1RALA

Three-dimensional structure of rat liver 3alpha-hydroxysteroid(slash)dihydrodiol dehydrogenase: a member of the aldo-keto reductase superfamily
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
308
structure length
308
Chain Sequence
MDSISLRVALNDGNFIPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLYEVEEEVGQAIRSKIEDGTVKREDIFYTSKLWSTFHRPELVRTCLEKTLKSTQLDYVDLYIIHFPMALQPGDIFFPRDEHGKLLFETVDICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQSKMLDYCKSKDIILVSYCTLGSSRDKTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRYQLQRGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of rat liver 3 alpha-hydroxysteroid/dihydrodiol dehydrogenase: a member of the aldo-keto reductase superfamily.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
total genus 75
structure length 308
sequence length 308
ec nomenclature ec 1.1.1.50: 3-alpha-hydroxysteroid 3-dehydrogenase (Si-specific).
pdb deposition date 1994-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1ralA00
3UZWA 1A80A 4GA8A 4JTCA 3WBWA 4PUWA 3ONBA 4DZ5A 2IKJA 3T42A 1XF0A 3RX4A 4H8NA 5AZ0A 1QRQA 1EXBA 2WZTA 4LB3A 3Q65A 1HW6A 2HE5A 1LQAA 2PDBA 2HDJA 4HBKA 2R24A 3CASA 2ISFA 3DOPA 4WEVX 1PZ0A 3R58A 2PDFA 3BUVA 5JH2A 1FRBA 1YE6A 3UWEA 2INZA 1ADSA 4JTDA 3B3DA 3BURA 3LEPA 3R8HA 3R7MA 1S1RA 1S2CA 2VDGA 4WDUA 4XZIA 3MB9A 4HMNA 1Q13A 2BP1A 2PZNA 4IJCA 1S1PA 2PDHA 3R43A 4YVVA 4XZNX 4JQ4A 1K8CA 4PRRA 4XVDA 5HNUA 1EKOA 1XJBA 2PDIA 1UR3M 2PDGA 2IKGA 3GHUA 4ZFCA 2PDLA 1YE4A 1IHIA 4JIRA 1PYFA 3CV7A 2FGBA 3BV7A 3LD5A 4GABA 4G5DA 1AH4A 5LIWX 1Z8AA 4GQ0A 3ONCA 1RY8A 2NVDA 4QXIA 5JH1A 1M9HA 3COTA 4PR4A 3UZXA 1Q5MA 5HNTA 3CV6A 4LBSA 1PWMA 2IPFA 3R94A 1ZQ5A 1US0A 5DANA 3BCJA 2CLPA 4WDXA 2F2KA 3H7UA 1JEZA 3CAQA 3R8GA 1QWKA 4R9OA 4Q3MA 4PMJA 3R6IA 2A79A 2R9RA 1T41A 1ZGDA 4PUUA 4JTQA 2IKHA 3F7JA 4WDWA 2PDJA 4LAZA 1X98A 4EXAA 3P2VA 1T40A 4EXBA 2PDPA 2P5NA 1ZSXA 1VBJA 2HEJA 1AZ1A 4XZHA 2FZBA 5LIKX 1ZUAX 3M64A 3FX4A 4XK2A 3MC5A 3CAVA 4MHBA 1SM9A 3WBXA 4YS1A 4JQ2A 1J96A 2BGSA 1PZ1A 3LN3A 3EAUA 2PDQA 4ASTA 4GQGA 2INEA 4NKCA 3GUGA 3N2TA 4FA3A 2PDWA 4L1WA 4JIIX 2FZDA 4FALA 1X96A 3O0KA 4XZMX 5C7HA 3RX3A 4JTAA 3QKZA 1YNPA 5LIUX 1AZ2A 1XGDA 5HA7A 4YVPA 3GHRA 3GHTA 3KRBA 2IS7A 2PDYA 3UZZA 1MI3A 3CMFA 3H4GA 2FZ8A 2WZMA 5LIYX 3G5EA 3M0IA 4JIHA 3V0TA 3LNMA 3LQGA 1AFSA 2PDCA 4Q7BA 3V0SA 2I16A 1IEIA 2ACRA 1MRQA 2IPJA 4GIEA 4JQ1A 4QR6A 2BGQA 4I5XA 2ACQA 2IKIA 3N6QA 4AUBA 1HQTA 4LB4A 4FAMA 1GVEA 4GCAA 4LBRA 2PDXA 2ACUA 4ICCX 2DUXA 3LZ5A 4IGSA 4JQ3A 4XO7A 4DBWA 4FZIA 2IQDA 1OG6A 3V0UA 3GHSA 3WBYA 2FVLA 2HVNA 4OTKA 1EL3A 3UG8A 4PRTA 2PDUA 2DUZA 2DV0A 2FZ9A 3V36A 1PWLA 4DBSA 2QXWA 1R38A 3LENA 4YVXA 2ACSA 4XO6A 3UYIA 2IQ0A 3D3FA 2PD9A 2AGTA 3WCZA 1LWIA 3EB4A 2I17A 1Z9AA 3VXGA 3FJNA 4WDTA 3C3UA 2F38A 2NVCA 4GACA 3G1RA 1EF3A 4WRHA 3RX2A 4XAPA 4DBUA 1RALA 4LAUA 2C91A 3DN5A 5M2FX 4L1XA 1S2AA 1MZRA 3U2CA 4XVEA 3M4HA 2IPGA 3LZ3A 4IJRA 3WG6A 3V35A 2PD5A 2PDKA 5AZ1A 4JTRA 5KETA 2HV5A 4F40A 3Q67A 1Z89A 1YNQA 3H7RA 3LBOA 3EB3A 3UGRA 2HVOA 1RY0A 2ALRA 4JQAA 5LIXX 4XZLX 3UP8A 1C9WA 3UFYA 4YU1A 4QX4A 3LUTA 2PDNA 2J8TA 3LQLA 2PF8A 2PEVA 1X97A 2HE8A 4H7CA 4QBXA 2IPWA 3O3RA 1AH3A 3S3GA 3NTYA 1AH0A 1Z3NA 2PFHA 1VP5A 4RPQA 2PDMA 4WGHA 3UZYA 3ERPA
chains in the Genus database with same CATH superfamily
4BQ5A 3W2NA 1UKPA 1V3LA 4JTCA 1PVNA 3AIEA 1X1ZA 3RHGA 3HB9A 1HP4A 1YQ2A 4HA0A 4PC8A 5EMLA 5C54A 3P93A 1ISWA 4DYJA 4UTMA 3GDMA 1H62A 2ZWYA 1FBAA 1AL8A 1PPIA 1JUBA 3OIXA 4C6JA 1AK5A 1NH6A 3HG4A 4BEUA 1KM4A 2QKFA 1Q7MA 3UG3A 4WR3A 5TAOA 4BFAA 2G97A 3LM3A 3QZ6A 5DY2A 1G5AA 3QYSA 3LCIA 1R3SA 5CKSA 3TR2A 1ISYA 4JTKA 4CKQA 4D6IA 2V3GA 5K2ZA 1B1YA 3CPRA 1BD0A 3UWEA 5T91A 1U2YA 4Q8NA 2OX1A 3UZ5A 2YJQA 3P8JA 3GXNA 3A5FA 3DHFA 2H90A 3AIWA 4QG6A 1GQIA 1J4EA 4A4AA 3W1UA 5I3JA 5FF0A 1Q13A 5HOSA 4DJFD 4GCXA 3UERA 1OCNA 4B4FA 1YDNA 5JU6A 3IRDA 3NSXA 1QU4A 1ZL1A 2XFFA 1W3HA 4JYEA 1GEQA 5CJ5A 4XVDA 1Q6LA 1F4AA 2DORA 1QFEA 4JX5A 3CQIA 3TMLA 2PDLA 4UCGA 2ZXQA 4CGTA 1H60A 2WM1A 5T26A 4PB5A 5FSEC 4GABA 4N9EA 2WBKA 4F8XA 3EXTA 8CGTA 2JQXA 3C0LA 3ALGA 3PUDA 1RY8A 5HK4A 3STGA 4K3ZA 5EMJA 4HCDA 1M9HA 1V0NA 2XSXA 3SY8A 1W3KA 4DUWA 4HT3A 1PWMA 3IIXA 3UXIA 1JDFA 1M5WA 1UOZA 1RLDA 3UPBA 3AS1A 4KRZA 5G2WA 3WH7A 1YPFA 1KBIA 3CUIA 2DZBA 1SJDA 5H8PA 1PX3A 4KW2A 1XIGA 4HK7A 3LRLA 2QT3A 4IIEA 1OYAA 3ITYA 3CO8A 3QTGA 4TR9A 3PUOA 3WMCA 3TK7A 1PZ2A 1KQYA 4ES4A 3SFKA 1LOLA 4ZB5A 3BLIA 2ZX8A 4QCFA 3WQGA 3QN3A 3OGVA 1AJ2A 4AC7C 3VILA 3I6EA 4TQTA 5C2GA 4XZHA 5CZ0A 2X30A 3ZO9A 5A2AA 2NXIA 4XZ9A 1E6QM 4RV8A 1K8XA 1FUYA 1GTHA 5CPSA 5RUBA 4XAFA 2KX9A 4OQVA 2WZIA 3GBDA 2J47A 4TVDA 4ZO9A 3DFPA 1F73A 3FEMA 4UR9A 4PCNA 4FA3A 2XVKA 1QHZA 2PDWA 3GYCA 4LCRA 3MDUA 2V2HA 3K1DA 4US5A 4C6OA 4ZXOA 2O4QA 3O0KA 3U7VA 2PLKA 1V3IA 5LA1A 1B54A 2V63A 3N4EA 3CHCA 3TCEA 1E4IA 5BWFA 1G6CA 4YMZA 3FS2A 3NSNA 2VZUA 4O18A 3KRBA 4FNTA 3TW6A 1M01A 5BOOA 1Q6GA 3UVAA 3N9KA 2WZMA 1MMFA 5U7SA 3WLOA 3KWSA 3BAJA 2MANA 4WOQA 4TTUA 3AI0A 5TBOA 5CC6A 5CG0A 3VOCA 3KBJA 3W27A 3PBMA 1IT8A 4O57A 1K8ZA 3EX4A 3A6OA 1T5AA 1VPQA 4IISA 1ZCOA 1SW7A 2HZGA 3AIQA 3WJYA 1EC7A 3I10A 2Z1BA 2OZTA 1HKWA 1GKRA 3SGZA 2Z7GA 3ZR5A 3M0VA 4J27A 4UUIA 1XISA 1EUAA 5DFAA 4AG0A 2CBJA 3H2NA 4K39A 3AS3A 3CPUA 2JGQA 4UTTC 4GC3A 1R3QA 3E0FA 2DZUA 4LEFA 1BWVA 4ICMA 4YHEA 3KBMA 3VNMA 4JTLA 2FTWA 4ZSTA 3VK5A 3GHSA 5EMYA 2Q09A 3UQNA 1AL7A 1Q8JA 3N2CA 3MWAA 4QEHA 3MYOA 3FA5A 5HULA 3V36A 3VI2A 3A21A 1KM2A 4ZO6A 2OYKA 2VGBA 5BWAA 3BV4A 1XIHA 5AHLA 5EYWA 1S39A 4MB1A 1JCJA 1R86A 3KOXA 1ODUA 5C6MA 3DKJA 3W38A 3N1AA 1Q4WA 3PB2A 1AJZA 1RCQA 4FHAA 1W1VA 4D1IA 1FH9A 3EWDA 4DN1A 3LSBA 2TPSA 4JX6A 3OU8A 3D47A 4O16A 1ONEA 3GDKA 1YPXA 4C6DA 2NT1A 2E1DA 2Q8ZA 2AMGA 4LS1A 4UFIA 4GQQA 3UR5A 1B4KA 3LLDA 2XJ7A 4AZ6A 4OU1A 4I5RA 4Q4MA 3F2DA 2J6XA 1V3MA 1TZ7A 1D7KA 5BU9A 3I68A 3IACA 2AKZA 4YU1A 4UTLA 4NZ3A 4PUNA 1FP8A 3M5XA 1KGXA 5IOBA 3GVQA 2DUAA 2ATMA 5BZAA 3NZGA 4AZCA 3O3RA 4W89A 2YXGA 4C7GA 1W3LA 4X63A 3IEBA 3KBWA 1VP5A 4LV4A 3S8HA 1Q3NA 4HTYA 2Y5EA 4AZBA 1A5BA 4W8BA 3V1PA 4US6A 1GQLA 1QNSA 4DYEA 4UOZA 4NI8A 2CW6A 3WUBA 3BO9A 3SCVA 1C7TA 3ONBA 1Y7VA 5I3GA 4DELA 3CQJA 4LUYA 4QEEA 1GPWA 3N18A 3DFQA 1DL3A 3UBPC 3UJSA 1RVGA 4B5NA 4C6NA 3VOGA 3MUIA 3Q65A 3TYAA 1DQXA 5DMMA 1SU5A 4MWAB 2R24A 1NWSA 2ISFA 3I6RA 3A9IA 5DBUA 5A6BA 5CJNA 1IF2A 4MFDA 3R1ZA 2PDFA 3ZYZA 1UD8A 3WDHA 2ADAA 2J9YA 3KLLA 4P5UA 2YW3A 3NPVA 3UR2A 4NZJA 2E1WA 1PCKA 3VD9A 4Q8UA 4D6DA 2CLLA 5CPNA 4RL3A 3CT2A 3T05A 1K03A 3GNOA 1FWGC 4KCTA 2DH2A 4CQCA 1XP3A 1LT7A 2DDXA 4ZSUA 4AMCA 5A1AA 1XYZA 3NAVA 1JQXA 3B9AA 3S9YA 5EU9A 1EP2A 4RE0A 4S2BA 4LAMA 2WW5A 4TX9A 2G50A 3WDIA 3KCLA 3ANUA 2GQ8A 4WUIA 4PMZA 3TYUA 3HV9A 2QEZA 1DYSA 2YPIA 3B8TA 1O66A 5J5DA 3KAOA 4C65A 1VD6A 3G1DA 4GVGA 1XIMA 2V9DA 4NY2A 1Z8AA 4JX4A 4C91A 5K4ZA 5REQA 3LK6A 1GKQA 4G2DA 4AWUA 3VM5A 4FXFA 3AWOA 4EAMA 2CHNA 4QJ5B 5MKGA 1RD5A 4JHMA 1I0DA 4EIVA 1H7RA 4Q32A 4EWJA 3S2JA 3WQPA 1US0A 2OZ3A 1L6GA 4CN6A 1EGVA 3NGJA 3B04A 2BY3A 1QBAA 2FB2A 4MMWA 4H8VA 5I3FA 1BTCA 2A3AA 5H6HA 1XPGA 2ZFAA 3CUJA 5IM51 5CAHA 1XBXA 2ABAA 2HWGA 4J28A 4MSSA 1OQFA 3R0KA 4YYCA 2NQHA 4OVXA 1T8QA 4X0NA 4YTUA 3GD6A 1M65A 4Q4SA 2GJRA 1UWUA 5BNKA 4UFJA 3M5VA 3W1LA 1PDYA 5TD4A 4OE7A 4I8DA 4RDWA 4PUDA 1IIHA 1O5KA 3QH2A 3QW3A 2YDAA 4HQVA 4UIOA 3M64A 1HJWA 4U3AA 3PFMA 1KRCC 2A5HA 1MXSA 3NG3A 4XK2A 4PL1A 4MHBA 3P60A 1MSSA 3T0TA 4H01A 3RLUA 2O9RA 2R91A 1U5HA 2MUCA 5ECUA 4F4RA 2W67A 2UZ9A 1D9EA 3S1GA 4BHYA 4LUSB 4K2SA 3VIHA 1J0IA 2PAJA 4AIBA 3SQMA 1KO0A 1V6VA 3P0WA 5G1TA 4ICNA 1VLIA 2FQIA 3AYVA 3M5ZA 4L4PA 2VWSA 3BCFA 4YYFA 3F2CA 4QDMA 5A8OA 1LRNA 3K4DA 3GHRA 3QPYA 3BARA 4LRSA 3WENA 2YXXA 3W7MA 1QXLA 2ISVA 1EIXA 3HV8A 2QIWA 1LWJA 2Y8KA 1UIPA 1ZZMA 2PGEA 1QT1A 3QYQA 1RJPA 3U57A 2C71A 1W1B1 5FAJA 1A5KC 2Z0IA 3BICA 1Q7QA 4LNYA 1O94A 3AWNA 3ES7A 1VFTA 1ME7A 3T0AA 4TVUA 1XIIA 4YTTA 2W3ZA 5FF7A 4IPJA 4O17A 3WL0A 1G67A 2ACUA 4M6PA 4A6GA 2CETA 1DXFA 1K9EA 1BYCA 4KRTA 2A21A 3EPMA 4R9XA 3NQ7A 3Q94A 3ABOA 4DBWA 3TOYA 4O50A 1A47A 4RW3A 2A2IA 3FDKA 4KIEA 1GKPA 3W7CA 3WBYA 3PBVA 2FVLA 2BG5A 3TXVA 4D71A 2ZUUA 3QSRA 5DBTA 4MZYA 2A3EA 5L9FA 1UA7A 2QXWA 2VI0A 2QIIA 4AYSA 3GU1A 4WSKA 5J5RA 4NL1A 3GNNA 3PZQA 1GNXA 2OELA 2NVCA 3PNUA 7CGTA 1OZQA 3S6TA 4Y90A 5EMUA 3W28A 4I90A 1NEYA 3IV3A 3CYJA 1W56A 3FOKA 5D04C 4HOWA 3M4HA 1KM3A 1YXYA 2E4TA 3W1AA 2WSKA 4YWIA 4XSLA 5DT5A 2CXEA 5LNVA 3LHZA 4L9XA 1O4UA 4IH3A 1TYGA 1N8IA 5K4XA 2X7WA 3HM7A 3AYTA 2JF7A 1VENA 3GXMA 1S5VA 3Q67A 4C60A 4AXNA 4NQ1A 1ZB5A 4Y9NA 4HK5A 3H12A 5E0KA 4R5EA 4DBEA 1NP2A 3TEVA 2V5KA 1RY0A 5B7YA 2QPXA 3ZWSA 3DENA 4DI9A 4OIFA 3D0CA 3Q58A 3EWYA 3MV11 1XIFA 3QEZA 4MJ4A 1WDDA 5GNYA 1OK6A 2RDUA 3KP0A 3KLKA 1PS9A 2OYMA 1W2PA 1AD1A 1VFLA 5LYRA 1IEVA 2FHFA 2J66A 4O52A 3RU8X 1KFKA 2E9BA 3GH7A 3O15A 1A5NC 5M5DA 3LOTA 1XXXA 2QJMA 5HATA 5XIMA 1LORA 1JYWA 1HO4A 4RPQA 2PU0A 1OINA 1P1MA 2BASA 1UP2A 3LYEA 3SCPA 1WXJA 5C70A 4HU0A 1TJRA 2D1ZA 3H21A 4WKHA 3SUUA 1QNVA 4DY1A 1W1PA 4IMCA 2ZE3A 4KWOA 4UFLA 2ZZ1A 3AHXA 3P5ZA 4LCQA 2ZUTA 1Y0EA 4JNYA 3W2UA 4M0XA 4NASA 5LXXA 4QE1A 1EP1A 1JRCA 1FWCC 2E9MA 1XSJA 1W9VA 2E9LA 4KEVA 1EJVC 3B05A 5AECA 3VKKA 1P1XA 3LCXA 1JGMA 2VOMA 1XLIA 1N8WA 7PTDA 4DJDD 3OP2A 3C4UA 4ALDA 1GOOA 4O0ZA 4LVBA 3TCSA 1SZEA 2YL9A 2B81A 4K36A 2NT0A 5B80A 1XUUA 1W1ZA 2VX5A 3SGGA 4JPGA 4CLMA 2VO5A 1W1IE 5BXTA 3R7MA 3VAVA 3PP7A 3VGFA 3BMXA 2OODA 3GAYA 2GOUA 5ABFA 4MWAD 1KR1A 4WY0F 3SY5A 4QIUA 1KTNA 3B9NA 1SSDA 2BODX 4X61A 3HTWA 4LVGA 3D3AA 1BHGA 4MKSA 3GXFA 1P6CA 4PRRA 4J7RA 3GKAA 1CWYA 1YDVA 1XJBA 4S3FA 2XN0A 3M0HA 2HTMA 3EOEA 3CEPA 4DQWA 3PBGA 5FJRA 4S3EA 3FYOA 3K30A 1OGGA 3BLLA 1F6KA 1GUVA 3PM6A 1EO5A 3PR2A 3NQDA 1MEHA 3WF3A 1ODZA 3EOOA 4EKJA 5IHRA 4E6MA 5FJTA 3M6YA 1VAHA 1WZKA 4EAYA 1XYFA 4UNIA 3PWAA 1W5QA 2P3ZA 5FJPA 2J25A 1FTXA 1HKKA 7TIMA 2FKPA 3H7UA 2V0TA 3PUEA 3QMRA 2VC7A 3DFSA 2QUMA 4C6QA 4ACYA 4C90A 3P61A 4Q3MA 1KD0A 1VEOA 3A9BA 2TODA 5HBFA 4KBXA 5A6LA 1E6PA 1RR2A 2ZVIA 4J35A 3W4RA 2A79A 2HPMA 5HWMA 4QDWA 4OUEA 3EXSA 4RV3A 4XTIA 1XYLA 4GIRA 1DJXA 1TWDA 1PKYA 2HRWA 2VMFA 4AYGA 1GQJA 2EGZA 3RK8A 2DW7A 4PUMA 3SRFA 3PTMA 5AC6A 1HX0A 3R10A 1H09A 3CZLA 4A2RA 4EXBA 1ZSXA 1FY6A 2HEJA 2BSLA 5CPOA 3M7SA 3MBDA 2CEQA 3VYLA 3H2MA 1EC8A 3DDMA 3VIGA 3UJFA 3UA4A 2WLYA 4TVCA 5CZKA 5A8PA 3W86A 2WC7A 3AJXA 1IIGA 1VFFA 1L6FA 3DBPA 4AISA 3V16A 1N82A 1TUFA 3AMLA 5LHFA 3NDZA 3USZA 4Q33A 4H83A 4E2VA 2FJUB 4ZOEA 3VKJA 1WZMA 2QPUA 4ZE4A 4S3KA 3W2KA 2OLSA 3TFXA 5I06A 4AAJA 4UTJA 2E6FA 2ZICA 4WJEA 4LEQA 3AHZA 4H9XA 1IT0A 3V4BA 5JBDA 2R1KA 3W23A 3FCPA 4JTHA 3HGOA 2WANA 3ITGA 3LRKA 4FXSA 3UZZA 4H8UA 2FTPA 2OKOA 4XIMA 2OU4A 3CGTA 3LNMA 2PGRA 3ANYA 4IUGA 4LF1A 5I3IA 1F3EA 3W7OA 4LJ3A 3ALFA 1VYSX 5I2UA 2CFFA 4EVZA 1J2BA 4PTMA 1V4YA 4LB4A 1EEXA 3SQLA 3B8WA 4F9DA 3C2OA 3L4TA 2B7OA 1OGSA 2OEJA 4PULA 2QCFA 4DPPA 1OC7A 3PG8A 1CT5A 1DE6A 4HZ6A 4BI7A 2ZX9A 4TV6A 4RE4A 5C5YA 3FKRA 3S2LA 1EL3A 3OO2A 1JZ5A 2J75A 2QCCA 6XIAA 1PTAA 5EGRA 4DUXA 1GVYA 4AVFA 5BXRA 3C8NA 1J79A 1TVPA 2ACSA 2X40A 4KIRA 2PD9A 3QF0A 1KC7A 1R7AA 4RNJA 1N55A 3STCA 3DYOA 1E43A 1X39A 3AYSA 1EDQA 5BCAA 3UA3A 3WD0A 1OC5A 2V68A 2VC5A 3E0IA 2YA0A 3G3DA 4GZJA 2C91A 1KW1A 2HISA 2B7QA 4UQBA 1WAWA 4U3CA 2WSRA 2EG8A 1E1CA 2IPGA 3L0GA 5C9UA 3B9DA 1A5MC 1ZBCA 3O8AA 3SB0A 3BWWA 3NGFA 4MAZA 1BVZA 1EBGA 4Q8MA 1I75A 4K8HA 1EJ7L 4D9PA 4RX0A 1DXEA 4UOQA 1YNQA 4GBUA 1ITCA 4QGCA 3W6YA 1TA3A 1C7SA 3SUTA 3UGRA 4Q6XA 2PI6A 2GVLA 3LXAA 1HG3A 5A95A 3C61A 5FIPA 4ZB2A 3CUXA 3NL2A 3L4UA 4LYRA 3MHFA 1C8QA 5GJPA 3R13A 4GK8A 2PF0A 1GVIA 2LLEA 1OX6A 1TIMA 3E96A 1ZY9A 2D2OA 2WSQA 4R27A 3E2QA 5HPCA 3QC0A 3W74A 1O6IA 3QRHA 5BMWA 3S6DA 3VZZA 4P7RA 2O4MA 1AH0A 1E6NA 4X0VA 3M0LA 4DXKA 4GJIA 1SJAA 3HFYA 5AHIA 3MO4A 4XV0A 3G0SA 4MJZA 4BI5A 1A80A 2VL4A 4PRWA 2P0OA 2Y7DA 4QS5A 5HNRA 1IZJA 3BJTA 2G41A 4FSAA 2IKJA 4UTUA 4A3RA 1K9DA 3UJ2A 1OHLA 1YADA 2WJZA 3HFTA 3MP3A 4X9SA 4JOMA 4L6HA 4J3SA 1JDDA 3MQTA 2Y85A 1LQAA 2VEFA 4GJ1A 2NV2A 3FGCB 1FX6A 3TQPA 4HN8A 1XQLA 3OYZA 3UPWA 3LRMA 4MB5A 1I2RA 1DJIA 1RP8A 1KV5A 3G1YA 1RVKA 4GUHA 3E74A 4W5ZA 1DWGM 3POHA 4DJFC 4NUWA 4M29A 1KM0A 2HPIA 1OVDA 4S23A 5KINA 4WDUA 3WLMA 1I2NA 2Y8VA 4FNQA 3IIVA 3UEQA 3S0CA 4E3VA 4P8WA 2YYTA 3MCOA 4UWMA 2J6VA 1CPUA 1VQTA 2Y61A 3WK0A 3JZUA 3B8IA 1I4NA 2QUNA 5M17A 4XZNX 4JQ4A 2EJ1A 4B91A 5HR7A 3IK2A 4XBKA 3G1HA 3WJZA 2R1PA 3IVSA 3U5YA 4H9UA 1UWSA 2VUNA 1EUNA 4EPDC 1GJWA 4M5PA 3ONCA 4L61A 4Q6JA 3L66A 3MHGA 4S3BA 1QNPA 2Y7EA 2C1HA 2NSXA 1RAKA 4FNUA 2H3DA 4Q8OA 3M07A 1MW2A 3DAQA 5ABHA 3RM8A 1E71M 3BSGA 1GVSA 2ZRXA 2JKAA 3UCDA 5CGMA 2F2KA 4GH1A 1UR9A 4AXKA 3WDRA 1Z44A 4H00A 4YLWA 3T6CA 1T41A 4RDYA 3IARA 3NPWA 1YMYA 4JR5A 2QCEA 4F9JA 1NJJA 3HO8A 1U5JA 2C13A 4I3GA 4A3YA 3WSUA 1JZ4A 1KFCA 3AISA 1L2QA 2WVVA 3L0NA 3QHNA 1XIEA 3EDJA 1R2TA 3GNXA 5AYIA 3P2VA 4HU4A 5E1QA 3VE7A 1KRBC 4PUJA 2X1TA 5SWUA 2P5NA 4IFOA 4CD8A 1C8VA 3IIPA 3GDTA 6TIMA 4W8LA 3G77A 1YEYA 4C1KA 1GZJA 2J7GA 5F2IA 3SR7A 1C9DA 1ZUAX 3DGRA 3U9IA 4UTTA 3T09A 3KE0A 3OHIA 1HJUA 2VP8A 3M0XA 4W9TA 1J8VA 2PA6A 1J96A 4DX3A 1HJXA 3H54A 1K3UA 4IX0A 5I24A 1GOXA 4ASTA 5H91A 1DJHA 2BVTA 2VFHA 2X0YA 4S38A 1E15A 2XVPA 1JZ7A 3NDOA 1ICSA 1RQHA 4FALA 1PIIA 1VJZA 3RFAA 4PGLA 1UPPA 3AS0A 3WEOA 3SUSA 1XV8A 4O28A 1AZ2A 2W63A 2VVSA 2KAUC 3AXMA 1E51A 4ZB0A 2DSUA 2PDYA 1F3XA 4FXRA 3WX7A 3HIJA 3LHWA 3WNLA 4HN4A 1UKTA 3B03A 3MP5A 4HB7A 3TKFA 3W7JA 2G37A 3MP4A 1NARA 4QTGA 2PP0A 3MY9A 1XCFA 1ZJIA 4DBDA 2OGYA 4UFKA 2G3NA 2I16A 2B4GA 1IEIA 4ZZ9A 2ACRA 3GE7A 4UZUA 1KV8A 3QZEA 3JVAA 2YA1A 5FA5A 3R5EA 3VM7A 3TVAA 5IXEA 3CTTA 3LB0A 1UB3A 2E5DA 2UY2A 4E8CA 4BWLC 3E12A 3QGAC 4AIOA 4NYUA 2Y8UA 4ICCX 3U4FA 4C5ZA 3S6OA 2VC6A 3IUIA 3VNYA 2V5BA 3ZR4A 4S3GA 3KM8A 2QQ6A 4BY3A 3LCHA 4H9YA 4OBRA 3O1NA 4MZ1A 5IBXA 1S46A 2G95A 3ISIX 1Y8BA 1OF8A 1YW1A 2Z27A 4DJEC 3WMBA 3PJUA 2VVNA 4W93A 1KGWA 6A3HA 3TN6A 2YZ5A 1WKEA 4H4IA 1K7XA 2G4FA 4J1OA 2PDUA 1XKJA 1S2VA 2YLAA 3GFYA 4OOUA 1NAL1 4OV9A 1WXZA 2QUUA 4QE4A 1GPFA 2DIJA 3WQ6A 2PE4A 1OT1A 3D3FA 4M56A 3B4YA 1E6RA 3SN4A 4NJKA 2C7FA 2GSEA 2QCNA 1BEUA 3IUDA 4IPLA 1H2JA 1MEWA 5A6JA 3B8DA 2PS2A 2WM0A 3IJDA 3W71A 1XRVA 3WJXA 4B2DD 4Q7NA 1OGBA 1GORA 3AZRA 1TZ9A 1HP5A 4HHHA 1NVMA 4CNUA 3HPSA 2FJKA 3PTQA 3B40A 4PTWA 3LCFA 2CERA 1LTDA 2ZUWA 4B5SA 3DG6A 2BNJA 2BDQA 4XBJA 1VCVA 2OGJA 5LNUA 4LUJA 4B5VA 3WLRA 1EC9A 2WKGA 1TUXA 1VEPA 1NDZA 3URNA 3LBOA 3JS3A 2CZVA 5A6AA 4PZVA 2CESA 4PB4A 3UP8A 3NQBA 4XZWA 2NXGA 1UPMB 4GFIA 4XIAA 4PL2A 3OOQA 3LQLA 3WNKA 2P3EA 2J7HA 4CU7A 1SMDA 1TELA 1PTDA 3SADA 4MKNA 2QNEA 3AHTA 4PTXA 4M8UA 1AODA 4XUYA 3E0WA 1NFBA 3GLCA 3ITCA 4LT9A 3VIMA 3GUWA 4QITA 4J3ZA 4ZODA 1JPIA 2YDRA 3KVJA 2DZXA 4P7OA 4ZGYA 4JFTA 5EPDA 2PUZA 4F0LA 2XSAA 5F2LA 4BF5A 2CLOA 1J0KA 2WHMA 3TYCA 2XISA 3TWAA 1XLHA 4X60A 2DVTA 3MTWA 3AYRA 5AHEA 2HCVA 2PDBA 1TQJA 4KGJA 5D9PA 4HBKA 2BXYA 2A6NA 2FFIA 3GFXA 1IZCA 4DXXA 3LHYA 5F4XA 5I03A 3MT1A 4W84A 1AA1B 3I3EA 4O0KA 3MKCA 3U48A 1QNQA 4R7JA 3NFUA 1DXIA 4Y8EA 3T8QA 3VGDA 2E67A 4MUPA 3B3DA 1CGYA 3A4WA 3WQFA 3CQKA 3GS6A 2V82A 3AMCA 1F07A 1CGTA 4LU0A 3VOIA 1GZ1A 1S1RA 3LV6A 1DIEA 4OHQA 5D8ZA 1TG7A 3URAA 5I0DA 4CD4A 4N6FA 4TX6A 5D2WA 3VNKA 3A13A 4L4LA 4M6QA 4ATWA 3NXFA 2OYLA 4DB7A 3PAJA 4O54A 1M68A 4L6DA 3WNNA 4ATLA 2ZDRA 3LMZA 3IGUA 3BGJA 3GHUA 2POZA 4XD5A 2AL1A 3W0KA 1ADDA 1VYPX 4MDOA 4DZAA 3G22A 3EKGA 1ISXA 1RBLA 4QJ3B 2DT2A 3ATYA 4GUIA 4YTQA 1HT6A 3IAPA 2AAMA 2YFNA 3AMKA 4C6EA 2SFPA 1V77A 4WXZA 3JW7A 5CGTA 1F05A 4JN6A 3EWXA 5F7UA 1SMAA 1J01A 3N6JA 4GGHA 4LS0A 3T08A 4NNCA 3N2MA 3PPHA 2V8ZA 4U10A 1ZGDA 1A4MA 1DWJM 4TMBA 2E28A 2HBVA 4KFNA 3KRSA 1VIZA 4JTGA 1REQB 3ITOA 2DPEA 2C1IA 1EPXA 3CEUA 3BOXA 1X98A 4EOUA 3CWNA 4I7WA 1T40A 8A3HA 5CCZA 3Q2DA 5C9ZA 4H3DA 5J04A 1Q66A 2WZEA 1LF1A 3AICA 5AVNA 4Q4PA 3QXBA 3V1HA 2FGZA 1SM9A 4GY0A 4E5TA 1TWSA 4MYXA 1TMHA 4LUTA 3RM9A 3RPMA 1F7BA 4R3UA 2PDQA 2R14A 2RDWA 4GD0A 1ZHAA 3RO6A 1FWBC 2DU2A 1JPKA 2GYIA 1JZ3A 5I23A 4DUVA 4TOQA 1NF7A 3S1VA 3W53A 1FP9A 4M24A 3LU2A 1YNPA 1JZ2A 2DZPA 3MHUA 1SFSA 3EGJA 1POKA 1H1YA 4CCEA 2ZX6A 3N6HA 3AHVA 2CCRA 4DWSC 3VD4A 4V28A 1V93A 4AD3A 1V0KA 3CMFA 3WQCA 5XIAA 2QV4A 3EWWA 4JHOA 1KFEA 3FJ4A 2XH4A 5CBIA 3VMPA 2WPGA 3VUPA 3RMJA 1W91A 3PANA 1LBMA 3BK0A 1KTCA 3TAOA 1YXCA 1RQEA 3FA3A 5FCZA 1AQFA 1DE5A 4OGZA 2JK2A 2OO6A 2PWVA 3H6OA 2IUZA 4WLCA 4HOXA 1CGVA 3HBLA 3IGHX 1HXJA 2VWTA 5DELA 4M81A 2OLHA 1I60A 3KL5A 2DUXA 3UNDA 4U4MA 2XVLA 3KOZA 4RW5A 1DWHM 2OOGA 3RLHA 2FFCA 3GC5A 3OVQA 3QTPA 8XIMA 3VGGA 1EA9C 3DFYA 1KWKA 2H8XA 5GJNA 3B97A 3WD3A 4B5XA 3H2FA 5BROA 1POJA 4KPLA 4QHRA 2YGYA 3DGBA 3GIYA 3N9RA 4L65A 3T4CA 4S3JA 1JCLA 3W7LA 4PRTA 5GJMA 2AL2B 2DUZA 2DV0A 1PX4A 1TCMA 4O15A 5DX7A 5H8MA 3KVKA 3FLUA 4DO5A 4GYKA 1BXCA 2O9OA 1NIUA 2V3FA 1E55A 1XLDA 3WK1A 1UCWA 2DEPA 3NR0A 3QGKC 1CBGA 3U0HA 1RALA 4G6CA 3QLLA 3EDDA 1NQKA 1DIDA 3WG6A 3ARQA 3T2PA 5JBEA 2WJEA 2UY5A 1Z41A 4J3XA 1V51A 1UOKA 1ITXA 1XDJA 1NOUA 1UASA 3PTKA 1UHVA 3GXPA 3LXBA 1JUEA 4KFPA 1Z89A 2QCDB 4MWAC 1R3VA 4PE8A 1FVPA 3WKZA 2YCJA 3S5SA 4DEFA 2VEGA 1BRLB 3C0QA 4EE9A 3F4VA 3VDCA 1JF5A 1PV8A 1W3NA 3QV8A 2D2HA 1TWZA 2RDTA 2QCGA 4AEOA 2VEMA 3SCNA 3VTRA 1X97A 3PWIA 4M51A 5FJUA 3SUVA 3A3HA 1W5NA 4H7CA 1VJIA 2IPWA 1W1A1 2DT1A 2V5JA 4C6KA 3D5HA 1IR1A 2XHYA 1QAPA 2PDMA 3KZPA 3QPEA 1FWEC 4EK7A 2XIIA 1XLJA 2X7VA 1M1BA 3SRDA 1SUXA 4D8AA 4PUWA 3EX3A 1FWDC 3SCQA 2BWGA 1XF0A 3ZJ7A 3IVUA 5AZ0A 4NP7A 3TZFA 4NRRA 2PWFA 4E4FA 4IQJA 1ZBVA 3WN6A 3QHOA 3CTLA 4IXHA 2EEXA 2HE5A 3W29A 1IV8A 1SR9A 2UY3A 1Z32X 1UQZA 3KXQA 3THDA 3HMCA 4IMEA 2CBUA 4GO8A 1QATA 1S5WA 5AYZA 3MDWA 2O56A 1YE6A 2VRKA 1OX5A 1XH2A 2BZNA 1V03A 2PC8A 1C8YA 1VLWA 3ARTA 3BURA 5CC7A 1XGEA 1E4LA 2R94A 3UJEA 2ZA2A 1PO9A 5LA2A 4RNHA 4D1JA 4XZIA 1H5VA 2G4JA 4AD2A 4ZOBA 1XBZA 3F5LA 2VX6A 4PTDA 4BA0A 1MEIA 3FJLA 1TREA 1PE1A 1LM1A 4DF2A 3KBNA 1NF0A 3I7SA 6REQB 3KUMA 3MVTA 2J13A 2YXOA 3RXZA 4ZTXA 1M41A 2PRMA 4WIWA 1UR3M 4ZFCA 5EA9A 4HYVA 5E5CA 4AVOA 1EJUC 4ONVA 4H7ZA 5HMFA 1PYFA 3KBSA 4ZBCA 3CHVA 3EOLA 4KEUA 1EJSC 3T2OA 1OZMA 5JH1A 4AX6A 4HYWA 1J2WA 2DZAA 3UWWA 3SSZA 4FX7A 1DIKA 1Q4NX 2Q8XA 2YZRA 2QJNA 1EYEA 4LUSA 2F6KA 3SRHA 3T2QA 1D7FA 3NQ8A 3ENLA 2DSZA 4ORMA 4DWSB 4GC4A 4JFWA 1P48A 3WQ8A 4JTQA 4YL2A 1K6WA 2YX0A 3T07A 1KBKA 3WLIA 2XFWA 3TSDA 1LL6A 1GW1A 1T7LA 1FXPA 3EWUA 5I02A 2ISSA 1BQCA 3PPGA 3UY8A 3AMGA 4PB3A 3W01A 2DT3A 4G9PA 2VFIA 1FWSA 3NQFA 1HIZA 3MI6A 3W9ZA 1TMLA 3BZGA 1P7TB 3REQA 4ZOCA 3GXTA 4AVNA 5HMSA 5G4HC 1QVBA 4KWWA 4HA3A 2AQVA 4KETA 2OEKA 2H9AB 2C19A 2D23A 2BVDA 3QW4B 1OFRA 4IFKA 4W8AA 2DW6A 4NU7A 1JCTA 1EXPA 1DVJA 2XIOA 2YL6A 3ITXA 1LL7A 3MZ2A 2G5WA 5A8GA 3QKZA 3ZLHA 1Q65A 3T44A 1ZU8A 1LUCB 4F0MA 5CXPA 4DO7A 1BQGA 1MI3A 3UW6A 4LVDA 4C6LA 1ZPTA 4GIAA 1MW1A 4JIHA 1WKDA 2D2JA 4UR8A 3E6EA 2B31A 1XQKA 3ZWTA 1NP0A 3WIJA 2JKPA 1YDYA 4R53A 2CC0A 1FWNA 3L4WA 4J5NA 4JNMA 3GZ3A 1E4NA 4N4QA 4D6HA 5DMYA 3FDGA 3N6QA 2Q71A 4GX8A 3BOLA 4J40A 1CCWB 5AB3A 1XIDA 4LBRA 1JPHA 7TAAA 4HMDA 4POCA 5C7VA 1DP0A 1H41A 1O60A 2TAAA 3CXOA 3GIPA 3SDOA 2CBIA 4XO7A 3WBEA 1RZMA 2D73A 4IPNB 3PZUA 2E68A 1P6WA 3ITVA 4HHMA 1CXKA 2QS8A 1B57A 3TC6A 1NDWA 5C9RA 5ABGA 4YJ5A 2P1FA 1J5TA 1FWRA 1VHCA 1IE7C 3MV01 4RZ6A 1TX2A 4W4QA 2WNWA 1GYNA 5D05A 3W37A 1VBHA 3AQUA 2BXVA 1VFUA 5PTDA 3VIJA 1GOKA 4I9JA 2VHLA 4GBDA 1JCMP 4FNSA 3P5YA 4DNMA 1SQ7A 3W6MA 3S2CA 3WL1A 2BV9A 4NX5A 4GWEA 3MI3A 2NLIA 3EEGA 4CNSA 4IGHA 4LRTA 4AMAA 1KCZA 3MJYA 2CKRA 3APTA 2W4XA 4WSHA 4U2YA 4K1WA 4K68A 5KSWA 4F0HA 1O95A 3VOFA 3S2NA 1MVYA 4G1KA 1UBPC 1FH8A 4AHOA 3NA8A 4QSHA 4ZQNA 1N7KA 1WDPA 2GK1B 3KOYA 2XGIA 3H22A 2O7SA 2QCHA 2GQ9A 4UC5A 2Z24A 4PMDA 4DXVA 1XLAA 3APYA 3UWZA 3NPXA 4AFYA 2O55A 5I09A 2GJXB 1UD4A 5E6YA 3VCRA 2PWHA 4QX4A 5LXEA 3EOSA 3PZIA 3BGGA 2PDNA 1G7UA 3N15A 5KZDA 4ZQOA 4Q7IA 3RGTA 3ARYA 2WMIB 2OQLA 4Y96A 1ZP4A 1UUMA 1TSIA 3F03K 3NTYA 1E70M 4R7WA 3TTOA 3M0KA 3SAZA 1EDTA 4QS6A 4DM2A 5JUVA 2DP3A 1GOWA 4BJHA 2PRHA 2GVGA 1DIOA 3M44A 2OMAA 4JDBA 4AZGA 3VDGA 2FZNA 1U33A 3H53A 4DF1A 3SGUA 4MZ8A 4DZ5A 3WQ4A 3T42A 1QK2A 1CXIA 3F4WA 4Y8FA 1B3WA 3IJQA 3TTYA 1AJ0A 3LLFA 3PTDA 1QRQA 4B5UA 4Q8QA 3WLNA 3VDHA 4E38A 1SO3A 1M7PA 2V5LA 4LC6A 3HMJG 1W31A 3MSDA 4B5TA 3B06A 5LNWA 2CZ5A 4RK8A 2OG9A 2ZIDA 2VEIA 1ISZA 2JKEA 3ATZA 3DOPA 3CL8A 4C5YA 2F61A 3A3WA 3DFNA 4TMCA 1FRBA 2Z25A 3MVIA 4IGNA 3LGGA 4KCVA 2CLEA 2DJLA 1S2CA 2GQAA 4WKAA 1XBYA 2V2DA 2EBNA 1K8YA 2Y24A 4XZBA 2PZNA 4ZMGA 1UZHA 1V5XA 3E5PA 3KFTA 1AUSL 1TV7A 1TV4A 1SO5A 3GTIA 3NPUA 1UUOA 2IXVA 4DWSA 4UNLA 2E09A 3CV7A 1VZWA 2ODOA 3QSTA 3DYPA 4G5DA 5BXPA 4DWDA 4YPJA 3VGHA 1PAMA 1W1TA 3E38A 1FCUA 4N42A 3CWOX 2B7NA 1EZWA 3NZPA 1EHAA 3QOMA 4RE3A 4CN4A 4IG2B 3A5VA 2CLFA 3EYPA 1WNOA 4PODA 2XWDA 3CPGA 4WXYA 4ZTYA 3R8GA 2WMJA 4CNNA 4HA4A 3WMLA 5CPMA 4O1AA 1GQNA 4O1BA 5G1YA 1QR7A 3G1AA 1I6NA 3U6WA 1ZNNA 2EQDA 1TZZA 1JG9A 1F9CA 4NAEB 2ABBA 3ZMRA 3CIXA 4ZQRA 4MADA 3LS9A 1JFHA 1E6XM 1PHWA 1KRMA 3B9EA 5FL0A 2VTFA 5EL1A 5IRPA 2RFGA 5LIKX 5I7GA 1ZENA 3LNPA 2VCCA 2CWXA 3BQ6A 3WMSA 2ISWA 3UD6A 1EB3A 3PVFA 3O0FA 3MC5A 3JU2A 2PWEA 5T9BG 1Q6EA 4V27A 3O6CA 4JEJA 1PZ1A 3CHFA 4AZ5A 3P81A 3LN3A 2J24A 2FPYA 4GYPC 2XU2A 2W0UA 4DIAA 1OIMA 3C2FA 1KB3A 3HGSA 2IXUA 3K2GA 1W6TA 1SR0A 4ML4A 1XR2A 2D0FA 2DSKA 3KDNA 4WD0A 4OFCA 3P14A 4Y6GA 1L6SA 2QCLA 3PBWA 3G18A 1FWJC 1QPOA 1WXYA 1AMYA 3BLFA 1NWTA 3GZAA 1W54A 2R1MA 1HN1A 1B3OA 4CCZA 3ZVHA 2HXUA 5AYXA 4HMEA 3Q37A 4D8LA 1GOQA 1QW7A 3G1SA 3PSWA 2X05A 4JTFA 1E1FA 3LV5A 1QMLA 3IK4A 3UR7A 3ICJA 2OQYA 4XAZA 4HA1A 1X6UA 4QQUA 4M1RA 1QPQA 1KLYA 1BAGA 3DH7A 1CDGA 5FKYA 3DZ1A 5E09A 5I5RA 3FSUA 4IWWA 2GSJA 3GDRA 4H9TA 1KR0A 3CZGA 2E77A 3M1ZA 5HJYA 1H50A 1OCQA 5TQLA 1EDGA 4KMQA 4Z1AA 5JBFA 1V08A 3MJMA 3CS2A 3ZT6A 3IGSA 3VIFA 3E2VA 3INPA 3FVDA 4WVXA 2A3HA 4UTWA 2ISDA 5G1MA 4ERAA 5HDRA 5I3KA 1S5MA 4J3VA 4OTKA 4V1XA 3W83A 4Q8PA 1ZBKA 3TONA 1J0JA 5HJXA 1NDVA 2W91A 1WDQA 4S3CA 2V67A 4ZO7A 4QAIA 1MYRA 3GNDA 1R38A 4N9DA 2XIBA 3N12A 1WDRA 1E73M 2I17A 2J7FA 7A3HA 1SGJA 3LLXA 4AD5A 1UD5A 2X8RA 2NUYA 5G4WA 4P8XA 1VFMA 4IX2A 4K37A 1AMKA 2BOGX 2BXZA 4XD6A 4F2TA 3HZ3A 5HMEA 3TA6A 1Z42A 1E6SM 3M47A 3SSJA 4IZGA 2GPTA 1WOAA 4MM1A 3TW9A 3MMWA 1B31A 3W88A 4AF0B 3H24A 3SN0A 1VS1A 2PDKA 2Y5SA 2G96A 3L23A 1RA0A 3V3WA 5HWNA 4A8RA 1XSIA 4JXCA 5FEXA 3TLLA 3UVIA 3ECQA 4LPCA 1P43A 1MDLA 4O10A 4R85A 6PTDA 5JIWA 4Z2IA 2OWCA 3MANA 4H6RA 4IJBA 3VOJA 3DHDA 1EBHA 5HQLA 2ZZ6A 3O05A 4Q4RA 1VFOA 1UWIA 3MSYA 3VIIA 1GWJA 2DZTA 3ANVA 3FY1A 1UKOA 2Y1HA 2ZC1A 4FNPA 1PKMA 1C9WA 1TWIA 1L6WA 5AC4A 2PGWA 4BCEA 3LUTA 4EF9A 1D3GA 3EBVA 2J8TA 2CHRA 2C79A 4KS0A 1Z69A 2F6UA 2PEVA 4O13A 3BJSA 5CC3A 3SJNA 2NQ9A 4CEUC 4G7FA 4JKKA 1OFOA 3EA3A 4ZA0A 2Y7GA 1AQMA 3S5OA 1QPNA 2PFHA 5ENLA 3TZNA 2PLMA 3OTRA 3H4XA 3TQ0A 1H0GA 3U7BA 3NZQA 1DTUA 4MG4A 2PWUA 5FF4A 1J9YA 3NCOA 1XCXA 3SJ3A 1HL9A 3DI1A 7REQB 1MDRA 3QPZA 1JCNA 4E2BA 1TPWA 3WJSA 3RX4A 4YCOA 3BLEA 2I9UA 2OZ0A 4JTUA 1VFHA 4EP8C 2NZLA 1HW6A 3CMGA 2XUCA 3ME3A 1LOQA 1W1YA 3CUZA 5IBXC 2VCAA 1J6OA 2OLAA 3W2LA 4MPKA 3BAXA 4JTIA 1DJZA 2XGZA 3GK0A 1XG3A 4KWVA 4PBFA 3NM3A 2HJPA 1XRFA 4KH2A 3IIZA 4OUIA 1H49A 4NILA 2EKCA 4B92A 1UKSA 3W7RA 2ESCA 3MB9A 4FF7A 3ZJ8A 4D6FA 4QJ1A 3BMWA 2BP1A 1OWQA 2VQTA 1OJXA 3RYSA 5K9CA 4UXDA 1G4EA 3FEQA 5KTLA 3MBFA 1IEWA 3CQHA 5DRIA 1DHKA 4OV4A 1EKOA 2OB3A 4CQAA 4NZCA 2VDHA 1IHIA 1D8WA 2FGBA 3BV7A 2Z26A 4CQ8A 4GQRA 5AHFA 1F6PA 4WF7A 2J88A 3HPFA 4QNEA 4NAEA 4K38A 3VGEA 4J3TA 3W02A 4KFOA 5HINA 3UZXA 4XG1A 5HNTA 2PTWA 1IXPA 1H1ZA 4EF8A 4CD6A 3HGJA 2OTDA 4OJYA 2TRSA 5I79A 3CL7A 3P74A 1OBAA 3AAMA 1K6AA 4L4MA 5FSDC 1PJ9A 3PPFA 4MVAA 1OD8A 1X1NA 5BW6A 3U4AA 2J7EA 3TA9A 4CQBA 5TIMA 3R6IA 3TNBA 1PUDA 2C18A 4PUUA 2IW0A 3PSVA 1CGUA 2GWNA 4CVWA 4OZOA 1OABA 4H6EA 1MWOA 1I1WA 3W6LA 4IIGA 1CXFA 1QI3A 2HVMA 3HQPA 4LAZA 4UQCA 1QTWA 3V18A 2QUTA 2XYLA 3II1A 1EEPA 3MU7A 4AIEA 3SO7A 1EO7A 1SFJA 1ZJHA 1S3HA 1OFAA 2NX1A 2RAGA 2X09A 3O16A 4FLOA 4FO4A 4H1ZA 4Q4KA 2ANUA 3G1VA 2CBVA 1B2YA 3CIVA 2Y2WA 1OEPA 1TO3A 3FX4A 2YL8A 4IMFA 4WGXA 1R2RA 1Y5VA 3STFA 3W3OA 4AY8A 4GHRA 3DI0A 4ZL1A 3A47A 2QAPA 4UB9A 4DF0A 1GVQA 3N2TA 4A3QA 3L4ZA 3KTSA 4XUGA 2Z1KA 4XAGA 5BXSA 5HMDA 4I7VA 4MGGA 4XZMX 5I3DA 3BDKA 2GOKA 4I6KA 4D6GA 2OT0A 2ZRZA 5DT7A 1XGDA 1KCKA 2VRQA 1P0EA 1GONA 4U31A 1TV3A 2VZOA 2OFJA 3P3BA 1AFSA 3LMYA 1I2OA 3WDJA 2GGGA 1WA3A 3C3NA 1I9CB 3IRSA 4UFHA 1FWHC 3HPXA 1R5YA 1J6PA 2A3CA 2QZRA 1YTDA 8XIAA 5EKYA 2Q3RA 2YL5A 2ZXBA 3KDOA 1E56A 1OT2A 2IKIA 3KBVA 3NDYA 4O12A 3PZNA 2OEMA 2NQZA 4FAMA 1K7EA 1WX0A 3JRKA 3G3MA 1E3XA 3NYDA 1UWQA 2F84A 3FHQA 2D24A 3WO8A 4PUKA 1UWRA 4E4UA 5HJLA 2X1UA 4PMXA 1OYBA 1UH3A 3SCUA 1RCOB 3A4XA 1E9ZB 3WQDA 4GJJA 5EBUA 1ZJAA 3CB3A 3K8LA 1JNEA 3UG8A 1P0DA 4LOCA 2FZ9A 4EX4A 5TF0A 3VIKA 3EPNA 1PWLA 4UOJA 1I2QA 1GOMA 3K1GA 3DFHA 3W73A 4P61A 1XLBA 2HQAA 4PMUA 5A6TC 3EXRA 3UYIA 1XYAA 2P8BA 1A0DA 2RJGA 4XX6A 1Z9AA 3ES8A 2F38A 1UH2A 4XAPA 4X2PA 2J79A 3ITTA 1W2VA 3WF2A 2G8ZA 1GJUA 4F66A 1LT8A 2V38A 4XVEA 4RJEA 1LRQA 1JI2A 4IP4A 3V35A 1LBLA 1V7YA 3CV2A 3AZSA 2BMBA 2OO0A 1VH7A 1MW0A 3VKAA 3VCCA 1XRTA 5CSSA 1TJ1A 1RA5A 3H7RA 3MCNA 4LGXA 3TTQA 1R47A 5CZSA 2VEKA 3LBMA 2X41A 3B9OA 5D2TA 3KVMA 3UFYA 3NIYA 3QOKA 1QJWA 3MMTA 2WMGA 3WLHA 4Z0JA 2QGYA 3OB8A 3A4AA 5CG7A 2CZEA 4HJWA 4US5D 3GBEA 5CSUA 4ATDA 2ZUNA 2WJDA 4C1NB 2WQPA 1X8FA 3RRXA 2VGFA 2X1RA 3S3GA 3IVTA 3PJXA 3UWVA 3ZLFA 2ZUSA 3M7WA 4FIQA 1CXLA 4B3KA 3RJYA 4HKPA 2PLJA 1HGYA 4GY7A 4Z2GA 2YFOA 4MPQA 4I9AA 1PYMA 2ZZ5A 2E6YA 2EAWA 4GXMA 2CPUA 3SCRA 3PAOA 2QDEA 4LFYA 3W2MA 1LYXA 4IL0A 2YBTA 1TE6A 1V02E 3UWUA 1TCDA 3GX9A 3F5JA 3ABRA 2HDJA 2C0HA 3TUUA 2ZQ0A 4UBPC 4MAVA 2FMOA 2PTYA 2FH8A 1XYCA 3NL3A 4IUOA 3E0VA 1PZ0A 2OSYA 2RGMA 3TNOA 3IUHA 3WLLA 3BUVA 2J9ZA 2I5IA 3DFTA 3GH5A 1ADSA 4JTDA 4C7DA 3AXKA 4P8VA 3T0DA 2YCLB 1CLKA 2VDGA 4Z2HA 3W7KA 4LS2A 1UZ4A 1VPXA 3NQ6A 1UUQA 6ALDA 2BHUA 3E1F1 1QHOA 3IIOA 2WVVB 1S1PA 4H9ZA 3R43A 1G0CA 1RPXA 2BTMA 2C16A 3REQB 1X1OA 4AWEA 2E3ZA 4IXXA 3TSMA 1K8CA 3IGXA 4M19A 3CIWA 4PTVA 4GKLA 2PDGA 4GYFA 1ELSA 1R3YA 4TX8A 1SZGA 3GVWA 1ENUA 3VPLA 2PRLA 2DT0A 1P0NA 2BLEA 4IG2A 5KZEA 4U5KA 1UA3A 5LZLA 4HCLA 4PR4A 1XC6A 1E9YB 3NQGA 4O4WA 3SECA 1WDWA 1A49A 3WUFA 3IJIA 3AIBA 1XLCA 4PCPA 3E02A 1F2JA 3STPA 4V33A 2OCZA 1MNSA 3PZ9A 3MO7A 3K13A 1YTKA 4HP5A 1WBHA 4JY8A 4PMJA 4S3AA 1VJSA 5U4NA 2YCEA 2TMDA 1ADOA 3TQKA 4PN2A 5K7JA 1TRDA 1XFBA 1K7FA 2V2CA 5CZTA 2WZHA 2PCEA 5GNZA 3UWYA 2F9RA 3F7JA 4WDWA 4WY0B 2WKLA 3EMCA 1ML1A 2AQOA 2YDSA 1ITUA 3G1XA 3UYCA 1G9HA 3OVRA 4YIWA 1CIUA 5AC8A 2Z1WA 2ZOXA 5BOEA 3VO0A 4FS9A 2Z2BA 4A8IA 5I6SA 3SQSA 1KFWA 1R3RA 4H9VA 4PSRA 3P80A 3WNPA 3QV9A 4OT7A 4BWLA 5KITA 4UTWC 2WVSA 2NW0A 4IOTA 1Q6OA 2X2GA 3FGCA 3ZS4A 1ME9A 1CGXA 1NWRA 2PWDA 5E0CA 1ZFJA 3WH9A 3OLGA 4MLJA 1TR9A 3PY2A 4LH8A 4RLIA 1PXGA 1X96A 1ONWA 4W86A 1E40A 2FZMA 4GIYA 5FF3A 3STEA 1RH9A 3BH4A 4ZFMA 4MIMA 3LGDA 3FYPA 4RZBA 4KWSA 4Z1BA 3S47A 3URQA 2OKTA 2VD8A 1FKWA 2WYSA 3LQGA 3V75A 2CHOA 2X0HA 3TC7A 3VZXA 3VE9A 1OM0A 1T8XA 1OF6A 5E9AA 2EKGA 3W24A 5C55A 2IPJA 4K8EA 5JVLA 5AFDA 1FCQA 4IM4A 1D2KA 1UD3A 5CPQA 2FHBA 2ZZ4A 1R9YA 4GCAA 2PDXA 1UMYA 3HA1A 1BSIA 2D0GA 5A6BD 1DORA 3VX0A 4N9BA 3ABZA 3WQ5A 1T6MA 2J7DA 1RJRA 1RD6A 4JN8A 3GVRA 1FDJA 4GVIA 4IL2A 3L2LA 1KA9F 3RCMA 1ESWA 2FTYA 1GGOA 1V02A 1TPFA 3F5KA 4IQLA 3V0UA 4BI6A 4MWAE 2WAGA 3VMOA 1K1DA 1EF2A 2QF8A 3H2EA 1IWBA 2WSYA 3N3TA 2PTDA 3FVMA 4DJDC 1MXGA 1BKSA 3NM1A 1BLIA 3CZKA 3GR7A 2Z6IA 1JYVA 1W3JA 4EPBC 4DBSA 3FJ6A 4QG9A 9XIAA 3M41A 1WOBA 4XO6A 3UXKA 1TTJA 1VC4A 3BC9A 2CXGA 4N02A 3WEZA 1IWAA 5D2VA 3QM3A 5CSYA 3KCJA 3BVJA 2W61A 4DBUA 4GRSA 5KEZA 1GHSA 4AB4A 2KZHA 2OJPA 4KF1A 3DN5A 5HQMA 2VT0A 4Y9OA 3DC8A 3WUEA 2BBFA 2VOTA 1HKJA 2FDMA 3ZT5A 1TPB1 3P67A 1JNDA 4H04A 1W17A 1E6ZA 3KX6A 1EH9A 1DJGA 1U30A 3LTYA 1K4HA 3OYXA 4QE5A 3BSHA 1E0XA 5FEZA 2PGFA 2Y6ZA 3VDAA 3W75A 2BFGA 2QVNA 4BK9A 5C9WA 4H8HA 3UWQA 4J4KA 2E5CA 4XD3A 1H7OA 4J2PA 3E0LA 3VMNA 3W1QA 3EDFA 1XM3A 1B5TA 2XVNA 5IDIA 1S2TA 2GK1A 2A6LA 3KOWA 3LCGA 1WCGA 2QPSA 3KP1A 1Z6KA 2A1YA 5LHEA 3A23A 3P82A 3OQ8A 2TYSA 1GTEA 4KERA 2JEPA 1DV7A 3PFRA 3KTCA 3MI2A 4JHZA 3M6DA 1V0LA 4CD7A 4LCSA 1BG4A 1UG6A 4JICA 2NWSA 4I7UA 1E4MM 3NEHA 3RPDA 2AQWA 2VDIA 4B5WA 3QHMA 1HGWA 4MDPA 2Y4SA 3MUCA 3XISA 1SJCA 1SZNA 1W37A 4PMRA 4CU8A 1YTEA 2GVJA 3N2BA 4CUCA 2WCAA 2VXNA 3AFBA 1EGZA 2YSWA 3QR0A 4ACZB 2IQTA 1KQZA 2YB1A 2EPHA 3PBUA 1QCWA 1NY1A 1XYBA 5FJOA 2I57A 2WMKA 2YCLA 1X7FA 3BE7A 3EOUA 5A6SA 1AQ0A 4KQNA 1B4EA 2INZA 4ZVJA 3FA4A 4XAYA 1WDSA 1FHUA 4NI3A 5HUPA 4HPHA 4O1FA 3TQVA 1XKYA 2J27A 2NUWA 3ZJKA 3CJPA 2HS6A 5D09A 4RXFA 3DC0A 1OD0A 2BY2A 4B9YA 1UD6A 3CNYA 3OVGA 3CC1A 2ZA3A 4LVAA 1XPYA 4HU8A 3PBYA 4B3ZA 3LA4A 1SFTA 3WNMA 3BSMA 4JFSA 4NZ1A 1QO2A 1NFPA 3D46A 1TFVA 2ZZ3A 4A22A 3TP4A 3AROA 1TVLA 4NF7A 1YRRA 4QCEA 2ZADA 4GQ0A 5C71A 2FDSA 5IFTA 4Q8TA 3HPAA 1Q6DA 2GDQA 1NDYA 4FOKA 1XH0A 2HSAA 4ZCWA 1E1CB 5G2IA 1XICA 3DU0A 2E0PA 1IXOA 1LROA 3MPGA 2GUUA 1CLXA 2VZTA 3CV6A 3OGSA 1GJPA 3WLQA 1KXQA 2L5HA 2IPFA 1XIBA 2O9TA 4NZ5A 4P7QA 1U22A 3QC3A 2H9AA 2VRJA 4U33A 1JCYA 3P62A 1QWKA 4NZ4A 3R8RA 1GYMA 4A21A 2YW4A 3BTNA 3TN3A 3CV1A 1XL9A 1LZOA 4DJED 4XWUA 1VB9A 2HBXA 4RXGA 4A3UA 1J5SA 2OVLA 1KFBA 1W9UA 5CC5A 1R46A 2E25A 1EQPA 4IIDA 4AEFA 3IPWA 2GSHA 1U1JA 1AZ1A 1GVRA 3GAKA 4F2BA 3PUGA 3UG5A 4GINA 1FWAC 3IJ6A 4M1BA 2POTA 1EIBA 3N34A 3WBXA 4YS1A 4URIA 4Q8VA 1XCWA 5BYWA 3EAUA 3WFAA 3VDBA 1V6XA 3TJIA 2C6QA 3W7HA 4L9ZA 3QMTA 4JTJA 4LNCA 4QLLA 1XC4A 2XWEA 4CCCA 5FJJA 1E0VA 4L1WA 3GG7A 4PUEA 3CO4A 1A53A 1FXQA 5D2XA 3AHYA 3T0CA 3TYZA 1HKMA 1A0EA 2HK0A 1UR2A 2QF7A 3EDKA 1R2SA 5C9XA 3EKZA 2XVGA 5DMLA 1QPRA 1TV8A 4LUIA 1IGSA 3G5EA 1LLOA 1MNZA 5DCDA 3V0TA 1BWKA 4C6IA 4NAFA 1O1HA 3SCOA 3JZEA 2P53A 4PSPA 2PDCA 1CEOA 2ONEA 1IXNA 1R3TA 3UT0A 2E6DA 3DX5A 3OGRA 2AOSA 2D0HA 4FX6M 1LG1A 2ZRYA 4JL2A 3H23A 4X2RA 3KCOA 1T96A 3IWPA 5F2GA 3WLPA 1A5OC 1HVXA 4IGSA 1D3CA 1XX1A 3QQWA 1TRIA 3W26A 2OXNA 3WLSA 2ZTKA 3GKFA 3AXIA 4TV5A 4NXKA 4XTDA 4B90A 2JIWA 2PP3A 2XN2A 3DHPA 3I65A 5F1UA 4ZENA 4O11A 1YLVA 3RITA 1BFNA 1UROA 2YA2A 4HNCA 4HZMA 3L9CA 4WHBA 3TX9A 2AMXA 3ZM8A 5G4EA 3SM0A 4U28A 4RCXA 2TSYA 3RNDA 2FVMA 1YPIA 3EWCA 1A3XA 4MOZA 3O06A 2AGTA 1LWIA 4A3HA 3SI9A 3QQ1A 2RUSA 3FJNA 1Y5WA 4FP1A 4IP7A 4WDTA 1H7PA 3BLOA 4GNJA 3P7YA 3FV9A 4UMAA 3DKLA 2INFA 1MZRA 4NG3A 3HJZA 2RJHA 5C2XA 1RCXB 3ARUA 3FN9A 4IJRA 4C1NA 3T7VA 1W3IA 1WQ5A 1LCOA 1FWWA 5KETA 2AAAA 5GPRA 3RILA 5LA0A 3PULA 3OBEA 4GPNA 4RZ5A 2GUYA 4XB3A 1PEZA 2A7PA 4LYQA 2VCBA 1FFRA 1V0MA 1O5RA 5HANA 4PCSA 4O1CA 1BRLA 1EJTC 3D6NA 2BB0A 3M5YA 1XYMA 1G4PA 4HOZA 3I4EA 3GW0A 5I00A 2WPBA 3M9YA 1CENA 4UQEA 2HMCA 3J7HA 4OBTA 1ICQA 3ARSA 1R3WA 4GZEA 1V3KA 2QJHA 1SW0A 1EPVA 1V6WA 3N9SA 2O92A 4MNLA 3L5LA 4JAWA 2DH3A 5AYYA 3C52A 1JZ6A 4UNKA 4L7ZA 2J77A 2VUYA 3GG8A 3LPGA 1SZFA 3L5MA 5EFDA 1Q8AA 3NQCA 3SIMA 3ZJ6A 3LX9A 2WMHA 5BRQA 3FKKA 3S42A 4GYPA 2VGIA 3NL6A 2DQWA 4DWSD 3VKCA 4PBGA 4DAIA 1BGAA 3UETA 2C0AA 4N6EA 4LWWA 1ZAIA 1R9ZA 1ICPA 2CIPA 4KEZA 3PZOA 4E4PA 4RR4A 4GZ7A 2IMRA 4LF2A 3OODA 4N2YA 7REQA 2MNRA 1EHNA 1GYLA 4D6JA 2EG6A 1H63A 2ZYFA 2FPTA 2Y89A 3L4YA 2WBGA 5A2BA 3V5FA 4YTRA 4LAOA 1B90A 2XN1A 3POCA 1F74A 1FH7A 4DI8A 4F0SA 3VD7A 1BXBA 3U2ZA 1ZRQA 2I56A 2NV1A 4HK6A 4M7SA 4NNAA 1F8MA 1QWGA 1BF6A 4HMNA 3DBNA 3CYVA 1JPMA 5FACA 1CW2A 3G8RA 3OA3A 4KGLA 2WKJA 1YIXA 4FR1A 1WPCA 1TWWA 4YVVA 3H55A 4HPXA 2GGIA 4CQDA 3TROA 1Y5XA 5G5IA 3TN5A 1U83A 1F6YA 4YN5A 1J93A 1HJQA 2EXOA 2VX4A 4IIFA 1J0ZA 2J62A 3A12A 4AC1X 1MQQA 5A2CA 1RBOB 1JXKA 4UTKA 4JBRA 3O07A 1S38A 2EF9A 3DUGA 3IJ8A 1XW8A 2ZX7A 6CGTA 3AALA 2WSPA 4C6BA 3KZSA 4LBSA 2ZRVA 3NURA 4CNPA 5REQB 1B3YA 2Z4GA 1X6NA 4GMEA 3SCTA 3H2AA 5M1TA 3LGEA 2CLHA 4Q22A 4R9OA 2PBGA 3GB6A 3MKVA 3WLJA 1BTMA 3M0ZA 4MLRA 3A3XA 1KTBA 1UP3A 4ADSA 1XLLA 5CBBA 2E40A 2YIHA 2D2GA 1T99A 4GISA 4FOJA 4DLMA 3AUOA 3UXLA 1H0IA 3H7VA 1JXJA 1VBJA 5DLCA 9CGTA 3ARWA 4QM1A 4TXEA 4NT0A 3G0XA 1O5QA 1JQVA 3GTXA 5LSMA 2Q02A 3RM4A 4HNVA 2H6RA 2NUXA 4BS0A 2BGSA 3ZLGA 3E3HA 3H26A 8TIMA 3RR1A 1IGWA 1MW3A 5CEWA 2EPOA 1XBVA 2PWGA 3RLGA 2REQB 3W82A 4AHQA 1SVDA 1LG2A 4AD1A 4CCDA 3NOEA 2VFEA 5T8GA 4GG9A 3N3MA 3W22A 5A8QA 4NAFB 5HA7A 1ECQA 1M04A 4BEQA 3GHTA 3QFWA 1V7AA 1AW1A 3ORWA 3H4WA 4P7NA 1SSGA 1H51A 1S5TA 4D2JA 4JFVA 1OB0A 2G3JA 2GFTA 3F4NA 3PZMA 4O4VA 3UR8A 4R7OA 1JL8A 4AZCB 1H1NA 3FHAA 4GYJA 4GZIA 2BGQA 3V5OA 1JDAA 5FJIA 1X6LA 4IPIA 3R2GA 5D37A 1S3TC 1V79A 4S1FA 2YB4A 4MFEA 1YDOA 2XIQA 4BQ2A 3F1QA 2OSXA 6ENLA 5BU6A 4C6MA 4INFA 4JQ3A 1KRAC 3S5YA 2Z28A 4WCJA 4MYAA 3GXDA 4KRUA 3IANA 3BW3A 5M3WA 1CYGA 3VKBA 1E72M 4Z0SA 3OA5A 3AC0A 3SCSA 1B3VA 1EA0A 4K8GA 4CQ9A 1OC6A 1WBJA 1BF2A 1HL8A 3U2EA 3MUZ1 4YCPA 4O1DA 4QNWA 3TDFA 3CL6A 3ARVA 3GYEA 3UJRA 5ABTA 3VXGA 5A8MA 5LNSA 4FPSA 3T81A 4JYDA 4H2HA 4KCWA 1KM6A 4JCMA 3F2BA 4UTIA 2JEQA 3LI1A 4B15A 2V5DA 4LAUA 1C93A 1QBBA 3MWCA 4PYSA 4DM1A 4J3WA 4ILSA 4W5UA 2V81A 4PBEA 1PBGA 4L56A 2HNHA 2QCDA 2XTKA 4I6VA 1AD4A 3OIHA 4F40A 4K1GA 4PTNA 3THUA 4UMBA 3MMDA 3NZ1A 1XRSA 5D38A 4JEQA 3NUKA 3T1GA 1GVOA 1BGGA 3O6DA 2WLZA 1V8EA 2ZX5A 3C6CA 1OX4B 2PC4A 5LIXX 4XZLX 1JULA 4HZ8A 4ADUA 1OG0A 1S5NA 3WFZA 4O19A 5CPTA 1A5AA 5K9DA 4HIBA 1Q6RA 3UY7A 4PMOA 1JUKA 3RAOA 3A24A 2OOFA 4QAWA 4OOZA 3B0VC 3BG9A 4I9TA 1F3WA 1C92A 1D3HA 3EMZA 3SW6A 4ORIA 3RPTA 3AU2A 3LDVA 3CAKA 2BOFX 2YR1A 3GM8A 1Z3NA 3G1FA 2JFEX 1U5VA 3AOFA 3UPMA 1TV5A 4WGHA 3UG4A 1M7XA 3UZYA 1DWFM 3ERPA 3EDEA 1M3UA 3TC3A 2ZC8A 2WCGA 1UYQA 4CNTA 5A5WA 4LBUA 5XINA 5FEPA 3OEXA 2HXTA 1W5PA 1A3WA 1A5LC 3N73A 1TPH1 3RIKA 2CITA 5LGXA 1WZAA 3TYBA 3W70A 4LB3A 1QI0A 3OZOA 4E0CA 2Y0FA 4Z2JA 3U8GA 2A3LA 2WK2A 5FAGA 1L2UA 2OZ8A 4MJ2A 3CASA 3CZ8A 4E3TA 5C8BB 5C2CA 3I3BA 4NYYA 1K9FA 3CQ0A 1L8PA 2BVWA 3TH6A 5DQPA 3EA2A 4WEVX 1YKWA 3V7PA 2WNZA 3LPFA 2YCIX 4WK9A 4LQ1A 1HJSA 3A64A 3ABXA 4IQDA 2VR4A 3VINA 4ROPA 3ABQA 3L7RA 2ZDSA 4NZFA 4RDZA 2NSOA 3RJXA 3M43A 1QW8A 4NJGA 4GX9A 3UF9A 4ZQPA 3CUGA 3BOFA 3ELFA 1FQ0A 3C86A 4WJ8A 5E9XA 1K4GA 3PK7A 1DJWA 5E6ZA 3OVPA 9XIMA 1YX1A 2WWDA 3WELA 4HJFA 4HPGA 2RH9A 2Y62A 3QY7A 1LJYA 1U1UA 1YE4A 3FK4A 3MUAA 1P0KA 2WOQA 3BL3A 2W9MA 5ABFB 2Q8LA 3WLTA 3PJWA 1F76A 3O6AA 1SO6A 1VCGA 1X7IA 3AXXA 4F0KA 4YHGA 1UW9A 2E8ZA 3CUFA 1UR1A 4HHLA 4PEEA 1OFPA 4AIUA 2NWRA 1ZQ5A 3TWBA 5DANA 3BCJA 2CLPA 1P6BA 5FD0A 5JMUA 4N7QA 2ZTJA 3WJWA 1PKNA 4A8NA 3AXHA 3MW7A 1KM5A 3ITLA 4IT1A 3KRUA 1FCVA 4UZSA 3ZR6A 2DZSA 1BYDA 4RNIA 2WVTA 4LXFA 2IKHA 4JKMA 4S39A 4HMCA 2O0TA 2QW5A 4Y2WA 1O12A 1VBUA 2V3DA 3EPOA 1R85A 4E2DA 2VR5A 4EXAA 2VX7A 3N4FA 1SYTA 1EGMA 3S5ZA 4H6KA 1XLGA 3MSGA 4W7UA 3L2MA 4GUFA 1FWIC 4OBSA 2QCMA 4QQ3A 2XPKA 1A4LA 1DBTA 1TX0A 2XDFA 5K3VA 1U1HA 2BVYA 1A50A 3CAVA 1BPLB 2YKKA 4JQ2A 1RQBA 4JL1A 4DZIA 4I8YA 4FLRA 1OK4A 4JN7A 2PBOA 1B9BA 3QJAA 4O14A 1L8NA 3GVVA 4JS3A 2YYUA 4B4HA 4JIIX 3IJ7A 1E0TA 2F2HA 4ML9A 4PCFA 4X9YA 3SZ8A 2HNEA 4PMVA 4YNGA 3RX3A 3EX6A 5LIUX 1ONXA 3GR8A 4XQ6A 3ZSTA 4HD5A 2ATSA 5HXMA 2IS7A 2V69A 1QW9A 1TKKA 3XINA 3W2JA 3H4GA 1W5OA 2FZ8A 2FYMA 3NO1A 3QKEA 4WOZA 3N13A 2ZZ2A 1HFBA 2NQ5A 2VFGA 4F3HA 4Z17A 1LQ2A 4Q4OA 4M80A 4FLSA 3QGVA 2WNQA 3W7PA 1K02A 2AKMA 3RMEA 3UXDA 5FL1A 3VX1A 1W0MA 4W87A 4GIEA 4JQ1A 2XH7A 1XD0A 4G8TA 2WCSA 1H3GA 3GRIA 3W84A 4C6FA 3EEZA 2QGHA 4GNKB 1F5ZA 4Z1DA 4K7YA 5FF2A 1UR0A 3BJFA 3W72A 3CUHA 1EJXC 3WEMA 5KZ6A 1JYNA 2NQJA 4FB7A 1YBQA 1G4SA 4JD4A 3S2MA 1DKWA 5D32A 2W79A 2EPNA 1OX4A 2YDQA 4M3PA 3VC5A 1ALDA 2FH6A 1TA3B 3DXIA 4TTGA 2XM1A 2XH2A 3RCNA 3GTNA 4MNKA 2ZE0A 2FVKA 2A3BA 3GNRA 1FDYA 1UQYA 4CD5A 5LNRA 3HQOA 3R0DA 1LUCA 4PFMA 2HROA 2VR2A 4D6CA 1J12A 4EPEC 3GDLA 2YCKX 3NYZA 3R12A 1EX5A 3W00A 4L64A 2FMNA 3BAYA 2FHCA 3PF3A 3NQ2A 4JNZA 1UBSA 3PNZA 7ENLA 4WX2A 3DEQA 3TU9A 3EB4A 2OQHA 1E0WA 2Z29A 1MUCA 3XIMA 3G1RA 5J8LA 1M7OA 1Q63A 1UH4A 1P5BA 3PPCA 3W7DA 2WVUA 3FYYA 5AN7A 3GVGA 1QOXA 1XFCA 3CU2A 4R88A 3UZJA 2GVEA 1LQ0A 4AY1A 1CXEA 2Y5JA 3L4VA 2NLYA 3V5CA 4Z2KA 8RUCA 3BAKA 3FFSA 1HZYA 1A5SA 2HV5A 4RE2A 3WF0A 1WE5A 4DRSA 1GHRA 4IF2A 3GSMA 1YXDA 4WY0A 1R30A 4GOAA 2V6AA 4BKNA 1H5YA 3MKKA 1IWPA 1VYRA 1F8IA 4NVTA 3G6LA 4QDPA 3TN4A 2VJXA 3GU9A 4S2CA 3EMQA 2D22A 2X42A 1J11A 3T4WA 3S1WA 3HF3A 4QRNA 3U3HA 1OADA 4CU6A 3QZAA 3PJTA 4PMNA 1M6JA 3TTSA 3W7NA 3B8UA 1UJQA 1AH3A 1C29A 1VEMA 2X2YA 2VGGA 3H2CA 2X1IA 1RLCL 5MF5A 3LSCA 3OG3A 5AHMA 3GFZA 2HK1A 1JGIA 3THQA 4DJFA 4F48A 1KCLA 1JPDX 4UQ9A 5CZJA 1F3TA 5G2HA 3NQVA 1NSJA 2DZVA 5CBJA 4GLEA 5AC5A 5A6MA 4MKVA 2QV5A 2I5QA 1EYWA 2UV8G 2GGJA 3O63A 1DQUA 3LBCA 1EXBA 3G2GA 5AY7A 4H19A 3VOHA 3DIPA 4FLQA 2DSWA 2I1OA 3N11A 4BQ4A 2I5GA 4JKLA 1LOSA 3M0JA 3S1XA 4WQ6A 4LC8A 4CEXC 4B3LA 2YBVA 3NXLA 3OG2A 3R58A 5AKQA 1W8GA 3E9AA 3EB2A 3RU6A 3N29A 2FGLA 3ZOAA 5DEZA 5D03A 5HQEA 1XUZA 1XI3A 1KKRA 2W62A 1VRXA 1RK6A 3TJLA 3R8HA 3GG1A 4D72A 2RHGA 3TOPA 3QV6A 1JD9A 2PZ0A 5A6KA 5A8NA 5D8WA 4IFRA 1KXVA 4LUTB 1DHPA 4IJCA 4IICA 3MSRA 4OKDA 4REQB 5DCBA 3R4IA 1R9XA 1ZLPA 3H2OA 3GC4A 4BF9A 3OHMB 4E8GA 2PDIA 3QY8A 5K9XA 5AVHA 1M53A 5DXYA 2VFDA 1VFSA 3S5NA 4O53A 3HPZA 4HSHA 1NELA 4HSOA 4C1LA 1LDCA 1LRTA 5LIWX 3AIRA 1Z48A 1TTQA 1EWDA 2PB1A 1FDZA 3CH0A 5CAKA 4JGDA 3QR3A 2J9XA 1A0CA 3COTA 2B0MA 1E0UA 3F4CA 1Q5MA 1TE1A 4M82A 3SEPA 1IEQA 1MO0A 3LG3A 4EACA 1D8CA 3HOJA 5D9NA 4HU3A 3VNZA 1ZJBA 4KCUA 2PU1A 3LHUA 4J3UA 2C1GA 5DRCA 1WO2A 3I3DA 4MY8A 4OWGA 2QHAA 4IPPA 2P88A 5MKGB 1P7TA 2I9EA 4RUBA 2R1NA 3EX2A 2Q3OA 3RF9A 1KM1A 4DYKA 2YLLA 5GNXA 1UWTA 4NRSA 3OBAA 2PDPA 4AZIA 4NJHA 4R34A 4AU0A 2XIJA 3VABA 3N04A 5LGZA 3B0XA 2Y70A 3E2RA 1OY0A 2FZBA 2VZVA 1JFXA 3NNTA 4AW7A 2EHHA 4GI8A 3CM4A 3DESA 3CMJA 1JD7A 1EZ2A 4GQGA 2R8WA 3TW7A 1XINA 3CBWA 3QV7A 1PHQA 1KXHA 3W1NA 4GFSA 3N25A 1AW5A 1THFD 4QP0A 4PFHA 4H6QA 1DJQA 4GQBA 3ARRA 3AUJA 2D20A 4AD4A 1KFJA 2VENA 3CT7A 4XKYB 5D9OA 2GDVA 2BY0A 4K7VA 1E9IA 2J8FA 4HSNA 3SURA 2QYGA 1O68A 2RDXA 4HNNA 2QDGA 3KVLA 1DWAM 1WKYA 3B0PA 4FMVA 4XISA 4NX0A 3KOFA 2QULA 4QR6A 4I5XA 2ACQA 1F4HA 4AUBA 3BLDA 1NFGA 3P0XA 3ZT7A 3WK2A 5D9MA 1MUMA 3OW1A 4EXQA 3BGAA 1DEDA 4MB4A 2CKSA 4IIHA 1BKHA 1UMLA 1JDCA 3W7GA 3YPIA 1XGZA 3M0MA 1OG6A 3BZJA 2QJJA 3WUGA 3NQEA 1NOWA 4GGBA 3QY6A 4IQEA 1RBAA 1XG4A 1REQA 4O0QA 1H61A 3LPOA 2EG7A 3S9ZA 1UZ1A 1TJ2A 4O8AA 4P8UA 1SFLA 4YVXA 2AGKA 3R79A 1BYBA 3UU0A 1W32A 4NIRA 3N19B 2EPLX 3HN3A 3WCZA 3VC6A 3KRZA 1AQHA 3IS4A 1PDZA 1N2VA 4FEZA 2DJXA 1EF3A 4WRHA 1S2UA 4XBSA 3GNPA 3W76A 1TV2A 4AD0A 5BRPA 4CN1A 3I4KA 5DMNA 2CZDA 4PMQA 3U2CA 5BOFA 3KHJA 4G56A 2R82A 1XS2A 2Z1VA 1W9DM 3OZPA 5AZ1A 1V6UA 4IIBA 1QNOA 3N2OA 3VD3A 3OPSA 3GG0A 4AWSA 5E0FA 2VZSA 1FKXA 1W9BM 3KS6A 3ZVIA 2BY1A 5IFPA 3EB3A 3JUGA 4NJIA 2DY3A 2E5BA 5DY3A 1A3HA 3QVQA 4JDYA 4N9CA 1A5CA 1AG1O 3ARXA 2ZUVA 3QLDA 1WUEA 3K8KA 2QLYA 4NXSA 1G4TA 2XZ7A 1J0YA 3T40A 3U2OA 1BWLA 4MJMA 5DXXA 4LALA 4IP5A 4ZE5A 4FOUA 3RUBL 5HUOA 1B30A 3C2EA 1XDLA 3WBAA 4H7VA 2Z1XA 1DQWA 1E3ZA 1XDMA 4GA8A 4Y9AA 2PCQA 3ZVHB 4IMGA 2UY4A 4HTBA 3L67A 2VQUA 5D2YA 2R6OA 5CGQA 1W5MA 5FI8A 1KWGA 5GQBA 1W3TA 4M7TA 2J7BA 1VHNA 2ON3A 3CH9A 3T78A 4MNMA 1NOFA 1PX8A 2AL2A 2PMQA 4REQA 1MQRA 3PG9A 1QPKA 4AZHA 1B3ZA 3VFLA 3S83A 4BQ3A 2QJIA 1XWYA 1R87A 3TAKA 4H9MA 3VNIA 3L68A 4M6UA 1P4CA 3QQ0A 4Y7EA 1PL9A 1B9ZA 4JIEA 2G3IA 3M0YA 1JJKA 1WAUA 2P8CA 4QLKA 3LEPA 4BF7A 4GKTA 7ODCA 3LXCA 1EJRC 3BPWA 2G0WA 2OX4A 3A4JA 1KXTA 5BRBA 2F8QA 4DUOA 2WQDA 4RDVA 4CNOA 5HNNA 3WLKX 2E8YA 5HNUA 4LSBA 5JQ9A 3KEHA 4JTSA 3CB8A 4AWTA 4AEEA 3ABSA 4FI4A 4MF4A 2CLIA 1VF8A 4LVFA 1IT7A 2RGLA 3RR4A 4D8ZA 1AH4A 1RSCA 5M03A 1Q85A 3W87A 2NVDA 4HYRA 3G8EA 5H1WA 1UKQA 3TLQA 3LCLA 1I2PA 1CTNA 3BXWA 2I14A 4MB3A 3GXIA 1Q45A 1RK5A 3K5XA 2WO5A 4GI9A 1ZS2A 1KFLA 2CLKA 4IHCA 4AQLA 4C6PA 5JIPA 4ERGA 1PTGA 4AZ7A 2D3NA 2X16A 2DVXA 2R9RA 3VFCA 2J4GA 5F4WA 2CWNA 1IQ8A 3W7IA 1KBJA 3W1XA 1LP6A 4MY1A 3OLDA 4GXPA 1ZAHA 2F7FA 3C8FA 1ECEA 4LTSA 4Y9MA 4ZQCA 3GW3A 2YOCA 4HVXA 3NO5A 4L9YA 1LBFA 2XFRA 1IEXA 1OCBA 1GG1A 1HF6A 2Z7KA 1DPMA 3N2XA 4MNJA 4IFKB 1TJ0A 3P6LA 4QG8A 3T9PA 4LW7A 1KBLA 2INEA 4X22A 4U5IA 3W1MA 1JRBA 5A69A 3MUXA 4IGMA 2J78A 5D30A 4DJDA 5AC7A 1HO1A 4HNUA 1DWIM 1QI2A 3WH8A 1TIWA 4NHVA 4IMDA 2PURA 1VKFA 5CSRA 3TTEA 1WB0A 5C7HA 1IXQA 2C3ZA 4JZ5A 3L12A 3WYZA 2GZXA 4LANA 2VELA 4YVPA 3I6TA 1OIFA 3KS5A 4PMYA 4HPJA 1US2A 3GO2A 1XLEA 1GK8A 1EQCA 4JYFA 3BANA 2VFFA 1N8FA 2OR2A 4O8RA 3SN1A 1WYIA 1PIGA 4Q7BA 1TPC1 3PC0A 3BAWA 1CB7B 1HKIA 5I3HA 3KW3A 3VD5A 1KNWA 1RV8A 3LTSA 4UMCA 1HQTA 3SY1A 3CLWA 4B16A 1WV2A 1GVEA 1W9PA 4DNHA 2UBPC 4ZQMA 5E70A 1VRDA 3BG5A 3LZ5A 3F4DA 3WH5A 1RHCA 4GY1A 1LLZA 2C14A 1PCWA 1QOPA 3RO8A 2VM8A 4DVOA 1PKLA 3P84A 4EWND 3QBUA 3LY0A 1C3FA 2Y88A 3HGRA 1PSCA 2NQLA 1JR1A 3CHEA 3OBKA 3FSTA 1BVNP 4HNOA 2A4AA 2F6XA 1CB2A 2HVNA 1JCXA 4MWAA 2FPVA 5L6UA 1CZ1A 3W7QA 2EPKX 1Q6FA 4FNRA 4JTTA 4UTFA 1EWEA 3LHTA 3NQMA 1KGUA 3WDPP 3PN8A 4GI6A 3KL3A 1QK0A 1PIFA 1OFEA 3C3UA 4RZ4A 1WP6A 4GACA 2DIKA 1OSEA 1O1ZA 1XLKA 1SO4A 3SUWA 3VZYA 4AY7A 2P10A 2W5FA 1H7XA 5M2FX 3UXAA 1SZRA 5AOUA 3E2SA 4QSFA 2CNCA 2EJAA 3GC2A 4Y9PA 3B0YA 3GTHA 1XHGA 3Q4DA 1R7OA 3WZ0E 4AHPA 1HUVA 5CJMA 3TIMA 3EX1A 3NL5A 3WFLA 1FCBA 1UWAA 1TPDA 1YNYA 4V15A 1M7JA 2JE8A 1V6YA 3C5QA 3FXGA 1G7VA 4P2VA 3VCNA 1SPQA 2PLCA 3WD1A 2E6AA 3OJGA 3DFOA 5LKYA 3TV8A 3O6YX 3Q45A 2ALRA 4JQAA 3KWXA 4QFUA 2XINA 1G69A 3SIZA 3I7QA 5T9CE 3WF1A 2ICSA 3USBA 4HNTA 1E5JA 1EFZA 5EY5A 1VBRA 4L1GA 1UR4A 3PWGA 1GW9A 2ZCGA 3ID7A 1TTPA 4A2SA 3MYPA 2OWWA 3S9IA 4P7LA 1KBBA 4O1EA 2YBUA 1TMQA 1XH1A 4GO9A 4FX8A 4G7EB 4GVFA 3GH4A 1UD2