1RALA

Three-dimensional structure of rat liver 3alpha-hydroxysteroid(slash)dihydrodiol dehydrogenase: a member of the aldo-keto reductase superfamily
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
308
structure length
308
Chain Sequence
MDSISLRVALNDGNFIPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVKREDIFYTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALQPGDIFFPRDEHGKLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSSRDKTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
publication title Three-dimensional structure of rat liver 3 alpha-hydroxysteroid/dihydrodiol dehydrogenase: a member of the aldo-keto reductase superfamily.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 75
structure length 308
sequence length 308
ec nomenclature ec 1.1.1.50: 3-alpha-hydroxysteroid 3-dehydrogenase (Si-specific).
pdb deposition date 1994-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ralA00
2IKJA 3QKZA 1OG6A 3WCZA 2R24A 4GIEA 2R9RA 3D3FA 3LZ5A 4G5DA 1PWLA 3H7UA 3EAUA 4WEVX 4WRHA 3DOPA 5JH1A 3MC5A 2HEJA 4FA3A 2PDQA 4L1XA 3R6IA 3DN5A 2NVDA 4XO6A 2PDHA 2PDWA 4I5XA 5C7HA 3COTA 2HVOA 4XVDA 3CMFA 2IKHA 3UYIA 4DBSA 2BGQA 4YS1A 2HVNA 1RALA 2WZMA 2PDKA 4WDTA 2PZNA 3R43A 1Q13A 2ALRA 3MB9A 3UP8A 2PDPA 4H8NA 3LQLA 2PDUA 3RX2A 3C3UA 2PDCA 1Z8AA 2IPFA 4OTKA 2PDXA 2HE5A 1HW6A 4HMNA 3LQGA 3GHUA 3R58A 4QBXA 4PRRA 2VDGA 3UWEA 1ADSA 2ISFA 1QWKA 3G5EA 4LAUA 3O0KA 2J8TA 4GABA 4XK2A 4ICCX 4JQ4A 1XF0A 1Z89A 1UR3M 1IHIA 4DZ5A 1VBJA 3GHSA 3LEPA 3LD5A 4IGSA 4XAPA 2PD5A 3EB3A 4R9OA 4XVEA 4NKCA 3LENA 4LBSA 3RX3A 4JQ3A 5LIYX 4JIIX 1JEZA 4XO7A 3R8GA 3EB4A 2INZA 1GVEA 1S1PA 3LBOA 4LB3A 5LIWX 3S3GA 2IPGA 2IQDA 3BCJA 5HA7A 1FRBA 4Q3MA 1AH3A 1AZ1A 2FZBA 1US0A 1EL3A 1ZGDA 4PUWA 2F38A 4PUUA 4YVVA 4ASTA 4ZFCA 3CV7A 3M4HA 4JQ2A 3H7RA 3ONBA 4MHBA 1ZQ5A 3FJNA 1LWIA 1AFSA 2FZ9A 4LBRA 3V35A 3Q65A 3LUTA 4YU1A 1EKOA 2IKIA 1RY8A 1YE6A 4WGHA 1ZSXA 4GQ0A 3Q67A 3NTYA 3GHRA 1RY0A 2CLPA 2PDIA 3CAVA 2AGTA 3B3DA 3V0TA 2BGSA 2FGBA 1T41A 2FZ8A 4JQAA 1R38A 3KRBA 4XZHA 3LZ3A 4F40A 4PR4A 1X98A 1YNQA 2PDFA 2A79A 3WG6A 4JTCA 1XGDA 4FAMA 4JTAA 2ACUA 3LNMA 3UFYA 4FZIA 4QR6A 4JTQA 3N2TA 2HV5A 3V36A 3ERPA 3BURA 4GQGA 2ACQA 4AUBA 4JTDA 3T42A 4PRTA 3GUGA 2PDJA 2PFHA 4GCAA 3V0SA 1EXBA 1X97A 3N6QA 4WDWA 4DBWA 1PYFA 5DANA 3WBXA 1SM9A 4IJRA 2DUXA 1C9WA 4QXIA 2I16A 4WDUA 3UZXA 5HNUA 4QX4A 1M9HA 2IS7A 4GACA 2PDNA 4YVPA 1S2AA 3R94A 1XJBA 3F7JA 1AH4A 5LIUX 3M0IA 1QRQA 2DUZA 2C91A 4JTRA 4RPQA 1Z3NA 4L1WA 5JH2A 5KETA 4LB4A 3CV6A 1T40A 2INEA 2IPJA 3UZYA 4JIHA 2NVCA 4DBUA 2BP1A 4GA8A 4H7CA 3O3RA 2IKGA 4JIRA 3FX4A 1K8CA 3R7MA 4XZNX 1LQAA 3P2VA 2PDYA 1S2CA 4EXAA 1AH0A 1HQTA 4FALA 4WDXA 2HE8A 4IJCA 4EXBA 5HNTA 5AZ0A 1A80A 3UGRA 2FVLA 1MZRA 2FZDA 2PDBA 4YVXA 2F2KA 1YE4A 2ACSA 3WBWA 1PZ1A 2I17A 3VXGA 1ZUAX 2IQ0A 2P5NA 3CAQA 2PDGA 3UZWA 1S1RA 1X96A 3UZZA 1MRQA 1Q5MA 3H4GA 3RX4A 2IPWA 2ACRA 2WZTA 2QXWA 5M2FX 2PDMA 2PDLA 3M64A 1YNPA 3LN3A 4XZIA 2HDJA 2PF8A 1J96A 1Z9AA 4Q7BA 2PD9A 4JQ1A 5AZ1A 3ONCA 2PEVA 1IEIA 4XZMX 4LAZA 3R8HA 1AZ2A 3WBYA 1VP5A 1EF3A 4PMJA 3G1RA 5LIXX 2DV0A 5LIKX 3U2CA 3CASA 4HBKA 3BUVA 3V0UA 4XZLX 1PWMA 3BV7A 3UG8A 1PZ0A 1MI3A 3GHTA
chains in the Genus database with same CATH superfamily
4NP7A 4XSMA 2ATMA 3LOTA 4GIEA 1NELA 3TZNA 4M24A 1BLIA 1CTNA 2OX1A 3N3MA 3W7RA 3EAUA 2QNEA 3IEBA 1IEQA 3WFZA 1GEQA 3QHMA 2EPLX 3VCRA 3HPFA 3EDJA 3ES8A 4O15A 3QPYA 4O17A 2X8RA 3DHDA 5D33A 3AFBA 5F2MA 3RR4A 4KH2A 3RHGA 1XC6A 3SURA 4XVDA 2WQDA 3TEVA 1UROA 1W8GA 2D2OA 4XUGA 3E5PA 3QEZA 4YS1A 4IIDA 3OZYA 2AQOA 4B92A 2WZMA 1E6RA 1S38A 5FCZA 4O57A 2HVMA 2IW0A 1E4LA 1F6YA 3T1GA 4D8LA 4EPEC 2L5HA 4FIQA 3VO0A 4EPDC 3AU6A 1DIOA 2WLYA 2QCHA 3C3UA 3LU2A 3GE7A 3CZKA 4WY0F 1XDLA 3PWGA 3FAXA 2ZXDA 4LOCA 4Y2WA 2XIJA 1VFLA 4KCTA 2CFFA 1TQJA 2YL8A 4AZIA 4AXKA 1GJWA 4RLIA 1LQ0A 1B3XA 4QDWA 1WAWA 3L4TA 2QGYA 4C6LA 3GNPA 4RPPA 4WKFA 2J7BA 3PZ9A 5HR7A 3B03A 3PWAA 5BMXA 1OFBA 3HMJG 2OELA 5CG0A 1HL2A 4IOTA 1O66A 5FF2A 1GEHA 5A1AA 3GHSA 1Z44A 3AMGA 2BOGX 1PKMA 1RA5A 2GL5A 4OGZA 3W29A 2VDIA 1Z7AA 3LENA 1HG3A 3GW3A 9CGTA 2BOFX 2FDSA 5CG7A 4B3LA 3R8GA 1IIHA 3S1XA 2VFHA 2INZA 5T26A 3LI0A 1S1PA 3UGVA 1SFSA 4M3PA 4QLJA 2BSLA 3QM3A 2NXGA 3WUEA 3KBMA 2Z29A 2NUYA 4HA0A 1HVQA 1QI2A 1PCKA 2Q09A 3FVMA 2NLYA 2PTZA 3RN6A 3CUFA 1XYLA 3BXWA 4J3SA 1LWIA 4FK9A 2YDRA 3Q65A 5I6SA 4K36A 2CNCA 2VCCA 4UQDA 3GU2A 3LG3A 1HF6A 4S3KA 2E28A 1FOBA 2DORA 4K1GA 1ADDA 1UQZA 2A3HA 4IZGA 1KXVA 3ATYA 3T6CA 2O4QA 1ZAHA 5I3KA 4M5PA 2V6AA 4MB5A 4MUZA 4Q6JA 4F40A 1EYEA 5IXEA 3QMTA 1DHPA 2GGIA 4JTCA 3TYEA 3KS6A 2XTKA 3N2XA 3CL8A 3W28A 5CPLA 4CU6A 5GNXA 1XDJA 1E9ZB 1MUCA 2C3ZA 2Z7KA 4ZL1A 4YNGA 3VE7A 3BLLA 4HGXA 4H3DA 1YKWA 4WUIA 5DLCA 3B40A 1H7OA 4PMVA 3HTWA 1RJQA 4LV9A 1HP4A 2YLAA 2PURA 3A9BA 3ARTA 1ECQA 2PDJA 2PFHA 1ESWA 4L9XA 2QDDA 4GY7A 1ML1A 3S9IA 3RXZA 4UCFA 1FWFC 1A5AA 2GFTA 4ADSA 2ZA2A 1BTMA 3ICJA 4O50A 4WDUA 3P84A 3WF2A 3PZMA 3AWOA 5HNUA 4QX4A 3L5MA 1RLCL 2ZBTA 1AQ0A 3P93A 1EYWA 2PLCA 1MMFA 2H9AB 4DJFD 4PFMA 1DJGA 2WCAA 4PSRA 3Q94A 3NA8A 3C86A 1B57A 4C6PA 3O1NA 1NWTA 4NJGA 1DP0A 1PL9A 1FFRA 4Q4SA 4UTLA 1XDMA 2GJNA 3N4AA 3QR3A 3H8AA 1JAKA 2CZFA 3EOLA 1HT6A 1M53A 3UWZA 4J2PA 1OF8A 3TN3A 3PFRA 1DQUA 4HNTA 3ECQA 4HZ6A 2F8QA 4OE7A 2SFPA 3UXIA 1E3XA 4XD4A 3N18A 3RO8A 4L6OA 2OSYA 1KWKA 5E1QA 1V3MA 3CNYA 3TN5A 3VXGA 1ZUAX 2PUZA 4KIRA 3FHQA 2GZXA 3AWNA 3CWOX 1ISWA 2FH8A 4IMGA 1D8WA 1LOSA 4L5ZA 2R1PA 3B8UA 2XJ7A 3PZNA 4E8GA 1B1YA 1TCDA 1Q6OA 3GR7A 4UTWC 1RH9A 4I8YA 1XPYA 1PPIA 2QIWA 1J2BA 4KFPA 5I3HA 2Z26A 1J12A 3SECA 5CPQA 3ANVA 3URNA 3B06A 3AXMA 1TVNA 1VQTA 2IXVA 1HGWA 4X22A 3ZR6A 3KS5A 3HG3A 3IV3A 1H7XA 2XGBA 3LRMA 3M64A 3RYSA 3O2LA 5FD0A 1W9PA 4PZVA 8XIMA 4DJFA 1M7PA 1OG0A 3U2OA 3WFLA 1M7OA 3WEMA 4M6UA 1OX4A 4FLQA 3B0UX 1P0DA 3G1RA 4DLFA 4N9CA 3FYOA 4M82A 2ICSA 1RP9A 1GUVA 2DV0A 3UESA 4AH7A 2VFGA 2WVTA 3QW4B 2ZX7A 2PP0A 1HJQA 3HPSA 1QO5A 3OOQA 3BH4A 1W9XA 4H8UA 3N34A 2BNJA 4Q8MA 3RCMA 1KFEA 3WL1A 3IVSA 1NSJA 1MI3A 3NSMA 4BFAA 2NX1A 4B9ZA 4AMAA 1N55A 5LA2A 4H1ZA 3QY6A 1R30A 2RFGA 3CMGA 3H7UA 4CKQA 4PMRA 4BKNA 1GNXA 4TX9A 5JH1A 1QBAA 4HU8A 4UTIA 4UOZA 1IEXA 3W7KA 4E8DA 1XIEA 2VD9A 2EQDA 1XM3A 1K6AA 1DKWA 5AY7A 1VFFA 4PMOA 2GLKA 2HVOA 3NUKA 4A4AA 1E3ZA 1E70M 4FXFA 4A3YA 2J9YA 3SY5A 2AKMA 4DWSD 4TIMA 5TD4A 2X7VA 3FKRA 3OEXA 4HIBA 2XN2A 1CGYA 2WSRA 1XCWA 3L9CA 4H2HA 1CCWB 1MQPA 3VNKA 3W81A 3LCGA 1CXFA 2QDEA 3FNDA 1O12A 4QE1A 2QV5A 4FNQA 4UFIA 4WOQA 2XIMA 1H41A 1TO3A 4BS0A 3IGUA 3TJXA 4BI6A 3EXSA 2JE8A 3RILA 1GKRA 4EE9A 1NQKA 3K8MA 1SO3A 4PRRA 1Q6DA 4DM1A 3DFOA 1XIJA 3OQ8A 3LMZA 1QWKA 3MO7A 4W7WA 5G1MA 2BXVA 3V7PA 3RLGA 4XAFA 4AVFA 1KB3A 3MW7A 4DUWA 4NJIA 2FH6A 1B3YA 3FFSA 3IVUA 2INFA 1BG9A 1SR0A 3RCYA 2B7PA 5C9ZA 5D03A 2C1GA 2WMKA 3N15A 3TC3A 3I3EA 4UXDA 3ZVIA 3NM3A 1TV4A 3I3DA 3NQ6A 1JNDA 1GVEA 2OOGA 2E3ZA 1EO5A 3EKLA 2CW6A 4E4PA 2OGJA 3GVVA 1TPVA 2DY3A 1MDLA 2XVLA 2V0TA 1UMYA 2A7PA 2W91A 3UWWA 4I8DA 1ZGDA 4LVGA 4ML9A 1NOFA 3T81A 1ECEA 3MUCA 2X0HA 2XWDA 3URAA 1XKYA 3M4HA 2GK1B 4Y9MA 3BMVA 1PZ3A 3CLMA 2XVPA 1NDWA 4W89A 5DX7A 4AZ7A 2XM2A 4GC4A 3W53A 2OQHA 3IGHX 4EPKA 3CAVA 1WKFA 1BFNA 1ME7A 3MMTA 4QNWA 5FEWA 1KXHA 2R1NA 3WLQA 4IP7A 4RNFA 4MYAA 1ZBVA 3EDKA 3APTA 1AD1A 2OTDA 3RFAA 3LCIA 4CQ9A 2R91A 2YA1A 3GWQA 1GTHA 3WD3A 4O11A 4MY9A 4DZAA 1D7KA 3F4CA 3N2TA 3W7LA 4GKTA 4Q32A 1AW2A 1FVPA 5IBXA 5DCDA 1P7TB 3DXIA 4Z1BA 4CCDA 4NU7A 4QRNA 3FDGA 3GUGA 3P8JA 1EXBA 3H7VA 3A21A 1QHPA 3MZNA 1QNRA 3BJFA 3NPXA 1G4TA 1K8YA 3AS0A 4V1XA 3ALGA 7A3HA 4DUOA 1OZMA 1B9BA 2Y5JA 2PU0A 2IS7A 3K5XA 5FIPA 3F2BA 3K4AA 4RKAA 4Q4OA 1IXNA 1ME9A 4QCEA 4M51A 3GH7A 3PNZA 2FFIA 2OSXA 4DO6A 1EX5A 4Q7NA 4QEEA 1F3TA 3FA5A 3RM4A 1LT8A 4GNKB 4ZMGA 2JIWA 1V93A 3NDOA 5E0KA 3WMBA 2IPJA 4US6A 3SM0A 3K2GA 3NQFA 1CXLA 3HU7A 2IKGA 3CAWA 3S5OA 3V1HA 3SGGA 4E3TA 5I02A 3T4CA 2Z1WA 3IWPA 4X60A 3QW3A 2XPKA 3U6WA 1PEZA 4ZQMA 3SIMA 3DC0A 3BLKA 1IWAA 2GJLA 2WZIA 5E0FA 7REQA 3T0BA 5LXEA 2HTMA 4JPGA 6ENLA 2VX6A 4PBFA 3TAKA 2VP8A 2V3FA 2A3BA 4FNUA 3SRDA 4RK8A 4MB3A 3E74A 1OGBA 5HXMA 4DLMA 2C8NA 3M0YA 5CAHA 1Z48A 2VCBA 4NNCA 3QKEA 2XH4A 5A5WA 3KOZA 1UOZA 4PBEA 1WP6A 4GJJA 2V3GA 3TQVA 3HGOA 2A85A 4AZ5A 1L2QA 4AD4A 3NQ2A 1I1WA 3ABRA 1B90A 4GI6A 3NZGA 4DYKA 1EQCA 4R85A 4DAFA 1KGWA 2YCLB 1LOLA 2A5HA 4GQQA 3EX3A 1TE1A 3ELFA 1UWIA 1WOBA 1X7IA 1J10A 4C6JA 1FKWA 1QI0A 1UIPA 1SJCA 3V0UA 4CEUC 3WLTA 4NZ4A 1T99A 3BV7A 2AL2A 3N12A 5CC6A 3OJGA 1TWWA 1QVBA 2JKAA 3V5FA 4CQBA 2C79A 5FJRA 5K9CA 1JRCA 4PULA 1XRFA 3I65A 1F5ZA 4IL0A 1E73M 4NNAA 1JQXA 4HNVA 3GUWA 3KOXA 5FEXA 1U22A 4M1RA 3PG8A 4L4PA 1EDTA 4MLJA 4D6CA 3P67A 4L1XA 2GJPA 4AX7A 3CTLA 4S3DA 3TQPA 4HKPA 1UD8A 4H9ZA 4GHRA 3O0FA 3H4XA 1E1FA 1ZB5A 1VJIA 1FWNA 4IXXA 4S3GA 4DUVA 2OKTA 1UH4A 3NCOA 2GQ8A 1EA0A 3C0QA 2CBIA 2CZEA 1ZTVA 2Q01A 3LV5A 3W37A 3G0XA 3VNIA 4IPNB 1GQIA 2WNNA 4JYFA 4ADTA 3BOXA 4WJ8A 3TU9A 1DWJM 1SGJA 1PUDA 2CIPA 1XLGA 4QQ3A 2NQ9A 2IPFA 1JPKA 2FYMA 1S46A 1I2RA 4K7YA 1QOQA 2J78A 3UA4A 3UPWA 2C1IA 3B8IA 1LDCA 3BSHA 4EANA 1JNEA 4LAUA 3O0KA 2VEIA 1R47A 4OT7A 4G9PA 1J0ZA 2W79A 2AKZA 1E1CA 1JZ5A 1TV3A 1H61A 2WKJA 2VQTA 4CQDA 1TV5A 3ANYA 3OHIA 1UYQA 3W27A 4B4FA 3GZ3A 3ABOA 4IGSA 3HF3A 2WV8A 3PULA 3NWRA 3KTCA 3CUJA 4DZHA 5HMSA 1IGWA 2H3BA 3ZLGA 2AMGA 4IFRA 3VIPA 4H8VA 1BWVA 2ZQ0A 3QN3A 3SB0A 4Z1CA 4ORIA 1O7AA 1G5AA 2WWDA 3CK5A 1SFJA 1V7AA 4C60A 3N14A 1F4HA 3ITOA 1AH3A 1C92A 1R86A 4NT0A 2PPGA 2YCEA 4ZO7A 4ZQCA 2ZRUA 5DEZA 1WZKA 1F4AA 4Q33A 4P7LA 1A49A 2E25A 4YTRA 1UMLA 1R3SA 4UMAA 3GX9A 4K68A 4MHBA 5CGMA 4XQ6A 4MWAB 1QNPA 4KWVA 1GOMA 3WDHA 4S38A 3ENLA 1A4LA 3KUMA 4DJED 1XFCA 4JXCA 1OC5A 1WOAA 2P3ZA 2D69A 3GZAA 1UBSA 3DHFA 1RBLA 1ZENA 2YIHA 5A8OA 2ZZ2A 2FZ8A 2MUCA 3NSXA 1LL4A 1DE6A 3ZMRA 5F4WA 1XIBA 1X98A 3MS8A 4HOZA 4TTUA 1WKYA 4RNIA 5EMKA 1E72M 4S3JA 4AIUA 3M5ZA 3SAZA 2BVYA 2O9TA 4IUGA 2Q3RA 3U2EA 3IVTA 4LVFA 2E6AA 1VHNA 3M9YA 5CGQA 1T6MA 1ONEA 3GR8A 1F8MA 3MKVA 3ERPA 2QIIA 1IQ8A 1XD0A 3AIBA 3QGVA 4DXXA 2JK2A 1PBGA 3KL0A 3V0SA 4UR8A 3GG1A 1KM0A 3EOSA 3OGSA 4X9SA 1EWDA 4AZ6A 1H49A 2VOMA 2WMHA 3OQEA 1Q2RA 3N11A 1KCKA 4MKSA 3TYZA 4N9EA 1W0MA 1S2AA 1UP3A 1LJYA 4GRSA 3W1MA 1BWKA 1V6WA 1EDGA 3DFPA 2BBFA 1BYDA 1Y5VA 4JTRA 4HMCA 4RPQA 1C7SA 3W1LA 4L1WA 2PP3A 5B7YA 2A6LA 3VMOA 3LERA 4PMXA 4A22A 4DJEA 4CD6A 4YTSA 5D02A 3O3RA 1XYAA 3AHTA 1XIFA 5U7SA 2NX3A 1LQAA 4DEFA 4HNLA 1S2CA 3UWVA 3L0NA 4ROPA 3P82A 2JALA 3CZLA 3GVGA 3MUAA 2FZMA 3RO6A 1P48A 3BMXA 1GQNA 5LNUA 1AW5A 3N2CA 3XISA 3NG3A 4AHPA 2D3NA 1W5MA 1VKFA 1EIXA 3MKCA 3DYMA 4PCPA 3AUOA 3QRHA 1OABA 1OYAA 2FVMA 3K4DA 3KAOA 4U4MA 3S5ZA 3M5YA 3W7HA 4DXVA 3U0HA 4PMZA 8CGTA 1V3KA 1S2WA 3VDHA 5K4XA 4UOQA 4F3HA 4YTQA 4K3ZA 4CU8A 3C61A 3L2MA 1RJRA 4MDPA 4ZQRA 5E70A 2VUNA 3FIGA 4F0HA 3OYZA 1C8VA 3N4EA 3P61A 1AQHA 3AS3A 4H9VA 4XZBA 1O4UA 4DY1A 2DSKA 1OFPA 1UR2A 5CPTA 2WZEA 2HJPA 3SUVA 4XZIA 1QR7A 3EX6A 3U3HA 1UR1A 4PMQA 3NQDA 2FDMA 4KS0A 3VPLA 2W4XA 5DMYA 3T78A 3CZJA 3EA1A 1W5NA 2WSYA 3BO9A 4MNMA 1R6WA 3P80A 4DF0A 1LTDA 3GDMA 3WQFA 3CASA 3MBFA 1VFMA 5F4SA 4GK8A 2Z0IA 5A8NA 1FWHC 2GDVA 7TAAA 2XG9A 4NJHA 4AHQA 3THAA 3E0VA 3QKZA 1UWQA 2R24A 4PTVA 4CD8A 1QXLA 2D2JA 4G5DA 4AU0A 4IIHA 1UD5A 2GGHA 3PUEA 4IG2B 3OZMA 5A95A 1VCFA 3DN5A 3G6LA 3ZYZA 4XO6A 3BGGA 3CB3A 4C1KA 1XW8A 5C7HA 2C19A 2W67A 3H2FA 2VR5A 2WNZA 1CGVA 2ZVRA 4I5RA 3KCLA 5IFPA 5HPOA 4IIFA 1FWAC 3QXBA 5FAGA 2QF8A 3GFXA 4NF7A 5MHBA 2VEPA 3QY8A 2HVNA 1ITXA 2XSAA 3IJLA 1WQ5A 3LRKA 3W7MA 2X0SA 2QVNA 2EHHA 3CO4A 4H2CA 4TX6A 1I6NA 2OFJA 3HBLA 2ALRA 4LH8A 4ZBCA 4EACA 4MADA 2B31A 3W9ZA 3WLRA 1AMYA 4DO7A 3RX2A 2Y2WA 2V5DA 4KPLA 4O1FA 3VD7A 4Y9NA 4V27A 2BX7A 2WVVA 5FAJA 1Q6RA 4F9JA 1LT7A 3GHUA 3G1FA 4ZFMA 1GOWA 4UR7A 3M0KA 3C2FA 1IT7A 2DUAA 5E9XA 3BV4A 1K7XA 2WCGA 1KM6A 3MSGA 1JPIA 3DH7A 2ZRZA 1QTWA 2DSWA 3STEA 2Q3OA 1PDZA 1LROA 4QIUA 4I6VA 4C7FA 1FTXA 3KM8A 2QUNA 4S2CA 3N6HA 4DN1A 1UWTA 1LL7A 4YMZA 3RLHA 1DJYA 2B0MA 2A7NA 5DF0A 3KE0A 3KP0A 2G3FA 1P0BA 3PZTA 3L68A 3C0JA 3ABQA 3CZGA 3G1YA 3G8RA 5AHIA 3E6EA 4R7OA 1TKKA 1AQMA 1UWUA 2CXGA 4EPBC 1J0JA 3PAOA 3WJXA 5DCEA 2PGFA 4E38A 4LPCA 4A3HA 1FH9A 1ICQA 1SSDA 3PS7A 3F4DA 4HZ7A 1YPFA 1WUFA 4H41A 2DZAA 4FLSA 1WBHA 4KEZA 4ASTA 1P6CA 3DHPA 3FXGA 1V6VA 4XZ9A 4HOXA 4P61A 4LBRA 5ECUA 3RMJA 1VH7A 3KVMA 2OWWA 2C14A 3WKZA 4MUPA 3H2AA 4YHGA 2QCNA 1VCGA 2QPUA 4NVTA 4N4PA 4FNTA 4K39A 1SSGA 2W92A 1W9VA 5DO8A 1YMYA 2XWEA 4DELA 3AROA 1XPGA 1YHTA 3QGAC 3RAOA 4B5NA 1OD8A 4WIWA 3TJLA 4PR4A 1FKXA 1F2JA 5CSSA 1KTCA 3FVDA 2QPXA 4JTAA 4EIVA 4H9XA 4UR9A 3EWUA 2E8ZA 3VNYA 2Z28A 3T05A 3DFNA 3PPGA 2OU4A 3UU0A 4KMQA 4PMUA 1LG2A 3TYDA 3CM4A 5HUOA 1REQA 1AJZA 3GC2A 2VGIA 4R3UA 3LLDA 2HROA 2QCDB 2GVYA 2YA0A 3HURA 5D9OA 4ZB5A 3DYOA 4WDWA 1SU5A 2Z2UA 1OX5A 2ZUVA 4CNTA 3MJMA 3N9SA 4KEUA 5DRCA 1KBKA 1CBGA 3LHWA 1MEHA 1UKTA 4B4HA 3IUHA 5DY3A 4B2DD 5I23A 2Z00A 4N7QA 1TPDA 1FCUA 1LL6A 2J79A 2V8ZA 5FJUA 4JGDA 1AH4A 2VRQA 3WBAA 3GG8A 1TSIA 3WDQA 4R9XA 5CSRA 4LCSA 4KKXA 1GGOA 1Z3NA 1UW9A 2OLHA 7PTDA 4C6CA 1W3JA 2IQTA 1FWBC 2RJGA 1UJPA 2X2GA 1VIWA 3UZYA 3HV9A 4F0RA 1TVLA 3LHUA 2YYUA 3EX4A 4XZNX 1KFCA 1EH9A 3TSBA 4LANA 3VK5A 3HPXA 2VDHA 3G8EA 1S5NA 4JEQA 3BICA 1OZQA 3L4VA 1JUBA 3UWYA 1OFDA 1R8LA 3QV6A 3VFCA 6REQA 4U10A 3IUIA 3L7RA 4GI4A 4ZQNA 1W3IA 4DHGA 1HO4A 1OIFA 1E6NA 3EWZA 2J6XA 3HG5A 2OQLA 1NWRA 3P60A 1UUQA 1GG1A 4E2DA 2A3CA 3M1ZA 1QW9A 3UZWA 1EP2A 4AZCA 3SQSA 4HSNA 3CGTA 5DFAA 4K6AA 3BAIA 4H04A 1TPC1 3VABA 4JR5A 1JXJA 3EKGA 1BSLA 1CLVA 3PM6A 1A5CA 4JYEA 3NURA 2P53A 4GX8A 4IP4A 3W1TA 4IMAA 5LYRA 2CPUA 4N9BA 4B2DA 1J01A 2E0PA 1SPQA 1HKVA 1F76A 4JTKA 3UY8A 1K8ZA 4UBPC 4WKAA 1CXIA 4QJ3B 3WELA 1OBAA 2EBNA 1TWZA 1TUXA 2VGGA 3INPA 4TR9A 4WHBA 3VKKA 1NOWA 3UZJA 3LYEA 3BUVA 5BRPA 2PU1A 4DWSB 2P0OA 4V1YA 4BF9A 1VRDA 1RQEA 3UG8A 1PCWA 1KM2A 1XWYA 5JIPA 3M0VA 4H9UA 3HQPA 2VFEA 3TYUA 1B4EA 3GFYA 4UQ9A 2H8ZA 3LZ5A 1UZDA 1RCXB 2EF9A 3HG4A 1RVGA 3VCCA 1QBBA 3T55A 5HANA 4IL2A 4IICA 3UVAA 4F0SA 4HN8A 3VIHA 4GISA 3M7WA 3W70A 4M29A 2PGWA 1DJIA 2ZKMX 1UPMB 5FEZA 1OD0A 5HJXA 4AY8A 3LX9A 2IKHA 2JQXA 5EKYA 3G1XA 4Q8VA 4BF7A 1X1ZA 1QPKA 2JEQA 4XWUA 1EZWA 3VGGA 1HXJA 4KRZA 2E5DA 4LNYA 3U2ZA 3W7DA 3GXPA 1U5JA 1YDVA 1C8QA 2BTMA 4GO9A 4F79A 2YA2A 3ARYA 2YL9A 3VMNA 3IGSA 3GBEA 4HK5A 1J9YA 2W63A 1NWSA 3R58A 2J25A 1ADSA 3ITVA 5T91A 5AFDA 1NQ6A 3IK4A 3GXFA 1O60A 2J75A 2ZADA 4AW7A 5BU9A 1JDAA 1LM1A 4AD3A 4ZOAA 1W2PA 3VUSA 4C90A 2OG9A 3UJEA 1IHIA 2V82A 4PMDA 4Y9AA 4D9PA 3TMLA 2Y7GA 1MVYA 1FXQA 5C2GA 5K9DA 3RGTA 2GJRA 1MSSA 1KXTA 1KQZA 3CXOA 1OWQA 4L9YA 3TTEA 1JG9A 1HNYA 4M8UA 1TELA 4Z2HA 4LUTA 3BDKA 4AYGA 1H2JA 4PGLA 1S5TA 1CWYA 1XLCA 4MVAA 2CLIA 1SFTA 2XH0A 5EY5A 1HL8A 3RNDA 4JICA 4QE4A 4D72A 1V0NA 1OIMA 1W3LA 4ZTYA 1ZJIA 4QAIA 1TMHA 3L65A 2XGZA 3M47A 3AXIA 4E2OA 3GYCA 2OGYA 4O4WA 1EEPA 4YYCA 4LXFA 3LGEA 3UG4A 1R87A 2IKIA 2YLLA 3SRFA 3CWHA 4QSFA 1EWEA 4XAZA 1PKYA 3O16A 3VUPA 5M5DA 4B5SA 1TJ2A 2PWVA 4HQVA 3NQGA 1JI2A 3ZFHA 1OFQA 4ZOBA 2VFIA 3TV8A 4GZIA 5FL1A 1BG4A 1H60A 3LCWA 1CX9A 5FF4A 1ITCA 3MPGA 3PSWA 1QOPA 2MNRA 4LEFA 4MY1A 3LV6A 3I7SA 4JTQA 1M65A 3FA4A 2OZ3A 5A6TC 1SO4A 3CL6A 1DXEA 3EWXA 1XCFA 4AF0A 1KFKA 4BWLA 1QPRA 1XQKA 1RK5A 1BVZA 2AL2B 1V6YA 3ABSA 4MZ1A 1BRLA 1XKJA 4JKMA 3FW6A 2OR2A 4AX6A 1JXKA 3HPZA 2QUUA 1NFGA 3BWWA 5DRIA 4AD2A 3R5EA 2OPJA 3G24A 3WNOA 1UKSA 1SMAA 1WKDA 1OM0A 5TQLA 5ENLA 3VE9A 5EGRA 3SCPA 3F4WA 1K4HA 4OJYA 3PZVA 4W5UA 2ZWYA 4D6JA 2XHYA 2O55A 3OVQA 1IT0A 1HIZA 3SO7A 5J04A 3VGBA 3CV6A 2INEA 4RDZA 1U1HA 2B81A 3EOEA 1LLOA 3EPMA 1V3LA 4MLRA 3FOKA 1NH6A 2CLOA 3UY7A 3NM1A 1OC7A 2EG7A 3R4IA 4MWAE 3S47A 1AH0A 4IJCA 3FJ6A 4P7NA 5A8PA 1HJUA 1EC9A 1TREA 1A80A 2H9AA 3AXKA 3LPOA 3I7RA 2E40A 2GSJA 3LPGA 1H4PA 1XD1A 5XINA 3RM9A 2PDBA 2CLLA 3TW6A 1YE4A 1ODZA 3WNNA 5G5IA 3NOEA 2F9RA 1C91A 4UTWA 4FSAA 3V5OA 1Y5XA 2YL5A 2E67A 1TPB1 2Y8VA 1UP0A 4JFUA 1QHZA 1BKHA 1X96A 3NZPA 4NQ1A 4M80A 4CGTA 3DENA 1EQPA 2ZZ6A 3H70A 2E7FA 1E1CB 3EZ4A 1Z32X 2EJ1A 1PIIA 3M0JA 1GG0A 3G1DA 4JIEA 1V6TA 1O1HA 1JCJA 2WANA 2A0NA 3SCOA 2WKLA 3C4UA 4F2UA 3OO2A 4QDPA 1D2KA 1YPXA 3ID7A 1FWCC 1KGXA 2ASHA 2F6KA 4RNJA 2Z1KA 1J96A 1Z9AA 2O7QA 5D9PA 2G3JA 3IS4A 1IXOA 4E8CA 1EBGA 3K1GA 4ZGYA 3EMQA 3GDBA 1TMQA 2ISWA 3G3MA 2BG5A 3C8FA 4YHEA 2PCQA 2ZRYA 4LCRA 2QCGA 3U7VA 3C2RA 3AYTA 4JOMA 1H11A 2YB1A 2J27A 3L0GA 3B8DA 5LNWA 4H4IA 5H8PA 1LZOA 4XBSA 4I9AA 4DX3A 2X40A 4FS9A 4LS0A 1QW8A 1OG6A 3B8SA 3CMJA 3UG3A 3WCZA 2BASA 3VZZA 1NIUA 3D3FA 2DIJA 2O0TA 1XYBA 3LHVA 4NASA 4UOJA 2A6NA 2VC9A 5DT7A 1T96A 5CLTA 1SFLA 2QCEA 1POKA 1G9HA 1IV8A 4NG3A 2CERA 1M6JA 3F5KA 3QVQA 2REQB 2YFOA 1H5VA 2E6DA 1E6SM 3B8WA 1CZ1A 1D7FA 3SUWA 4JN6A 1UA3A 1DYSA 4BZYA 3QH2A 5EBUA 3IIZA 3RRXA 4DBSA 3QPEA 3MWCA 3SCSA 4FXJA 3K30A 4GLEA 3IANA 5CCZA 5LA0A 1FY6A 1E51A 1M1BA 4H01A 4UWMA 4DPQA 3G1AA 4WDTA 2VZTA 1UASA 2ZX8A 5HNNA 5E09A 2BOEX 3VIFA 1J6OA 1BQGA 4XG1A 2CZDA 1L6SA 4Q8OA 3UP8A 3C2VA 4ONVA 4H9YA 3AISA 1D3HA 4YCOA 1LF1A 3W6YA 5KZEA 2JBMA 4MWAC 3ME3A 4X0VA 1WXZA 2C18A 1CEOA 3DFHA 5DT5A 2WOQA 1LQ2A 2ZZ3A 5FF7A 1KCZA 3E0IA 4W4QA 1PHWA 2HK0A 4W7UA 1E71M 2WSKA 1A5MC 1WYIA 2R94A 2C16A 2WHJA 1QI5A 4GH3A 4JAWA 1UWAA 4GXMA 3EXTA 5HMFA 1FP9A 4M7TA 3KOYA 1UR3M 3MHUA 1TX2A 5AC7A 3M46A 5J5DA 2DJXA 4QEHA 1LP6A 4UFMA 3F4VA 5AOUA 4DJDC 1HVXA 2RDUA 1XX1A 3W26A 4XKMA 4Z08A 4M1BA 3PBMA 4W87A 3AZRA 1GVRA 3ITTA 3TYBA 4FLRA 3N6JA 3WDRA 4UNIA 3QMRA 4XO7A 2BLEA 3SY8A 1GVSA 2QUVA 3DC8A 3KL5A 3PBYA 4LB3A 1B3WA 3OLGA 2ZZ5A 4OFCA 3C0SA 3OBAA 1H5YA 1J0KA 5REQA 4Q3MA 1DJNA 2FZBA 1EGZA 4YYFA 4GYPA 3AMCA 1SQ7A 2DZSA 3HPAA 1EEXA 2EPMX 1L8NA 2ZYFA 3BG3A 1JJKA 4O1BA 1V8EA 2CBUA 3E0WA 3NQEA 3BQ6A 3FJNA 3GNOA 4HA4A 4PEKA 4OOZA 1M7JA 4IMDA 1EOMA 4O0ZA 1VEMA 5M3WA 1R3YA 3C2EA 4DNMA 1P43A 2PB1A 5AC6A 4B5XA 4AVOA 5KSWA 2DZWA 2PWUA 1NDVA 2VEGA 3FEMA 3MV01 3W23A 5F7UA 3NL2A 2P50A 4X9YA 3CQHA 3SZ8A 3FN9A 4AIEA 4S23A 4XZHA 3LZ3A 3RF9A 1VAHA 3K8KA 2HWGA 3RLVA 2WK2A 4UTTA 5BRBA 2GOUA 4G6CA 1C93A 2WC3A 4ENLA 3A13A 4YLWA 2KZHA 1TV8A 5E5CA 2FQIA 1EJRC 1Q65A 3E02A 4QG9A 1THFD 1KC7A 4I3GA 4HSOA 2FTPA 3W2JA 3PZQA 1UH3A 4I5UA 1E0WA 2XVKA 4FR6A 2WO5A 1LRNA 3TQKA 2WPBA 5KZ6A 1LLWA 1A3XA 1DV7A 2BMBA 1LRQA 3CIVA 4GIRA 1POJA 2G3MA 1SM9A 3M0XA 2NWSA 3O6YX 5AYIA 2AAAA 2VZUA 3WN6A 3QTGA 3NO5A 1CNVA 4LRTA 1VC4A 1DJXA 3QC3A 4GACA 3BAWA 1A50A 3F7JA 4PTNA 5LIUX 4ZB0A 2OSWA 1KFJA 1U30A 3CB8A 2POZA 1FQ0A 4TTGA 4W7VA 4LGXA 5I3GA 5D2WA 1BXCA 3PZIA 5JH2A 3B0XA 2XH7A 3THDA 4QTGA 1WPCA 4OBTA 4BQ2A 3AXXA 1JI1A 3A24A 1K8CA 3CUZA 3AS2A 4MNJA 2PDYA 3WDPP 3DBNA 5C7VA 1I9CB 2Z2AA 2PTYA 1GJUA 3Q37A 2FKPA 1M3UA 3W76A 3AYRA 2Q6ZA 5D04C 3BE7A 4AZBA 1S5VA 1QDSA 1KKRA 5BW6A 1FHUA 3T0CA 4C6IA 5AHNA 2WVVB 2XIQA 4NJJA 5CSUA 1KWGA 4L4OA 4UC5A 4MSSA 3WMCA 4UCGA 3A47A 3MI3A 2I17A 1F3EA 4ZE4A 3ZWSA 2JKEA 4UUIA 1NP2A 1YX1A 4GVGA 3RJYA 1F61A 1JCTA 1H62A 4NI8A 1KRAC 2VURA 3WQOA 4DO4A 3AI0A 4IQJA 3S2JA 3H6OA 4OKDA 3LHZA 5F4XA 3UR8A 1SMDA 2DZXA 1TTIA 5ABFA 2IPWA 1ME8A 4UB9A 1XQLA 1J0YA 2VXNA 2YBVA 4HSHA 3UWQA 3E38A 3QQWA 2VYOA 3WEZA 4LYRA 1KM1A 1ZL1A 3OTRA 1K7EA 1YEYA 3CAKA 4IPPA 5I00A 1BEUA 2ZE0A 1O95A 1E0XA 5D9NA 1OT2A 1YBQB 2QQ6A 3G22A 2UY2A 2O56A 4O1CA 3BSGA 2GVLA 4WGXA 2NV9A 3S83A 1JL8A 3WLJA 3HOJA 3QQ1A 4CCZA 4NUWA 3VOCA 5L6UA 3U2CA 1HL9A 3FS2A 3WK2A 4S2BA 3B0YA 3KDNA 2Y62A 4K8EA 3KBWA 1C3FA 5FF3A 4LVBA 2EPNA 1JYNA 3NO1A 3S42A 1UG6A 2YCJA 5CZKA 1WDDA 2GWGA 1K7FA 4F0MA 5A8QA 5BCAA 1MNZA 4PCTA 4XB3A 4LFYA 4I9MA 3AMDA 1W8SA 7ENLA 5T8GA 2WJFA 1HN1A 4NX0A 4CD4A 3DGBA 2NVDA 3AQUA 2ESCA 2VEKA 5AVHA 3GYEA 4HHHA 5KZMA 2A3AA 3VZYA 4I5XA 1XISA 2FHCA 1TFVA 3RDKA 1NEYA 3AO0A 3THCA 3WSUA 4AEFA 4C6QA 1ZJHA 3SR7A 4KCWA 2ANUA 3ITGA 5A2BA 3IJ6A 4N9DA 2BGQA 1S2TA 3S6TA 1XYCA 2X05A 3BGJA 2FB2A 2C0HA 4B5WA 3H4WA 1F74A 2OT0A 1GQKA 2DW6A 1TPUA 5BMWA 4Y9OA 1LORA 3BMWA 2NV1A 1R7OA 5H8MA 1NY1A 1REQB 4MM1A 3CT2A 3WENA 5KMYA 3NL6A 1O68A 1XH0A 4ZR8A 2VR4A 1Z8AA 1XLAA 3OGVA 5E6YA 1XRVA 2I57A 3MA8A 3LCXA 2Y8UA 1PAMA 3M43A 3LCHA 1UC5A 3KHDA 5BXPA 1W3TA 1XYMA 5FJOA 3UW6A 2BXZA 1PX8A 3TW7A 3QFEA 2PE4A 3EWYA 1LCOA 1GORA 3IPWA 3HB9A 3P8IA 1E15A 1RJPA 4P7QA 3MP5A 3CPGA 4F0KA 4JFTA 3LXAA 1NARA 2VKZG 1XF0A 1Z89A 4BF5A 5CBIA 7XIMA 4AWEA 2X42A 5AYZA 1H09A 4C6BA 1F3WA 3IIPA 2G41A 3LD5A 4DJFC 1V79A 4MFDA 4AWSA 3W1AA 1G7VA 2DSUA 1I0DA 3WH8A 4NAFA 5ABEA 3BAKA 2W5FA 1PKLA 2WMIB 2HNEA 1PVNA 3IUDA 1Z6KA 3KVLA 1AL8A 1VBRA 4O28A 3A5VA 3CQ0A 3LDVA 5JMUA 5BYWA 5B7ZA 1HFBA 4J35A 2WYSA 1IXPA 3WFAA 5BXSA 1RA0A 1GOQA 1EL3A 4G56A 4PUUA 1E40A 6REQB 2P8CA 4L4LA 1WNOA 3R10A 2FGZA 3E2VA 3DG3A 3QQ0A 3PFMA 4R33A 4CNOA 3LB0A 2W6RA 2PRMA 3GIQA 2I1OA 3LUTA 2QMKA 3CEUA 1WV2A 3SBFA 2BHUA 4D8ZA 1ZSXA 3D0CA 1RPXA 1RBOB 2DU2A 3R0KA 2VQUA 4NJKA 2WNWA 4PA8A 3FSUA 1LG1A 1T41A 4JQAA 1R38A 3OPSA 2E8YA 1MEIA 5J8LA 3S9YA 1XBYA 1K70A 4R34A 1SZGA 3PTMA 4JHOA 5FSDC 3BOLA 1QW7A 3POCA 4H6EA 3JU2A 5GJNA 3TW9A 4TV5A 3GU9A 3OHMB 1XIDA 4RX0A 3U9IA 1BYAA 3U7BA 1B3OA 5BOOA 3GKAA 4D1IA 3S9ZA 3BAXA 4YXGA 1R2RA 4B3ZA 3ES7A 2YGYA 1MEWA 3WF3A 4ERAA 4CN6A 4Z1YA 5I03A 3B05A 5BZAA 1OSEA 1FHVA 1ZP3A 1YTDA 5HDRA 1GTEA 1BVWA 3VOFA 2WBKA 2NSOA 3W7JA 1KNWA 4HMDA 2VR2A 4IWWA 4K8HA 4UMCA 1IXQA 3IJ7A 1JIBA 4H7VA 3TYAA 4I7WA 5CZ0A 2UZ9A 4Z1AA 3K4WA 4JTHA 1EC7A 4RZ6A 4QITA 2WHLA 4LUSA 4LF1A 2VI0A 5KETA 3ARQA 4WX2A 4B91A 1R9XA 3WF4A 3N25A 3BZGA 3R25A 4ECLA 2BP1A 4GOAA 4MIMA 4QQUA 2WMGA 1MXSA 2X30A 3TE9A 2VX7A 3QZ6A 2ONEA 3OA5A 1EP3A 2HE8A 2ZRWA 1Y5WA 4FPSA 1PO9A 1ONRA 1MUMA 3PSVA 4HU3A 4I90A 1LRTA 4X3ZA 3SCQA 2X7WA 3LMYA 4OHQA 4IQDA 4E0CA 2D3LA 1GW1A 2ACSA 1CECA 3HQ1A 4ZE5A 3DG7A 4MG4A 4RV8A 1ZBCA 4FX8A 4UZUA 1CGXA 3CLWA 3DIPA 4O53A 5AB3A 4CQAA 4N2YA 4DBEA 2A3LA 5CJMA 2HBVA 2R6OA 4RUBA 3S1UA 2BVDA 4WLCA 1GYNA 3GXNA 3W02A 2AQWA 1JQVA 4WR3A 2ACRA 1SJAA 2CZ5A 4PL1A 2WMJA 2PDLA 4HCHA 1WXJA 1FH7A 4AG0A 3TR2A 4HD5A 2WXDM 2X1RA 3FEQA 4JKKA 3OG3A 1H3GA 2GQAA 3ONCA 5IBXC 3H55A 4TV6A 4EOUA 3R8HA 1L9WA 1RCOB 2BY0A 1VP5A 3LXBA 5EMMA 3WF0A 1R2TA 3VM5A 1U1UA 4LUTB 1L8PA 4OWGA 2TAAA 2TSYA 3THQA 3LHYA 4UQBA 4HBKA 5D4YA 1GPWA 1GWJA 4FOJA 1GCYA 3MKKA 3TK7A 4CQCA 1LYXA 1BXBA 1L0PA 3O07A 1K9EA 5CPMA 2QHAA 5I3IA 3M07A 1EJSC 4D8AA 5CBJA 3MANA 4S1FA 1OHLA 4ML4A 2CWNA 1GW9A 2DZUA 3V5CA 4HHLA 1ZALA 1JCNA 4JN7A 2HEJA 3HFYA 1QO2A 4XTIA 1CLXA 2XIIA 3TQ0A 5I3JA 3C8NA 2E68A 3CO8A 2I56A 2HNHA 2OEKA 3QSRA 1UHVA 5G1TA 1XIHA 1ZPTA 5AECA 2DZPA 3VX1A 4WSKA 4L4MA 4GIAA 2QCFA 4C5YA 1YQ2A 4LUIA 2PC4A 2HISA 4IG2A 2PZNA 2WSQA 5HNRA 2CWXA 3PTDA 3IV8A 4QLLA 4CUCA 3LGGA 3WO8A 1VPYA 4RXFA 3MB9A 3AIWA 4ICNA 4AF0B 1M7XA 2Y61A 5D2VA 3MI6A 1KR1A 1EF2A 2PGRA 3WUBA 3F2DA 3W7EA 1QI4A 4HJWA 1BRLB 2WPGA 2PDXA 3M6DA 4B90A 4TUFA 4LJ3A 1RZMA 1P4CA 3ABZA 4C6OA 3KRUA 2YPIA 1E6XM 4S3BA 3PC0A 2NQHA 3H2NA 3W6MA 3OBEA 3MHFA 5HK4A 1CB2A 1I60A 3CPUA 3SDOA 2WQPA 4UTJA 4EXQA 4GGHA 5B80A 4HNCA 3GTXA 4OOUA 2XH2A 3KX6A 1VCVA 4C6FA 4JL1A 3WLLA 1VBHA 3TA6A 2FB3A 2GJXA 2FFCA 2CC0A 2WBGA 2RDTA 3SGZA 1TTJA 1AA1B 2BHYA 2X1IA 3PTKA 3R89A 3FHAA 4XAPA 3KW3A 3FK4A 3ZVHA 4R9OA 1SR9A 1XLMA 3RX3A 3TSMA 4AIBA 2OJPA 3LY0A 4JHZA 3PUGA 3QV9A 4PODA 1PDYA 3LBOA 5LIWX 3S3GA 3IACA 4V33A 1QMLA 1T8XA 2IPGA 3UT0A 2RH9A 4UTKA 4G1KA 2D2GA 4R7WA 2HBXA 2ZRVA 3GG7A 2R1LA 3CBWA 2W62A 3LRLA 3P7YA 2Z27A 3K13A 4W9TA 4BHYA 1SO5A 3VC5A 3MUIA 2QJJA 1FDZA 1JPHA 2GVEA 3NXFA 4C7GA 1DWIM 3CV7A 2XVGA 3T40A 1KBBA 3O6AA 4UQAA 1H0IA 5HOSA 1N7KA 1GZ1A 3N73A 4WSJA 4OBSA 1XGEA 1A3WA 3QV8A 3EOUA 5CPNA 3UPMA 1UCWA 3GDRA 4UFJA 1Q6QA 3KFTA 4MZ8A 3IARA 2PDIA 3TFCA 4L6HA 4ZQOA 3E49A 2VC7A 4Z0SA 5C9UA 1Y7VA 4RW5A 4WKHA 3WNMA 4GGBA 5HMDA 3B4UA 4HJFA 4KCVA 2DW7A 3DCPA 2PDFA 3VMPA 1NOUA 4EK7A 3TTQA 1FWGC 3L12A 1W2VA 2CLMA 3LNMA 4HU4A 3UFYA 3VNZA 1US2A 3QY7A 1DJHA 4Y7EA 2Y85A 3KCOA 2NZLA 2Q02A 2XISA 1W1YA 2VFFA 1HO1A 1X8FA 2V5KA 1W1VA 4GI9A 3BAJA 5ECVA 3B4YA 5LGXA 1Q6EA 2PMQA 4YJ5A 3KOWA 4NZJA 5DXXA 4JNZA 1TWDA 4QXIA 4JS3A 3B9EA 3GM8A 3GIPA 3UZXA 1TJ0A 4Y8FA 5EMYA 1W32A 4W88A 5JIWA 4LW7A 4B5UA 1MXDA 2VZVA 4KF1A 3I68A 1EOKA 2QCDA 5CSYA 1TMLA 3VYLA 3JUGA 4J7RA 3UJSA 5HBFA 4DPPA 3TLLA 5HJYA 3B9DA 4E4FA 1WDWA 2ZVIA 2DGAA 3Q2DA 4J3TA 3WBEA 2W66A 4IMCA 2NVCA 3DESA 4X0NA 4GA8A 1P5BA 2QAFA 4H7CA 3WJWA 1QPNA 3M16A 1NF0A 3SRHA 1TZ9A 1XC4A 5AZ0A 1QPQA 3PJTA 1BSIA 4C5ZA 3IGXA 4JNYA 3MJYA 4ZQPA 2FZDA 4KWOA 2BFGA 4O12A 4YVXA 3VDCA 1V0KA 1OCBA 4G8TA 4LVDA 2GDQA 5CZSA 3TA9A 2CU0A 1YRRA 1WB0A 3WBWA 1ZAJA 3QPZA 3PAJA 4GVFA 4R27A 3ZR4A 2IQ0A 2BY2A 4AMCA 4CN1A 2DZBA 2TRSA 4V2XA 4CNUA 1G7UA 1OINA 2CXEA 5K4ZA 3VA8A 3L21A 4Q4PA 1QNOA 3S5YA 1GOIA 4PC8A 2CHNA 3USBA 1VB9A 2GYIA 2AOSA 4J3ZA 1VLIA 1R3QA 4XX6A 1EP1A 1MW3A 2J88A 1NFPA 3LS9A 2NQZA 1XH2A 1SZEA 2R1KA 1G1YA 1EFZA 3MHGA 5K2ZA 5AZ1A 5LGZA 2C71A 3ZT5A 1Q6LA 1EA9C 4DIAA 4H8HA 1W9BM 1WBJA 4Q8PA 4XISA 2FPTA 4K37A 5REQB 2QCMA 3AALA 2E09A 3TJIA 4O54A 4GBDA 3BK0A 3ISIX 1KGUA 3DZ1A 2OO0A 2X09A 2WM0A 3WQDA 2VGBA 1PTAA 4PUJA 3T0TA 1WZLA 3P81A 4JX4A 1VEPA 1E5JA 3STPA 3W2UA 3CUIA 1Q7ZA 2G96A 1DIEA 2Y7FA 5DMMA 1HTIA 1UD3A 4DWSA 4DJEC 3KCJA 4ADUA 4A2SA 2PGEA 2ZUTA 4P2VA 3WK3A 2V68A 4WY0B 4J40A 3W2NA 1GQLA 5K7JA 3BW2A 3F4NA 5I3FA 1E1EA 3KZSA 2NT1A 3SSZA 4O18A 4IGNA 4PUDA 4F9DA 3GS6A 4NZFA 3KLKA 3BCFA 3M6YA 1VZWA 3DKJA 2V81A 1TWIA 4HPJA 3NSNA 4XD5A 2G8ZA 4M6VA 2CITA 1BPLB 3QGKC 3EYPA 4LWWA 3L0KA 3T0DA 4L64A 3TMQA 3ORWA 1OK4A 4GFIA 1B0IA 1TZZA 3W7NA 3OB8A 2W61A 3GVQA 1UWSA 1TV2A 4JZ5A 3QSTA 5I7GA 3T2PA 3T0AA 4EAYA 2QCCA 1JDEA 3WQ6A 1NDZA 1K9DA 4H6KA 1H7WA 4GABA 2QLYA 2WC4A 3SCNA 4HA1A 3OZPA 3G2GA 5DELA 1TR1A 1DORA 3HV8A 2VUYA 2O4MA 1KA9F 5LXXA 4PTWA 4HA3A 2FGLA 1UA7A 4BI7A 3KBSA 4MAZA 1TJ1A 4QSHA 1Y0EA 5A6BD 2Z6IA 1JUEA 1WDRA 5CH9A 1JEZA 3VNJA 1DTUA 3RR1A 2QDHA 5EA9A 4PTMA 1JAEA 3D5HA 3T8LA 1CPUA 1T7LA 2PSNA 2PTDA 4LALA 2F7FA 3OVPA 3SUSA 2Q8LA 1VJSA 2F38A 4D2JA 4Z2JA 3HGRA 4LS2A 2E5CA 3FGCA 3NOYA 1XYFA 5PTDA 3NZ1A 3ONBA 1HGYA 4JY8A 4IQLA 2R14A 1Q3NA 4AZHA 1UOKA 4GUHA 5BU6A 3LCLA 1SZRA 3PZUA 1VHCA 3C3NA 1RY8A 4WGHA 4O8RA 1BD0A 3Q67A 1SYTA 1WCGA 5A6MA 1A5SA 5ABFB 1E4MM 3FYPA 1VYSX 1DEDA 3A3HA 3DFSA 3KRZA 5BNKA 5GNZA 2H90A 2QAPA 2QEZA 3U5YA 4KEVA 1W17A 3MVIA 4AY7A 5EPDA 2C7FA 3KOFA 3NFUA 5EMLA 2MANA 1MYRA 2PLJA 1UUMA 2NT0A 3DERA 2XSXA 3MDWA 1MXGA 1XGDA 1G0CA 2Q8XA 3CHFA 1TUFA 3SCRA 2JIEA 3AIVA 4S3CA 5BROA 2V2DA 5F2IA 2J7FA 3V36A 5HATA 4B16A 3RLUA 2W9MA 3EXRA 2VX4A 5C2CA 3N3TA 5D2TA 2FPVA 4M6QA 5AHMA 5IOBA 3ABXA 3T42A 1TTPA 2UY4A 2E4TA 3UXDA 5A6BA 1P0EA 3BL3A 2CLEA 1YADA 2D23A 3KZPA 1EJ7L 5DANA 3RCNA 3WBXA 2Z1VA 4POCA 3BCDA 4K1WA 4O0KA 1F3XA 3UNTA 4M81A 4J4KA 2PTWA 4WF7A 4HZMA 1KM5A 3JZUA 4H6RA 1OX6A 1ZAIA 2Y7EA 1XJBA 3EEGA 1YPIA 4AISA 2BXYA 1X6LA 4QFUA 4PN2A 5TF0A 2NQJA 2GGEA 2EKCA 3NQVA 1GHRA 3CT7A 2ZUWA 4ACZA 5FSEC 1EB3A 2P10A 3GTFA 5U4NA 3CIWA 4Z42C 2Z25A 3D3AA 3SRKA 1EC8A 4FEZA 5A6SA 4CQ8A 3G0UA 1GVQA 4EXBA 1JF5A 5LSMA 4AWUA 1E6QM 1J5TA 3UGRA 4C7DA 1GZJA 4J28A 4DZIA 3E2RA 1TJPA 4DUXA 3A22A 4GCXA 3LLXA 3W7IA 2NXHA 1XLEA 1EHNA 1F6PA 2E1WA 3S1GA 3M41A 2WAGA 3LBCA 3WNKA 4C1NA 3UPBA 3DFYA 5H8UA 3MO4A 3AXHA 3KEHA 5HULA 1FWTA 3UG5A 1S1RA 1R46A 2OEJA 3FLUA 3M0HA 5D05A 1MRAA 1SO6A 1TWSA 1BTCA 4XD3A 1F73A 1ONWA 1F07A 1VEOA 1SZFA 2ZICA 3SQLA 2YL6A 3UF9A 2VCAA 1V3IA 4RE2A 3N13A 5CJ5A 2TODA 3WNPA 3W01A 3CZ8A 2HDJA 4W5ZA 1XXXA 4GQRA 4NAFB 1C9DA 3R2GA 4UMBA 3N9KA 5IRPA 4JQ1A 5G1YA 4ZSUA 2PEVA 1L6FA 3LNPA 1AZ2A 1AD4A 3EGJA 2W3ZA 4GD0A 3GLCA 3GH4A 1VBUA 4S3AA 1SJDA 3GW0A 4KCUA 3R79A 3AMLA 1DIKA 2P8BA 1I2QA 4NNBA 8XIAA 5A6KA 1QNSA 3I4EA 5D2YA 1PIFA 2BV9A 3NEVA 3MZ2A 4DJDD 1J18A 1J0HA 3P5YA 4QP0A 1E43A 3PUOA 4QG6A 2XN0A 3AHXA 4CD7A 1HJSA 2R82A 4Q8WA 3MT1A 4WEVX 4WRHA 5D8ZA 3RIKA 3M0LA 1FUYA 4P8WA 2ZCGA 2Z4GA 4KGJA 1IR1A 4GZ7A 5H2ZA 2FPYA 4L61A 1W5PA 3U8GA 2PRLA 2J8FA 3GXTA 4JX6A 4OQVA 2V5JA 3EWBX 4LUYA 2C6QA 1RHCA 4DO5A 1E5NA 1H7NA 3Q45A 3SGUA 3B9NA 3VKJA 5JBFA 1TYGA 3VOGA 1VPQA 8A3HA 3GKFA 3UCCA 1PTGA 1EPVA 1OC6A 1TA3A 2P76A 5M17A 2NQ5A 2Z7GA 1YYAA 5LZLA 4ZTXA 3P5ZA 1GKQA 3ITLA 4CVWA 3S6DA 3OIHA 4XBJA 3I6RA 1W1IE 4H8NA 3LQLA 2REQA 4ZCWA 3PB0A 3F5LA 2V67A 3MBDA 5M1TA 3AIQA 3SFKA 4HMNA 3BZJA 2B7OA 4JCMA 3SSJA 1DQXA 3W1QA 1B54A 3WLIA 4JBRA 1FCVA 1XUUA 1V51A 4KEMA 3WEOA 4UTUA 4AIOA 1ZCCA 1Q66A 4JDBA 5I06A 4DZ5A 1ZZMA 1VJZA 4U31A 4LUSB 2J24A 1V6UA 3M44A 3RK8A 1A47A 4XTDA 5FL0A 5EFFA 1B2YA 1OY0A 2VNCA 2C15A 4PFHA 2OZ8A 1C8XA 4DBDA 4M19A 1Q4WA 4H00A 5I77A 1TB3A 3PZOA 1GZGA 3AOFA 4CCEA 2CZVA 4RV3A 4MB4A 4NZCA 1KFWA 3APGA 5TAOA 1GYMA 3C56A 3NVDA 4ZFCA 3W7PA 2Y8KA 2VOTA 3T07A 1BF6A 3GTIA 1ZQ5A 1AFSA 4I6KA 4WCJA 3V35A 1XUZA 1W1ZA 3ARWA 4GE8A 1IF2A 1JYXA 2WW5A 3L67A 5ABGA 2DVTA 4A8IA 3SADA 3KWXA 2D2HA 3BARA 2FTWA 4IT1A 3VGDA 4ATLA 4Z0JA 3JZEA 1PX4A 1QAPA 4BY3A 1OADA 3PBWA 3VIKA 4JDYA 4OZOA 3POHA 4GNJA 3B9AA 3S5NA 1W6TA 2DDXA 4AZGA 4PL2A 2O9PA 3IK2A 3OG2A 2YB4A 5A6JA 4W86A 4KETA 4PUNA 3ZR5A 1O94A 4Z17A 2GPTA 1O5QA 4NZ1A 4FZIA 4QR6A 3FSTA 3EX1A 1EDQA 1XFBA 2VELA 2HV5A 4NAEA 4CNPA 9XIAA 5GPRA 3GXMA 2V3DA 2ACQA 3H22A 3P62A 5I78A 1YW1A 2QKFA 3CUHA 4G2DA 3ZSTA 4C6DA 4E5TA 1M04A 4OV4A 4GCAA 3A4XA 3SI9A 4IX0A 1X97A 4J5NA 1JF6A 1PV8A 4ERIA 2I16A 1Q6GA 1VYRA 1CIUA 1XBZA 2QJGA 3JVAA 2PCEA 2G97A 1Y8BA 1ITQA 2J13A 2PDNA 3EWDA 3L4XA 3TFXA 3L66A 3VM7A 1CI1A 5CAKA 2ADAA 4LNCA 4L7ZA 4WSHA 4BEUA 3OW1A 1W3KA 3FYYA 4GNVA 3UJRA 1XSJA 3ITCA 3IAPA 2DSVA 3W00A 5DQPA 2YCKX 3BJTA 3FX4A 1XINA 3ZOAA 4TVCA 1HQTA 3A64A 4WDXA 3ZLFA 3L2IA 1OF6A 1XLFA 2I5IA 3H21A 3E0LA 4AB4A 3KWSA 1H50A 1RV8A 3APYA 1E9IA 4LYPA 4RL3A 4H83A 3STGA 4LT9A 2ZUMA 1ENUA 2CCRA 2W27A 2VZOA 3VD4A 4D1JA 4V28A 1UBPC 2WC7A 5LA1A 4LU0A 1W1TA 2DP3A 2XVNA 4YN5A 1UB3A 1Q8AA 3TONA 4REQB 2OXNA 1XIMA 3R0UA 4A8LA 3DFTA 2ISSA 1IE7C 2GJXB 1KTBA 2FVKA 2R1MA 1W1B1 4NZ5A 4P8UA 3OVRA 4O10A 2B7QA 4YL2A 1RK6A 5M2FX 2ISVA 3WH5A 1J5SA 1EIBA 2QDGA 4ROQA 3ZVHB 3MV11 2E9MA 1U1JA 1OFRA 2GDUA 4Q7IA 1G94A 5FESA 4YTTA 1PXGA 3ARVA 1K8XA 5A8GA 4QLKA 1NP0A 4BWLC 4JTTA 2HSAA 1E0TA 3A3XA 4C6MA 4KFNA 1IZJA 4WD0A 1RVKA 1XSKA 2WJEA 4IPLA 3SUUA 2GQ9A 4FP1A 4D6IA 2ZUUA 3W25A 1PWMA 1YXDA 3E2SA 1JCLA 5C8BB 4INFA 2CLKA 1YBQA 1WDQA 3SEPA 2NQLA 3DI0A 3Q58A 3OIXA 1OQFA 3VNMA 1DWHM 4UTFA 3VIMA 3V75A 3MC5A 1RBAA 4L56A 5GJPA 2PZ0A 1JDDA 4OVXA 3MSRA 5IHRA 4D6FA 4ZXOA 2EEXA 8RUCA 1JUKA 3MUY1 3R8RA 2PDWA 3PUDA 3GU1A 1JZ8A 3TTYA 1EBHA 4WJXA 2E6FA 1G69A 3WUFA 2BDQA 2XYLA 1ZNNA 1F8IA 1VS1A 2FMOA 1S2VA 4JTJA 1ZU8A 1VPXA 1J11A 4FF7A 3W74A 5D09A 2BB0A 1FWWA 1F9CA 4KRUA 1QOXA 1K9TA 2YBUA 1OB0A 5KEZA 4AFYA 4D6EA 4E4UA 3PN8A 3C6CA 2WCSA 1PJ9A 1YDOA 3DUGA 2QMJA 3NZRA 4Q4MA 4P7RA 3EDFA 5A2AA 1X7FA 5XIAA 2VDGA 4IH3A 1X38A 4GYJA 1U83A 1KBIA 1GQJA 4HB7A 4B9YA 1DTNA 3NXLA 1LWJA 1S5WA 1W37A 2HS6A 2O92A 4FNPA 1FWSA 3NPUA 3N9RA 2GGJA 2QJIA 1XSIA 1Q85A 3XINA 5JQ9A 4D6HA 3CHVA 3NQAA 1VBJA 2Y6ZA 5G4WA 4MPQA 3VOHA 1UD2A 4PE8A 4M56A 1OCNA 5FEPA 4MNLA 1DXIA 5C9WA 2Y70A 3G3DA 1B31A 1I2OA 1VIZA 4OIFA 4Q8QA 1I8JA 1EPXA 1QUMA 1V77A 1H1NA 3H12A 3QBUA 1XRSA 1YNYA 1W1A1 1TG7A 3K1DA 3N04A 3GNXA 2OX4A 3PB2A 3UA3A 3WD2A 4O16A 3T08A 4U3CA 1EJTC 3TWAA 3DGRA 1E56A 3CU2A 4P5UA 4Q4KA 4IISA 4HPHA 3A23A 5T9BG 3IJQA 3ITXA 4OBRA 2VJXA 4HCLA 4RDWA 5JBEA 3EWCA 3QHOA 6ALDA 1MFVA 3CUXA 3LTPA 2WMIA 4U2ZA 4KQNA 3FA3A 4KT2A 1KM4A 1DJQA 1PZ2A 3VNLA 3G77A 4MJZA 2J74A 4EWND 1QT1A 1YE6A 3AIRA 2EPKX 1MQRA 2PWHA 3CUGA 5TIMA 4JYDA 5DCBA 2CLPA 5A69A 4HNNA 4QGCA 3RITA 1XGZA 2C1HA 3DDMA 3V0TA 3PK7A 2FGBA 1ZJBA 4GZJA 3B8TA 4EP8C 2E77A 3GC5A 4KERA 1RSCA 1JYVA 1OYCA 3M5VA 1H1YA 3TOPA 2Q71A 3WLMA 4XZWA 4HN4A 3MP4A 3CZEA 1US3A 1LBMA 1G67A 1XLHA 2AL1A 2Z1SA 1C7TA 4NI3A 4OUEA 3OLDA 1ISXA 3B9OA 3S2LA 3BURA 3U4AA 4ZODA 4JTDA 4KWUA 3UVIA 3BANA 3D46A 1FCQA 4PRTA 1R3RA 3L5LA 2EPOA 4JX5A 4KRTA 2NWRA 3IRDA 2OOFA 5IFTA 1WZAA 4A8RA 1C9WA 3VKBA 2TYSA 4TX8A 3S2MA 1FA2A 4RE0A 1TCMA 3C0LA 1MDRA 1W9DM 2XGIA 2O9RA 2P1FA 4UZSA 4IHCA 5CXPA 2QYGA 3V16A 1W5QA 2ZXQA 5EU9A 4A3QA 3GTNA 2QJMA 1BF2A 1FDYA 2PWEA 4UTHA 1VR6A 4Z2IA 1AUSL 4B3KA 4CU7A 3OODA 2C91A 1Y65A 1A5OC 4N0RA 3KP1A 4WJEA 1OEPA 5IDZA 4OUIA 1DPMA 3C2YA 2DVXA 5G2IA 2PWGA 4CCCA 5EMJA 2WWCA 3BC9A 4DBUA 1K02A 4PB4A 3BLOA 4TQTA 4AXNA 4N6EA 3SY1A 4GYPC 1R2SA 3GC4A 3WD0A 4NXSA 1NVMA 1J79A 4AWTA 2VVNA 3ZM8A 3ZT6A 2JGQA 1EJXC 3QLDA 1EUAA 1GOOA 5E93A 2OEMA 2P88A 4AEEA 3MY9A 5AC8A 3ARXA 4DAIA 4JEJA 1XLJA 2QR6A 2XZ7A 4WQ6A 1WXYA 3V1PA 4F66A 4KGLA 3W1NA 1L2UA 4JTLA 3L5AA 1A4MA 5HWMA 4IIGA 1WUEA 2P5NA 5D30A 1IEVA 4NX5A 4Q4RA 4QJ4B 2CYGA 1WO2A 1LUCA 4FX6M 4FO4A 1ALDA 3WLOA 4GQBA 1CXEA 1E6PA 3RU8X 3H53A 1E4IA 4ZZ9A 3TNOA 3S2CA 4TVUA 5CC3A 2YZRA 4JD4A 2ZOXA 3JRKA 4MKNA 3UR2A 4DI8A 4UTTC 1B4KA 1JGIA 1QATA 4U5KA 4PTDA 1UZHA 4URIA 4GWEA 1E55A 4GKLA 4XIAA 4Q8NA 5K9XA 1RPKA 4PMYA 3VGFA 1D3GA 3O6CA 4G7FA 5BWAA 4PUEA 1E9YB 3W2LA 4YPJA 1O6IA 2POTA 4K8GA 1JZ2A 4GYFA 4NL1A 3WZ0E 5FJTA 2J7GA 1WA3A 3GXDA 3W2KA 4LRSA 1EO7A 2RAGA 1BKSA 3HO8A 3PZGA 2J7DA 4QJ5B 1AMKA 2H6RA 4XZLX 4O52A 3UXLA 1GVYA 2QV4A 1ZBKA 3S5SA 4JTGA 3FGCB 1JVNA 4WXYA 2ZUNA 3CV1A 1PZ0A 1QNQA 3IIOA 5BOEA 1U5VA 2GOKA 1D3CA 1ELSA 4ATDA 2IKJA 1R0MA 3HFTA 1IWPA 3RUBL 4JL2A 4ATWA 1Q63A 4DM2A 2R9RA 1KRMA 3T8QA 3WMSA 4O13A 4J3VA 2BY3A 2WHMA 1XL9A 2QJHA 3NDYA 2QVHA 3MI2A 4HVXA 3R13A 2PDQA 3AIUA 5LHFA 4UIOA 3M0MA 5K3VA 5CC7A 1I2NA 3CH0A 4H9TA 3G1HA 1TZ7A 4MTVA 4XBKA 6TAAA 3L23A 1QASA 4GZEA 3T44A 3TTOA 3W2MA 5KTLA 4PB3A 5GNYA 3LTSA 1W1PA 1L6GA 2EAWA 1HKWA 3DI1A 2Y88A 3WQPA 9RUBA 1X6UA 1GOKA 1KQYA 2OVLA 3PBGA 4CNNA 1LWHA 1ZRQA 2ODOA 4Y90A 1ZFJA 4W8LA 3FJLA 4MJMA 3WDIA 4FLOA 1WZMA 2AQVA 3FV9A 2DIKA 1N8FA 3VU2A 3CHDA 3ZWTA 1R5YA 4XV0A 2QGHA 3R11A 1U2YA 5G2HA 4AYSA 4HMEA 2XFWA 4GG9A 1DWAM 5M03A 3BTNA 1I75A 1YDNA 1KBLA 3LM3A 2AMXA 4FI4A 4S3FA 4IFKA 3UQNA 3ITYA 3NIYA 3MQTA 1MFUA 2F6UA 2J77A 2AAMA 1G4EA 1I45A 4YIWA 1AQFA 4GO8A 4JNMA 2XZ9A 5HJLA 2DPEA 4XK2A 1DBTA 3REQB 4ACYA 4UTMA 3W7QA 4ACZB 2QCLA 4IUOA 4UQCA 4H9MA 3BLEA 5G4HC 3LGDA 4RE3A 4GJIA 5BXTA 4NKCA 3NQ8A 1QU4A 5MKGA 3WIJA 3CYJA 1B3VA 3U4FA 3I10A 4JIIX 2I9UA 3HN3A 5A94A 3EPNA 1VRXA 1GK8A 2ON3A 4RZBA 3NVTA 3C2OA 4ZXLA 3FDKA 4DVOA 1CYGA 5BRQA 3VNDA 2V69A 2ZX6A 2OB3A 4W85A 3GO2A 1BYBA 2QS8A 2QF7A 3MP3A 3S6OA 3GVWA 7CGTA 3M7SA 4C1NB 4HPNA 2FZ9A 3WD1A 1KFLA 4LX4A 1GVOA 2NSXA 1IYXA 1NFBA 4GJ1A 3NAVA 1NTHA 4NIRA 3TXZA 4JTIA 2ZUSA 4GQ0A 5A6LA 2J7CA 4ZB2A 2FHBA 5I0DA 5FI8A 2UBPC 4K2SA 1N2VA 1R9YA 2V3EA 1YNQA 2DVUA 4EX4A 3NPWA 6XIAA 1VF8A 2RDWA 3B8VA 1FFQA 1HX0A 4N6FA 3PR2A 3PJXA 4U5IA 2OO6A 2Y5EA 2EGZA 1HJXA 4QNEA 2XDFA 1X39A 2ZFAA 1FH8A 2WHKA 3IJDA 4TU1A 4LYQA 3MCMA 3F1QA 2PA6A 3SW6A 1UQYA 3QMSA 3ARUA 5C71A 5FJPA 3QF0A 3L4YA 1BWLA 3G1VA 4HYWA 1B5TA 1OCQA 1H7RA 3RPTA 4A3RA 4F48A 1E0VA 2C0AA 3WLSA 3T7VA 4W93A 3SN4A 5MF5A 4A29A 1TPEA 1NDYA 3A4AA 3EMZA 4DI9A 2DT1A 1M03A 5HAOA 5AHLA 4GBUA 2PAJA 2GVJA 4B15A 3CQJA 3SN1A 4E6MA 4RZ4A 2DUZA 3E3HA 3CS2A 1UKQA 4ZSTA 3OBKA 3ARZA 1W31A 1PX3A 3U57A 1K03A 4HOWA 4CN4A 3NL3A 3WJZA 4LY8A 1IIGA 3EA2A 1TA3B 2LLEA 3LPPA 4IQEA 3ZJ6A 1EUNA 3I3BA 1VD6A 3LA4A 1XP3A 3UEQA 1V3HA 2CKRA 1Q4NX 2CLHA 5AYYA 3WY1A 1R9ZA 2H8XA 4EWJA 4CNSA 3TP4A 2A21A 1IWBA 3EDEA 1CLKA 2ZX5A 1DWFM 3ZIZA 1KKOA 2ATSA 3GRIA 1OFOA 3CTTA 3FY1A 4QJ1A 1XIIA 1F7BA 4X61A 2HPIA 4KBXA 2QW5A 4C65A 4HZ8A 2PDGA 4QG8A 1H51A 3Q4DA 2CEQA 1H63A 1UPPA 2CHRA 1P1MA 1Q5MA 2KX9A 1ZS2A 3W88A 2ISDA 2WKGA 4BJHA 4XD6A 2I5GA 2V2HA 2DT0A 3A4JA 3KBNA 1LBLA 2XN1A 4WOZA 1KD0A 4ZO9A 4GI8A 4TMCA 2X0YA 3II1A 3LLFA 1V4YA 3WYZA 2EO7A 2I7GA 2WLZA 3N19B 4E2BA 1YNPA 3LN3A 3IIVA 4GPNA 4HTYA 5E6ZA 1N8IA 1IR2A 5C9XA 4W84A 1FWJC 4C1LA 3CPRA 3PG9A 1UWRA 2XFFA 4XZMX 4W8BA 2G4JA 1B9ZA 2RDXA 3GR4A 4ORMA 3TROA 1DOSA 2NUWA 2VRKA 3G18A 5LIXX 3HIJA 5LIKX 3O15A 1SW7A 3N2OA 6A3HA 1AJ2A 2CBVA 1KLZA 3HM7A 2PF0A 4DYJA 4P8VA 5HUPA 2CBJA 4EKJA 1VBGA 4TMBA 1JULA 1GYLA 1I0BA 1AG1O 4DYEA 1JZ6A 4MDOA 2E6YA 1ZHAA 2CHOA 3W87A 5HMEA 1U33A 3WLHA 2UY3A 1IT8A 1XR2A 3BQ5A 4Z1DA 3ZLHA 5HQLA 4HU0A 3ZQ9A 3R6IA 2DFAA 5FF0A 1CXHA 4WK9A 3H24A 3BW3A 4FMVA 1K6WA 4MNKA 1V08A 3N2BA 2D22A 3M5XA 3COTA 2VX5A 2A4AA 2WZHA 1I2PA 3WK1A 4HNUA 1TJRA 3E2QA 1P6WA 4PSPA 4MPKA 4ZO6A 4LEQA 2J7EA 5JVLA 5I24A 2FIQA 3R1ZA 3NQCA 3TCEA 2GUBA 4IPIA 4K38A 4NAEB 3FKKA 1BXNA 5TBOA 4Y6GA 4GMEA 1U5HA 4FHAA 3W38A 4S3EA 4WY0A 4GVIA 4J1OA 4OTKA 2G37A 3BAYA 3MCOA 3CQKA 4QE5A 3TCSA 3QYSA 2RKXA 2HPMA 1RQBA 3AHVA 1UC4A 4R7JA 2ISFA 1C90A 3NPVA 2JGYA 3AYVA 2D24A 1PTDA 4RCXA 1W9UA 3GQYA 3QR1A 5CQ1A 4L6DA 2D1ZA 3UETA 1Q6CA 1QCWA 1G4PA 2BHZA 1KLYA 3LEPA 3W75A 3AJXA 5LNRA 1N82A 1X8CA 2WNQA 3SCUA 3GNDA 1FWIC 5BXRA 3O8AA 1QHOA 3TIMA 2OKOA 1D8CA 3B0PA 3FJ4A 2PP1A 4LY4A 1KV5A 3EBVA 1K1DA 5C0QA 2CESA 4IPJA 4PUKA 5CZTA 4F8XA 3NGFA 2VVSA 3XIMA 4KWSA 3BCJA 3TWBA 1CGUA 5CBBA 1AZ1A 1P1XA 3QTPA 4G7EA 4YWSA 3TUUA 1WDSA 1I1XA 1GJPA 4GX9A 4LC6A 2VD8A 3TTSA 1JPDX 4O0QA 4JY9A 4NSBA 3KVKA 1DL3A 6PTDA 5E9AA 1MW1A 3IAQA 5F2GA 1JR1A 3KDOA 4YCPA 4Z2LA 8TIMA 3B0VC 3N29A 1JFHA 2QUMA 3CHEA 2F6XA 1ZBWA 1GOXA 1HP5A 3NYZA 1NM9A 4NXKA 5I07A 3NQBA 2E1DA 3BLDA 4LVAA 2J66A 3NTYA 2V5LA 5AC5A 2X41A 3T2OA 4EVZA 2OLAA 2QPSA 1R3WA 3LTYA 3NL5A 2AGTA 4IP5A 2FLIA 1CGTA 2NW0A 3W71A 3VGEA 2WB5A 3CYVA 3KRSA 5AYXA 1SUXA 4Y9PA 2HQAA 3GK0A 3A3WA 1JD7A 1UJQA 4V15A 5JBDA 3IJ8A 5F2LA 4OV9A 2Z1XA 2A79A 3WF1A 2ZA3A 1Q45A 3WD4A 2ACUA 3L2LA 3F03K 1P0KA 2ZC1A 4F2TA 3MYOA 3OP2A 4IIBA 3LSBA 4GUIA 3DYPA 5EBAA 2I5QA 1OVDA 1TPH1 2A1YA 2Z1BA 3ZJ8A 4GXPA 3VDGA 1FWEC 4IX2A 2VFDA 2YW3A 1YDYA 3AC0A 2D73A 3NO3A 4A2RA 3MMUA 2UV8G 2Y5SA 5E0CA 3N6QA 1TE6A 3W0KA 1GVFA 2DUXA 3WMLA 3E0FA 3HG2A 2IXUA 4G1NA 4UNLA 2V2CA 3L4UA 3W1RA 1GONA 3T4WA 1M9HA 3QOKA 4QROA 1FXPA 3H2OA 1HUVA 1JCYA 3SUTA 4YVPA 3VIOA 3R94A 5FJIA 3QC0A 3WQ5A 5L9FA 2XFYA 3M0IA 1QRQA 3THUA 1A53A 3PHAA 7ODCA 2HS8A 2HXUA 2BVTA 3MUXA 3SIZA 4IGHA 1A5UA 2ZZ7A 4GINA 1P6BA 1DQWA 4N02A 1V7YA 1N8WA 3NQMA 3G1SA 3VCNA 4RZ5A 4H19A 5HR6A 1T40A 3AZSA 4C6KA 1DWGM 3W83A 5HQMA 1TIWA 3CEPA 4JIRA 1XLLA 2ABBA 4QAWA 4HT3A 4Y8EA 1XIGA 3ZSSA 3W24A 4MB1A 5F1VA 2ZIDA 3H54A 4ZO8A 3P74A 4IIEA 3DU0A 3S46A 3QYQA 4HHMA 4F4RA 2GGGA 1HKIA 3GAYA 1R3TA 4FB7A 1VFUA 1Z41A 1DIDA 5HWJA 3W22A 2FTYA 4O19A 5EFDA 5IHSA 4AC1X 1SJBA 2DIEA 4IXHA 1MRQA 5I79A 3URBA 3T09A 3DAQA 3BG9A 5DY2A 1OX4B 3HZ3A 3S2NA 2GUUA 3I4KA 3ZJ7A 1UZ4A 3WQCA 1VFSA 1G4SA 4IMEA 3ATZA 2PF8A 4HK7A 2GWNA 4Q7BA 1UD6A 3P0XA 1JDFA 3W3OA 1SW0A 4DB7A 1E9LA 2OCZA 3DX5A 1DJZA 1UR0A 4LF2A 1ISYA 2FHFA 2J7HA 4BR1A 1JCMP 3WBYA 2ABAA 1JRBA 3G6MA 1ISZA 2Z6JA 3WH9A 1FHLA 1QNVA 3MSYA 4FR1A 2TPSA 2H3DA 4JIQA 2PI6A 5A3HA 2BWGA 1OGSA 4IGMA 1XLIA 4IM4A 4PYSA 4PEEA 3PWIA 2VL4A 2EXOA 3GXIA 4IF2A 5JU6A 5C5YA 1TTQA 3JW7A 3SCTA 1EJUC 5CLWA 1TIMA 2ALDA 4S39A 5DN1A 1Q7QA 2CLFA 2NVAA 4RW3A 3VOIA 2IMRA 6XIMA 1EJWC 3UCQA 4KW2A 1PB0A 1KW1A 1QJWA 3ZZ1A 3MUZ1 4RNHA 1S3TC 1NWUA 3MTWA 3RPDA 4J3WA 5IDIA 3W7OA 4MMWA 3QR0A 3GFZA 4UNKA 4AVNA 1QFEA 1PHQA 1CT5A 4O1DA 4UFHA 5T9CE 2RUSA 2E5BA 3CMFA 4ALDA 3UYIA 1IGSA 1R7AA 2Y89A 4A8NA 1FX6A 2CKSA 1TRIA 2J9XA 2OWCA 3FAWA 1J93A 3RJXA 3MVTA 3FCPA 3ARSA 1A5BA 4A35A 3TXVA 1PS9A 3VKCA 2G95A 1RLDA 4RXGA 2ZTKA 1ODUA 2DZVA 2Y1HA 1YTEA 3EB2A 3HA1A 5HINA 5AKQA 1YXYA 3P6LA 3EOOA 4D6DA 2V5CA 1PKNA 1VGAA 2G4FA 3ZJKA 4ES4A 2YDAA 3AS1A 4U28A 3D6NA 5D32A 3VDBA 3VFLA 3TZFA 3UWEA 2OYKA 2Z2BA 2VGFA 5HWNA 2P0IA 1ONXA 5CKSA 5KINA 3QHNA 4XKYA 3G5EA 1ZP4A 1TV7A 2J8TA 2PLKA 1ADOA 4D71A 4ICCX 3VVGA 1Q6FA 4PCFA 4L80A 3PANA 4PCSA 1A5NC 4WVXA 2YXGA 3OZOA 1KBJA 4H6QA 2VM8A 5J5RA 2PD5A 3QZEA 3FXYA 3EEZA 4LUJA 4NRRA 2YCIX 3RM8A 3KVJA 5ABHA 5FJJA 3E96A 2YXOA 5EL1A 3UCDA 3W7GA 5FOOA 1K9FA 3GNNA 4AY1A 1E6ZA 4JCLA 2VC5A 4GUJA 3WLNA 1FRBA 1VFTA 2YW4A 4AQLA 1PSCA 3E1F1 3VGHA 3GNRA 3K46A 4BQ4A 1DJWA 1NU5A 3R12A 4AC7C 1WDPA 1XYZA 3TN6A 3NDZA 3H7RA 1KO0A 4J3XA 2BODX 2QJNA 2P3EA 4E2VA 3L4ZA 5GJMA 1LUCB 1UUOA 4DWSC 4MFEA 1RD5A 4YU1A 5EYWA 4MJ4A 3H2MA 3URQA 2A3EA 4QM1A 4XAYA 4A21A 1JCXA 2F2HA 4J2MA 5AC4A 1RCQA 2FMNA 2YBTA 1EHAA 3WX7A 1TPWA 5I09A 3S1VA 2PTXA 4GY0A 3QFWA 4M0XA 3VDAA 3U5UA 2C13A 3B04A 4F0LA 3MCNA 3PBUA 3UWUA 9XIMA 1KRBC 1A3HA 2PBGA 4ZEPA 2OMAA 1PE1A 2G50A 3ALFA 1XICA 1B3ZA 3M0ZA 3BG5A 2NLIA 3EPOA 3NYDA 3WK0A 4HYVA 2ZRXA 4AUBA 1CDGA 4NY2A 1MW0A 5BWFA 3U48A 2Y63A 4DNHA 3W6LA 4DBWA 4P8XA 4AEOA 1OFEA 2IUZA 4IJRA 3N4FA 6CGTA 3T9PA 3S0CA 1JDCA 2O9OA 3QJAA 4LCQA 3S1WA 3BLIA 1GHSA 2J9ZA 1J0IA 2ZDRA 3GAKA 1XBXA 3GG0A 5I2UA 3WH7A 2OLSA 1G01A 1ZLPA 1FWDC 3WJSA 4IFOA 7REQB 4ZOEA 1HJWA 4NHVA 3UXAA 2HXTA 2VT0A 1BYCA 1DE5A 3VZXA 5KITA 2VRJA 5HQEA 3ZXWA 1M5WA 1JZ4A 3O05A 4EF8A 3G0SA 3EMCA 5C54A 3STFA 1R85A 4MZYA 2VHLA 2E9LA 5A6AA 4O1EA 4XSLA 2YJQA 5LKYA 3KLLA 3O9NA 3OGRA 4Q4QA 5FA5A 3T2QA 2J4GA 4K7VA 4I7UA 3VD3A 3YPIA 1UKPA 2NV2A 4NRSA 3GH5A 4MY8A 4IFKB 1Z42A 3QLLA 1WKEA 1B30A 3PBVA 3EA3A 3O63A 1XG4A 1V6XA 1XH1A 2OT1A 1QK2A 1Q2SA 1BGGA 3AHYA 3WLKX 3GDLA 1V3JA 3E5BA 3KTXA 5CEWA 3QZAA 3H4GA 3ANUA 3JR2A 4D6GA 1QK0A 3RX4A 2J8GA 3W82A 3TAOA 2B4GA 4FF5A 1V0LA 3WJYA 2WVSA 3DHUA 2WZTA 4GFSA 3AHZA 3CL7A 2YDSA 2PDMA 1VYPX 1DVJA 3O7UA 3WQWA 1V02E 5MKGB 4MOZA 4GC3A 2OYMA 3BLFA 1TR9A 3GSMA 2OQYA 1IEIA 1X6NA 3W84A 4REQA 2OYLA 5JUVA 2GQ3A 1EF3A 4LTSA 4PMJA 5CJNA 4DRSA 1NF7A 5AYBA 3LK6A 3AAMA 3SJNA 5LNVA 4MF4A 4R88A 3AICA 3UXKA 4ZENA 4FXSA 3KHJA 4HTBA 3TVAA 3NZQA 1EX1A 4PCNA 3W1XA 3UZ5A 3DEQA 2CETA 2VEMA 1HJVA 4A3UA 4KFOA 3HGJA 5C2XA 5C6MA 2VZSA 2EPHA 1KM3A 4I7VA 1A0EA 3V4BA 3TLQA 5I5RA 4KESA 2BVWA 3UNDA 3DG6A 2FJKA 3DFQA 4LV4A 4LAMA 1QWGA 3NGJA 3PVFA 2F61A 3GTHA