 A;  2QI2 A;  5A2Q M;  1X7P A;  2JNB A;  5GIO C;  1KC8 H;  3J7A R;  2OZB A;  1VQ6 F;  3CCJ F;  2OTJ F;  3J81 M;  3CCE F;  1X52 A;  3CCV F;  2CZW A;  3G4S F;  3CME F;  1YJ9 F;  1KD1 H;  1JJ2 F;  2OTL F;  1GZ0 A;  3CC2 F;  1NJI H;  3CCQ F;  2KG4 A;  4BW0 B;  2VGN A;  1VQM F;  3RA6 A;  1VQ4 F;  3I56 F;  1YIJ F;  3PLA C;  3LWQ C;  3G71 F;  2OHW A;  3NK6 A;  2I6D A;  1Q7Y H;  3CCR F;  3NK7 A;  2LBW A;  1XBI A;  3CG6 A;  1VQP F;  1K9M H;  1SDS A;  3SIU A;  4X3L A;  2ALE A;  1VQK F;  3I55 F;  5IT9 M;  3FFM A;  1VQ5 F;  1E7K A;  3CPQ A;  3N4Z A;  3LWO C;  3V7E A;  3NMU C;  3OBY A;  1VQN F;  5G4U C;  2FC3 A;  4C4W C;  3CXC F;  3E20 B;  3OBW A;  1RA4 A;  3LWP C;  2QEX F;  1VQ8 F;  3VI6 A;  5FLX M;  1W3E X;  2BO1 A;  1Q82 H;  3HAX D;  3JAM M;  2KTV A;  1H7M A;  5GIN C;  3IR9 A;  1IPA A;  3LFO A;  5GAN K;  2QA4 F;  3GYQ A;  3CPW F;  3O85 A;  1W42 A;  1GO0 A;  3JCM M;  3MCA B;  5GAP K;  3CMA F;  5EO3 A;  3OW2 F;  1ZWZ A;  3V7Q A;  1K73 H;  3G6E F;  3LWR C;  1X7O A;  5DCV A;  3NVI B;  3CD6 F;  3VMF B;  1N8R H;  3HJW C;  5FJ4 C;  1QVF F;  1PXW A;  3ON1 A;  1VQL F;  1KQS F;  3PAF A;  3CCU F;  1T0K B;  3CC4 F;  1VQO F;  3NVK E;  1W40 A;  4NUT A;  1RLG A;  1CN7 A;  1YJN F;  3E1Y A;  3WXM B;  3LWV C;  1VQ7 F;  1VQ9 F;  2VGM A;  1S72 F;  3CCS F; 
#chains in the Genus database with same CATH topology
 1OFU A;  4FFB A;  5JQG A;  3GHZ A;  2KTU A;  4X1K A;  4F6R A;  4LCK A;  1YIT F;  2OTM A;  2Q1X A;  3ELC A;  4FFB B;  5HXZ A;  5JQG B;  4BY9 D;  3CCM F;  2UYJ A;  4X1K B;  4F6R B;  2FGY A;  1M90 H;  5FNV A;  4O2A A;  2GVI A;  3C9U A;  3ERN A;  1GO1 A;  2HP0 A;  3F0F A;  5IYZ A;  3J80 M;  5FNV B;  4O2A B;  1KC8 H;  5GIO C;  2RB9 A;  2HP0 B;  5EYP A;  1DBF A;  3R0P A;  5IYZ B;  1CLI A;  3I3F A;  1IV3 A;  3J81 M;  3QHD A;  3K0T A;  3LDT A;  1GZ0 A;  3KHN A;  5EYP B;  4BT4 A;  2HP3 A;  3P0Z A;  1VH8 A;  3CCQ F;  3TD4 A;  3D54 A;  5MN4 A;  5HY1 A;  3B6N A;  5HWE A;  1FNJ A;  1Q7Y H;  1W5F A;  2LBW A;  2HRU A;  1H47 A;  1OAP A;  5J2T A;  1J7H A;  4X3L A;  3ZOP A;  4O4H A;  1W5B A;  4ZHV A;  2YYE A;  3K14 A;  4G4Z A;  5J2T B;  4X1Y A;  4M8I A;  2GZL A;  3N4Z A;  3LWO C;  3NMU C;  4O4H B;  4NQ3 A;  4E6E A;  2FC3 A;  3E20 B;  3OBW A;  4X1Y B;  3WGM A;  1XV2 A;  1VQ8 F;  2V9Y A;  3N2K B;  3VI6 A;  1W3E X;  3T80 A;  4B5C A;  2KTV A;  1SA0 A;  2ZOV A;  2ZVZ A;  3WGN A;  3V3T A;  2HRY A;  5GAN K;  1W59 A;  3RYF B;  3JAW B;  5KMG B;  3O85 A;  1TUB A;  4EI8 A;  2Z1F A;  3L7Q A;  2ZF8 A;  3DDN A;  3IKF A;  3F0D A;  1FNK A;  2IG8 A;  3UT5 B;  4G4X A;  3VYS C;  5EZY B;  3OW2 F;  4LNU A;  1TUB B;  3V7Q A;  3G6E F;  1X7O A;  5DCV A;  2UYP A;  1JN1 A;  4EB6 A;  5AVM A;  3V4D A;  3VMF B;  4LNU B;  1RLU A;  3WGL A;  4BT7 A;  2I6R A;  3HJW C;  3WGK A;  4TUY A;  3JAR A;  3M4S A;  1QVF F;  1PXW A;  1U43 A;  4BVT A;  3MBM A;  2BTU A;  4BT5 A;  3VIU A;  3RE3 A;  3N2G A;  3JAR B;  3CB2 A;  3FBA A;  1W40 A;  4XCQ A;  3E22 A;  2BTO A;  1QAH A;  1Z5V A;  3N2G B;  1T0A A;  3Q8H A;  1VQ7 F;  3HWU A;  2VGM A;  4G4Y A;  2ZOD A;  1YGY A;  3E22 B;  4B62 A;  1Q86 H;  3AGK A;  4BVR A;  3VCZ A;  5G4V C;  3RA5 A;  3QTY A;  3TD3 A;  4TZZ A;  5CA0 A;  4U39 A;  3CCL F;  1YJW F;  3JAT A;  2WAL A;  2AIF A;  2Z1U A;  3C9R A;  5EIB D;  5JVD A;  5CA0 B;  3C8L A;  3JAT B;  1RQ7 A;  1K8A H;  1IV1 A;  2QI2 A;  1NQ3 A;  4YJ3 A;  3JAS B;  2JNB A;  3BYQ A;  3KIZ A;  3CYQ A;  1VQ6 F;  2DT4 A;  1UFY A;  4YJ2 A;  1VK3 A;  4O2B A;  1YJ9 F;  1KD1 H;  4YJ3 B;  2ZAU A;  3CC2 F;  2KG4 A;  4X1I B;  1XHO A;  4BW0 B;  5MN5 A;  2Z01 A;  4YJ2 B;  5EIB C;  2HX0 A;  4HNA A;  4O2B B;  1W57 A;  2IAF A;  2I6D A;  5CB4 A;  4I50 A;  4BT3 A;  5B8F A;  1K9M H;  1VQP F;  4HNA B;  3S03 A;  3MDO A;  2ALE A;  5CB4 B;  4I50 B;  3I55 F;  4TV8 A;  5IT9 M;  2PHN A;  2HS0 A;  1E7K A;  3CPQ A;  2N48 A;  3V7E A;  4IHJ B;  1VQN F;  4TV8 B;  3F6M A;  5GON A;  4ERH A;  1RA4 A;  2QEX F;  5HP8 A;  4I55 A;  3HKC A;  5KX5 A;  2BO1 A;  2G9I A;  5HP7 A;  1JFF A;  2HS3 A;  3C9T A;  5GON B;  3LFO A;  4WBN A;  2QA4 F;  4I55 B;  3HKC B;  5KX5 B;  3WJP A;  4B45 A;  3EOR A;  1JFF B;  3RYH B;  3ZP7 A;  2IQQ A;  5HY4 A;  4WBN B;  5GAP K;  3CMA F;  3RYI A;  2YXZ A;  3K12 A;  1K73 H;  5C8Y A;  4DRX A;  3N2K A;  3LWR C;  1YQN A;  2CSL A;  4IIJ A;  1COM A;  3NVI B;  3RYI B;  2VXY A;  2P6Y A;  3QUW A;  5C8Y B;  4EI9 A;  4DRX B;  5FJ4 C;  4IIJ B;  3RYF A;  3JAW A;  4B46 A;  5KMG A;  2R6R 1;  1KQS F;  4O4L A;  3CYP B;  3CCU F;  5LA6 A;  4ZHW A;  3NVK E;  1CN7 A;  3UT5 A;  5EZY A;  2CW4 A;  1YJN F;  3M84 A;  4O4L B;  1X25 A;  3FD5 A;  5LA6 B;  1VQ9 F;  3S0W A;  1JY8 A;  2RHJ A;  2KGW A;  3P4E A;  3SIV A;  1ODE A;  2QTP A;  2LBX A;  1YHQ F;  2HVY D;  3N4Y A;  2K1S A;  2EWC A;  1PF5 A;  4RHA A;  1Z5W A;  4C8E A;  2UYK A;  1UI9 A;  1CK2 A;  2BTQ B;  2UZH A;  4NWO B;  3CC7 F;  4BVS A;  1FFX A;  2Q1Y A;  5A2Q M;  3KJK A;  2CVL A;  2MQE A;  3J7A R;  3S0H A;  2OZB A;  3K2X A;  1FFX B;  2OTJ F;  3JVH A;  2DYY A;  3TD5 A;  1X52 A;  3CCV F;  4G4W A;  3CME F;  3KE1 A;  1JJ2 F;  4C81 A;  1NJI H;  2W8B C;  2VGN A;  5HY0 A;  1VQM F;  2GLZ A;  1W5A A;  1VQ4 F;  3G71 F;  2OHW A;  3NK6 A;  3CCR F;  3NK7 A;  1IV4 A;  3CG6 A;  4G4V A;  1SDS A;  2UYN B;  3JAS A;  3SIU A;  3VOB A;  5LYJ A;  5BMV A;  1JD1 A;  5IJ9 A;  3JAL A;  1VQK F;  4ZOL A;  3HTN A;  3FFM A;  5LP6 C;  5LYJ B;  4PWT A;  5BMV B;  4X1I A;  4X20 A;  4BT2 A;  1ONI A;  3OBY A;  5IJ9 B;  3JAL B;  3HKD A;  5G4U C;  4ZOL B;  2VAM A;  3WGJ A;  3CXC F;  5LP6 A;  3ESJ A;  1KNJ A;  3WJQ A;  4EI7 A;  4X20 B;  5FLX M;  3HKE A;  1Q82 H;  3HKD B;  1QD9 A;  1VHA A;  4C8G A;  2VAW A;  4C8I A;  3JAM M;  4BVQ A;  1TVK A;  5LP6 B;  1H7M A;  3IR9 A;  1IPA A;  5CA1 A;  4KWE A;  1GX1 A;  4BT6 A;  3HKE B;  3D01 A;  1W42 A;  1TVK B;  1IV2 A;  3M1X A;  4IHJ A;  5CA1 B;  3MCA B;  3U0O A;  3P10 A;  5J2U A;  2CWJ A;  3VTI C;  3VYU C;  5J2U B;  1H48 A;  2LCA A;  3GTZ A;  3ON1 A;  1KNK A;  1U3L A;  4I4T A;  3PAF A;  3S02 A;  3RYH A;  1T0K B;  5JCO C;  3IEW A;  2H8C A;  1VQO F;  5HY2 A;  4NUT A;  4C82 A;  1R1M A;  3I7T A;  4I4T B;  5HXU A;  3IEQ A;  5JCO A;  3E1Y A;  2RHL A;  2AIZ P;  4TV9 A;  3IMP A;  5ITZ A;  4X3M A;  1NMU B;  3LYB A;  1QU9 A;  1Q81 H;  4U3J A;  4ZHQ A;  3RYC A;  1XRG A;  4TV9 B;  1W2B F;  5IJ0 A;  1M1K H;  5ITZ B;  5LXT A;  5EB0 A;  5EWR A;  4DXD A;  3WPX A;  1QVG F;  4U3J B;  4ZHQ B;  3RYC B;  1W5E A;  5GIP C;  1YI2 F;  5IJ0 B;  5LXT B;  1W55 A;  2CHS A;  1W41 A;  3ZO8 A;  3LME A;  1DT9 A;  1U3P A;  1X7P A;  3S0Y A;  2F9Z C;  3FD6 A;  3HKB A;  3CCJ F;  2NMU A;  3VOA A;  3CCE F;  2RHO A;  3MCQ A;  2CZW A;  2AMT A;  3G4S F;  2OTL F;  3FPI A;  5LOV A;  3HKB B;  2H6L A;  1Q8R A;  3RA6 A;  3S06 A;  3VYT C;  3I56 F;  1YIJ F;  3PLA C;  3LWQ C;  5LOV B;  1XBI A;  4O4J A;  2VAP A;  1SA0 B;  4R40 B;  3C9S A;  2HS4 A;  4O4J B;  4RQO A;  1VQ5 F;  3F0G A;  4ZI7 A;  2ZVY A;  3DC2 A;  2L26 A;  4O4I A;  4C4W C;  5MN6 A;  1FSZ A;  2CHT A;  2HQS C;  3LWP C;  5JH7 A;  4ZI7 B;  4O4I B;  3HAX D;  3MQW A;  2UYN A;  4EB6 B;  2H8E A;  3D00 A;  2PMP A;  1RQ2 A;  5GIN C;  3JAK A;  4TUY B;  5JH7 B;  3GYQ A;  2B33 A;  3CPW F;  2Z1E A;  3WJR A;  1GO0 A;  3JCM M;  3JAK B;  3F0E A;  5EO3 A;  1ZWZ A;  3OON A;  5EAZ A;  3WPW A;  1W58 1;  2RHH A;  3CD6 F;  1SZQ A;  3VO8 A;  1VQL F;  3ZP4 A;  4G88 A;  4ZHY B;  2LBT A;  1U40 A;  3IKE A;  3CC4 F;  1RLG A;  3KJJ A;  2Z1T A;  1VQV A;  5JVD B;  5EB1 B;  4ZK7 A;  3WXM B;  3LWV C;  2R75 1;  1N8R H;  1S72 F;  3CCS F; 
#chains in the Genus database with same CATH homology
 4X3M A;  1NMU B;  1Q86 H;  3AGK A;  4BVR A;  1Q81 H;  2KTU A;  4LCK A;  5G4V C;  3RA5 A;  1YIT F;  1W2B F;  1M1K H;  4TZZ A;  3SIV A;  5HXZ A;  4BY9 D;  2LBX A;  5EWR A;  3CCL F;  3CCM F;  1YHQ F;  1YJW F;  1QVG F;  2HVY D;  2WAL A;  3N4Y A;  2FGY A;  1M90 H;  2AIF A;  5GIP C;  1YI2 F;  1GO1 A;  1W41 A;  1CK2 A;  3CC7 F;  4BVS A;  1K8A H;  3J80 M;  1DT9 A;  2QI2 A;  5A2Q M;  1X7P A;  2JNB A;  2F9Z C;  5GIO C;  1KC8 H;  3J7A R;  2OZB A;  1VQ6 F;  3CCJ F;  2OTJ F;  3J81 M;  3CCE F;  1X52 A;  3CCV F;  2CZW A;  3G4S F;  3CME F;  1YJ9 F;  1KD1 H;  1JJ2 F;  2OTL F;  1GZ0 A;  3CC2 F;  1NJI H;  3CCQ F;  2KG4 A;  4BW0 B;  2VGN A;  5HY0 A;  1VQM F;  2GLZ A;  3RA6 A;  5HY1 A;  3I56 F;  1YIJ F;  5HWE A;  3LWQ C;  3G71 F;  2OHW A;  3NK6 A;  2I6D A;  1Q7Y H;  3PLA C;  3CCR F;  3NK7 A;  2LBW A;  1XBI A;  3CG6 A;  1VQP F;  1K9M H;  1SDS A;  3SIU A;  1VQ4 F;  4X3L A;  2ALE A;  1VQK F;  3I55 F;  5IT9 M;  3FFM A;  1VQ5 F;  1E7K A;  3CPQ A;  3N4Z A;  3LWO C;  3V7E A;  3NMU C;  3OBY A;  1VQN F;  4NQ3 A;  5G4U C;  2FC3 A;  4C4W C;  3CXC F;  3E20 B;  3OBW A;  4EI7 A;  1RA4 A;  3LWP C;  2QEX F;  1VQ8 F;  3VI6 A;  5FLX M;  1W3E X;  2BO1 A;  1Q82 H;  3HAX D;  3D00 A;  3JAM M;  4BVQ A;  2KTV A;  1H7M A;  5GIN C;  3IR9 A;  1IPA A;  3V3T A;  3LFO A;  5GAN K;  2QA4 F;  3GYQ A;  3CPW F;  3O85 A;  4EI8 A;  1W42 A;  1GO0 A;  3JCM M;  5HY4 A;  3MCA B;  5GAP K;  3CMA F;  5EO3 A;  3OW2 F;  1ZWZ A;  3V7Q A;  1K73 H;  3G6E F;  3LWR C;  1X7O A;  5DCV A;  3NVI B;  3CD6 F;  3VMF B;  1N8R H;  3HJW C;  4EI9 A;  5FJ4 C;  1QVF F;  1PXW A;  3ON1 A;  1VQL F;  4BVT A;  1KQS F;  3PAF A;  3CCU F;  1T0K B;  3CC4 F;  1VQO F;  5HY2 A;  1W40 A;  4NUT A;  1RLG A;  3NVK E;  1CN7 A;  4XCQ A;  1YJN F;  5HXU A;  3E1Y A;  3WXM B;  3LWV C;  1VQ7 F;  1VQ9 F;  2VGM A;  1S72 F;  3CCS F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...