1RB8G

The phix174 dna binding protein j in two different capsid environments.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
187
structure length
187
Chain Sequence
MYQNFVTKHDTAIQTSRFSVTGNVIPAAPTGNIPVINGGSITAERAVVNLYANMNVSTSSDGSFIVAMKVDTSPTDPNCVISAGVNLSFAGTSYPIVGIVRFESASEQPTSIAGSEVEHYPIEMSVGSGGVCSARDCATVDIHPRTSGNNVFVGVICSSAKWTSGRVIGTIATTQVIHEYQVLQPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title The phiX174 Protein J Mediates DNA Packaging and Viral Attachment to Host Cells.
pubmed doi rcsb
source organism Enterobacteria phage phix174
molecule tags Virus/dna
total genus 36
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02306 Phage_G Major spike protein (G protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rb8G00
4WM8B 5BNOB 2ZAHA 1NCQA 2R042 1AL21 2R072 3TN93 4CDUB 5C8CC 1C8NA 1VBA2 4CDWA 1PGL2 4RHV2 1VBD2 1ZBE1 4CDXB 4N43C 1R092 1TMF1 1E57A 5CFDC 2HWB3 1AR63 4JGZC 1NA1C 2HWC3 2RS11 3VDDC 5A32A 1R083 1NY72 4WM8C 5BNOC 1MEC2 3ZFFA 2MEV1 5C4WA 4CDUC 4FTSA 5DDJ2 1AR91 1VBC3 1RHI1 1PO21 1Z7S3 2HWE2 3TN91 3JD71 2RS52 1QJY3 4CDXC 2ZZQA 1PO13 1RUE2 2WFF2 3VBSB 3IDEA 4NWWA 1IHMA 1EV12 2WS91 5J98B 1AR61 4Q4W3 1F8VA 2RS33 5FMOL 1QQP3 2XBO2 1R081 4JGZA 1AYM3 5L7OA 3VDDA 1BBT3 1VBB3 1CJDA 4Q4Y2 4WM8A 4PDWB 5BNOA 1PVC1 2HWF2 4RR3B 1TME3 2PLV1 1RVF2 1QJU2 1W39A 2RM22 4GB33 1RUC3 4N53B 1FPN2 4RS5C 3VBSC 4CDXA 1HRV2 1VB4A 1COV1 1RUD2 1RUG2 1VBA3 4Q4V1 1RUH2 2ZTNA 1VBD3 4PDWC 1AYM1 1AR71 1VBB1 4RR3C 1HXS2 1ASJ2 4CEWC 1VBE1 4JGYB 4N53C 1RB8G 3DPRB 1AYN1 4IV1A 1OHFA 1AR82 1RUF1 4NWVA 3VBOB 3VBSA 2BPA2 3ZFGC 1V9U2 2IZWA 2R041 2R071 4YVWB 1H8TC 1VBA1 1D4M2 1PGL1 4RFT0 1VBD1 4RHV1 2XPJA 4EJRA 3JBG2 3VBFB 4JGYC 2HWD2 4PDWA 1AL23 1R091 1B35A 3DPRC 4RR3A 1ND3B 1ZBE3 3JB8A 4CEYB 3CJIB 4N53A 3VBOC 1TMF3 1NY71 1POV1 1MEC1 4Q4Y3 4N43B 5D8AB 1BEV2 5DDJ1 4YVWC 2RS13 5CFDB 3HAGA 2HWE1 2MEV3 1NA1B 5BNPB 2RS51 5K0UB 3VBHC 1FPN3 1AR93 2RR12 1RHI3 5BNNB 1PO23 1RUE1 1ND3C 2WFF1 1HRV3 1A6CA 1VB2A 4JGYA 1QJZA 3JD73 4CEYC 3CJIC 1EV11 1C8M2 1RUG3 2VQ0A 4AEDB 2XBO1 5D8AC 3VBUB 5ACA2 3VBOA 2WS93 4Q4Y1 1RMU2 5BNPC 2HWF1 5K0UC 5A33B 1EAH2 2TBVA 1RVF1 5BNNC 1PIV2 1QJU1 2RM21 3VBFA 1FPN1 1PVC3 5J96B 4Q4X2 4AEDC 1HRV1 1V9U3 2PLV3 1RUD1 5C8CA 1RUG1 3VBUC 3CJIA 4CEYA 1D4M3 1RUH1 4RS5B 1COV3 5AC92 4N43A 5D8AA 5CFDA 1HXS1 4Q4V3 1ASJ1 2BBVA 5CFCB 1NCRB 1NA1A 1AR73 2WWSA 5K0UA 1RUJ2 1SMVA 1VRH2 1VBE3 2FZ1A 1AR81 4CDUA 2WZR2 1HQNA 1V9U1 4CEWB 1AYN3 1VAKA 4AEDA 1RUF3 2RMU2 1ZBA2 1D4M1 3JBG1 2HWD1 5CFCC 1NCRC 2R043 2R073 3ZFGB 4FTBA 3M8LA 5A33A 3ZFEB 4RHV3 2R062 1RUI2 1H8TB 1R093 2GSYA 5ACA3 1QJX2 1HRI2 3S6PA 1BEV1 4GH4B 5GKAC 1OOPB 4QPGC 1POV3 1ND2B 1MEC3 4RS5A 5DDJ3 2RR11 5C9AB 3ZFEC 4Z92B 2HWE3 2X5IB 5CFCA 2HWB2 2RS53 1DDLA 1C8M1 1X36A 2HWC2 2WFF3 1RUE3 3VBHB 5ACA1 3J8F2 4GH4C 1EV13 1OOPC 2BUKA 5FOJB 4CEWA 1AL0G 1ND2C 1VBC2 1RMU1 2WLPA 4Y4YA 2XBO3 1Z7S2 4YVSB 1EAH1 1R1A2 1HX6A 1RUJ3 1PIV1 1QJY2 5C9AC 1PGW2 2X5IC 1PO12 2HWF3 3NAPB 3ZFGA 1POV0 1NG0A 4Q4X1 1RVF3 2BFUS 3ZFEA 1QJU3 2RM23 1H8TA 4Q4W2 4IV3B 2RS32 1ZBA3 1QQP2 4GMP3 3LOBA 1BBT2 5AC91 1RUD3 4YVSC 4GH4A 1FMD2 3DPRA 1RUH3 1TME2 3NAPC 1RUJ1 1MQTB 1RUC2 4GB32 1VRH1 1HXS3 5C9AA 1ASJ3 2X5IA 4YVWA 2WZR1 4CDQB 3VBRB 4IV3C 4FTEA 1AUYA 1AR83 2RMU1 3VBHA 1ZBA1 4GMP1 4QPIB 1ND3A 4GMP0 4YVSA 1MQTC 2R061 5L7OC 3JBG3 1RUI1 2HWD3 4RQPB 2FZ2A 3J8F3 3NAPA 4CDQC 3VBRC 1FOD2 1QJX1 5ABJB 1HRI1 1BMV2 5BNPA 5JZGB 1R1A3 4IV3A 5BNNA 4QPIC 4WM7B 4IV1B 1BEV3 4BCUA 4LLFA 1X33A 1AL22 2HWB1 4QPGB 3VBUA 4RQPC 1ZBE2 2RR13 1MQTA 2HWC1 1GFF2 5ABJC 1TMF2 3J8F1 4SBVA 1C8M3 5JZGC 4CDQA 3VBRA 4FSJA 1FMD3 2GH8A 2RS12 1B35B 1VBC1 4WM7C 3JB4C 1Z7S1 4IV1C 1R1A1 2MEV2 1OPOA 1QJY1 1AR92 1PGW1 3FBMA 1RMU3 4QPIA 1RHI2 1PO11 1PO22 1EAH3 3TN92 1K5MB 3JD72 1PIV3 5FMOS 4Q4W1 4RQPA 2RS31 4Y5Z0 1WCDJ 1QQP1 4Q4X3 1BBT1 2WS92 1B35C 1NCRA 5ABJA 1AR62 1NCQB 2BFUL 1FMD1 5JZGA 1R082 4CDWB 1NOVA 5AC93 1TME1 4WM7A 4GB31 1RUC1 2DF7A 1PVC2 1K5MC 1FOD3 2PLV2 4QPGA 5A32B 1VRH3 3ZXAC 3ZFFB 1CD3G 2WZR3 1NCQC 1COV2 5C4WB 2Y26A 4CDWC 5LK7B 4Q4V2 2RMU3 1AYM2 1AR72 5C8CB 1VBB2 1OOPA 1VBE2 1FOD1 1K5MA 1ND2A 2R063 2QQPA 1BMV1 1RUI3 1AYN2 3ZFFC 4JGZB 5L7OB 1F2NA 3VBFC 5C4WC 3VDDB 1RUF2 1M06G 1QJX3 1HRI3
chains in the Genus database with same CATH superfamily
4ITCA 5JXJA 3ZSKA 5ISLA 3CNAA 3FE5A 4A45A 5FZOA 2R072 4K8RB 1VBA2 2WT1A 1W2AX 3ASIA 1XNKA 3POYA 4K1YA 4QKBA 4R4ZA 3ZKUA 2XONA 4JDOA 2ZGRA 1R092 2DVDA 4ASKA 4HPKB 1G6NA 3W21A 4EN6B 4TTGA 1XE0A 3RQ0A 5KHJA 5FV3A 2XL9A 4IEWA 3TNPB 3BB6A 4Z07A 2WWUA 4AI3A 1UXXX 4NOTA 1KS5A 1T6BX 1E5IA 2O0OA 3WCSA 4OZOA 5FDBA 1PHMA 4RYDA 4B4QA 2E53A 4QM9A 4XBLA 4LTAA 2V4VA 4XMIA 1IPJA 4QXKA 3FC0A 4PCRA 2BYVE 4X6QB 3DYPA 4EN7B 2E26A 1MS9A 2Y60A 5DDJ2 1RHI1 2CV6A 3K2OA 4FFFA 1DYPA 1YQ5A 1Z7S3 4ATEA 2WO3A 2HWE2 2OQ6A 5EQUA 3TN91 3JD71 1B09A 3RRDA 5DPNA 3B5LB 1FATA 3MF9A 2YGMA 2ZX0A 2ZHMA 2ZZQA 1PO13 3VZNA 5BYNA 2BVVA 1RUE2 2VMFA 2JECA 2QZ3A 3C7FA 3E6BA 3O1OA 1URXA 3POSA 4XFAA 3FN9A 4BQWA 2XQRA 1F8VA 3HN1A 4BHPA 4BXSV 2W1WA 3UGHA 2VVEA 1QQP3 4D69A 2XG3A 3M3IA 3WDUA 3HWJA 4EWEA 1BK1A 2B9VA 4G3YC 2A3WA 1PZ8A 5BNOA 3GCXA 4YZ5A 1PVC1 4F83A 1IS3A 3IN9A 1W6NB 1TME3 2W91A 1KGYA 1RVF2 3LSEA 1US2A 4NN0A 4ZY9A 3T1MA 4AL9A 1W39A 2D97A 5C33A 4RS5C 4LE3A 3I97A 3MEPA 5FO7B 2YPJA 5KXEA 3NV3A 2A5ZA 1JZ4A 4LA3A 2QQVA 4IQPA 4R4XA 1ENQA 2WBKA 1EYBA 1RUG2 3M2MA 1X50A 1HB2A 3FHIB 3KT4A 4MX3A 3SCFA 4BLIA 3GJBA 4ES8A 2DDUA 3AMHA 2GZWA 2JKXA 1F31A 1VBD3 1ULOA 2ZTNA 3BODA 3HQUA 5SV5A 4A7KA 1AYM1 1AR71 4PBPA 2UWAA 2WQZC 5LZ6A 3V0BA 4URTA 4JGYB 4YRDA 4AXOA 4FFIA 4Q5OA 4B7EA 1ZRFA 3T0DA 5FJKA 3VD9A 4TN7A 1OC1A 1XSQA 1ZX5A 1A34A 3O1VA 3ZPOA 3AZXA 3VKOA 3L9JT 1XJAA 1P8JA 3PDQA 2EAKA 4OUMA 1IS5A 1RGSA 2E9QA 2VZUA 4CPBD 1H8TC 4P9LA 2E7AA 2OYZA 1WMXA 4BQ2A 3NMBA 1V6NA 3K3OA 4RFT0 4RHV1 3SXWA 2XPJA 1OSGA 4FPKA 2JB8A 3T1LA 3NKTA 4JGYC 3VBFB 4E2GA 4FAGA 1AL23 1MS1A 1GSLA 2VJXA 2Z79A 1GNZA 3ES4A 4HK8A 2P6CA 1B35A 2WZ8A 1REDA 3CQOA 1J3QA 4J6GA 1XYOA 1N3OA 1W0NA 2DCTA 3GYDA 5DN2A 4LBKA 1ZBE3 4IEUA 1TZOA 5GLZA 2YY1A 3CJIB 5I8TA 3KF5A 1JU4A 1NLQA 4OLLA 2VY0A 5DQ0A 1NY71 4BA6A 1U5YA 1MEC1 2PHRA 3WUCA 5FPAA 1UX6A 4JDNA 2VNVA 5D8AB 1BEV2 1W9YA 4OULA 5CFDB 2WZEA 3GBGA 2YB7A 5FZ8A 1OI6A 4L0PA 1QDOA 2MEV3 1O91A 3AZVA 4BU2A 5KC5A 5E89A 5K0UB 3VBHC 3GGLA 3NQHA 4IE0A 4CPBA 4CU8A 2I2SA 4SLIA 2D43A 1N1VA 1PO23 4CUGA 3ACFA 1ZRIA 2NN8A 1HRV3 4BYYA 4KH9A 3WQ1A 1AJOA 1QJZA 1UY0A 3CJIC 1EV11 4J1XA 4CXXA 1LGNA 4AEDB 5FOBB 3M3QA 3JXSA 2Z2SB 4DXZA 4XVHA 2XBO1 5D8AC 4XHBA 2GMMA 4LIUA 2SLIA 3VBOA 4QKDA 1LOFA 2XLGA 2GDFA 3POGA 2Q8CA 1MZ6A 3USUB 3VDAA 1VMHA 5KHIA 5BNQA 5A1FA 4MGKE 2L9LA 3CIHA 3H50A 5F5IA 5CBLA 1AXYA 5K0UC 3A22A 1EAH2 3PMEA 2Q8DA 2B4KA 4JKKA 4OHXA 2OPWA 4XCAA 3KCCA 4LO8A 4FAHA 5A3NA 1QJU1 3IT8A 4UYBA 2HBTA 5CIRA 1FPN1 5JSRA 4EN9B 2BWAA 4XCBA 2AACA 5JSOA 4Q4X2 4AEDC 2PLV3 1BK0A 4W6WA 4Q1RA 4YM0A 1RUD1 4D7YA 4EN0A 3I3DA 3OEAA 5C8CA 1ENRA 5FZGA 1HJFA 3UNPA 3N7KA 1G9BA 1D4M3 3LD8A 4HONA 1O6UA 5H9PA 4MHUA 5FZEA 4XILA 4AFBA 3M7AA 1H9PA 3GDBA 3OD4A 3OYWA 4YW2A 2D6OX 2EXIA 4Q4V3 4YSFA 5FREA 4UI9L 2X10A 3I49A 2BW8A 4JKLA 4LHLA 1NA1A 3C7EA 1HQLA 2XVGA 2WWSA 3KF3A 5FMBA 3OUHA 3FZ3A 3KV9A 5B4NA 2IXCA 1QY4A 5GZCA 4QDSA 3WF2A 4HFSA 1X8EA 2FZ1A 3CJXA 5SV8A 1AR81 4CDUA 5IK4A 3RMXA 1Z0HA 3ZR5A 5F3CA 1HQNA 3N36A 1W06A 3TNQA 1AYN3 2LUWA 1L7LA 2EVXA 4C0HA 3GJAA 1BVVA 1UOFA 1RUF3 1F5JA 1ZBA2 1S2KA 1WLDA 2D5HA 5FMCA 3HD8B 3AYDA 1W9SA 5I0DA 1D7PM 2R073 2GC0A 2WC2A 5E6HA 1ZRCA 3M8LA 1CZTA 5A33A 4JX0A 2YGLA 3ZXEA 1OMIA 2VULA 1IQDC 1ONAA 4QU1A 1WCSA 1R093 2GSYA 4AK3A 4MXWA 4B4RA 1NKGA 2PAEA 3AM2A 2W1SA 3D3AA 1OD3A 3MIHA 3PU8A 3VHOA 1PNFA 4MSVA 1O59A 4JRLA 2PMWB 1GICA 2ZX2A 2VXRA 3AKTA 4XFGA 1JOJA 4M01A 1POV3 3VGIA 3SKJE 4AFCA 3H8XA 4W65A 4META 2GC2A 2WQ4A 4QXBA 2GALA 1ZZBA 5DDJ3 2B45X 5DZGA 2VBPA 2JDKA 5FRAA 1O4ZA 1H6XA 2MNGA 2VU9A 2HWE3 4YLZA 3LQCA 4F3JA 4ASMB 1Z78A 1U0AA 2VH9A 4A6OA 1S1AA 2B7YA 2ZCWA 1W8TA 2CAUA 4MH0E 2JE7A 4Z8BA 1RUE3 1OA3A 5LA9A 3MPPG 5ACA1 1F4AA 3BTXA 3OUIA 1WGPA 2BUKA 1HIXA 1XBFA 4QKFA 1LHNA 4CU9A 1JN2P 4G4FA 5L9VA 1RMU1 4MADA 4DEVA 3VDBA 2XLAA 4P9IA 5G04L 4MGQA 5DG2A 2Y34A 4YVSB 1CAXB 1DZQA 3HVDA 4QQ2A 4R9CA 3I2HA 3ETPA 2CHHA 4A4AA 1GZTA 4Y22B 4Q8LA 4XAEA 2HEVF 3PNAA 4XYXA 1POV0 2JEMA 2C1FA 3ZFGA 1NG0A 4EN8B 2DTYA 3ZYHA 5A6XA 1RVF3 5FZ7A 3SEPA 3ZFEA 3I2DA 4BQ3A 4MGSA 1LAJA 4A3XA 1SCRA 2VUDA 4QXCA 4IV3B 1LGCA 2RS32 1E5SA 2Z4FA 4C0BA 1RXFA 2Z69A 5D2AA 5A3WA 3WF0A 5J09A 3KMHA 4AQ2A 2PN5A 3NNGA 5FPUA 4D8MA 1UYXA 2SBAA 1ZZ6A 2IC1A 4L97A 4YVSC 3AFKA 4GH4A 1FMD2 1IS6A 3DPRA 1UU5A 4I01A 1VE0A 3WQBA 1G9DA 3O1PA 1XE7A 3BTAA 3SQOA 3DCQA 3R0RA 5FXZA 2KM2A 1G8WA 2EXKA 2VGDA 1JZ8A 3BUCA 4B8EA 4GB32 1MQTB 1VRH1 3T4HB 4Y4RA 4AHWA 3WP4A 2VNOA 5FY0A 2WNUB 4AAPA 2OUHA 4I2OA 4Y1YA 3I2IA 2X5IA 4YFWA 3L2YA 1QNWA 3OB8A 2PAKA 4IV3C 4LLOA 1QXPA 1JS9A 2CGNA 1OLMA 2ZKNA 3S30A 2OT7A 1UZWA 4YZ1A 5KBFA 1J3RA 3C7GA 4LO4B 4FPYA 1I9RA 1JBCA 1JUHA 2CNAA 2LALA 3OJBA 4ARYA 4IEXA 3OGVA 2VUAA 2VTXA 4QPIB 4DRVA 2YC0A 4AR2A 3OF1A 3KVBA 3A21A 1QNYA 3APBA 1MQTC 1KFXL 2JDZA 4AGGA 2XUMA 1XC6A 2R061 1ZRDA 4M0NA 4OMCA 2RHPA 1RUI1 2ZXQA 4TZDA 1IOAA 1OF3A 3UGFA 2FZ2A 1YO8A 4I02A 4O7XA 4AHYA 4E27A 2VOXA 1U5XA 1IKQA 4CXYA 3MIEA 1FOD2 1HRI1 2VQUA 3EQEA 1IGOA 2J1RA 2KXLA 4ISRA 1VIWB 4AVSA 4W8JA 5JZGB 5BNNA 4GJZA 1DLLA 4QPIC 4QHBA 4HKOA 4WM7B 5FZIA 5BUVA 1BEV3 4BCUA 3M3EA 3NW4A 3RYPA 1CIWA 3NNLA 3ZSJA 4P08A 1W0OA 2W94A 2RG4A 2CWSA 1S0BA 4BLJA 1UAIA 3MI8A 1OH4A 4LBOA 1ZA4A 3JUUA 2K0GA 2E33A 1TMF2 3OBZA 2WDBA 2FHRA 2FCUA 3HQXA 3LPFA 4UW5A 1H9WA 4SBVA 5FYHA 4CCOA 5LWBA 2WYSA 2VC9A 3FLPA 4OUSA 1GMMA 4CDQA 3VBRA 5JZGC 5KR7A 4FSJA 2RS12 1FX5A 1QJFA 5FUIA 3KCXA 4WM7C 1G7YA 1Z7S1 3BPSA 2R1DA 1JOPA 4LIVA 1O3RA 1OPOA 1N1TA 1FT9A 3KT7A 3UT0A 1WD4A 3ZIWA 1AR92 3FBMA 4NPLA 4LOSA 1PO11 1KITA 2A71A 1EAH3 4FQZA 1XYPA 2YU2A 3OG2A 2DCYA 1UY3A 4JQRA 2J22A 1KQRA 5I0SA 4FQ4A 2W46A 2BNNA 5IYYA 1W6PB 1QU0A 1QQP1 1WCDJ 3ENRA 4Q4X3 1NCRA 3K46A 1GKBA 1VMFA 2JDNA 3MLJA 4IW3A 3WNNA 1NUKA 1WZXA 1A8MA 1NCQB 1YRZA 4KBZA 2DYCA 4RFRB 1I5PA 1QH7A 1W9TA 5F3EA 3ZXJA 4JHZA 1REEA 2ID4A 4HK9A 1TME1 3MFCA 3L2HA 1V6LA 4YW1A 3B01A 3LEGA 2V09A 4PI0A 5IVJA 4LBJA 4BQXA 2P5BA 2DVGA 3DV8A 1EY2A 5FPZA 5T3NA 4DUVA 4YYOA 1HDKA 5HV4A 2EALA 5C3SA 3I2KA 1AHSA 1WKYA 4NHYA 5KXDA 4PBOA 3UESA 4CP0A 4XJAA 4CCDA 5KC6A 3SCHA 1NCQC 3PU3A 1COV2 2VW2A 2W1UA 4P9XA 3K4AA 3JU9A 2B39A 1OH3A 1LR5A 1ULFA 3AMPA 3AZYA 4MGTA 4E4ZA 2VQTA 1YUDA 1UOGA 3FLTA 1RJ7A 2VVFA 1JYXA 5FLJA 1GWLA 1VBE2 4XF4A 1WW5A 4K6BA 3EXUA 4U2AA 2E32A 1ND2A 3FX3A 2Y33A 3AX4A 1LODA 1W6MB 3WXPA 1J3PA 2W1QA 5CB7A 5TSWA 4C1XA 2HEYF 5IAVA 2QQOA 3ON7A 4LK6A 3R4UA 4HZFA 4JGZB 5J48A 5L7OB 2BDRA 2JDHA 2JG9B 3VDDB 1HN0A 5GZFA 1XNCA 4WM8B 5DZEA 3VB9A 2ZAHA 1NZIA 4AVTA 1WLCA 1XNDA 1AL21 2J7MA 4S2GA 1W6QA 1C8NA 1TG7A 5HI0A 4CDWA 3AYAA 1PGL2 1VBD2 2VNRA 3G6JB 4Y20B 4B1MA 1ZBE1 2ZGTA 4CDXB 4FPHA 4N43C 2JG8A 3T0AA 1E57A 4LNVA 4ZZ5A 4XIKA 3IMMA 4DNYA 1R64A 1K42A 3IIIA 3ABZA 3NJYA 4XJWA 4NHKA 4JGZC 5I0TA 1YI9A 2JG9C 2OX0A 1D0GA 5E16A 3VDDC 3ZN4A 2ZGQA 5A32A 1W8UA 2G9GA 3D0SA 3LEKA 2XDVA 3LA7A 4WM8C 1LRHA 2P37A 4XOGA 5GALA 1UY2A 2MEV1 2OW4A 4Q8KA 5IVBA 1CVNA 1LULA 2VCAA 1NQJA 1C28A 1KEXA 3AP6A 3WVJA 4XUOA 1PO21 5DG1A 5LASA 4MGZE 3WT3A 5KXCA 4XJ8A 2RS52 1PVXA 5FYTA 4HETA 4CDXC 4RSUA 4UW4A 3WEZA 2DUOA 2RVAA 4RGGA 4ZPIA 1ALYA 1JHNA 1KJRA 4KG8A 2WFF2 1SLBA 3LFIA 3VBSB 4NWWA 4E9KA 4F7ZA 4I09A 4S2DA 3NV1A 4AGRA 1KRIA 1AR61 1H0BA 4KU8A 5FP9A 3GHMA 4QXHA 5F32A 2GMPA 4XQ4A 1RYYA 1YQ2A 3N7MA 2RS33 1R081 1O3QA 1VBB3 2CL2A 1VLNA 4XFHA 1QDCA 2X8KA 4PDWB 4XQWA 5IT6A 5EYYA 3FFQA 1UU4A 3NJZA 2HWF2 2OVUA 4XETA 4QX3A 1GP5A 3AYCA 4RR3B 4XHXA 5IK8A 2PLV1 3ORJA 3U10A 1OLME 1GOHA 1CGPA 1W8FA 1US3A 1CAWB 2RM22 1LHOA 4GB33 2ARAA 1MVQA 4N53B 3VBSC 3UV9A 1W8NA 1GBGA 2YBSA 1QXJA 4YW7A 5FPLA 2D6KA 4XMAA 1HRV2 3BOWA 1OQ1A 1VB4A 4XIOA 1LECA 5FCCA 1DGWX 5IW0A 3IZOA 1DQ6A 4Y1VA 5BY5A 4Q4V1 4R52A 4LR4A 3THTA 1RUH2 1LOAA 4NO4A 4OUEA 1IG0A 1SG3A 4PDWC 1KD7A 1YLLA 4Y33A 3NNJA 1F5FA 1MPXA 1BLZA 5LEKA 4LK7A 1W2TA 4RR3C 5A3MA 2ZABA 4C90A 1VR3A 4CEWC 4LMFA 4N53C 4XFCA 2DCZA 2VOVA 4AWDA 1DHKB 2NLRA 1AYN1 4YW6A 4IV1A 3V56A 5J3UA 2P3YA 1YIPA 3H7JA 1RUF1 2WNVB 2QQKA 4NWVA 3VZLA 2UYBA 5EPAA 5JPNB 1W6OB 3WOGA 1OUXA 3SITA 1CAVB 4YGDA 5IAXA 2R071 2LM3A 4YVWB 2JICA 1VBA1 1D4M2 3P1IA 1ZZ9A 2WO7A 2OQ7A 4Z1VA 4UF0B 3JBG2 2VMHA 5FP3A 1LOCA 2BU9A 2HWD2 3SH4A 2EA7A 2YDEA 2P2KA 3U4XA 3D0JA 1R091 5FZ6A 1RJ8A 3LDKA 3VN4A 4AHXA 1W6NA 1ND3B 2NM1A 4Q1PA 4CP9B 4FOWA 2VZSA 3N9QA 4QQPA 4YM1A 2WNVC 3WG2A 1TMF3 1POV1 4XW3A 3RNSA 2YHJA 5FK7A 1SDWA 4Q4Y3 2A6ZA 2VR4A 4IEOA 5I8SA 4N90A 2ZMKA 1X9TA 1TNRA 2RS13 2DVAA 3NSTA 5DDJ1 3I3QA 4YVWC 4P02B 4Q29A 5EP9A 2VZPA 2F4LA 5LATA 3HAGA 4Q0PA 4R9DA 2HWE1 4AEMA 3N9NA 2A1XA 5CISA 4XJUA 5BNPB 1X82A 4A2UA 5FZMA 1DFQA 3P6BA 1BQPA 1AR93 2VZ1A 3LIHA 3OY8B 2RR12 4OHYA 3WQ0A 4NRMA 1RUE1 3RG0A 1ND3C 1SLCA 5F3GA 1ZZ8A 1VB2A 2JKBA 4JGYA 1GQPA 1W8ZA 3PURA 1C8M2 1DBNA 4JDMA 3N9PA 3WW1A 5K8SA 1EPZA 1GU3A 2E63A 2XB6C 2YBKA 3LEIA 3N9LA 4URAA 1K3IA 2EXHA 5CADA 3VZMA 4YW4A 2Y0IA 5BNPC 1OFNA 1SPPB 5CKNA 3O1SA 3T2OA 4CE8A 1C3HA 1RVF1 2BTVC 1PIV2 5EV7A 1MS3A 3O7OA 2IXKA 2E31A 3VBFA 3X29B 2H6BA 2WT0A 3ZPYA 2IXIA 3RDIA 1PK6B 2V4AA 3LEMA 4LQRA 1YQCA 3AJYA 5IUQA 2E6VA 1V9U3 3B93A 5DUXA 4GKYA 1CN1A 1UMIA 3NO8A 5JOZA 1OF4A 2ET1A 2O14A 4UFJA 1ENSA 1RUG1 3CJIA 3DYOA 4XF3A 3DXUA 1GOFA 5JOYA 4RS5B 1COV3 2R6QA 2PYTA 3B02A 4LHSA 4M4RA 5D8AA 5AVPA 3QOPA 3MV11 2Y6KA 5CFDA 1IKPA 3VHRA 4BK5A 3PTRB 4JTNA 2Q1MA 5FZAA 4FFGA 5CFCB 4D3WA 1RUNA 1AX1A 3HQRA 3VHPA 1FI2A 1PK6C 2RJLA 5K0UA 4F8AA 1HLCA 4TSVA 3QCWA 4CYDA 5APAA 3ZSMA 1CJPA 4NPMA 3WW3A 1VBE3 2JD9A 4HOOA 4S2FA 3J7HA 1YIFA 4LPLA 2P17A 2WZR2 4RGKA 3PHMA 4H7LA 1N47A 3RJ2X 5A7PA 5J1XA 2X05A 4AEDA 4LBNA 2GP5A 4ZU4A 2D40A 5BV6A 2DCKA 1SLTA 2BEOA 4OCTA 3AMMA 4NRPA 4DB5A 4Q0QA 3WINE 1E5HA 5DAWA 1HJGA 1FAYA 2WINB 4BDVB 1LOEA 3LGRA 2ZHKA 3CMGA 3USUA 5CFCC 1J59A 3SKVA 3OUJA 3ACIA 4HKLA 5F8PA 1YYNA 4KG0A 4BQ4A 4OYUA 1UY1A 2WA3A 2B5HA 4QKNA 1UKGA 1H8TB 1S2EA 2A6XA 4JKMA 4XFFA 3Q8BA 1AX2A 3U11A 2BERA 3MHZA 3ZLIA 2YMZA 4YW5A 5JIAA 2XWBB 2ZJCA 3BVCA 3S6PA 5JPMB 2IFWA 3O12A 1BEV1 5GKAC 5L9BA 3SNMA 2CGOA 4QPGC 5LW9A 4LJHA 4PHZA 5F6LB 3B3QE 1UY4A 2D3PA 5DAXA 2WFPA 1TEIA 1Y9MA 4WZCA 5JLVA 3VZJA 1LCLA 4M3CB 3WX5A 3SEEA 2A3XA 4B4PA 3WF1A 1Y43B 5LA2A 5C9AB 3RZKA 5CG8A 1H1MA 4MOAA 4E8DA 3EHKA 2QQLA 2D5FA 4E4SA 3TEWA 5DAQA 1J58A 2RS53 2ARCA 1W3XA 2UY9A 3ZXGA 1DDLA 1IG3A 3H3ZA 4P9YA 1QKQA 2R7EB 4JQTA 2WFF3 3KSCA 3OPZA 3UKVA 3VBHB 1QF3A 2QFEA 3I54A 1FYUA 1RINA 2XL7A 4LKFA 5A3OA 3SH5A 1NLSA 3KT1A 1UPIA 5FPBA 1XB9A 4Z82A 2Y6HA 1VBC2 4D6RA 4Y26A 2XJTA 3DN7A 1U5IA 3K77A 4FFHA 1BJQA 3BTYA 2VO5A 1EAH1 4PLMA 2JD4A 2Q5TA 4AVBA 1CESA 4QM8A 1RUJ3 5C9AC 2VECA 5EJZB 4N7UA 2Y38A 2WO1A 1PGW2 1XNAA 2PELA 3RWKX 1MS0A 2HWF3 1YI7A 3SH3A 4Q4X1 2BFUS 5FKCA 2VTFA 3IKWA 3MIFA 3CBNA 2RM23 5D1IA 3UKTA 4CCCA 4LUKA 4Q4W2 1NXD1 3OCPA 4FPEA 3ZX7A 4UFIA 3KLSA 1JOBA 2OS2A 5A6YA 5FY5A 2AGSA 2AYHA 4LBLA 2ARBA 4JAAA 3RZGA 2WLQA 1GWKA 2O1QA 1XOYA 2VZRA 5DAVA 4ZU7A 2ORZA 5JXGA 1RUH3 3QH7A 2ZEYA 2VL4A 1CX4A 4BQYA 2IWGB 1JZ3A 2ZKLA 2BNMA 3MUZ1 4W50A 2GNTA 3ST7A 4TXWA 1SQ4A 3WDXA 4OQ9A 1CX1A 3ILRA 4XE9A 1SHWB 1W04A 1Y3TA 1K5JA 3K48A 1DQ1A 1G9CA 3LA3A 2WABA 1PM7A 3IPVA 5FYBA 1AF9A 2PQQA 3PVOA 3POBA 3DXTA 4COVA 5JMCA 2ZGUA 4X8NA 2TEPA 2XMLA 5CAZA 1AUYA 3JQWA 1W8HA 1ZBA1 4GMP1 2I07B 4CCLA 3GBWA 2C9KA 1Q8OA 5LRSA 1E5RA 1BCXA 1ZYBA 2NMNA 1GNHA 5JMOA 1WA6X 1YEWA 2ZMNA 3FJSA 1OLQA 4YVSA 1CAXA 3U37A 3KHBA 3EO6A 3A7QA 3JBG3 4GALA 4JV4A 2HWD3 1JHJA 2J1TA 4RQPB 4AVAA 4Y22A 3J8F3 1AZDA 2WQ8A 3VKMA 3H42B 2W3JA 5ABJB 4KQ7A 2K2SA 1BMV2 1MS4A 1UNBA 4AF9A 5A7SA 3WG1A 3WNKA 5L19A 1R1A3 4IV3A 4KI5M 3AZZA 2R16A 1AX0A 2ERFA 1JW6A 2XJPA 2ZS6B 4CXWA 3S7EA 3WD5A 1DYKA 3PTYA 4DRRA 1ST8A 3N4MA 2IUWA 3CU7A 1PGSA 3NJXA 2R0HA 1LHVA 3URFA 2B9UA 2WA4A 3VBUA 3WNXA 4RQPC 2WAAA 1JTZX 5LBCA 1GOGA 4XQDA 1V0AA 2RR13 1MQTA 1PX4A 4AE2A 5ABJC 3FLRA 3LCPA 2WNUA 4ORFA 1MZFA 2XJQA 2WYFA 3MO4A 1C8M3 2J1EA 5CKMA 1B35B 3VD3A 2Q4SA 5JIUA 2F17A 2Q30A 4NROA 3JB4C 4EROA 4EE2A 1T2XA 4FPCA 2W68A 3P3NA 2VUJA 2HH9A 3M3CA 5DABA 4GZ9A 2CDOA 4QPIA 5FYIA 3KV4A 4COZA 2YV8A 3CF6E 4DS0A 2UY8A 1RC6A 2ZGPA 2ZGOA 5JXIA 4XBQA 2HKXA 4RD7A 2ZAAA 2CYFA 4GWNA 4XFIA 4XUQA 2VOWA 1PIV3 1N3PA 4K21A 3W59A 3WHTA 4QT6A 4AW7A 1UIKA 1U5ZA 3V0AB 2RS31 3IDBB 3AK0A 3N7JA 5JUVA 1S0EA 4BE3A 2WS92 1B35C 3ZYFA 1RUOA 5DZFA 2VCCA 1PMJX 3V64A 1JYIA 5T50A 3AVSA 5B2GB 5GJ6A 2QQWA 1FMD1 5JZGA 5L36A 5T5LA 4IEZA 3A23A 1CR7A 3VKNA 2WRAA 3TEZA 4B3NA 4WM7A 2Y6GA 1YFWA 5A7WB 4GB31 4OI4A 1FNZA 1O3TA 3MICA 5HCBA 3MBWA 3MLLA 2XJRA 2ZX3A 1ZNPA 3J9SA 4WVVA 3VD5A 1TVGA 4L8QA 4IUGA 4PLOA 4QX1A 1SDDB 4L92A 4AZZA 2FBEA 3ZXAC 2MHFA 3C8XA 4MGIE 2PHXA 4WBBA 2YUEA 3ZFFB 2OZJA 4NAMA 4LBQB 1Q5OA 2WZR3 3BOPA 5C4WB 2G4IA 3IDAA 3FUQA 2Y6FA 3NVCA 1V6MA 2Y26A 5FP8A 3WW4A 4YM3A 4AEKA 1ODMA 5LK7B 3AKSA 1OKOA 3TBDA 4Q27A 1GZWB 5C3PA 3BGAA 2W0XA 3CDZB 4MXVA 5C8CB 5DAPA 1VBB2 1DF0A 2D3RA 1S0DA 3KQ4B 1LOFC 4CU7A 2XR4A 1DGRA 2XGXA 2RDSA 1OOPA 1W0PA 3NV4A 4H2AA 4HXCA 4P9GA 1WLTA 5CNAA 3T4VA 5FTTC 1PMIA 3A0KA 1FOD1 2EIDA 4KU7A 5CG9A 1OVSA 3LF7A 4NE9A 3FL7A 4Y1XA 5FIXA 4CUCA 1JODA 3ZFFC 5JDBA 3I3MA 4KGQA 4BZ4A 5C4WC 1W6PA 4PQ9A 4GA9A 4EV0A 1DGLA 1DCSA 4DY5A 3UL2A 1NCQA 3C7OA 2R042 2J1VA 5FZ4A 4CTEA 4CDUB 1BXHA 3TN93 4BIOA 3ZOIA 5C8WA 2HYXA 5C8CC 2LS6A 4W6YA 3ZMOA 1JMUB 4LXLA 4LEJA 5KXBA 2W87A 3VDCA 2DVFA 5FZKA 1DG6A 2GU9A 1UN1A 3OD0A 1TMF1 2WUHA 2Y6LA 1PMHX 5T5PA 1XU1A 3RYKA 3JCIA 2DWRA 1HB3A 5HPOA 1GANA 2VW1A 4OHZA 1CONA 2IFRA 1Y9GA 1NA1C 2RS11 2W39A 3IB3A 4XEZA 3RJRA 4D7TA 4P5HA 1S4CA 2JDUA 4AI9A 2WN3A 2BOIA 1H1IA 4HN0A 1IQAA 1W2UA 1ZM1A 3DEMA 4RA0A 4CDUC 4FTSA 1AR91 4TLFA 1VBC3 2DCJA 5FY4A 5FYZA 1RXGA 1UWWA 2ZX1A 3OBTA 2ZGSA 4D0QA 3E6CC 5KHKA 1BKZA 3Q8FA 3O0XA 3J7LA 2BV4A 1PZ9A 1MR5A 2BGOA 3RMYA 3TWIA 5FXWA 1GP4A 3IDCB 2WO2A 4AVCA 4QMAA 5FZ3A 3IDEA 1UCXA 5IVCA 4EWDA 5DMYA 4HLTA 4N7IA 4Y1UA 2DVBA 2C4XA 4Q4W3 2RDQA 1L7RA 2ET7A 5EJ3A 3VHNA 3POFA 1SFNA 4Q0UA 5FMOL 4JGZA 5L7OA 1AYM3 5A6QA 2JG9A 3VDDA 4M0HA 3OPWA 5LRRA 4Q4Y2 4WM8A 3QLQA 3KHCA 3TYJA 1JZ5A 4CVUA 3E5QA 1LEDA 3S5QA 1V6OA 2VZ3A 2ARXA 3KGLA 4IDZA 4P00B 5F5QA 3V65A 5IVFA 2Y6JA 4W6XA 2BJSA 4YW3A 3RGBA 5LA0A 4HVRA 3HBZA 5GLVA 2LRPA 5LY2A 4CDXA 4CZSA 2PA7A 2QQUA 4IGQA 4AI2A 1LJ7A 3T2TA 4EQVA 3W20A 3H8OA 1COV1 2OA2A 5JAXA 1J1TA 2QZ2A 4H7MA 4K1ZA 4RN5A 1UZ0A 1LOGA 4IGPA 4LITA 3VD4A 3AVRA 1ENXA 3OBRA 4LORA 4KBBA 1A3KA 2EIGA 3LIGA 5F2SA 5GLTA 5FZFA 4P5YA 2DU1A 2EF6A 3OGGA 3D8CA 1C1FA 2P6HA 3C7HA 1HXS2 4V2WA 1ASJ2 3PUIA 5FO8B 1VBE1 2DTWA 2WL1A 1K12A 2WWJA 1UO9A 3ZN6B 4E8CA 5FZBA 2JIJA 3RZLA 3JZVA 3DPRB 3FHAA 2EICA 3H8UA 4AVVA 3WP6A 3RPQA 2VVDA 3VBSA 3WNLA 2BPA2 4BPZA 4BM8A 4C1WA 3ZFGC 1DGWA 1V9U2 2QDRA 5AVAA 1LHUA 2GH2A 4QGMA 4GXLA 1OPMA 1CIYA 1BZWA 4HVOA 4BQ5A 1QWRA 2DBIA 4N9HA 1OQDA 4NHXA 1PGL1 2K46A 2WSUA 1FXZA 4N9IA 5FJHA 1VBD1 4DUWA 4YG0A 1XE8A 3I2JA 2E51A 4PDWA 4YARA 1LKNA 3HNMA 1ULCA 2E7TA 4B1LA 2YFUA 1Q8PA 5DUWA 3T2QA 4DFSA 1C5HA 3DPRC 4RR3A 2UYAA 2W95A 3HMYA 1CAWA 2JB4A 1Q56A 4XC9A 4CEYB 4D6QA 4N53A 4BWOA 5M0TA 2DV9A 1DQ2A 4XZPA 1JXNA 3ZSEA 1DZRA 3J7MA 4KWJA 4N43B 1W8WA 4Z2AA 1J83A 4Y5TA 3I4IA 3LDBA 2EAAA 4BQ1A 1DQ4A 5FFOC 3B7MA 4K40A 4XXAA 1R1ZA 4QD2A 1DP0A 2RS51 2XWJB 3QBQA 4CCJA 1V70A 1YQ8A 3BALA 1FPN3 2XHKA 1PZ7A 1F15A 1L7QA 2D7FA 5BNNB 2GN7A 3MW2A 1OD5A 2WFF1 3FFZA 4OHWA 5A80A 2FDKA 1A6CA 3MV01 4BIFA 2G1MA 4CEYC 5FQ0B 3CEWA 4UOJA 2OUJA 4ONUA 1Q8QA 5F3IA 1G86A 2D6MA 2D93A 4MG2A 3N9MA 1V6KA 4HBNA 4JZRA 3RS6A 2WNOA 4UAPA 2WNVA 2WS93 3ZR6A 3ELNA 4CU6A 1IZ3A 1W6OA 2TNFA 2XKOA 3K4ZA 1J84A 4RL7A 4XUTA 1CAVA 2HWF1 3QD6A 3B9IA 5CZKA 3SCGA 1DLCA 1SBDA 2VTXJ 1NZCA 2TBVA 1YC61 2GNDA 3TRSB 4UFKA 2W47A 4PQQA 2RM21 5BNNC 3G7DA 4UF0A 4HKWA 2XKPA 4YG6A 5I0UA 2RDNA 5ERLA 4BXFA 1O5UA 3RVHA 2XLFA 5L9RA 4HN1A 3INAA 3IM0A 3R05A 5JVVA 1HRV1 4X8PA 4XDOA 4IE6A 1RL3A 3WNOA 5F9TA 2XJUA 1S0JA 1STMA 1WD3A 4WVMB 1RUH1 4I3GA 5F5AA 5AC92 3WNPA 4C8DA 2C26A 4IE5A 5C3QA 1APNA 1K45A 2H0BA 1QJEA 2BBVA 1UYYA 3O5SA 1NCRB 5GZEA 3UYJA 3ZVXA 3EBRA 3OBAA 3O1TA 2VUCA 1O5LA 2GMEA 2J1AA 2QBXA 3CL1A 3I59A 1RUJ2 1WMEA 2VMDA 4O61A 4K20A 3R4SA 3OY8A 5FZ0A 5K4LA 3CZUA 3F95A 3LSDA 4DQAA 2IVIB 4XPVA 4QPYA 4G9SB 3N9OA 2CU5A 3IWZA 4CEWB 5F7UA 1JZ6A 1VAKA 5EJ1B 4ZXKA 2YXSA 3UJOA 4AOCA 1U12A 2JWPA 3RZJA 5LBFA 2NP0A 2RMU2 5FY1A 4I0BA 1D4M1 3IBMA 4HPKA 1HN1A 1WBFA 4H55A 4AYUA 5DUUA 4A7YA 2AUYA 3F2ZA 5LY1A 3JBG1 3PVNA 1LESA 2PQSA 2HWD1 1D4VB 1NCRC 4OQ8A 2R043 2PHFA 4HANA 1H8VA 4QX7A 4IEQA 3E1F1 3AXDA 3HT1A 4IEPA 1H4HA 2ATFA 3WG4A 1WMDA 5FWEA 3HOBA 3LE0A 5GM0A 4D7SA 3ZM8A 1LB2A 2BVBA 5ACA3 5C3OA 2W5FA 3U07A 1ULEA 3IMNA 3D4KA 4BJ0A 1QJX2 2I45A 3WLUA 4AFAA 3I2FA 1WCQA 3CHXA 4PLNA 3RI9A 3K3NA 3TEYA 2ADEA 4NIAA 4MZUA 2ZGLA 1LEMA 4M4PA 1ND2B 5JWPA 4UBHA 2WZPP 3GXUA 4RS5A 3NV2A 4QGLA 3AJZA 4LKDA 2XOMA 2RR11 3POEA 4CSWA 5A70A 3GZTB 4XTPA 5CFCA 1REFA 5CVRA 3WV6A 2BP6A 2HWB2 3MF6A 3WDVA 1C8M1 1CQ9A 2VBDA 4EZHA 2VG9A 3P5BA 3DKWA 1X36A 2HWC2 3AZWA 4XF0A 1W6QB 2JDAA 3GHNA 3ZYIB 1Y4WA 3J8F2 4QHZA 3ACHA 2ZGNA 4GWJA 1C5IA 2HJIA 3FBYA 3EYPA 1AL0G 1ND2C 3UETA 3NNMA 5C6CA 4V2VA 2NZ9A 1R1A2 5FYYA 2DUQA 1PIV1 1QJY2 3LA2A 2E7QA 3IAQA 3MLKA 1WBLA 3RZHA 4IETA 3NAPB 3J4UH 5A1AA 3MUY1 4DXRA 2WIIB 1YJLA 4I30A 1POQA 2WR9A 2Q0AA 2QUOA 4E4DX 3H1YA 3PUSA 1SACA 4CRQA 2JDPA 1H8TA 1CPNA 1GYKA 1UZYA 2FDIA 5IVYA 1UL9A 1BBT2 2WAOA 1JI6A 3BN6A 5HXVA 3NKGA 3EB7A 4KWKA 1CZVA 4JC1A 2ZGKA 3WF4A 3AB0A 2FDGA 4OHVA 2VPVA 2MPFA 3NAPC 4M3CA 3TOJA 4QDRA 1RUC2 4OVEA 1HKDA 2YYOA 4RGAA 1HXS3 4AFDA 1ASJ3 5C9AA 5KWRA 2NMOA 2Q1ZB 4YGBA 2WZR1 3KQRA 4FO9A 3LKJA 1IS4A 3OPTA 3WNMA 4JCKA 5JCTA 1G9AA 3VL9A 2GC3A 4HMZA 3NRUA 3ACLA 4UT5A 3ZKYA 3VBHA 3H9AA 4A7ZA 4QX2A 2YZ4A 3MFAA 4FPLA 1VALA 1F35A 3WG3A 3S5AA 1UQXA 3HIFA 1S2BA 3HR9A 4LBMA 3O1MA 3KVAA 3I8TA 2YG0A 4Z2WA 5DXDA 4KNCA 5JR7B 3KD4A 5FBJA 4GWMA 2UWCA 3DECA 3T2PA 3ZXDA 4FP2A 3D6EA 3HN3A 3LPGA 2GN3A 5I0RA 3VV1A 2H0VA 1GP6A 3H8RA 3IIAA 1L3JA 2P1BA 2X29A 4COYA 3PVEA 4BMEA 3PMSA 5HBAA 2VOTA 3USSA 1JZ7A 1GR3A 3C2UA 1AVBA 1UOJA 3E6DA 2ZZJA 2GNMA 3SHRA 4IV1B 4LLFA 4Q0SA 4LO7A 1FV3A 4JHTA 2BWCA 2XHNA 4E2QA 2BBAA 4E4HA 1CAUB 1XSRA 4QPGB 3RZZA 1ODNA 4I0AA 2Y0OA 3DKQA 3KZ4C 4WV8A 3UK9A 5EHDA 1VJ2A 2QCSB 4QAWA 5FYCA 4DMIA 1YWKA 2P4EA 3FHQA 2CAVA 5C7GA 5FPXA 1O4YA 4X6RB 1KJLA 4KMQA 5HV0A 1DYOA 1VBC1 4P14A 5IK5A 2FMDA 4Y3OA 1H30A 4IV1C 1WW6A 4UW6A 5F6KA 3CZJA 4O9GA 2QVSB 3ATGA 1D0HA 2LTNA 1PGW1 4A3ZA 1RHI2 2OIIA 4DZGA 2VE1A 1UZVA 2A7AA 2K9ZA 3FMGA 2D44A 2QQMA 5E8AA 1K5MB 3TB0A 3TN92 3JD72 1MS5A 2V73A 2I74A 2V5DA 1KDMA 1MVEA 3HNBM 2W2IA 3KM5A 3ZIXA 1DQ5A 2YBPA 2OPKA 4FPGA 3H3UA 4Q4W1 4DPNA 2XXZA 4RQPA 5IFPA 4Y5Z0 3Q8AA 2ZHNA 4QX0A 4L11A 5EIYB 3PUQA 5ABJA 4QB2A 5JI7A 4PF1A 1N1YA 5FZOB 4OI2A 3POJA 1GZ9A 2P34A 4LHKA 1WWYA 1EUUA 5A1LA 4ZXEA 1YFXA 4U36A 2VZTA 1NOVA 4R9AA 1A8DA 1GLHA 5AC93 3Q8EA 5BPXA 5J36A 2DU0A 3LOIA 3WCRA 2ZX4A 5FO9B 1HV0A 2DF7A 4MHRA 1PVC2 1K5MC 1GNYA 4TLGA 3I7DA 4LKSA 1C1LA 1V00A 3HEIA 4XBNA 1QMJA 3WZ1A 2UWBA 3MZHA 4L99A 3RFRA 2ZHLA 4WVZA 1M4WA 1G9FA 1W90A 2ZACA 2IXLA 2RE9A 2VBBA 1V6IA 3OGSA 1I5ZA 1QEXA 4IL7A 4ZHNA 1SFPA 2W52A 5FUPA 1CD3G 2PAMA 4K7JA 1FV2A 1QXRA 1UW8A 1VP6A 2PHDA 5LK5A 3D82A 3R6SA 2Y64A 2GAUA 2RMU3 3B00A 1ZVFA 5F2WA 4NIHA 1AYM2 4K3UA 3AXEA 1AR72 2IXJA 1C57A 1SBFA 2XQXA 4R8HA 1YXWA 5IVVA 1WMFA 1O8SA 2BOJA 1ZZ7A 4NPRA 1VAMA 1LENA 3THCA 1GUIA 4OFGA 3ZMNA 3GNEA 1BMV1 4LA2A 2VOKA 3U14A 4LBQD 3ZYRA 5JSPA 2D6NA 3V0AA 2A75A 2AREA 1F2NA 3AL6A 4QU2A 3T0BA 3VBFC 5KHGA 3KV5A 4Q2FA 1QJX3 1M06G 2XVLA 4BISA 2PHWA 2YFZA 5BNOB 2AEZA 4CCMA 1JU3A 5A7OA 2PHUA 1W2OA 5FPVA 1HW5A 4A41A 4AI0A 2ZA9A 1ZREA 1ZZCA 5K7PA 1MS8A 3RSJA 4FPJA 2R0FA 4RHV2 4W4ZA 2Q8EA 4MUVA 3VL8A 3ZXKA 2A70A 2JXAA 1W9WA 4LO5B 3KWVA 5FAXA 1TE1B 1W2NA 5A7WA 1LGBA 3Q9OA 4AQSA 5E88A 5T52A 4AI1A 2HLEA 4Y5SA 3M4FA 5CFDC 4A44A 3DL3A 3E5UA 2HWB3 1XPWA 1AR63 2EIBA 1EPWA 4YNIA 3RZMA 5A6ZA 2CGPA 2ES3A 1O4TA 2HWC3 4WVWA 4MLOA 2OZ6A 1HB1A 1GQHA 1R083 5FZ9A 1ZA7A 5FR3A 1NY72 1PM4A 4FI9A 5BNOC 1MEC2 1ULGA 5E1RA 3ZFFA 4LBQA 3N7LA 3UJQA 5C4WA 1WUVA 2X53S 4I0WB 1CPMA 1UF2C 3V0BB 2BRTA 4ZZ8A 2BQPA 1X9PA 3DYMA 4YZ2A 1QOTA 2P3IA 3AC0A 1GZWA 3VZOA 1QJY3 4ATFA 2R30A 4V1PA 1SLIA 4MYEA 3M1HA 2RJ2A 1S0FA 3O0VA 3PUHA 3U4SA 5JI9A 4K9SA 1LHWA 3MIGA 3ROUA 4WZFA 4TWTA 4NRQA 3HJRA 3WDYA 4XJZA 1BVP1 1D2SA 1HB4A 4K8FA 1IHMA 1EV12 1HV1A 2WS91 4S2HA 1DZTA 3ZSLA 2VMIA 2Y8KA 4QDQA 3FWEA 5J98B 3MW4A 2GC1A 5EFUA 5A7QA 2Q1FA 1OT5A 5FZCA 5HCHA 2XBO2 2J1UA 3K51A 1CZSA 5CA6A 3BIEA 1BBT3 4GULA 4M3CE 1CJDA 1WW7A 3MW3A 2ZPXA 4GQ7A 4PI2A 5LB6A 1SFYA 2ILMA 4AG4A 4XURA 4GIQA 2F4PA 2P3KA 4YGCA 3AFGA 3ZDSA 4AHZA 1JYTA 1Q43A 1QJU2 1JH5A 1OURA 1RUC3 3N3HA 5ANQA 3UGGA 1FPN2 3WW2A 2XJVA 2JE9A 1WCKA 3NJVA 2VMEA 4IGOA 2BGCA 1NQDA 1JUIA 1RIRA 1RUD2 2DBNA 1UMHA 2JE8A 2VMGA 5EXOA 4LKEA 1UYZA 2FMYA 4YM2A 1VBA3 3MIBA 4J1WA 1OA4A 1OFSA 3SLIA 3PUAA 4QB6A 1GQGA 2Z42A 1I3HA 3WDWA 1QOSA 2G9ZA 1WW4A 1VBB1 3T08A 4Y1ZA 2OKXA 3GZEA 4IE7A 3VLBB 2ZBJA 2PHTA 3VUOA 1YQ6A 1UMZA 1X7NA 4QWNA 2UU8A 3PIJA 4COWA 4EZ4A 1RB8G 4I3PA 1EP0A 5F1RA 1OHFA 3KS7A 3PLQA 2YC2A 1YJKA 1AR82 4XABA 1OA2A 3VBOB 1N3QA 1SZBA 1OUSA 3C3VA 2W92A 4DO0A 1GWMA 2JENA 2IZWA 4UFHA 5T5JA 2R041 4FOQA 3MDPA 2RV9A 2VCBA 4QQOA 4BB3A 4LE4A 3IPVB 1UD1A 2FCTA 1DQ0A 1YFYA 2AENA 4EJRA 2A3YA 1YNAA 3I3BA 1QIQA 4A42A 1SLAA 2WJSA 1ACCA 3WP5A 3MGUA 4OI0A 3ALQA 1S0CA 1SCSA 2C0ZA 1NT0A 2W9XA 2C5DA 3JB8A 3I3EA 3POWA 4PIXA 4XF9A 3VBOC 3T3YA 4EWAA 3ECQA 3BI3A 4LO6B 2PHLA 2C24A 2HEWF 3NWKA 1F4HA 5T54A 5J7MA 1WLWA 3OYWB 5BXXA 2CWMA 5FLHA 1ULPA 4AEJA 2GP3A 3AL5A 1NYWA 1UX7A 2ZEWA 1QH6A 4GJYA 3GCWA 2CDPA 3EMRA 5I93A 5LA1A 3O14A 1NA1B 2VD7A 4PT6A 3POIA 4O65A 3QH6A 3GALA 1S0GA 3A4UA 2NYYA 1RHI3 3OEBA 1IPSA 1OLRA 2A73B 4H3WA 3WR0A 2VZQA 4O9EA 3KCYA 2G19A 3GM8A 1I6XA 2BNOA 2ZMLA 3JD73 5F5CA 3WQ7A 3ZN6A 1X8MA 3MIDA 2F6BA 3W9AA 1RUG3 5JR2A 2VQ0A 1UXZA 4LOTA 1NE6A 1H6YA 4M3CF 4AGVA 5FWJA 4FCAA 3N35A 3VBUB 5ACA2 4AAXA 5B4XA 4NIIA 3BTZA 4YZ3A 4D6SA 1KXGA 4PJYA 3ES1A 3BU7A 4Q4Y1 5LBEA 5LBBA 3ZYBA 4QPWA 1KFUL 1RMU2 4QX5A 2QKDA 3ME2A 4KGGA 4A6SA 4OZXA 5F39A 3M70A 3O0WA 1LU2A 4XDQA 5A33B 5GZGA 5FUNA 5LEJA 4YWAA 1XRUA 4OI1A 1PVC3 3LZZA 4XF1A 4MXWB 5T5OA 3W5MA 2D98A 5F37A 2YU1A 4FT8A 5J96B 4CP2A 4HL0A 1VRBA 4QQHA 2TUNA 4FP3A 4UFLA 4NIGA 1O7FA 3W5NA 3M3OA 3SMHA 3VBUC 4CEYA 3HPNA 5FZ1A 5EYXA 5IFTA 2V72A 2CTVA 4QHOA 4NIDA 4MV2A 1QHDA 1W9FA 5FP4A 5GLUA 4CUAA 2ZGMA 2QQIA 4PIYA 3RI8A 2AH2A 4N43A 1BYHA 2WNUC 1EUTA 4IE4A 2VMCA 3ILFA 1W6MA 2JDYA 1HXS1 3MPBA 1ASJ1 4DOUA 5KHHA 4XJ9A 5H9RA 2DUPA 1UKRA 3BU0A 3JQXA 3VKFC 4AFMA 4BK4A 1AR73 5IHRA 4QX8A 5FY8A 1SMVA 2NQYA 2WSVA 3KV6A 2WNEA 4PF5A 5AFBA 1VRH2 2B42B 2DFBA 1H1AA 2ZEZA 5FYMA 4BH9A 1JYVA 4XACA 2YC4A 3BIWE 3THPA 5A7NA 4CP1A 5IATA 2EIEA 2QQJA 4KWUA 3ZYGA 4DUXA 1V9U1 5FQ0A 2GNBA 1O8PA 3S7IA 4LT5A 2AC1A 4Y20A 1ULDA 4UBGA 3BPZA 2G9FA 5C3RA 1T6GC 3AMNA 2ZEXA 3PIGA 1QGLA 3RWNA 3LFMA 3ACGA 2C9AA 1OQEA 5J37A 4JVAA 1GV9A 5EZWA 1MACA 2IXHA 3PL0A 3ZFGB 4FTBA 2O8QA 5FYUA 4IEVA 2A6WA 4MGYE 3ZFEB 4RHV3 5C71A 3GZUC 2R062 2WN2A 3B9CA 4CUBA 1RUI2 5ANNA 3GF6A 3U1XA 1VPHA 1W28A 1GZCA 3HNYM 3O1RA 4XUNA 3ZYJB 3T09A 2HBUA 3H3LA 3W58A 5A3TA 5FP7A 1HRI2 1JYCA 3AKQA 2JJ6A 3U78A 4GH4B 1OOPB 2C6SA 5C5TA 2UURA 1MEC3 4WVMA 3AP7A 5FYVA 3LB9A 2QJVA 3H7YA 4XUPA 5IWFA 4JTOA 4ZS3A 4LUMA 2ORXA 1PX3A 3AP5A 1Q8SA 3DGTA 1UU6A 4FOVA 5IJRA 3ZFEC 4Z92B 1H2LA 2B8MA 1FNYA 2FQPA 2WKKA 5JOWA 3TEXA 3U75A 2X5IB 5H9QA 2X09A 4ZKTB 1N1SA 4ARXA 5EWSA 1SEFA 3E5XA 2O8OA 3FUOA 3LWCA 3OTFA 2J1SA 2JIGA 2QQNA 4LHNA 3PVBB 4GD4A 4LULA 3MYXA 1DU3D 1OBNA 4GH4C 1EV13 1OOPC 4MVTA 2NPIA 4H14A 1WCUA 3LAGA 4DY3A 2FDHA 5FOJB 4CEWA 2ZOEB 2WLPA 4Y4YA 3VKLA 5I91A 1UZZA 3A0NA 1XNBA 3O1UA 2XBO3 2R49A 4QQLA 1YFUA 1Z7S2 1HX6A 1NE4A 4FPFA 4KL1A 2ADDA 4XZUG 1W03A 3AP4A 3J26N 1H2KA 1PO12 2D3SA 2X5IC 3AKRA 5L73A 1H2NA 1J1LA 2Z5WA 1S55A 1QJU3 2P3JA 1WA4A 4AQTA 4DINB 5A3UA 3AKPA 3AYEA 2BZDA 1ZBA3 3GZAA 1QQP2 4GMP3 4AQ6A 1W99A 3LOBA 1A78A 3VZKA 4M00A 4GKXA 4C91A 5AC91 5C70A 1RUD3 5CEHA 3OGRA 4QGNA 5FXXA 5T55A 5K9YA 4FVVA 2OXBA 4JRAA 4INDA 3CO2A 1JYNA 4FOYA 4HT1T 1TME2 2VM9A 4MO3M 4Y24A 4E2SA 3UKNA 3B94A 3DUIA 5A3LA 4ES9A 1RUJ1 2XUEA 3OSDA 1XNTA 1W8OA 2J42A 2JDMA 4ASLA 1SLLA 2WT2A 4P9WA 4TYSA 3H0OA 4YVWA 4ZU5A 3ZO0B 4CDQB 1LTEA 1UYPA 4HSLA 3T30A 1XU2A 3VBRB 1W05A 3DF0A 2PXJA 1Y7BA 1VMJA 2PTMA 2XVKA 3ILNA 3THDA 4UW3A 2HYKA 5FZHA 5C5UA 4UFMA 3HBKA 4FTEA 1AR83 2RMU1 1MZEA 4DEQA 3CLPA 3TAYA 3OGJA 3ZYPA 3H1WA 2KA3A 1ND3A 4CP9A 3P3PA 4CCKA 2VCMA 4UWDA 2VNGA 1RTVA 5FMDA 4NMIA 5HCAA 3EJKA 2QE3A 4GMP0 1MZ5A 3WP3A 4COUA 3LDRA 4KWLA 5L7OC 5IK7A 4GWIA 2CY6A 5FK8A 2RDRA 5IVEA 3J7NA 2QDNA 3NAPA 4CDQC 3VBRC 2JX9A 4PIZA 4FXKB 3ZDVA 4BMBA 3BKZA 2LROA 5JOXA 1QJX1 1DGRN 2FDJA 3I2GA 1AXZA 3I2OA 5BNPA 4Q0VA 4NVPA 3BYWA 2IVJA 5H9SA 1I1EA 3S0MA 1CWPA 2A6YA 4Q26A 1AJKA 5CU1A 2VXJA 1KS4A 2FD8A 1ZRRA 2R32A 3H1MA 1NLRA 4NR1A 2CSGA 1LU1A 1H4GA 1X33A 1AXKA 1AL22 3D5OA 1OVPA 4CCEA 1O3SA 1XYNA 3HT2A 4NHLA 5FY7A 5GZDA 2HWB1 1LNSA 2XH6A 4IERA 1ZBE2 1NXMA 5FLIA 3VD7A 1Y9QA 1DIWA 1QOOA 3WF3A 4P9JA 2HWC1 5FY9A 5LCWL 5FZDA 2KR2A 2VW0A 1GFF2 4EYUA 1NX9A 2DURA 2VZOA 3J8F1 2AR6A 2D6PA 1SPPA 1UIJA 1LOBA 2V5YA 1FMD3 3SC7X 2GH8A 2D6LX 2DFCA 3WHUA 3Q8CA 4J25A 4XXPA 4DIQA 2W08A 4B7KA 2H6CA 3ITQA 1OKQA 1PK6A 4XTMA 1R1A1 2MEV2 3QACA 3IAPA 4UXAA 4YZ4A 2YROA 1UOBA 4L2NA 1JYWA 1QJY1 3S57A 2EXJA 4IESA 4NAOA 4R9BA 2VQAA 1RMU3 5FKBA 1OXCA 1S0IA 2LW8A 1RITA 1PO22 4ZONA 5G05L 5A3PA 2FDFA 3U0ZA 4YPJA 5FMOS 2YPDA 4NUBA 2N7GA 2XJSA 2KD7A 5FBZA 5HXMA 5GLWA 3ZXLA 5DUVA 3K4DA 2B46X 1BBT1 3RYRA 3E97A 1NAEA 1XQNA 4D94A 3AMQA 3BCWA 1AR62 3AP9A 3K75B 2BFUL 3KB5A 5FYSA 1V6JA 4XDPA 1R082 5D21A 4AI8A 4CDWB 1F9KA 3GBFA 2VAUA 2RJKA 4ET7A 3B69A 4CA9A 4HSJA 4XAAA 3PJQA 1RUC1 1YHFA 1Q3EA 2PFWA 1XXNA 1KDKA 2JG8B 3R4DB 5CYYA 1D2QA 1FOD3 4CCNA 1H2MA 4YFZA 5HCFA 4BOWA 4XFBA 5I8YA 2PLV2 1CAUA 4QPGA 1BHGA 1W3VA 2FCVA 4GAZA 1IPKA 5A32B 1VRH3 4N8MA 4IEYA 3WSOA 3WY6A 3PJYA 3WDTA 1PNGA 4FPOB 1JZ2A 4QB1A 2ETEA 1TNFA 4CDWC 4YG3A 5FZLA 4HVQA 3ETQA 2ENRA 4Q4V2 3NNFA 5CKQA 5JXHA 3OOXA 4HG6B 3ZXFA 2AZ5A 2AEYA 2JG8C 1C4RA 3SISA 3ZN5A 1Q8VA 3NL1A 4ZS2A 4DXSA 4ISQA 3CKHA 2Q8OA 2R1BA 4NHMA 5AFEA 4FBFA 2VZVA 1K5MA 4DXTA 2R063 2QQPA 4NJ4A 4YGEA 4FXGB 1YCIA 1RUI3 1VAVA 4L9BA 4B29A 4IXLA 1AYN2 1UPSA 2QNKA 1HQWA 3KGZA 4OMDA 2BGPA 1TQ5A 5FXVA 3WUDA 1RUF2 1SBEA 2QTWB 2A6VA 3I59B 1HRI3
chains in the Genus database with same CATH topology
4ITCA 3ZSKA 3CNAA 3FE5A 2R072 1VBA2 2WT1A 3ASIA 1XNKA 3POYA 4K1YA 4R4ZA 4JDOA 2ZGRA 1R092 2DVDA 4HPKB 1G6NA 4EN6B 3RQ0A 5KHJA 2XL9A 4IEWA 3TNPB 3BB6A 4Z07A 4AI3A 4NOTA 1KS5A 2O0OA 3WCSA 5FDBA 1PHMA 4B4QA 2E53A 4QM9A 4XBLA 4LTAA 4XMIA 1IPJA 4QXKA 3FC0A 4PCRA 2BYVE 4X6QB 4EN7B 1MS9A 5DDJ2 1RHI1 2CV6A 1DYPA 1Z7S3 4ATEA 2HWE2 3TN91 3JD71 1B09A 3RRDA 3B5LB 1FATA 3MF9A 2YGMA 2ZX0A 2ZHMA 2ZZQA 1PO13 3VZNA 5BYNA 2BVVA 1RUE2 2JECA 2QZ3A 3E6BA 1URXA 3POSA 4XFAA 1F8VA 3HN1A 4D69A 2VVEA 1QQP3 2XG3A 3M3IA 3WDUA 3HWJA 4EWEA 1BK1A 4G3YC 2A3WA 1PZ8A 5BNOA 4YZ5A 1PVC1 4F83A 1IS3A 3IN9A 1W6NB 1TME3 3LSEA 1RVF2 4NN0A 3T1MA 5C33A 1W39A 2D97A 4RS5C 4LE3A 3MEPA 5FO7B 2YPJA 5KXEA 3NV3A 2A5ZA 4LA3A 4IQPA 4R4XA 1ENQA 1EYBA 1RUG2 3M2MA 1X50A 3KT4A 3FHIB 4MX3A 3SCFA 4BLIA 4ES8A 3AMHA 2GZWA 1G9DA 1F31A 1VBD3 2ZTNA 4A7KA 3BODA 5SV5A 1AYM1 1AR71 4PBPA 2UWAA 2WQZC 3V0BA 4URTA 4JGYB 4YRDA 4AXOA 4B7EA 1ZRFA 1ZX5A 3AZXA 3VKOA 3L9JT 2EAKA 4OUMA 1IS5A 1RGSA 2E9QA 1H8TC 4P9LA 2E7AA 2OYZA 1V6NA 4RFT0 4RHV1 3SXWA 2XPJA 1OSGA 4FPKA 3VBFB 3T1LA 3NKTA 4JGYC 4E2GA 4FAGA 1AL23 1MS1A 1GSLA 3ES4A 2Z79A 1GNZA 4HK8A 1B35A 4J6GA 1REDA 1J3QA 1XYOA 1N3OA 2DCTA 3GYDA 4LBKA 1ZBE3 4IEUA 5GLZA 2YY1A 3CJIB 5I8TA 4OLLA 2VY0A 1NY71 4BA6A 1U5YA 1MEC1 2PHRA 3WUCA 1UX6A 4JDNA 5D8AB 1BEV2 4OULA 5CFDB 3GBGA 1OI6A 1QDOA 2MEV3 1O91A 3AZVA 5KC5A 5E89A 5K0UB 3VBHC 2I2SA 4SLIA 2D43A 1N1VA 1PO23 2NN8A 1HRV3 4BYYA 4KH9A 3WQ1A 1AJOA 1QJZA 3CJIC 1EV11 4J1XA 1LGNA 4AEDB 5FOBB 3M3QA 4DXZA 2Z2SB 2XBO1 5D8AC 4XHBA 2GMMA 2SLIA 3VBOA 1LOFA 2XLGA 2GDFA 1MZ6A 3USUB 5KHIA 5BNQA 4MGKE 3H50A 5CBLA 1AXYA 5K0UC 1EAH2 3PMEA 4OHXA 3KCCA 4LO8A 4FAHA 1QJU1 3IT8A 5CIRA 1FPN1 5JSRA 4EN9B 2BWAA 5JSOA 4Q4X2 4AEDC 2PLV3 4W6WA 4Q1RA 4YM0A 1RUD1 4D7YA 4EN0A 5C8CA 1ENRA 3N7KA 1G9BA 1D4M3 5H9PA 4XILA 4AFBA 3M7AA 1H9PA 3OD4A 3OYWA 4YW2A 2D6OX 2EXIA 4Q4V3 4YSFA 5FREA 2BW8A 4LHLA 1NA1A 1HQLA 2XVGA 2WWSA 3FZ3A 2IXCA 1QY4A 5GZCA 4HFSA 1X8EA 2FZ1A 3CJXA 5SV8A 1AR81 4CDUA 5IK4A 3RMXA 1Z0HA 1HQNA 3N36A 3TNQA 1AYN3 2LUWA 2EVXA 4C0HA 1BVVA 1RUF3 1F5JA 1ZBA2 1S2KA 1WLDA 2D5HA 3HD8B 3AYDA 2R073 2GC0A 2WC2A 1ZRCA 3M8LA 5A33A 2YGLA 3ZXEA 1OMIA 2VULA 1ONAA 1WCSA 1R093 2GSYA 4AK3A 4MXWA 4B4RA 2PAEA 3AM2A 3MIHA 3VHOA 1PNFA 4MSVA 4JRLA 1GICA 2ZX2A 2VXRA 3AKTA 4XFGA 1JOJA 4M01A 1POV3 3VGIA 4AFCA 4W65A 4META 2GC2A 2WQ4A 2GALA 1ZZBA 5DDJ3 2B45X 5DZGA 5FRAA 1O4ZA 2MNGA 2VU9A 2HWE3 4YLZA 4F3JA 4ASMB 1Z78A 1U0AA 2VH9A 1S1AA 2B7YA 2ZCWA 2CAUA 4MH0E 4Z8BA 2JE7A 1RUE3 1OA3A 3MPPG 5ACA1 1WGPA 2BUKA 1HIXA 1LHNA 1JN2P 4G4FA 1RMU1 2XLAA 4P9IA 5DG2A 4YVSB 1CAXB 1DZQA 4QQ2A 4R9CA 4Y22B 4Q8LA 2HEVF 3PNAA 4XYXA 1POV0 2JEMA 2C1FA 3ZFGA 1NG0A 4EN8B 2DTYA 1RVF3 3ZFEA 3I2DA 4A3XA 1SCRA 4IV3B 1LGCA 2RS32 4C0BA 2Z69A 5J09A 3KMHA 4AQ2A 2PN5A 2SBAA 1ZZ6A 2IC1A 4L97A 4YVSC 3AFKA 4GH4A 1FMD2 1IS6A 3DPRA 1UU5A 4I01A 1XE7A 3BTAA 3R0RA 2KM2A 1G8WA 2EXKA 2VGDA 4B8EA 4GB32 1MQTB 1VRH1 4AHWA 3WP4A 2VNOA 2WNUB 2OUHA 4I2OA 4Y1YA 2X5IA 4YFWA 3L2YA 1QNWA 2PAKA 4IV3C 4LLOA 1QXPA 2CGNA 2ZKNA 3S30A 4YZ1A 5KBFA 1J3RA 4LO4B 4FPYA 1I9RA 1JBCA 1JUHA 2CNAA 2LALA 3OJBA 4IEXA 2VUAA 4QPIB 2YC0A 3OF1A 1QNYA 3APBA 1MQTC 1KFXL 2JDZA 4AGGA 2XUMA 1ZRDA 2R061 4M0NA 2RHPA 1RUI1 4TZDA 1IOAA 2FZ2A 1YO8A 4I02A 4AHYA 4E27A 2VOXA 1U5XA 1IKQA 3MIEA 1FOD2 1HRI1 3EQEA 1IGOA 2KXLA 4ISRA 1VIWB 4AVSA 5JZGB 5BNNA 1DLLA 4QPIC 4QHBA 4HKOA 4WM7B 5BUVA 1BEV3 4BCUA 3M3EA 3NW4A 3RYPA 1CIWA 3ZSJA 1W0OA 2CWSA 1S0BA 4BLJA 1UAIA 3MI8A 4LBOA 1ZA4A 3JUUA 2K0GA 1TMF2 2FHRA 3HQXA 4UW5A 1H9WA 4SBVA 3FLPA 4OUSA 5JZGC 4CDQA 3VBRA 4FSJA 2RS12 1FX5A 3KCXA 4WM7C 1G7YA 1Z7S1 2R1DA 1O3RA 1OPOA 1N1TA 1FT9A 3KT7A 3ZIWA 1WD4A 1AR92 3FBMA 1PO11 1KITA 2A71A 1EAH3 4FQZA 1XYPA 2DCYA 4JQRA 1KQRA 5I0SA 4FQ4A 2BNNA 1W6PB 1QU0A 1QQP1 1WCDJ 3ENRA 4Q4X3 1NCRA 1GKBA 3MLJA 1A8MA 1NCQB 1YRZA 2DYCA 1QH7A 3ZXJA 1REEA 4HK9A 1TME1 3MFCA 3L2HA 1V6LA 4YW1A 3B01A 2V09A 4LBJA 2DVGA 3DV8A 1EY2A 5FPZA 5T3NA 4YYOA 1HDKA 2EALA 1AHSA 5KXDA 4PBOA 4CP0A 4XJAA 5KC6A 3SCHA 1NCQC 1COV2 2VW2A 4P9XA 3JU9A 2B39A 1LR5A 1ULFA 3AMPA 3AZYA 4E4ZA 1YUDA 3FLTA 1RJ7A 2VVFA 5FLJA 4XF4A 1VBE2 1WW5A 4K6BA 3EXUA 4U2AA 1ND2A 3FX3A 3AX4A 1LODA 1W6MB 3WXPA 1J3PA 5CB7A 5TSWA 4C1XA 2HEYF 3R4UA 4HZFA 4JGZB 5J48A 5L7OB 2JG9B 3VDDB 5GZFA 1XNCA 4WM8B 5DZEA 2ZAHA 4AVTA 1WLCA 1XNDA 1AL21 4S2GA 1W6QA 1C8NA 5HI0A 4CDWA 3AYAA 1PGL2 1VBD2 2VNRA 3G6JB 4Y20B 1ZBE1 2ZGTA 4CDXB 4FPHA 4N43C 2JG8A 1E57A 4LNVA 4XIKA 4DNYA 4XJWA 4NHKA 4JGZC 5I0TA 1YI9A 2JG9C 5E16A 1D0GA 3VDDC 5A32A 3ZN4A 2ZGQA 2G9GA 3D0SA 4WM8C 4XOGA 3LA7A 5GALA 1LRHA 2P37A 4Q8KA 2MEV1 2OW4A 1CVNA 1LULA 1NQJA 1C28A 3WVJA 3AP6A 1PO21 5DG1A 3WT3A 4MGZE 5KXCA 4XJ8A 2RS52 1PVXA 4HETA 4CDXC 4RSUA 4UW4A 2DUOA 4RGGA 1ALYA 1JHNA 1KJRA 4KG8A 2WFF2 1SLBA 3VBSB 4NWWA 4E9KA 4F7ZA 4I09A 4S2DA 3NV1A 4AGRA 1KRIA 1AR61 1H0BA 4KU8A 3GHMA 2GMPA 4XQ4A 3N7MA 2RS33 1R081 1O3QA 1VBB3 2CL2A 1VLNA 4XFHA 1QDCA 2X8KA 4PDWB 4XQWA 5IT6A 5EYYA 3FFQA 1UU4A 3NJZA 2HWF2 2OVUA 4XETA 3AYCA 4RR3B 4XHXA 5IK8A 2PLV1 3U10A 1CGPA 1CAWB 2RM22 1LHOA 4GB33 4N53B 1MVQA 3VBSC 3UV9A 1GBGA 1QXJA 2D6KA 4XMAA 1HRV2 3BOWA 1OQ1A 1VB4A 4XIOA 1LECA 5FCCA 1DGWX 1DQ6A 4Y1VA 5BY5A 4Q4V1 4R52A 4LR4A 3THTA 1RUH2 1LOAA 4NO4A 4PDWC 1KD7A 1YLLA 1F5FA 5LEKA 4RR3C 5A3MA 2ZABA 4C90A 1VR3A 4CEWC 4N53C 4XFCA 2DCZA 2VOVA 4AWDA 1DHKB 2NLRA 1AYN1 3V56A 4IV1A 5J3UA 1YIPA 3H7JA 1RUF1 2WNVB 4NWVA 3VZLA 2UYBA 5JPNB 1W6OB 3WOGA 3SITA 1CAVB 4YGDA 2R071 2LM3A 4YVWB 2JICA 1VBA1 1D4M2 1ZZ9A 4Z1VA 3JBG2 2VMHA 1LOCA 2HWD2 3SH4A 2EA7A 2YDEA 2P2KA 3U4XA 3D0JA 1R091 1RJ8A 3VN4A 4AHXA 1W6NA 1ND3B 2NM1A 4Q1PA 4FOWA 4QQPA 4YM1A 2WNVC 3WG2A 1TMF3 1POV1 4XW3A 3RNSA 2YHJA 1SDWA 4Q4Y3 2A6ZA 4IEOA 5I8SA 4N90A 2ZMKA 3NSTA 1TNRA 2RS13 2DVAA 5DDJ1 4YVWC 3SMHA 4Q29A 3HAGA 4Q0PA 4R9DA 2HWE1 4AEMA 4XJUA 5BNPB 1X82A 4A2UA 1DFQA 1BQPA 1AR93 3OY8B 4OHYA 2RR12 3WQ0A 1RUE1 3RG0A 1ND3C 1SLCA 1ZZ8A 1VB2A 2JKBA 4JGYA 1C8M2 1DBNA 4JDMA 3WW1A 1EPZA 2E63A 2XB6C 2EXHA 5CADA 3VZMA 4YW4A 2Y0IA 5BNPC 1OFNA 1C3HA 1RVF1 2BTVC 1PIV2 5EV7A 1MS3A 3O7OA 2IXKA 3VBFA 3X29B 2H6BA 2WT0A 3ZPYA 2IXIA 3RDIA 1PK6B 5IUQA 3AJYA 2E6VA 1V9U3 3B93A 5DUXA 4GKYA 1CN1A 3NO8A 5JOZA 2ET1A 1ENSA 1RUG1 3CJIA 4XF3A 5JOYA 4RS5B 1COV3 2R6QA 2PYTA 3B02A 5D8AA 5AVPA 3QOPA 5CFDA 1IKPA 3VHRA 4JTNA 2Q1MA 5CFCB 4D3WA 1RUNA 1AX1A 3VHPA 1FI2A 1PK6C 2RJLA 5K0UA 4F8AA 1HLCA 4TSVA 3QCWA 4CYDA 3ZSMA 1CJPA 3WW3A 1VBE3 4S2FA 1YIFA 2P17A 2WZR2 3PHMA 4H7LA 1N47A 3RJ2X 4AEDA 4LBNA 5BV6A 4ZU4A 2D40A 2DCKA 1SLTA 2BEOA 3AMMA 4DB5A 4Q0QA 3WINE 1FAYA 2WINB 1LOEA 3LGRA 2ZHKA 3USUA 5CFCC 1J59A 4HKLA 1YYNA 4KG0A 2WA3A 2B5HA 1UKGA 1H8TB 2A6XA 4XFFA 1AX2A 3U11A 2YMZA 4YW5A 5JIAA 2XWBB 2ZJCA 3S6PA 5JPMB 2IFWA 3O12A 1BEV1 5GKAC 3SNMA 2CGOA 4QPGC 5F6LB 3B3QE 2D3PA 2WFPA 1TEIA 4WZCA 5JLVA 3VZJA 1LCLA 4M3CB 3WX5A 2A3XA 4B4PA 1Y43B 5C9AB 5CG8A 1H1MA 3EHKA 2D5FA 4E4SA 1J58A 2RS53 2UY9A 3ZXGA 1DDLA 3H3ZA 4P9YA 1QKQA 2WFF3 3KSCA 3OPZA 3UKVA 3VBHB 1QF3A 2QFEA 3I54A 1FYUA 1RINA 2XL7A 3SH5A 1NLSA 3KT1A 1UPIA 4Z82A 1VBC2 4Y26A 2XJTA 3DN7A 1U5IA 1BJQA 1EAH1 4PLMA 2JD4A 2Q5TA 4AVBA 1CESA 4QM8A 1RUJ3 5C9AC 2VECA 4N7UA 2Y38A 1PGW2 2PELA 1MS0A 2HWF3 1YI7A 3SH3A 4Q4X1 2BFUS 3IKWA 3MIFA 3UKTA 2RM23 5D1IA 4LUKA 4Q4W2 1NXD1 3OCPA 4FPEA 3ZX7A 3KLSA 2AGSA 2AYHA 4LBLA 2ARBA 4JAAA 2WLQA 2O1QA 4ZU7A 1RUH3 3QH7A 1CX4A 2IWGB 2ZKLA 2BNMA 3ST7A 2GNTA 1SQ4A 3WDXA 3ILRA 4XE9A 3K48A 1Y3TA 1DQ1A 1G9CA 3LA3A 1PM7A 3IPVA 1AF9A 2PQQA 3PVOA 5JMCA 4COVA 2ZGUA 4X8NA 2TEPA 5CAZA 1AUYA 3JQWA 1ZBA1 4GMP1 2I07B 3GBWA 1Q8OA 5LRSA 1BCXA 1ZYBA 2NMNA 1GNHA 2ZMNA 3FJSA 1OLQA 4YVSA 1CAXA 3EO6A 3JBG3 4GALA 4JV4A 2HWD3 4RQPB 4AVAA 4Y22A 3J8F3 1AZDA 3VKMA 5ABJB 4KQ7A 2K2SA 1BMV2 1MS4A 4AF9A 3WG1A 5L19A 1R1A3 4IV3A 3AZZA 2R16A 1AX0A 2ERFA 1JW6A 2XJPA 2ZS6B 3S7EA 3WD5A 1DYKA 3PTYA 4DRRA 3N4MA 3CU7A 1PGSA 2R0HA 1LHVA 3URFA 2B9UA 2WA4A 3VBUA 3WNXA 4RQPC 1JTZX 4AE2A 4XQDA 2RR13 1MQTA 5ABJC 3FLRA 3LCPA 2WNUA 4ORFA 1MZFA 2XJQA 1C8M3 1B35B 5JIUA 2Q4SA 2Q30A 3JB4C 4EROA 4FPCA 2W68A 3P3NA 2VUJA 3M3CA 4QPIA 4DS0A 4COZA 2YV8A 3CF6E 2UY8A 1RC6A 2ZGPA 2ZGOA 4XBQA 2HKXA 4RD7A 2ZAAA 2CYFA 4GWNA 4XFIA 2VOWA 1PIV3 1N3PA 4K21A 3W59A 3WHTA 4QT6A 4AW7A 1UIKA 1U5ZA 3V0AB 2RS31 3IDBB 3AK0A 3N7JA 1S0EA 4BE3A 2WS92 1B35C 1RUOA 5DZFA 3V64A 1JYIA 5T50A 5B2GB 5GJ6A 1FMD1 5JZGA 5L36A 5T5LA 4IEZA 1CR7A 3VKNA 4B3NA 4WM7A 1YFWA 4GB31 4OI4A 1FNZA 1O3TA 3MICA 5HCBA 3MLLA 2XJRA 2ZX3A 1ZNPA 3J9SA 4WVVA 4L8QA 4PLOA 4L92A 2FBEA 3ZXAC 2MHFA 4MGIE 2PHXA 4WBBA 2YUEA 3ZFFB 2OZJA 4LBQB 1Q5OA 2WZR3 3BOPA 5C4WB 2G4IA 4YM3A 3FUQA 3NVCA 1V6MA 2Y26A 3WW4A 4AEKA 5LK7B 3AKSA 3TBDA 4Q27A 1GZWB 2W0XA 4MXVA 5C8CB 1VBB2 1DF0A 2D3RA 1S0DA 1LOFC 1DGRA 2XGXA 3NV4A 1OOPA 1W0PA 4P9GA 5CNAA 1WLTA 5FTTC 1PMIA 3A0KA 1FOD1 4KU7A 5CG9A 4Y1XA 3ZFFC 5JDBA 4KGQA 4BZ4A 5C4WC 1W6PA 4PQ9A 4GA9A 4EV0A 1DGLA 4DY5A 3UL2A 1NCQA 4CTEA 2R042 4CDUB 1BXHA 3TN93 4BIOA 5C8WA 5C8CC 3ZMOA 4W6YA 4LEJA 5KXBA 2DVFA 1DG6A 2GU9A 1UN1A 3OD0A 1TMF1 5T5PA 1XU1A 3RYKA 3JCIA 2DWRA 1GANA 2VW1A 4OHZA 1CONA 2IFRA 1NA1C 2RS11 2W39A 4XEZA 3RJRA 4D7TA 4P5HA 1H1IA 4HN0A 1IQAA 1W2UA 1ZM1A 4RA0A 4CDUC 4FTSA 1AR91 4TLFA 1VBC3 2DCJA 3E6CC 2ZX1A 3OBTA 2ZGSA 5KHKA 1BKZA 3O0XA 1PZ9A 1MR5A 3RMYA 3TWIA 3IDCB 4AVCA 4QMAA 3IDEA 1UCXA 4EWDA 4HLTA 4N7IA 4Y1UA 2DVBA 4Q4W3 3VHNA 2ET7A 5EJ3A 1SFNA 4Q0UA 5FMOL 4JGZA 5L7OA 1AYM3 2JG9A 3VDDA 4M0HA 5LRRA 4Q4Y2 4WM8A 3QLQA 3TYJA 3E5QA 1LEDA 1V6OA 3KGLA 2ARXA 5F5QA 3V65A 4W6XA 4YW3A 4HVRA 3HBZA 5GLVA 4CDXA 4CZSA 2PA7A 4AI2A 1LJ7A 3T2TA 1COV1 2OA2A 5JAXA 1J1TA 2QZ2A 4H7MA 4K1ZA 1LOGA 3OBRA 1ENXA 4KBBA 1A3KA 2EIGA 5GLTA 2DU1A 2EF6A 3OGGA 3D8CA 1C1FA 1HXS2 1ASJ2 5FO8B 1VBE1 2DTWA 2WL1A 3ZN6B 3JZVA 3DPRB 4AVVA 3H8UA 3WP6A 3RPQA 2VVDA 3VBSA 2BPA2 4BPZA 4BM8A 4C1WA 3ZFGC 1DGWA 1V9U2 2QDRA 5AVAA 1LHUA 2GH2A 4QGMA 4GXLA 1OPMA 1BZWA 4HVOA 1QWRA 4N9HA 1OQDA 1PGL1 2WSUA 1FXZA 4N9IA 1VBD1 4YG0A 1XE8A 2E51A 4PDWA 4YARA 1LKNA 1ULCA 2E7TA 1Q8PA 5DUWA 4DFSA 1C5HA 3DPRC 4RR3A 2UYAA 3HMYA 1CAWA 1Q56A 4CEYB 4N53A 4BWOA 2DV9A 1DQ2A 4XZPA 1JXNA 3ZSEA 1DZRA 4KWJA 4N43B 3I4IA 2EAAA 4BQ1A 1DQ4A 5FFOC 3B7MA 4K40A 4XXAA 1R1ZA 4QD2A 2XWJB 2RS51 3QBQA 1V70A 3BALA 1FPN3 2XHKA 1PZ7A 2D7FA 5BNNB 2GN7A 3MW2A 1OD5A 2WFF1 3FFZA 4OHWA 1A6CA 4BIFA 4CEYC 5FQ0B 3CEWA 2OUJA 4ONUA 1Q8QA 1G86A 2D6MA 2D93A 1V6KA 4HBNA 3RS6A 2WNVA 2WS93 3ELNA 1IZ3A 1W6OA 2TNFA 2XKOA 4RL7A 1CAVA 2HWF1 3QD6A 3B9IA 3SCGA