1RB8G

The phix174 dna binding protein j in two different capsid environments.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
187
structure length
187
Chain Sequence
MYQNFVTKHDTAIQTSRFSVTGNVIPAAPTGNIPVINGGSITAERAVVNLYANMNVSTSSDGSFIVAMKVDTSPTDPNCVISAGVNLSFAGTSYPIVGIVRFESASEQPTSIAGSEVEHYPIEMSVGSGGVCSARDCATVDIHPRTSGNNVFVGVICSSAKWTSGRVIGTIATTQVIHEYQVLQPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The phiX174 Protein J Mediates DNA Packaging and Viral Attachment to Host Cells.
pubmed doi rcsb
source organism Enterobacteria phage phix174
molecule tags Virus/dna
molecule keywords Capsid protein
total genus 36
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02306 Phage_G Major spike protein (G protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rb8G00
3TN92 1AL21 2RS33 1AYN1 4RS5C 1AYN2 3VDDC 4YVSA 2ZAHA 1FMD2 3ZFEB 5C4WA 1MQTA 1C8M1 4RHV3 3JD72 1H8TA 1V9U3 1RUH1 5BNNA 1MQTB 4Q4V1 2WWSA 1RUH3 4FTEA 1R1A2 1VAKA 2WZR1 4PDWB 3CJIB 1K5MC 1RUJ2 4N43A 5CFDB 1EV11 1IHMA 1AYM2 4GB33 1B35A 1VBE2 3M8LA 2HWE2 2RM22 4IV1B 1QJX3 2R041 5ABJA 1OOPA 1VBC1 1B35B 2MEV1 2RMU1 2RS12 1PVC3 5FOJB 1FOD1 1RUG2 1HXS1 1AR72 2IZWA 5CFDC 5GKAC 1AR71 4AEDC 2R061 4QPGB 4N53B 4Z92B 5JZGB 1QJX1 1F8VA 1B35C 1BMV1 4CDXC 4IV1C 1VBB2 1PO12 4WM8A 1TMF2 2PLV2 5CFCB 1POV1 2XBO2 1K5MB 2RR13 2BBVA 1RUI3 5L7OA 5BNPB 1NCQC 4Q4V3 1RMU3 5C8CC 2BPA2 1TME3 1VRH3 2HWB1 3J8F2 1RHI1 4CDUA 1RVF3 3VDDB 1RHI3 5A32B 2GH8A 4SBVA 1AR73 1BEV3 4CEYC 1VBD3 1RUC2 3LOBA 2RS13 1HRV3 1RUJ1 1QJU2 2RS51 2XPJA 4Q4W2 3VBOA 4QPGA 4GMP3 5CFCC 2RS32 3VBRA 4CDWA 1C8M2 4AEDA 3JD71 4CEWC 3JBG1 1ZBA1 2R073 1PIV1 1R082 3JBG2 1D4M2 3ZFFB 5L7OB 1BBT3 5BNOC 4JGZB 1OOPC 4CEWA 1C8M3 1AL23 1PVC2 1FMD3 4RFT0 3VBUA 1RUD2 5A33A 1NCRA 2FZ1A 1VBE3 1Z7S3 5DDJ2 2RS11 3VBHC 2MEV3 5A33B 1TME1 1W39A 4GH4B 1ND2B 4GMP0 1QJU3 1RUI2 4GB31 1VBA1 5J96B 1RMU1 1BMV2 2X5IC 3VBFB 3DPRA 2X5IB 3VBFC 4GMP1 1AR82 4Q4V2 1SMVA 1RB8G 1AR81 3VBOC 4YVSC 2WFF2 3DPRB 1R081 1NCQA 2HWD3 2PLV3 2VQ0A 5CFDA 1VRH2 3DPRC 1BEV1 1QQP1 3ZFGB 1HRV1 1RUJ3 1COV3 1PO23 2RS31 4RQPC 1F2NA 1C8NA 1PGL1 1AUYA 1PGL2 1EAH2 1VB2A 1ND3B 4CDXB 1FOD2 2WS93 4CEYA 1ZBA2 1OOPB 4GH4C 3S6PA 4RHV2 1RUG3 3ZFFC 3VBHB 1RUI1 5AC93 1HRI1 4GB32 1RUF3 4RR3A 2HWF1 1R092 4Q4Y3 1VBD2 1A6CA 1TMF3 1AR62 1QJX2 1AR61 1BBT2 1R091 2ZZQA 5K0UA 1WCDJ 3HAGA 4Q4W1 4WM8B 2HWB3 5FMOS 3JB4C 4CDUC 5ACA1 1RUD1 2RR11 1R083 2PLV1 5K0UB 5BNOB 1DDLA 4FTBA 1QQP3 1AYM3 5DDJ3 4YVWA 4CDQA 1NY72 1NA1B 4WM7B 2R072 5LK7B 4Q4W3 5BNNC 1RUE1 2HWD2 2RMU3 1FPN3 5ABJB 2DF7A 4RQPB 2BUKA 4FTSA 4JGYA 1NG0A 1E57A 1ND3A 5D8AA 1X36A 1RVF2 4CDQC 1ND2A 3ZXAC 1RUC1 1R1A1 1EV12 4BCUA 1BEV2 4JGYC 3ZFEA 4IV3B 4RR3B 1QJY3 1AR91 2HWE1 1H8TB 2RM21 2WLPA 2TBVA 2FZ2A 3VBFA 1COV2 1PO22 1PIV3 3TN93 5BNNB 1TME2 1EAH3 2BFUL 4QPGC 3TN91 1HXS2 4LLFA 5BNPC 5CFCA 4AEDB 1D4M1 1VBA2 4N43C 1K5MA 1QJZA 2WFF3 1VBD1 5C9AC 1MEC3 1HRI3 1RUH2 2HWC1 1TMF1 1HXS3 1GFF2 1VBB1 1POV0 5JZGC 4N53C 5C8CA 2WZR2 5C4WC 5AC92 1RVF1 1CJDA 2WS92 5C4WB 1AYM1 1ASJ1 2HWC3 1ND3C 1V9U2 4NWVA 1RHI2 4Q4Y2 2R042 1HQNA 2MEV2 3ZFGC 3ZFEC 5ACA3 4N43B 2WFF1 3CJIC 3JD73 4PDWC 2R062 3ZFFA 3JBG3 1QQP2 3ZFGA 1M06G 2ZTNA 1OPOA 5ACA2 2HWC2 1FOD3 1H8TC 1PO11 1AR93 1PO13 4JGYB 1ZBE1 1PIV2 5C8CB 1NOVA 1RUF1 4NWWA 4WM7C 1ND2C 3J8F3 1QJY2 2BFUS 3JB8A 1RUE2 2HWD1 4N53A 1NCRC 1VBB3 1PVC1 1RUD3 1BBT1 1EV13 4EJRA 3FBMA 3VBHA 3VBRB 4CDWB 1MEC1 1X33A 1ZBA3 4RS5A 5DDJ1 1CD3G 5AC91 4JGZC 4YVWB 4Y4YA 2GSYA 5BNPA 1PGW1 1Z7S2 1OHFA 4PDWA 2WS91 5BNOA 3VBSA 1ASJ2 4CEWB 4CDUB 2Y26A 5C9AA 3VBUB 1NA1A 2R063 1AL0G 1RMU2 4QPIA 4WM8C 3VBRC 4CDWC 4FSJA 2HWF3 4Q4Y1 2RMU2 5C9AB 1RUG1 4CDXA 1FPN2 1NCRB 1R1A3 1AL22 1VRH1 1VBA3 4RQPA 4CEYB 4IV3A 3NAPA 1FMD1 1D4M3 5D8AB 4YVSB 3VBOB 1MQTC 4Q4X3 1HX6A 2X5IA 1RUE3 1EAH1 1COV1 1PO21 4RR3C 2WZR3 2XBO1 1ZBE2 4RS5B 5D8AC 2RS53 3CJIA 1PGW2 4CDQB 1NCQB 1HRI2 4Q4X2 1QJY1 2HWE3 2RM23 4RHV1 4Q4X1 5FMOL 2HWB2 1V9U1 5A32A 1VBC2 5ABJC 4IV1A 1AR63 1R093 4QPIB 3VBSC 1RUC3 1FPN1 1VB4A 3VDDA 1AYN3 1NA1C 4GH4A 1ZBE3 2R071 1NY71 5JZGA 2R043 3NAPB 5K0UC 1VBE1 1HRV2 5J98B 2XBO3 3VBUC 1AR83 3NAPC 4JGZA 5L7OC 1RUF2 4WM7A 4YVWC 3VBSB 2HWF2 3J8F1 1QJU1 2RS52 1AR92 4QPIC 3IDEA 1POV3 1MEC2 1ASJ3 2QQPA 2RR12 4Y5Z0 4IV3C 1VBC3 1Z7S1
chains in the Genus database with same CATH superfamily
4JKKA 3TN92 5LRRA 3ZM8A 2PHWA 5EWSA 5FQ0A 1F5JA 3RZGA 4AK3A 2RDSA 3AMNA 5CG9A 2VXRA 4BQWA 1EYBA 4M4RA 3RZLA 1FMD2 3GZEA 5SV5A 5C4WA 3ZFEB 1C8M1 1IQAA 3IDBB 5GLZA 3ZYIB 2VW1A 3T0AA 4HKLA 1LKNA 2QFEA 1MQTB 4WBBA 4XJUA 1MZEA 2JDPA 1YEWA 2WWSA 4ZONA 3TYJA 1FX5A 4IEVA 3HQXA 4QKDA 4NRQA 2Q1FA 1S2BA 4QWNA 4A2UA 2DBIA 3I3DA 1OKOA 1ZRIA 3S30A 5J7MA 5CFDB 4Y5TA 5JI9A 1EV11 2YUEA 4YNIA 2XJVA 4XZPA 1PHMA 1I1EA 2VE1A 4L11A 4TTGA 1DQ6A 1IHMA 1AYM2 4GB33 2ID4A 1YQ5A 1HIXA 2W94A 4NJ4A 4IV1B 4XXPA 2B9VA 5ABJA 4XILA 3AP9A 1JZ2A 1ZRDA 1PK6A 3WSOA 1BVP1 3H7YA 3H0OA 1X7NA 1Z78A 4ZZ8A 5IT6A 1PK6B 4Q8KA 4NO4A 1AR72 4OI4A 2IZWA 4D0QA 2QDRA 5GKAC 4FXKB 2D98A 5JXHA 5A1LA 4FQZA 4GWIA 4QPGB 4BYYA 4UW4A 1SFPA 2VMIA 3M3OA 2ARBA 3Q8BA 1CJPA 4HVOA 4IV1C 3WP3A 1US3A 1PO12 1TMF2 4H7MA 4LBNA 2PLV2 4Y1UA 2Q1ZB 3K4AA 5DG1A 1POV1 3PU3A 2E33A 4P5YA 3RVHA 3VKOA 5EV7A 5AVPA 1C4RA 3B9IA 2RR13 5FYZA 4EE2A 2BBVA 5FO8B 3ON7A 1XNTA 1NYWA 3ZSLA 4EN8B 5HBAA 1FI2A 3K48A 2GU9A 1FV2A 1MZFA 2PHRA 4KL1A 2Z69A 4LO6B 3ZXLA 4AFCA 3E6DA 2ZHKA 2IUWA 1DQ1A 4OULA 1DQ2A 2GC1A 4KWJA 5FKBA 3N9PA 1LJ7A 1QJEA 1SCRA 1WMDA 4Y1XA 4AQSA 2OVUA 1RVF3 1HJFA 1RHI3 2CSGA 4A41A 1HQWA 5FXWA 3CZJA 5FP7A 3DECA 3PU8A 4BZ4A 4WZFA 1JZ7A 3JU9A 3CU7A 4HFSA 1RUC2 3DYOA 2G9ZA 1S0EA 3NV3A 3AMPA 3LOBA 1RUJ1 2L9LA 5ISLA 4JRAA 4B7EA 3HJRA 4XUQA 4YPJA 3UKTA 4IE7A 4QPGA 5CFCC 4IE4A 3AFKA 3MLKA 1U12A 2ZGQA 3U75A 5LCWL 4CXYA 3ZPYA 2HLEA 1G86A 2PMWB 3LSDA 4PIZA 2YBPA 4FAGA 2WQ4A 4NAOA 4KMQA 1V6OA 3SISA 5C33A 3H8OA 2VBDA 3I2GA 4ARXA 3V0AB 1ULOA 2AC1A 5KHJA 2NM1A 4C91A 1D4M2 3O12A 1WMXA 4CA9A 3UGHA 2WZ8A 1BBT3 1YJKA 1X8EA 3J4UH 4MGZE 4V2WA 4CEWA 1RUNA 3ME2A 3LIHA 4Y1VA 3I3QA 3POYA 1XPWA 3ETPA 1FYUA 1V6IA 2W92A 3KV6A 4QPYA 2P4EA 4QQOA 2D43A 3P1IA 2ARAA 3ORJA 5A33A 1NCRA 1F4AA 1VBE3 4LXLA 4LBJA 3PHMA 3AVRA 4UF0B 5L9BA 1OH3A 3GCXA 1OF4A 4KI5M 3EYPA 1GWMA 1QXPA 4W6XA 3UESA 3WDTA 3OOXA 4YSFA 5A33B 1AJKA 4JHTA 1H4HA 1H1IA 3F95A 3Q8FA 1W6QB 4NIAA 4NOTA 1CZTA 3D6EA 3I59B 4GB31 1HJGA 4NPLA 3WF2A 1GWKA 2OXBA 1PZ8A 3CMGA 5CBLA 4AOCA 2D6KA 2UWBA 4N9IA 2DCTA 2ZX1A 3V56A 1QU0A 2V09A 3PDQA 2X5IB 3VBFC 2YC0A 4XFGA 1AR82 4Q4V2 2QDNA 4QX0A 1RB8G 3WF1A 2W91A 4MGSA 1NCQA 2EXHA 4AEMA 1VRH2 4XAAA 1OI6A 1JU3A 1N1VA 2J1VA 2A70A 4LBQB 3MUY1 5A1FA 3AK0A 1Q5OA 1L7QA 4LE4A 5F7UA 3ZFGB 4OHVA 5IJRA 3C7GA 1SPPA 2OW4A 3AXEA 4R52A 1PGL1 4Y26A 2F4PA 3AKQA 1EAH2 1VB2A 1ND3B 2DCZA 2VC9A 3BALA 2TUNA 2VUCA 3CJXA 3BU0A 2QTWB 3I2KA 4HVQA 5FZ3A 4GH4C 3ATGA 2VBBA 1JI6A 4DO0A 3K46A 2HEYF 3OGJA 1SQ4A 4Q29A 3DUIA 4XETA 5FBZA 4JRLA 1QWRA 3VDCA 1OA4A 3LFMA 4RR3A 2HWF1 1VBD2 5FPVA 1QJX2 2DVGA 5K0UA 4I0WB 1WCDJ 5FZLA 2DTWA 1EPZA 4ARYA 2HWB3 1S0JA 4W50A 2QKDA 5FMOS 5FXVA 3MV01 1RUD1 3KV9A 1WCKA 4CTEA 3MIHA 2BGOA 2AH2A 1QDOA 3HN3A 1XNBA 5BNOB 5FP3A 5I8TA 1A8DA 3ACGA 4QKBA 4IL7A 2YV8A 1UX7A 1NA1B 2K0GA 4M4PA 4JKMA 4DNYA 3QBQA 4ZU5A 3KLSA 2A3XA 2WLQA 5FZBA 3RYPA 3A0NA 4RGAA 1Y4WA 3NL1A 2LUWA 2HWD2 1SDWA 2YC4A 2XVLA 3I7DA 4M00A 4QX2A 2QVSB 2QNKA 1QDCA 2HBTA 4ASMB 3F2ZA 3NVCA 3RI8A 4HN1A 3SEEA 2ZGOA 2BUKA 5DABA 5IVCA 1NG0A 3IDCB 2JG9C 2RJKA 2UWCA 4PF5A 1ALYA 1RITA 1WGPA 1ND2A 2A1XA 4QX8A 1SLTA 3ZXAC 2W0XA 4IEZA 2C9KA 4BCUA 1K12A 4HONA 4ZY9A 1BEV2 1VMFA 1W8HA 2LROA 3OYWB 4JGYC 4W4ZA 3SCGA 4DQAA 4YZ1A 1SLAA 4JKLA 5FYTA 4OZOA 2YU1A 2NPIA 2V5YA 2WLPA 3MIGA 3AMMA 2IXJA 1QH6A 3MICA 1V6JA 3MUZ1 1RXFA 3GGLA 2ZGLA 5D21A 5FPZA 4BK5A 4QXBA 1EAH3 3OPZA 4RSUA 1HXS2 3CF6E 1MVQA 5BNPC 4AEDB 1YIPA 3M7AA 3E1F1 1DQ5A 1G9AA 1VBA2 3UV9A 1K5MA 3Q8EA 1QJZA 2PHXA 2VMFA 1UYPA 4XFAA 5APAA 1MS1A 2HH9A 3E5XA 4R4XA 3KV4A 4YZ5A 1MEC3 1UU4A 5C9AC 2R1BA 2PYTA 1IS3A 2FMYA 3T2PA 5F37A 1XBFA 4XQWA 2WYFA 3QOPA 1JYCA 1YQ6A 3FWEA 5JZGC 5J3UA 3RSJA 2XOMA 4FOVA 3POIA 3IZOA 2WZR2 1RJ8A 1ACCA 5KHHA 1HV0A 1BKZA 3TNPB 2HBUA 1KITA 3LEKA 3NNFA 3HBKA 3K77A 4YW7A 4DIQA 3O1MA 2EALA 2NLRA 4XTPA 1AYM1 3T30A 4CXWA 1SZBA 2B45X 4S2GA 3Q8AA 4DRRA 4XDPA 5FYBA 2HYXA 5LA1A 2QJVA 2JWPA 1VPHA 1LOEA 2GP3A 3DKWA 3ETQA 4E2QA 1ZRRA 4CP9B 5ANQA 3H8XA 5L19A 4AVAA 3S0MA 2W39A 3OGSA 4IW3A 2BWCA 1ENSA 5DUWA 4HPKA 3JD73 5A80A 4DUVA 5JUVA 1UMHA 2BVVA 3ZFFA 2NP0A 1QQP2 4FPLA 1PZ7A 4AL9A 5F39A 5IVEA 3MPPG 4JV4A 2WAAA 2Q8EA 2IWGB 2ZTNA 4HANA 4DUWA 4U2AA 5ACA2 2HWC2 1DP0A 3I2DA 3MYXA 4E4HA 3B94A 2RG4A 2VVDA 2QZ2A 3HNMA 4BXFA 4I2OA 2EXIA 4QX5A 5C8CB 3DKQA 1KS4A 3LSEA 4L99A 4NWWA 1H9WA 2WWUA 3CO2A 3VD4A 3GALA 1QJY2 4G9SB 4IQPA 3I8TA 4AI2A 1UMIA 1CAUA 2BFUS 1RUE2 4FPJA 5F2WA 4ZXEA 5CKMA 1CAXA 3NSTA 4FBFA 3W5MA 2OZJA 1RUD3 1BBT1 2VUJA 4CZSA 4CCOA 3FBMA 4LR4A 3VBRB 1KS5A 4FPCA 4LPLA 1CPMA 3DYMA 1UWWA 1S0GA 3MFAA 3NQHA 5FTTC 1Q43A 2FCTA 3ZXDA 5FZEA 3SHRA 2FCUA 3T09A 2ZEYA 5AC91 4DB5A 4TLFA 3PJQA 5IFTA 2XJTA 5DG2A 5BNPA 3A23A 4ISQA 4PDWA 3CQOA 3KT4A 5AVAA 3EJKA 2WS91 5J48A 5FJKA 4NPRA 3ZYHA 3VBSA 2VVEA 4CEWB 4CDUB 1ZRFA 2OX0A 4K8RB 5IAVA 1WMFA 1GSLA 3VBUB 5C9AA 1W6OB 3V0BA 1AL0G 4BLJA 1IG3A 4P9GA 4P9JA 2MPFA 2VTFA 4B3NA 5C9AB 3GHMA 1O8PA 4ATFA 1X8MA 1NCRB 2WNOA 3K3OA 1CPNA 3MFCA 1AL22 3KD4A 2DFCA 3OUHA 2VBPA 4RQPA 3NJVA 5E1RA 4CEYB 4AVCA 3OGVA 4DXZA 2VJXA 4XACA 2XQXA 3AP5A 4HKOA 2ZGNA 4COYA 4Z1VA 1CAUB 4W8JA 4LHKA 5D2AA 1GP4A 2Y0IA 3GF6A 4CU7A 4H55A 5GLVA 2BW8A 1FXZA 1RUE3 1V6NA 1V6LA 1GNHA 2ZKNA 4XBLA 1DQ0A 1ZBE2 4XUNA 3SH4A 1TE1B 2DCKA 2MNGA 4IERA 3OB8A 2H6CA 2JG8B 2D6NA 4GJYA 3CJIA 3ES4A 1DGWA 2BGCA 2V72A 5FCCA 5TSWA 4OUEA 4XZUG 1HRI2 1H1AA 3H3UA 3FUQA 4Q4X1 2WBKA 4CVUA 5FPUA 3LE0A 4KU8A 2VW2A 2VZ3A 2OZ6A 1V9U1 3PL0A 3ZKUA 3FN9A 4IEYA 3L2YA 1VBC2 1Y9QA 1QEXA 3VD3A 3C3VA 3N35A 4QB1A 4FOYA 2CL2A 4PQQA 4DEVA 4LIVA 3FHAA 1CVNA 1FPN1 2QQWA 3RMYA 3VDDA 4A6OA 4NIIA 4FFIA 4UW6A 1NA1C 2B39A 3CL1A 2OKXA 4GH4A 4XE9A 4I0BA 1YLLA 4XBNA 1NY71 1RL3A 2BNNA 3HOBA 3AKPA 2Y60A 3EHKA 3LOIA 2VECA 3WNOA 1W8WA 5FY7A 3FZ3A 2ILMA 3WCSA 5JAXA 5LEJA 3VBUC 2O8OA 1WD3A 5EPAA 1OURA 1OFNA 5CYYA 2ZGRA 4DXTA 4M0NA 5LZ6A 2JDMA 3INAA 3J9SA 2VW0A 5E6HA 2JECA 2WO3A 4V2VA 1OVPA 3KZ4C 5L7OC 2D97A 4UT5A 2QQNA 4ASKA 3EB7A 4NHLA 3K51A 1ZZ6A 1X9PA 2FCVA 3ILNA 3KV5A 5E8AA 5JIAA 2X8KA 4F8AA 1RJ7A 1W0NA 1J3QA 3J8F1 4QPIC 2HKXA 2SBAA 3IDEA 1POV3 3SCFA 3KB5A 1MEC2 4OQ8A 2DVAA 4OFGA 4BDVB 2I45A 1V6KA 2NMNA 4PLOA 1NUKA 4FPOB 4B1MA 4Y5Z0 4BOWA 2O1QA 4IV3C 1VAMA 2GNMA 3FHQA 4Y1YA 1VBC3 5FZ0A 3R05A 2ZX2A 3B01A 3WOGA 1Z7S1 4QMAA 2VAUA 2XLFA 2D5HA 3FLTA 4G3YC 1AL21 2RS33 3LFIA 4XHXA 3AX4A 4RS5C 1SCSA 3SCHA 5JDBA 2GMMA 4KWLA 5IFPA 1SACA 1UXXX 1XRUA 5JXGA 5FQ0B 3N3HA 4LK7A 1ZZ9A 2ET7A 2ZEZA 3OCPA 4RHV3 1WW6A 5ERLA 4OI1A 1NKGA 2G19A 4CP2A 4IEQA 1RUH1 4XXAA 5IWFA 3MLJA 1AXZA 4XOGA 3VB9A 3B02A 2W1UA 5FP9A 1AJOA 1M4WA 5F1RA 5A6ZA 4TYSA 1UD1A 1W90A 3WUDA 3WDUA 4FPEA 3KSCA 1RUJ2 2JXAA 5FYCA 4OUMA 5FZKA 4NIGA 3R4SA 1AZDA 4GKYA 3G6JB 3KVBA 4YYOA 2EIDA 3SNMA 3M8LA 5C5UA 2LTNA 3USUA 2R041 3N9LA 1VBC1 3WCRA 3E5UA 4JDNA 4YM0A 1GNZA 1UY4A 2JJ6A 1PVC3 2RMU1 2RS12 3A4UA 3MW2A 4QU1A 3X29B 5CISA 4XF3A 1RUG2 4YG0A 1HXS1 1NT0A 4CE8A 4GULA 2OT7A 1OH4A 2B8MA 2D6MA 5GZGA 5KC6A 1XNKA 5CFDC 4MYEA 1GOFA 4B8EA 2VTXJ 2WSUA 1BYHA 2VL4A 3MDPA 1PGSA 2R061 1HDKA 2ZGMA 3MIBA 3OPTA 4Y22B 5JVVA 1QJX1 4E2SA 5BY5A 1B35C 2ZACA 4CDXC 5I0RA 3RJ2X 5JZGB 1W28A 1BMV1 2XKOA 3O7OA 2NN8A 3FFQA 5E16A 4DEQA 4QKNA 4WM8A 4ZKTB 3P3NA 2V5DA 4IE6A 4EN0A 5CFCB 2ZX0A 1UX6A 4YZ4A 4CUAA 5FYYA 3ACFA 2YU2A 2XBO2 4NIHA 4CPBA 5I91A 5FFOC 4D8MA 1RUI3 3B3QE 4FFGA 2EIGA 5LRSA 3ZDSA 5EP9A 5BNPB 1P8JA 2Q8DA 2GNDA 2BPA2 3H50A 2EAAA 2YYOA 5HXMA 1VRH3 3FMGA 3BPSA 3EXUA 5FBJA 4YW4A 3LB9A 5K4LA 4IGQA 1OUSA 3ZOIA 1W3VA 1LOBA 1PM4A 2ZGSA 4M3CF 4LHLA 3H7JA 1WBLA 3WP6A 5I8YA 4C0BA 3AL5A 3O0XA 1LOCA 3B00A 4OCTA 2DWRA 1K5JA 4HKWA 1O91A 1C5HA 4LJHA 2CGPA 3U4XA 3WVJA 1N1SA 2CGOA 1PMHX 3OBZA 2H0BA 1D2SA 4LUKA 4PIYA 2YFUA 4Q4W2 4GMP3 3KCCA 3UYJA 1IS6A 3VBOA 2JIGA 2KM2A 2VO5A 4CDWA 2R1DA 1JYIA 1LU1A 4FPKA 5HCHA 4S2HA 4AR2A 4BIOA 3PVBB 2QQIA 1CR7A 1DIWA 4GAZA 4XF1A 2WNUC 2VM9A 5G04L 1LHNA 2VTXA 4EWDA 2R073 5J09A 3BODA 2BNOA 2JDAA 3BPZA 3JBG2 4JAAA 4KG0A 3ZFFB 4LITA 5JI7A 4FOWA 4JZRA 4BU2A 1OOPC 3NWKA 5BNOC 2E7QA 1C8M3 1OF3A 3W9AA 2ZGUA 3RYKA 4ZU4A 3AYDA 1H30A 3MF6A 2DBNA 3CLPA 3T2TA 4E9KA 1GR3A 1H2LA 4KH9A 1RUD2 3HPNA 3WW4A 2QQUA 1JMUB 1RC6A 5A3MA 1UY2A 1S0BA 5DDJ2 4JC1A 3RGBA 2MEV3 1TME1 1JZ4A 1IPJA 1ZA7A 4GH4B 1ND2B 3ST7A 3RPQA 1J58A 5DZGA 1JXNA 2XUMA 1PVXA 3PVOA 4CCJA 4CU8A 5C5TA 1S0CA 1O59A 3THCA 3ZN4A 4CP9A 3PURA 1RMU1 1CIYA 3O0VA 5T5PA 5GLTA 4K20A 3U07A 5F9TA 2XHNA 3KS7A 4DY5A 1AXKA 3C2UA 4NHMA 4I30A 5IATA 3VZLA 4JQRA 1BXHA 4W6YA 3APBA 3G7DA 4X6QB 4YARA 5KXDA 4UOJA 4GMP1 1MZ6A 1SMVA 1CONA 4YVSC 3WR0A 1LULA 4JTNA 3JQWA 1RTVA 2VQ0A 1PX4A 5DAQA 4AG4A 5CFDA 3QD6A 4HOOA 3IKWA 3KGZA 1BEV1 2Y34A 1S55A 2ZHNA 3M3EA 5KHIA 2ZS6B 2VVFA 5F5CA 2O0OA 4K3UA 3AP4A 4OI2A 4RQPC 4XFBA 3HVDA 1F2NA 2Y6LA 4A3ZA 3HQUA 4XTMA 1GICA 3IWZA 2I74A 1UU5A 1LGCA 3HD8B 5LK5A 5JMOA 2P2KA 3K2OA 4CDXB 5FZ7A 3T2QA 1FOD2 3U14A 4NIDA 1W0OA 2VUAA 2W68A 3S7IA 3I97A 1REFA 4XURA 3N7KA 5JXIA 1XNDA 1DZQA 1NLRA 1RUI1 1JBCA 1HRI1 2VOVA 2Q1MA 2WNVB 4GKXA 5T50A 2IC1A 3L2HA 1RUF3 5B4XA 1A6CA 1TMF3 2X29A 3EQEA 2OUJA 1PNFA 2JICA 3T08A 3ASIA 3TEZA 3B69A 2WKKA 1W9FA 1RIRA 3HAGA 4Q4W1 1IG0A 3I4IA 4XW3A 2P17A 2W9XA 3ZSEA 3I2OA 2RR11 2PLV1 5K0UB 3KT1A 5F3IA 2UURA 1W03A 2RDNA 2E63A 5IAXA 2BOJA 3K75B 4FTBA 1AYM3 1UQXA 3GXUA 3HMYA 1H0BA 1GOHA 3GM8A 5DDJ3 1O5LA 1LGBA 5JIUA 1TQ5A 1LODA 1A78A 3IPVA 1GOGA 5FRAA 1FNZA 1JUIA 4HG6B 5BNNC 4QX3A 2ZAAA 2Z5WA 3A0KA 3QCWA 4GWMA 2RHPA 2DF7A 2IXLA 3AC0A 3DL3A 3EMRA 4YM1A 4RQPB 5JOZA 3TWIA 2RDQA 3BB6A 1L3JA 2EXKA 1GQHA 4JGYA 3FUOA 3AKTA 4LNVA 4RD7A 2W3JA 1RVF2 2UWAA 2WWJA 3A22A 4LHSA 5DAVA 1KEXA 3TOJA 3VZJA 4V1PA 1R1A1 4MADA 1EV12 1QOSA 4KNCA 4A4AA 5LWBA 5F32A 4P00B 1T6GC 4Y5SA 3UKVA 1CAXB 1DGLA 4IV3B 1CESA 3ZXJA 5A7QA 2A73B 1H8TB 1VAVA 2TBVA 5FK7A 1JW6A 1REEA 1J1TA 4XJ9A 1W9YA 3VZMA 1PO22 3JUUA 3WG1A 1T6BX 5CB7A 3VZKA 3RG0A 3RDIA 1H6YA 1MZ5A 1WA6X 1Z0HA 3KVAA 3TN93 1TME2 1TZOA 2P3JA 2BFUL 3UNPA 5IVBA 4LKFA 2OQ7A 1XE8A 4LLFA 4O7XA 4D7SA 3P3PA 1D4M1 3MIFA 1BHGA 2YBSA 1PNGA 3LPFA 4B4QA 5FYUA 1KJLA 1VBD1 3IPVB 4QHOA 5E88A 4C1WA 1J59A 4LMFA 4RN5A 1ZX5A 3MLLA 5L9RA 3ZN6A 1VRBA 4H7LA 4QQPA 1HXS3 1VBB1 2VCBA 4UAPA 4S2DA 1POV0 4OQ9A 1D2QA 4F83A 4HXCA 2GN7A 5C8CA 4CU6A 1F35A 1OUXA 4GIQA 4JTOA 5LBCA 4YW3A 2OS2A 1QH7A 5DAPA 1RVF1 1K45A 1N3QA 5CAZA 2Q5TA 2WO2A 2J1RA 1UCXA 2EVXA 4UFIA 5C4WB 4HSJA 4XHBA 1V00A 5C3QA 5FKCA 1MS3A 1ASJ1 2PN5A 3KQ4B 4AEKA 1D7PM 3KM5A 3PUHA 3DF0A 2ARXA 2UY8A 5E89A 1CZSA 1HQNA 1VLNA 4FPHA 4OYUA 2CAUA 5LA9A 1OKQA 1W6NA 2R7EB 1EY2A 1HB1A 4N43B 2UYAA 5DUXA 2WFF1 1J3RA 2XLGA 1DBNA 4XUOA 5JLVA 2R062 3OGGA 5IVYA 2Y38A 1L7LA 1S1AA 3NNJA 3QLQA 3BTAA 2GAUA 1XXNA 1Y9MA 2CV6A 4QXHA 5LBFA 1OPOA 2VZQA 1W6PA 2Z42A 4P02B 1XU2A 3N9OA 2EIBA 3H1YA 1GANA 3KWVA 3USUB 2JDYA 3FE5A 5FXXA 1KXGA 1OD5A 4AI8A 1A34A 2ZA9A 4X8PA 4BE3A 3BIEA 4CU9A 2XWBB 2ORZA 4I02A 1NOVA 1RUF1 4P9IA 4WM7C 3KHBA 2WAOA 5F2SA 3QH7A 1NAEA 4MG2A 1EUUA 3OF1A 2P34A 4MGKE 2ZXQA 1APNA 4N53A 3AZYA 3HNYM 1NCRC 4BISA 3ECQA 1VBB3 4TXWA 4AHXA 1LOAA 1PVC1 2G9GA 1X50A 1EV13 4M3CB 4YLZA 4DXSA 3AMHA 3U4SA 3VBHA 4EZHA 2Q0AA 4UFLA 3BKZA 2J42A 2ZMNA 2DTYA 4JX0A 1JZ3A 5A3WA 4E4ZA 2AYHA 2J1EA 1J3PA 3DCQA 4WV8A 2WO7A 1UY3A 1KDKA 2RJLA 2HEWF 3NJXA 1C1LA 4JGZC 3ALQA 3AVSA 2DCJA 1OMIA 2GSYA 4Z2AA 3WDYA 2DFBA 1OA2A 3R4UA 2WABA 4JQTA 5A7PA 4B4RA 2B46X 5JMCA 4IETA 2PAMA 1GQGA 4K6BA 4CP0A 1W2UA 1IOAA 2ZABA 1O5UA 1PMIA 2Y26A 4NRPA 3GCWA 4YGCA 1H8VA 3V65A 1GUIA 4WM8C 4FSJA 3VBRC 4Q4Y1 1Q8SA 4BIFA 2RMU2 2WIIB 1YQCA 2P1BA 3LGRA 4XCBA 2B42B 2E7AA 1RUG1 1ZVFA 4QXKA 4OLLA 4CDXA 2XDVA 5IYYA 4QU2A 1CX1A 1R1A3 4QB6A 4ZXKA 5FPLA 1ULDA 1VRH1 3WNKA 2YGMA 3WG2A 3D0JA 1YRZA 3ZR6A 1C5IA 2I07B 1I5ZA 2WQ8A 4AVTA 5IK5A 2I2SA 1FMD1 5D8AB 3WZ1A 3R6SA 4FFFA 3VBOB 5IHRA 2UU8A 3I2HA 4LIUA 1DGRN 3IMMA 5GALA 3WQ0A 5LY2A 2WO1A 2WN3A 2Y6FA 4FP3A 1UMZA 2A6VA 2R32A 1EAH1 1COV1 4RR3C 5SV8A 2VQTA 1XNAA 4HK9A 1UOFA 4UBGA 1CIWA 4RS5B 4RGGA 3LA7A 5FWEA 3FL7A 5D8AC 3VHPA 5A6YA 3LD8A 4LE3A 2XMLA 1UKGA 1PGW2 3Q8CA 4CDQB 1NCQB 2AUYA 2HEVF 4META 3IM0A 2VNOA 1DYOA 4Q4X2 1QJY1 5IUQA 3VDBA 3ILFA 1SBFA 2XJPA 3KQRA 4AW7A 2OA2A 4KG8A 1V70A 1JZ5A 1CAVB 3PLQA 1MR5A 3AL6A 3IIAA 1WD4A 2EICA 4IV1A 2DVFA 2PFWA 5ABJC 3D8CA 4Q0QA 4AQ2A 2JDHA 4ATEA 4X8NA 3ZO0B 2WC2A 4QDSA 4QPIB 3S57A 4HT1T 1OFSA 2GN3A 1VB4A 2VZPA 1ULEA 1AYN3 1DLLA 1G9BA 4BQ5A 1UZVA 2CU5A 4XMAA 1S2KA 3OBRA 2PQQA 1ZBE3 3HBZA 4Y33A 1VIWB 3CKHA 3OPWA 2R071 1UYYA 5HI0A 5GJ6A 4QGNA 2C9AA 5JZGA 2R043 3PIGA 5FZFA 4D3WA 2VMGA 1JN2P 1VBE1 1GYKA 1W0PA 2Q4SA 3LDBA 4QM8A 5J98B 2YDEA 5FZIA 3POFA 1AR83 1DZTA 1S0FA 1XYNA 1ZZ8A 1YI7A 2GNBA 3IT8A 2E7TA 5DZEA 4D6QA 5IVJA 5K7PA 5F3EA 3B93A 2FHRA 1YWKA 2JDUA 2Q30A 1DU3D 1TVGA 1RUF2 2YG0A 4E27A 1LEDA 2FDGA 1IKPA 4Q26A 4WM7A 4OHYA 1QNYA 4YVWC 3POJA 3LDRA 5A7WB 4R9BA 4XDQA 3PUAA 2AACA 3SH5A 4XYXA 3IAQA 5I0TA 1WCQA 3T1MA 2Y6KA 3W21A 1MS9A 2PELA 3ZN6B 3ZSMA 3BUCA 4FT8A 1ZZCA 1US2A 3NJYA 5H9QA 1WLCA 2RR12 3VL9A 5C3RA 2ZOEB 4NRMA 1UIKA 1Q8PA 2BBAA 2YB7A 4C90A 4YW1A 1OLQA 1QMJA 1ZRCA 1JOJA 2DDUA 4QXCA 2ZCWA 3MV11 2FD8A 2KD7A 3AZZA 2JE8A 5FAXA 3ZYFA 4AVVA 1AYN1 1Q8OA 2VCAA 2JG9B 1QOTA 3O1SA 1UL9A 4R4ZA 4YVSA 2ZAHA 3I59A 3VDDC 2NYYA 4N8MA 3J7MA 2F6BA 2HYKA 1KDMA 3THTA 4P5HA 4R9CA 1H2KA 3D82A 3HT1A 2B9UA 3NKGA 4PJYA 1H8TA 3URFA 2ZHMA 4YFWA 5EIYB 5A6QA 5BNNA 5K8SA 4MV2A 4E8CA 1XU1A 3TEWA 3OJBA 4LBLA 3IMNA 1OD3A 1R1A2 2WZR1 2XHKA 4COWA 3KHCA 3IBMA 3BOPA 5FPXA 1KJRA 1NLQA 5F5QA 2BZDA 1K5MC 1WBFA 3GZAA 5A7OA 4HPKB 1DQ4A 1LHWA 3H8RA 4A44A 1HV1A 3WHUA 2W1SA 2VNRA 3I2IA 2NZ9A 1W9WA 4MOAA 4Z2WA 2D3PA 1B35A 1SG3A 1YJLA 2VG9A 2ZEWA 2HWE2 2RM22 5F5IA 5FY1A 3SXWA 4YW2A 3VHRA 1V6MA 1RGSA 3ZLIA 5C3SA 4LO8A 4Q2FA 4XDOA 5FOJB 1FOD1 3M1HA 2BOIA 2A3WA 3U37A 5KR7A 3LEMA 1SDDB 2VR4A 4O65A 1EPWA 4DINB 3PUIA 4UFKA 1DGRA 4LOSA 4OVEA 4HVRA 3AYEA 5FWJA 1ZREA 3WD5A 3U0ZA 5EHDA 4N53B 5I0SA 1DG6A 1F8VA 1WLWA 1W6MB 2AEZA 3TB0A 1W8NA 4IEXA 5FK8A 4A7KA 2BTVC 1VBB2 4R9DA 3WQ1A 2VZOA 3KCXA 3O5SA 3TNQA 4P14A 5LA0A 3ZXGA 1KFUL 1ULGA 2J1TA 1U0AA 3E97A 3POSA 4I09A 3WX5A 1K5MB 2ZMKA 4DFSA 4JCKA 4UW3A 1OQEA 2Y6GA 5JR2A 5GZEA 1NCQC 1RMU3 2WQZC 2C1FA 5C8CC 1W9SA 4UBHA 1TME3 4LBQD 3TEXA 5IW0A 3ZMNA 4Z82A 1I6XA 1ST8A 4CCMA 4LBKA 1YQ8A 4QM9A 2Z79A 4NN0A 5ANNA 1F31A 2R30A 4AHWA 1RHI1 5BYNA 3N4MA 4XUPA 1W6PB 4XABA 5LB6A 1SLCA 4CRQA 3VDDB 3H9AA 4DZGA 3MI8A 4QGLA 1GZWA 2GH8A 3ZYJB 3LA2A 3VD5A 1AR73 1LNSA 3AP6A 4HZFA 1VBD3 2ENRA 1GWLA 1WMEA 1JHJA 1T2XA 2PAKA 3WP5A 4I3PA 2WRAA 3MW3A 4Z07A 1QJU2 2RS51 2XPJA 2ZMLA 2WZPP 3VZOA 1FATA 4P9XA 2RS32 4LLOA 1QJFA 3ELNA 3PJYA 2CDPA 1AX1A 1C8M2 3A7QA 4EWAA 4AEDA 4LORA 4EQVA 3RRDA 4AQTA 4LA2A 2Z4FA 4Q1RA 4RFRB 1W6NB 3JBG1 1H9PA 1ZBA1 3DXTA 1PIV1 5DQ0A 1AXYA 3IDAA 1RINA 1C1FA 4JGZB 2WNUA 2VCMA 4YGDA 5FUIA 2QQMA 5L73A 4BQ1A 1AL23 1ULPA 2W46A 4AI3A 1PVC2 3W58A 1FMD3 2Y6JA 4L2NA 2W5FA 3VBUA 3V0BB 3VHNA 1WKYA 4YM3A 1DZRA 2ZX3A 4Z8BA 1Z7S3 4FI9A 4XC9A 5M0TA 1ZA4A 1JYTA 4CCLA 1YFYA 1LCLA 3VBHC 1XOYA 4OMCA 1XE7A 1NQJA 5KXCA 2JEMA 3M4FA 4GMP0 3WF3A 1H2NA 5I93A 2FDIA 5CADA 1W8FA 1VBA1 3QACA 4I01A 1GP6A 2ZZJA 4AFBA 3AB0A 4Z92B 3S5QA 1K42A 4KU7A 4BPZA 1SBEA 2YFZA 2JE7A 2A6YA 1DFQA 2YPJA 4EZ4A 3SMHA 3HNBM 4BB3A 2XG3A 3U10A 2ZGKA 3AZVA 3C7FA 3DPRA 3GBFA 4DY3A 5CG8A 3BVCA 1WUVA 1QF3A 1X82A 3GYDA 2WFF2 3DPRB 1PMJX 2PLV3 3I3BA 2FDFA 5FJHA 2W95A 2OQ6A 2WYSA 4LKSA 2GMEA 1LU2A 2BV4A 1VP6A 2YGLA 1MPXA 2D6OX 2WSVA 4UI9L 1LESA 3MIDA 2A6XA 5AFBA 2ARCA 1MS5A 1CQ9A 4IE5A 4ES8A 3AP7A 2EA7A 3CHXA 5EXOA 1JYWA 4NMIA 1HRV1 1COV3 1W8UA 4OZXA 4YRDA 3U78A 1C8NA 3EBRA 3J7NA 1CGPA 2ZGPA 1O4ZA 4U36A 4XEZA 1V0AA 1AUYA 4QAWA 4BMEA 3MBWA 2D5FA 4BQ4A 1O3RA 5I0UA 3OBAA 2WS93 4YGBA 4A7ZA 2RE9A 5A7SA 2AZ5A 1OOPB 1S0DA 2K2SA 1RUG3 3ZFFC 3ACIA 5FZGA 5AC93 4GB32 4C1XA 4Q4Y3 1ODMA 2BWAA 3UJQA 1AR61 1R091 4PHZA 3VLBB 1N3OA 4WM8B 4CCNA 5D1IA 5A3UA 2D93A 1SFYA 4YWAA 5ACA1 2JE9A 5KWRA 1UO9A 1R083 2J1SA 5H9PA 5FPBA 2ZGTA 2D3SA 2DYCA 3FJSA 4IEPA 1DDLA 3H1MA 3LAGA 4ORFA 4EN9B 4EROA 3R4DB 4YVWA 4CDQA 4AI0A 4BH9A 3J7HA 1N3PA 1OT5A 2R072 5LK7B 3POEA 4Q4W3 4XQ4A 3THPA 2PTMA 1DF0A 2PHDA 1RUE1 3N7MA 4FFHA 3WLUA 2Y64A 4Q8LA 4BHPA 1VMJA 4MXVA 4BK4A 2HJIA 4Y4RA 4MHRA 3JXSA 4XIKA 3RQ0A 2DUQA 2CGNA 3PMEA 1XJAA 3PUSA 1F5FA 1OSGA 5GLWA 4DUXA 5EFUA 1Y43B 4PIXA 5D8AA 1X36A 3MF9A 2F17A 1BVVA 1DLCA 4M01A 2GALA 2D6LX 4HBNA 5FZ8A 1O6UA 1GQPA 1GZ9A 1OBNA 5FZHA 3BU7A 5F3CA 5L36A 2C24A 5DAWA 5J37A 3BTZA 4NUBA 5A3TA 1QJY3 2JKXA 5T5OA 2CY6A 5AFEA 3WNLA 5GZDA 2YHJA 3DV8A 4PLMA 3VBFA 2WA4A 5LY1A 4K9SA 1F9KA 5CKQA 1COV2 3W59A 2VMHA 1IKQA 4PBOA 3HIFA 1YXWA 5BNNB 5KBFA 1J84A 3THDA 4AE2A 2EF6A 3TN91 3RZKA 4XFFA 5KC5A 5C70A 4MGIE 2ES3A 4WZCA 3OD4A 4N43C 3UL2A 1ZNPA 2WFF3 2VZSA 3SEPA 3WDXA 1LOFA 3HEIA 4HL0A 4ITCA 2E6VA 1YHFA 3M70A 3LZZA 3ZYRA 1BLZA 3AYAA 3O1TA 4Q0UA 3DGTA 3ZSKA 1W99A 2HWC1 4XVHA 4L9BA 1GFF2 2VNVA 2QQKA 2R16A 5FZ1A 3WF4A 4I0AA 5C4WC 3NO8A 4XAEA 4H2AA 1G9FA 1XYPA 5T55A 2WJSA 3WDVA 1W2NA 5JOYA 4GWNA 5EQUA 2RJ2A 2XH6A 3T4HB 5FZ6A 1UZWA 2YXSA 4PT6A 1UYXA 5CU1A 5FR3A 2XR4A 1W3XA 4Y22A 5EJ3A 3I49A 4LUMA 2VZVA 1V9U2 4P08A 3OEAA 4NWVA 3SKVA 1O7FA 2PHLA 1ZYBA 4Q4Y2 1YIFA 2VZTA 4QX7A 4LO7A 3OSDA 4YM2A 3AM2A 4EN6B 4URTA 1OC1A 2LW8A 3VKMA 3LEGA 5FUPA 3SC7X 2BERA 3CJIC 2D40A 2X10A 5T5JA 1QXRA 4PDWC 1UZ0A 4BLIA 1CWPA 2V4VA 4LA3A 1UU6A 3FLPA 4COZA 3ZFGA 5L9VA 2J1AA 2JDNA 1W9TA 1CZVA 1ZZ7A 2VMEA 1M06G 5LASA 1LENA 2PHUA 4MLOA 4H3WA 2BDRA 3UETA 4DOUA 1RYYA 1H8TC 5A3LA 1PO11 4YW6A 5FXZA 2X05A 4AGGA 4R8HA 2ZJCA 1AR93 3HN1A 1YC61 2JG9A 3C7HA 4QGMA 3NJZA 3VDAA 1AVBA 1U5IA 4YZ3A 4AEJA 1WCUA 3ZN5A 2P3KA 1ND2C 1QXJA 1G9CA 2ATFA 2JIJA 2YZ4A 4A7YA 3JB8A 1UW8A 2TEPA 2HWD1 2QQVA 2LM3A 3K4ZA 4HLTA 4Y20A 5F8PA 2CAVA 1U5YA 1WW5A 2DU0A 3VZNA 4QDQA 3MEPA 2GC3A 4K7JA 1ONAA 1G9DA 4AVSA 2JB8A 1WA4A 2W08A 1U5XA 3D5OA 4NR1A 3WG3A 4CDWB 1MEC1 2B7YA 1KRIA 3B5LB 2ERFA 1X33A 1ZBA3 4RS5A 3ZVXA 1QGLA 4AAXA 3ROUA 5DDJ1 2VZRA 4FQ4A 2C4XA 4B1LA 5HPOA 1CD3G 1FNYA 5LBBA 3GJAA 1Z7S2 4NPMA 4XF9A 1OXCA 1PK6C 4KGQA 5CEHA 1C28A 1A3KA 1CX4A 2AREA 1W2OA 2E51A 2ORXA 4YG3A 1ASJ2 2YROA 2A6WA 1F15A 3H1WA 2WNUB 3A21A 1SFNA 5B2GB 1W04A 2R063 5DMYA 3IAPA 1RMU2 4QPIA 2OIIA 3FC0A 4OI0A 2C5DA 5DAXA 5FY5A 3ZMOA 1GZWB 1FPN2 4GALA 2PQSA 4CPBD 5JXJA 1ULCA 3GBWA 1W6QA 2DUOA 2ZX4A 3N9MA 1BCXA 3BIWE 1VBA3 4K1ZA 4Q1PA 5CZKA 5FMDA 5FZAA 5A7NA 1TNFA 4FOQA 1NZIA 4IDZA 2JB4A 4IV3A 3U11A 2Y33A 3NAPA 5GLUA 1D4M3 1O8SA 1Q56A 2W52A 4FPFA 4AAPA 3OG2A 3MIEA 3P6BA 1MQTC 4QHBA 4LOTA 1QY4A 2WNVA 4KWUA 4AF9A 4ZS2A 2ZPXA 2X5IA 1HKDA 1O3SA 1UPIA 1AX0A 1BQPA 1X9TA 5JSPA 5IVFA 1PO21 1IS5A 5IK4A 2QZ3A 3SKJE 1D4VB 3SH3A 4GXLA 3B7MA 3OUJA 1NZCA 3WNPA 4FPYA 2LS6A 1KGYA 1RXGA 2H6BA 5FYSA 1GMMA 1R64A 2HWE3 2RM23 3D3AA 1HB2A 4RHV1 4GQ7A 5FMOL 4AZZA 4O61A 5JSOA 1DYPA 3NNMA 5EYYA 5H9RA 1NXD1 5I0DA 2D7FA 3E5QA 1AR63 1R093 4E8DA 5EZWA 1ENRA 3C7OA 1RUC3 4D7TA 4IXLA 5CKNA 1E5IA 2X53S 2G9FA 3WHTA 2IXCA 1A8MA 1HN1A 2G1MA 1W05A 3OY8A 4W65A 4MZUA 3K3NA 2E32A 1CAWA 1LAJA 4G4FA 2VOKA 1ZZBA 2VQUA 1ZM1A 4CCKA 2UYBA 4C8DA 1W6MA 4OHXA 3M2MA 3NAPB 1NE6A 3Q9OA 4EV0A 1NQDA 1CAWB 1HRV2 3OYWA 3AJZA 4XUTA 3FLRA 3WQ7A 2R6QA 2DU1A 2VOXA 4Y24A 1OVSA 2QE3A 2N7GA 3WQBA 4TZDA 5GZCA 1R1ZA 2ADEA 2PA7A 3QH6A 4NVPA 1OPMA 2O8QA 1OLMA 4Y3OA 5FO7B 3MW4A 5HCAA 1QNWA 2XWJB 2GH2A 3VUOA 1ULFA 3O0WA 4AGRA 2JDKA 4BA6A 2CDOA 2XJSA 3T4VA 1D0HA 3OUIA 1NXMA 3VBSB 2HWF2 1SBDA 5GZFA 3SITA 4J1XA 2C6SA 1STMA 1AR92 4AYUA 4F7ZA 5LATA 4ZZ5A 1LEMA 2EXJA 4FPGA 2WUHA 1ODNA 2A3YA 2ZEXA 1IGOA 1OLRA 4MHUA 4H14A 1CN1A 1SLBA 2DURA 3WINE 3GJBA 4SLIA 5FY9A 4P9LA 3OBTA 1LTEA 2VZ1A 1O4TA 4BM8A 1SLIA 1S4CA 4JHZA 5CA6A 1IZ3A 1E5SA 4BQXA 4PLNA 4YGEA 5JPNB 4XQDA 1BZWA 5EYXA 3VKFC 1AYN2 3CEWA 4W6WA 3SQOA 2GNTA 4J25A 2LRPA 3MZHA 2GMPA 1MQTA 4UFHA 4E2GA 2XQRA 1GKBA 3ZYBA 1UOGA 1URXA 3JD72 3LA3A 5FZ4A 5HCFA 1V9U3 3NV1A 4IEUA 4D94A 5A1AA 5F6LB 4J6GA 4Q4V1 4AHYA 1RUH3 5FZOB 4MO3M 5FZ9A 2XUEA 1GP5A 4PDWB 1VAKA 1XSRA 4FTEA 3UGFA 3CJIB 5F5AA 3W5NA 1GLHA 1SEFA 3UK9A 1UOBA 4N43A 2VXJA 4J1WA 1IQDC 5BXXA 2PAEA 4XF4A 2DVBA 2V4AA 3ITQA 5DN2A 3WEZA 4AHZA 4XFCA 4KGGA 4OHWA 1VBE2 4DXRA 3O1VA 3RZJA 1QJX3 3HR9A 1OOPA 1Q8QA 2JKBA 2A7AA 4MVTA 4NHYA 4C0HA 1B35B 2MEV1 2VGDA 4HMZA 4LO5B 3VKNA 1HB3A 1XB9A 4ASLA 2ETEA 5IK7A 4BQYA 2JD4A 4FO9A 2VCCA 4INDA 1HN0A 1AR71 4AEDC 5C8WA 2XVKA 4NROA 3LPGA 2XL7A 2P6CA 2D3RA 4AVBA 4TLGA 2ADDA 1N1TA 3OTFA 3S5AA 3RYRA 2A75A 4AI1A 5JSRA 2Y8KA 1FT9A 1PM7A 4O9GA 4UW5A 3KGLA 1H2MA 4E4SA 4ZS3A 2G4IA 5L7OA 4D6SA 4CYDA 3I54A 4Q4V3 2VMCA 4QQHA 3VHOA 1W8TA 4CXXA 2BU9A 2FBEA 4D7YA 1CAVA 1MS4A 2HWB1 5A6XA 5KXEA 2CWMA 4QQLA 2E26A 3J8F2 5J1XA 3AMQA 4MXWA 1YUDA 5DPNA 4QD2A 4NE9A 4CDUA 5FREA 4LKDA 2IFWA 2R49A 4NAMA 5FYVA 2XJQA 4UWDA 5A32B 1JOBA 1XNCA 2R0HA 2Y0OA 4SBVA 2YY1A 4B7KA 1UKRA 1BEV3 1W8ZA 3WW2A 2BYVE 1XYOA 4CEYC 4BXSV 2XB6C 3C8XA 2MHFA 1HW5A 2YMZA 2RS13 1W2AX 1HRV3 2KA3A 2V73A 4D69A 5F3GA 5G05L 3BCWA 5BV6A 4LK6A 3FHIB 4ZPIA 1Y7BA 4FCAA 3NRUA 3NW4A 5KXBA 4Y20B 4NHKA 3VBRA 3CNAA 4L0PA 3ZX7A 4MX3A 2QUOA 4UFJA 1OA3A 1XQNA 5FLJA 4EWEA 3V0AA 5FZCA 3LKJA 1YFXA 3JD71 3M3CA 4UXAA 1U5ZA 4CEWC 2XONA 4QKFA 3JCIA 1EUTA 3ACLA 5A3OA 1JHNA 4M3CE 3WW3A 1R082 4LQRA 2WL1A 1S0IA 3O14A 4MGQA 5L7OB 4QQ2A 4X6RB 1OLME 2YPDA 4RGKA 2KR2A 3O1OA 4LULA 4XFHA 2A6ZA 1QKQA 4N9HA 3AKRA 4RFT0 2FDHA 4N7UA 3O1PA 4Q0VA 5C3PA 3WNMA 4LEJA 2D44A 4A42A 2FZ1A 4K8FA 3ACHA 5FDBA 1DGWX 1WWYA 3N9NA 5LA2A 2ZKLA 3GHNA 4ES9A 1GU3A 1J1LA 4YG6A 2RS11 1C3HA 4WVMA 4YZ2A 4AQ6A 1W39A 2XXZA 3KMHA 3RZMA 3VN4A 1QJU3 2JD9A 1GNYA 2VOWA 3PNAA 4NHXA 1RUI2 3LCPA 4M3CA 4UYBA 2IFRA 5CNAA 4COUA 1JZ8A 1LOGA 5J96B 5T5LA 3WT3A 1LGNA 2EAKA 3TAYA 1UNBA 3WG4A 1O3TA 3CZUA 1BMV2 1DHKB 2O14A 4KWKA 4ONUA 2X5IC 3VBFB 1N47A 3NNLA 3RJRA 1LRHA 2WINB 4JDMA 4KBZA 4AFAA 3M3IA 5BPXA 2K46A 5FMCA 1AR81 3VBOC 4IEOA 2XVGA 4EYUA 1R081 2HWD3 1UOJA 4ZHNA 2JG8C 4XCAA 3TBDA 2WN2A 1LB2A 1QOOA 5FZMA 3DPRC 3DN7A 3J7LA 1QQP1 4QDRA 5H9SA 1LECA 1FAYA 2VH9A 5A3PA 1DYKA 2YC2A 4Q27A 1RUJ3 2FDJA 1PO23 2TNFA 2RS31 2BJSA 2WA3A 2BEOA 2WZEA 4P9WA 2VUDA 3RS6A 3PVEA 3UT0A 5A3NA 4QB2A 1E5HA 3BGAA 4BWOA 1FV3A 5BUVA 3CIHA 1PGL2 1MVEA 1POQA 2WFPA 1VMHA 2W2IA 3MPBA 2DUPA 2IXKA 2VOTA 4CEYA 3RZHA 2W87A 1ZBA2 3I2JA 4QPWA 2GDFA 1HQLA 4LO4B 4MGYE 4MSVA 1G6NA 3S6PA 1JTZX 4B29A 3H3LA 4FVVA 4RHV2 4WVMB 2XKPA 3VBHB 1YO8A 2Z2SB 3OY8B 2A71A 1UY0A 1G8WA 4PQ9A 1AX2A 3MGUA 3VGIA 1R092 2OPKA 4KBBA 4O9EA 4Q0PA 1AR62 3VV1A 4IUGA 1BBT2 5DUUA 1W8OA 2ZZQA 1NE4A 5K9YA 1MS0A 3JZVA 4XJZA 3UGGA 3JB4C 4CDUC 2ET1A 3V64A 2W47A 3W20A 2IVJA 5T54A 4ZU7A 3ZR5A 1SHWB 5HCBA 4DRVA 1QQP3 2CTVA 4MUVA 4XJAA 5BNQA 1NY72 3WY6A 1H1MA 1JYXA 2WNEA 4WM7B 1UPSA 3HT2A 3VD9A 5GM0A 2Q8OA 3RWNA 4AGVA 3ZXEA 3DEMA 4P9YA 1XE0A 4LBQA 2RMU3 2H0VA 5A7WA 3BN6A 3ZYPA 3FX3A 1FPN3 3NKTA 3ZIWA 5ABJB 2RDRA 1W6OA 3RWKX 1TG7A 1GZCA 2BVBA 4TSVA 3ZXFA 3CDZB 5JWPA 2LALA 4GJZA 5FUNA 4FTSA 3N7JA 4OHZA 1BJQA 1E57A 1ND3A 4IE0A 4IGOA 4MGTA 2BGPA 2XJUA 3EO6A 4GD4A 4CDQC 2EIEA 1WW4A 1RUC1 3GNEA 1ENQA 2IXHA 1YCIA 5CIRA 3KF3A 1AF9A 5F6KA 3H42B 3ZFEA 3LF7A 4A6SA 1LHOA 3AZXA 3LWCA 2VY0A 3ZYGA 4RR3B 2P6HA 1YYNA 1AR91 2HWE1 2NMOA 2RM21 4CCEA 4KQ7A 3MO4A 2FZ2A 2AENA 4URAA 2CWSA 5HV4A 1YFUA 1PIV3 5KHGA 3WNXA 5KHKA 1KFXL 3T0BA 3PTRB 3E6BA 1H6XA 4XBQA 4PI2A 5LBEA 2RVAA 5FOBB 1GBGA 3L9JT 4K21A 4QPGC 5CFCA 1SLLA 3ILRA 3RNSA 4N7IA 1JODA 3PIJA 4DS0A 3E6CC 2JG8A 3U1XA 5HV0A 4Y1ZA 2NQYA 2R0FA 4FP2A 1ENXA 4DPNA 1QIQA 2ZBJA 3D0SA 4WVVA 2IVIB 1GV9A 4B4PA 3FBYA 3PMSA 3RI9A 1WZXA 4FXGB 1HRI3 2J7MA 3DYPA 5FYIA 1RUH2 3BTXA 1SPPB 2J22A 1WW7A 2C26A 1TMF1 4MXWB 5JPMB 1L7RA 1Q8VA 4LHNA 4Q0SA 3FFZA 3LEIA 3POBA 1PX3A 4N53C 2E31A 5FMBA 3N7LA 4L97A 4QT6A 1UY1A 1XC6A 2E53A 3RFRA 5AC92 3T1LA 1CJDA 3WNNA 4CCDA 5IVVA 1D0GA 4K1YA 4TN7A 3USSA 4CP1A 2P3IA 4MH0E 4BJ0A 4AWDA 4ET7A 2WS92 1LOFC 4UF0A 3RZZA 4CUCA 2OPWA 1KQRA 1HLCA 2HWC3 2KXLA 1MACA 2SLIA 1ND3C 1YFWA 4HN0A 5C7GA 2VZUA 1O3QA 1RHI2 2GC2A 2JENA 2R042 1E5RA 3OEBA 3AYCA 3R0RA 3O1UA 2QQJA 1AHSA 1O4YA 2MEV2 1UXZA 1W06A 3ZFGC 3ZFEC 1LHVA 5FV3A 2PHFA 5ACA3 2CHHA 1UF2C 2QQLA 5I8SA 3PTYA 4LKEA 1WCSA 1JYVA 5C6CA 3JBG3 3S7EA 5DZFA 2F4LA 2IXIA 5FYHA 3LIGA 5A70A 3WDWA 2AEYA 2WDBA 5HXVA 1IS4A 1VJ2A 2VPVA 2XLAA 3UKNA 4AFMA 1OQ1A 3ZXKA 1FOD3 4BMBA 1S2EA 1JS9A 3O1RA 2B5HA 1TEIA 2B4KA 3AKSA 3B9CA 5FPAA 1KD7A 1PO13 2BQPA 2CYFA 1WLTA 2JX9A 1ZBE1 4JGYB 4LBMA 4TWTA 2AR6A 4PBPA 5FP8A 1IPSA 3ZDVA 1PIV2 5LW9A 2WT0A 3MHZA 4YFZA 4L8QA 5FO9B 2D6PA 3DXUA 3TRSB 2BNMA 3J8F3 2VULA 3K4DA 3I3EA 3ZIXA 1UAIA 5JOXA 3GBGA 1RUOA 3M3QA 4EJRA 4Q5OA 3C7EA 3H8UA 3IN9A 3I2FA 1Y9GA 3IIIA 2ZHLA 4N90A 3ZKYA 2WT2A 4R9AA 4LBOA 1JU4A 4WVWA 3POWA 4YW5A 1Y3TA 3KT7A 1UYZA 2PXJA 4YVWB 1TNRA 5T52A 4Y4YA 4D6RA 3PVNA 1PGW1 1OHFA 3AXDA 5FY0A 4BQ3A 2QCSB 3OD0A 4LTAA 5BNOA 1JZ6A 2P5BA 5FP4A 3ZSJA 4JDOA 2VD7A 3I3MA 2VMDA 4XPVA 3IB3A 4IESA 4XMIA 1NA1A 1G7YA 4F3JA 4CDWC 2HWF3 3NMBA 2W1QA 4IGPA 3GDBA 2E9QA 4RYDA 2Y6HA 2AGSA 2XGXA 4FAHA 1F4HA 2P3YA 4JVAA 3ENRA 4K40A 1BK1A 5EJZB 3N9QA 2A5ZA 2X09A 1JYNA 1GZTA 2DVDA 2RV9A 1DCSA 2GC0A 4CUBA 3KF5A 2UY9A 5DXDA 2WT1A 3WXPA 4HSLA 3HQRA 4A3XA 1VALA 5FYMA 2VU9A 4HETA 4YVSB 2OYZA 1IPKA 1VR3A 3T2OA 3VD7A 2CNAA 3ZPOA 4RL7A 4COVA 3OGRA 4ISRA 1HX6A 2VNGA 4Q4X3 1UIJA 2XJRA 3WF0A 4GZ9A 1C57A 1YI9A 5JCTA 3GZTB 3BYWA 2WZR3 5C71A 1JUHA 2BRTA 1EP0A 2XBO1 5CVRA 4HK8A 3SLIA 3AJYA 1WLDA 4CSWA 5JOWA 1YNAA 1MS8A 3WW1A 2RS53 3PUQA 1LR5A 5FZDA 2FDKA 2YBKA 1N1YA 3JQXA 4I3GA 4PF1A 3POGA 5JR7B 4PCRA 5EJ1B 2HWB2 3UJOA 3NV2A 5A32A 1NLSA 3D4KA 1JOPA 3J26N 5C3OA 3WP4A 3BOWA 5B4NA 1UZYA 1Q3EA 1HB4A 2OUHA 3TEYA 3VBSC 4S2FA 1I3HA 4XJ8A 3RMXA 5T3NA 5J36A 1VE0A 2K9ZA 4XF0A 1PZ9A 4XJWA 1UZZA 2DV9A 2C0ZA 2QQOA 4AXOA 3N36A 2JDZA 1YQ2A 2DCYA 2VQAA 4DMIA 2P37A 3BTYA 2FMDA 4CCCA 1REDA 3AZWA 1I5PA 3HWJA 4IEWA 3ES1A 1LHUA 1H4GA 2BP6A 4PI0A 1W2TA 2PHTA 4UFMA 5K0UC 2WR9A 4XIOA 3ABZA 2Q8CA 2GZWA 4BQ2A 2XBO3 2XL9A 3T0DA 4GWJA 1J83A 3NAPC 5FIXA 5FZOA 1I9RA 4LT5A 4OMDA 1XSQA 1B09A 4JGZA 5FLHA 1OQDA 3VL8A 4L92A 2QBXA 2WNVC 1UN1A 3H3ZA 4AI9A 4CUGA 4M0HA 4XFIA 5IK8A 3LDKA 5FY4A 3GZUC 4QHZA 4E4DX 2GP5A 2W1WA 4GA9A 3T3YA 5FY8A 4OUSA 1QJU1 2RS52 2FQPA 4RA0A 4WVZA 4A45A 4QX1A 3VKLA 3WV6A 1NX9A 3KCYA 3AFGA 1QHDA 3LQCA 1ASJ3 2J1UA 3P5BA 5FLIA 2QQPA 3CBNA 5DUVA 3WUCA 4AFDA 3NV4A 3NNGA 1JH5A 1BK0A 4EN7B 1K3IA 5LEKA 3BI3A
chains in the Genus database with same CATH topology
3TN92 5LRRA 2PHWA 5EWSA 5FQ0A 1F5JA 4AK3A 3AMNA 5CG9A 2VXRA 1EYBA 1FMD2 5SV5A 3ZFEB 5C4WA 1C8M1 1IQAA 3IDBB 5GLZA 3ZYIB 2VW1A 4HKLA 1LKNA 2QFEA 1MQTB 4WBBA 4XJUA 1MZEA 2WWSA 3TYJA 1FX5A 4IEVA 3HQXA 1S2BA 4A2UA 3S30A 5J7MA 5CFDB 5JI9A 1EV11 2YUEA 4YNIA 2XJVA 4XZPA 1PHMA 1I1EA 4L11A 1DQ6A 1IHMA 1AYM2 4GB33 1HIXA 4IV1B 4XXPA 5ABJA 4XILA 3AP9A 1ZRDA 1PK6A 1BVP1 3H7YA 3H0OA 1X7NA 1Z78A 5IT6A 1PK6B 4Q8KA 4NO4A 1AR72 4OI4A 2IZWA 2QDRA 5GKAC 4FXKB 2D98A 4FQZA 4QPGB 4BYYA 4UW4A 2VMIA 2ARBA 1CJPA 4HVOA 4IV1C 3WP3A 1PO12 1TMF2 4H7MA 4LBNA 2PLV2 4Y1UA 2Q1ZB 5DG1A 1POV1 3VKOA 5EV7A 5AVPA 1C4RA 3B9IA 2RR13 2BBVA 5FO8B 3ZSLA 1NYWA 4EN8B 5HBAA 1FI2A 3K48A 2GU9A 1FV2A 1MZFA 2PHRA 4KL1A 2Z69A 4LO6B 3ZXLA 4AFCA 3E6DA 2ZHKA 1DQ1A 4OULA 1DQ2A 2GC1A 4KWJA 1LJ7A 1SCRA 1WMDA 4Y1XA 4AQSA 2OVUA 1RVF3 1RHI3 1HQWA 4BZ4A 4WZFA 3JU9A 3CU7A 4HFSA 1RUC2 1S0EA 3LOBA 3NV3A 3AMPA 1RUJ1 4JRAA 4B7EA 3UKTA 4QPGA 5CFCC 3AFKA 3MLKA 1U12A 2ZGQA 3ZPYA 1G86A 3LSDA 4PIZA 4FAGA 2WQ4A 5C33A 1V6OA 3SISA 3V0AB 5KHJA 2NM1A 4C91A 1D4M2 3O12A 1BBT3 1YJKA 1X8EA 3J4UH 4MGZE 4CEWA 1RUNA 3ME2A 4Y1VA 3POYA 1FYUA 1V6IA 4QQOA 4QPYA 2D43A 5A33A 1NCRA 1VBE3 4LBJA 3PHMA 3WDTA 4W6XA 1QXPA 5A33B 4YSFA 1AJKA 1H4HA 1H1IA 1W6QB 4NOTA 3D6EA 3I59B 4GB31 1PZ8A 5CBLA 2D6KA 2UWBA 4N9IA 2DCTA 2ZX1A 3V56A 1QU0A 2V09A 2X5IB 3VBFC 2YC0A 4XFGA 1AR82 4Q4V2 2QDNA 1RB8G 1NCQA 2EXHA 4AEMA 1VRH2 1OI6A 1N1VA 2A70A 4LBQB 3AK0A 1Q5OA 4LE4A 3ZFGB 4OHVA 2OW4A 3AXEA 4R52A 1PGL1 4Y26A 2F4PA 3AKQA 1EAH2 1VB2A 1ND3B 2DCZA 3BALA 2TUNA 3CJXA 4HVQA 4GH4C 3ATGA 2HEYF 3OGJA 1SQ4A 4Q29A 3DUIA 4XETA 5FBZA 4JRLA 1QWRA 1OA4A 4RR3A 2HWF1 1VBD2 1QJX2 2DVGA 5K0UA 4I0WB 1WCDJ 2DTWA 1EPZA 2HWB3 1S0JA 2QKDA 5FMOS 1RUD1 4CTEA 1WCKA 3MIHA 2AH2A 1QDOA 5BNOB 1XNBA 5I8TA 1A8DA 4IL7A 2YV8A 1NA1B 2K0GA 4DNYA 3QBQA 4ZU5A 3KLSA 2A3XA 2WLQA 3RYPA 3A0NA 4RGAA 3NL1A 2LUWA 2HWD2 1SDWA 2XVLA 3I7DA 4M00A 2QVSB 2QNKA 1QDCA 4ASMB 3NVCA 3RI8A 4HN1A 2ZGOA 2BUKA 1NG0A 3IDCB 2JG9C 2RJKA 2UWCA 4PF5A 1ALYA 1RITA 1WGPA 1ND2A 3ZXAC 1SLTA 2W0XA 4IEZA 4BCUA 1BEV2 3OYWB 4DQAA 4JGYC 3SCGA 4YZ1A 1SLAA 2NPIA 2WLPA 2V5YA 3MIGA 3AMMA 2IXJA 1QH6A 3MICA 1V6JA 2ZGLA 5FPZA 1EAH3 3OPZA 4RSUA 1HXS2 3CF6E 1MVQA 5BNPC 4AEDB 1YIPA 3M7AA 1G9AA 1DQ5A 1VBA2 3UV9A 1K5MA 1QJZA 2PHXA 4XFAA 1MS1A 4R4XA 3E5XA 4YZ5A 1MEC3 1UU4A 5C9AC 2R1BA 2PYTA 1IS3A 2FMYA 4XQWA 3QOPA 1JYCA 3FWEA 5JZGC 5J3UA 3RSJA 4FOVA 2WZR2 1RJ8A 5KHHA 1HV0A 1BKZA 3TNPB 1KITA 2EALA 2NLRA 4XTPA 1AYM1 4S2GA 2B45X 4DRRA 2QJVA 1LOEA 4E2QA 3DKWA 3ETQA 1ZRRA 5L19A 4AVAA 3S0MA 2W39A 2BWCA 1ENSA 5DUWA 4HPKA 3JD73 2BVVA 3ZFFA 2NP0A 1QQP2 4FPLA 1PZ7A 3MPPG 4JV4A 2IWGB 2ZTNA 4HANA 4U2AA 5ACA2 2HWC2 3I2DA 3MYXA 3B94A 2VVDA 2QZ2A 4I2OA 2EXIA 4QX5A 5C8CB 1KS4A 3LSEA 4L99A 4NWWA 1H9WA 3CO2A 3GALA 1QJY2 4G9SB 4IQPA 3I8TA 4AI2A 2BFUS 1CAUA 1RUE2 4FPJA 1CAXA 3NSTA 4FBFA 2OZJA 1RUD3 1BBT1 2VUJA 4CZSA 3FBMA 4LR4A 3VBRB 1KS5A 4FPCA 1CPMA 3MFAA 1S0GA 5FTTC 1Q43A 3ZXDA 3SHRA 5AC91 4DB5A 4TLFA 3PJQA 2XJTA 5DG2A 5BNPA 4ISQA 4PDWA 3KT4A 5AVAA 3EJKA 2WS91 5J48A 4NPRA 3VBSA 2VVEA 4CEWB 4CDUB 1ZRFA 5C9AA 1WMFA 1GSLA 3VBUB 3V0BA 1W6OB 1AL0G 4BLJA 4P9GA 4P9JA 2MPFA 4B3NA 5C9AB 3GHMA 4ATFA 1X8MA 1NCRB 3MFCA 1CPNA 1AL22 3KD4A 2DFCA 4RQPA 5E1RA 4CEYB 4AVCA 4DXZA 3AP5A 4HKOA 2ZGNA 4COYA 4Z1VA 1CAUB 4LHKA 2Y0IA 3GF6A 4H55A 5GLVA 2BW8A 1FXZA 1RUE3 1V6NA 1V6LA 1GNHA 2ZKNA 4XBLA 1DQ0A 1ZBE2 3SH4A 1TE1B 2DCKA 2MNGA 4IERA 2H6CA 2JG8B 2D6NA 3CJIA 3ES4A 1DGWA 2BGCA 5FCCA 5TSWA 1HRI2 1H1AA 3H3UA 3FUQA 4Q4X1 4KU8A 2VW2A 2OZ6A 1V9U1 4IEYA 3L2YA 1VBC2 1Y9QA 3C3VA 3N35A 4FOYA 2CL2A 1CVNA 1FPN1 3RMYA 3VDDA 4UW6A 1NA1C 2B39A 3CL1A 4GH4A 4XE9A 4I0BA 1YLLA 4XBNA 1NY71 1RL3A 2BNNA 3AKPA 3EHKA 3LOIA 2VECA 5JAXA 3FZ3A 2ILMA 3WCSA 5LEJA 3VBUC 2O8OA 1WD3A 1OFNA 2ZGRA 4M0NA 3INAA 3J9SA 2VW0A 2JECA 3KZ4C 5L7OC 2D97A 4NHLA 3K51A 1ZZ6A 3ILNA 5JIAA 4F8AA 5E8AA 2X8KA 1RJ7A 1J3QA 3J8F1 4QPIC 2HKXA 2SBAA 3IDEA 1POV3 3SCFA 3KB5A 1MEC2 2DVAA 4OFGA 2I45A 1V6KA 2NMNA 4PLOA 4FPOB 4Y5Z0 4BOWA 2O1QA 4IV3C 1VAMA 2GNMA 4Y1YA 1VBC3 3R05A 2ZX2A 3B01A 3WOGA 1Z7S1 4QMAA 2XLFA 2D5HA 3FLTA 4G3YC 1AL21 2RS33 4XHXA 3AX4A 4RS5C 1SCSA 3SCHA 5JDBA 2GMMA 4KWLA 1SACA 1XRUA 5FQ0B 3N3HA 4OI1A 1ZZ9A 2ET7A 3OCPA 4CP2A 4RHV3 1WW6A 4IEQA 1RUH1 4XXAA 3MLJA 1AXZA 4XOGA 3B02A 1AJOA 1M4WA 5F1RA 4TYSA 1UD1A 3WUDA 3WDUA 4FPEA 3KSCA 1RUJ2 2JXAA 4OUMA 3R4SA 1AZDA 4GKYA 3G6JB 4YYOA 3SNMA 3M8LA 2LTNA 3USUA 2R041 1VBC1 3WCRA 3E5UA 4JDNA 4YM0A 1GNZA 2JJ6A 2RMU1 1PVC3 2RS12 3A4UA 3MW2A 3X29B 4XF3A 1RUG2 4YG0A 1HXS1 4GULA 2B8MA 2D6MA 5GZGA 5KC6A 1XNKA 5CFDC 4MYEA 4B8EA 2WSUA 1BYHA 3MDPA 4BE3A 1PGSA 2R061 1HDKA 2ZGMA 3MIBA 4Y22B 5JVVA 4E2SA 1QJX1 5BY5A 5I0RA 1B35C 2ZACA 4CDXC 5JZGB 3RJ2X 1BMV1 2XKOA 3O7OA 2NN8A 3FFQA 5E16A 4WM8A 4ZKTB 3P3NA 4EN0A 5CFCB 2ZX0A 1UX6A 4YZ4A 2XBO2 5I91A 5FFOC 1RUI3 3B3QE 2EIGA 3ZDSA 5BNPB 2GNDA 2BPA2 3H50A 2EAAA 2YYOA 1VRH3 3FMGA 3EXUA 4YW4A 3LB9A 1LOBA 2ZGSA 4M3CF 4LHLA 3H7JA 1WBLA 3WP6A 5I8YA 4C0BA 3O0XA 1LOCA 3B00A 2DWRA 4HKWA 1O91A 1C5HA 2CGPA 3U4XA 3WVJA 1N1SA 2CGOA 4PIYA 2H0BA 1D2SA 4LUKA 4Q4W2 3VBOA 4GMP3 3KCCA 1IS6A 2KM2A 4CDWA 2R1DA 1JYIA 1LU1A 4FPKA 4S2HA 4BIOA 3PVBB 1CR7A 1DIWA 4XF1A 2WNUC 1LHNA 5J09A 4EWDA 2R073 3BODA 2BNOA 3JBG2 3BPZA 4JAAA 4KG0A 3ZFFB 5JI7A 4FOWA 5BNOC 1OOPC 3NWKA 2E7QA 1C8M3 3W9AA 2ZGUA 3RYKA 4ZU4A 3AYDA 1H30A 3MF6A 3CLPA 4E9KA 3T2TA 1GR3A 1H2LA 4KH9A 1RUD2 3WW4A 1RC6A 5A3MA 1S0BA 5DDJ2 4JC1A 2MEV3 1TME1 1IPJA 4GH4B 1ND2B 3RPQA 1J58A 5DZGA 1JXNA 2XUMA 1PVXA 3PVOA 1S0CA 3ZN4A 1RMU1 5T5PA 3O0VA 5GLTA 4K20A 3U07A 5F9TA 3KS7A 4DY5A 1AXKA 3C2UA 4NHMA 4I30A 5KXDA 3VZLA 4JQRA 1BXHA 4W6YA 3APBA 3G7DA 4X6QB 4YARA 4GMP1 1MZ6A 1SMVA 1CONA 4YVSC 3WR0A 1LULA 4JTNA 3JQWA 1RTVA 2VQ0A 4AG4A 5CFDA 3QD6A 3IKWA 3KGZA 1BEV1 1S55A 2ZHNA 3M3EA 5KHIA 2ZS6B 2VVFA 2O0OA 4K3UA 3AP4A 4OI2A 4RQPC 4XFBA 1F2NA 4XTMA 1GICA 3IWZA 2I74A 1UU5A 1LGCA 3HD8B 5LK5A 2P2KA 4CDXB 1FOD2 1W0OA 2VUAA 2W68A 3S7IA 1REFA 3N7KA 1XNDA 1DZQA 1NLRA 1RUI1 2WNVB 1JBCA 1HRI1 2Q1MA 2VOVA 4GKXA 5T50A 2IC1A 3L2HA 1RUF3 1A6CA 1TMF3 2X29A 3EQEA 2OUJA 1PNFA 2JICA 3ASIA 3B69A 2WKKA 3HAGA 1RIRA 4Q4W1 4XW3A 3I4IA 2P17A 3ZSEA 2RR11 2PLV1 5K0UB 3KT1A 2UURA 2E63A 4FTBA 1AYM3 3HMYA 1H0BA 5DDJ3 1O5LA 1LGBA 5JIUA 1TQ5A 1LODA 1A78A 3IPVA 5FRAA 1FNZA 1JUIA 5BNNC 2ZAAA 2Z5WA 3A0KA 3QCWA 4GWMA 2RHPA 2DF7A 2IXLA 3DL3A 5JOZA 4YM1A 4RQPB 3TWIA 3BB6A 1L3JA 2EXKA 1GQHA 4JGYA 3FUOA 3AKTA 4LNVA 4RD7A 1RVF2 2UWAA 3VZJA 3TOJA 4V1PA 1R1A1 1EV12 1QOSA 4KNCA 1T6GC 3UKVA 1CAXB 1DGLA 4IV3B 1CESA 3ZXJA 2A73B 1H8TB 1VAVA 2TBVA 1JW6A 1REEA 1J1TA 4XJ9A 3VZMA 1PO22 3JUUA 3WG1A 5CB7A 3VZKA 3RG0A 3RDIA 1MZ5A 1Z0HA 3TN93 1TME2 2P3JA 2BFUL 4LLFA 1XE8A 4D7SA 3P3PA 1D4M1 3MIFA 1PNGA 4B4QA 1KJLA 1VBD1 3IPVB 5E88A 4C1WA 1J59A 1ZX5A 3MLLA 3ZN6A 4H7LA 4QQPA 1HXS3 1VBB1 4S2DA 1POV0 4F83A 1D2QA 2GN7A 5C8CA 4GIQA 4JTOA 4YW3A 1QH7A 1RVF1 1N3QA 5CAZA 2Q5TA 1UCXA 2EVXA 5C4WB 4HSJA 4XHBA 1V00A 1MS3A 1ASJ1 2PN5A 4AEKA 3KM5A 3DF0A 2ARXA 2UY8A 5E89A 1HQNA 1VLNA 4FPHA 2CAUA 1OKQA 1W6NA 1EY2A 4N43B 2UYAA 5DUXA 2WFF1 1J3RA 2XLGA 1DBNA 5JLVA 2R062 3OGGA 2Y38A 1S1AA 3QLQA 3BTAA 2GAUA 1XXNA 2CV6A 1OPOA 1W6PA 2Z42A 1XU2A 3USUB 3H1YA 1GANA 3FE5A 1KXGA 1OD5A 4AI8A 2ZA9A 4X8PA 2XWBB 4I02A 1NOVA 1RUF1 4P9IA 4WM7C 3QH7A 3OF1A 2P34A 4MGKE 1APNA 4N53A 3AZYA 1NCRC 3ECQA 1VBB3 4AHXA 1LOAA 1PVC1 2G9GA 1X50A 1EV13 4M3CB 4YLZA 3AMHA 3VBHA 2Q0AA 2ZMNA 2DTYA 4E4ZA 2AYHA 1J3PA 4WV8A 1KDKA 2RJLA 2HEWF 1C1LA 4JGZC 3ALQA 2DCJA 1OMIA 2GSYA 3WDYA 2DFBA 1OA2A 3R4UA 4B4RA 2B46X 5JMCA 4IETA 2PAMA 1GQGA 4K6BA 4CP0A 1W2UA 1IOAA 2ZABA 1O5UA 1PMIA 2Y26A 4YGCA 3V65A 1H8VA 4FSJA 4WM8C 3VBRC 4Q4Y1 1Q8SA 4BIFA 2RMU2 2WIIB 3LGRA 2B42B 2E7AA 1RUG1 1ZVFA 4QXKA 4OLLA 4CDXA 4QU2A 1R1A3 4ZXKA 1ULDA 1VRH1 2YGMA 3WG2A 3D0JA 1YRZA 1C5IA 2I07B 1I5ZA 4AVTA 5IK5A 2I2SA 1FMD1 5D8AB 3WZ1A 3R6SA 3VBOB 2UU8A 1DGRN 5GALA 3WQ0A 4FP3A 1UMZA 2A6VA 2R32A 1EAH1 1COV1 4RR3C 5SV8A 4HK9A 4UBGA 1CIWA 4RS5B 4RGGA 3LA7A 3VHPA 5D8AC 4LE3A 1UKGA 1PGW2 4CDQB 1NCQB 2AUYA 2HEVF 4META 3IM0A 2VNOA 4Q4X2 1QJY1 5IUQA 3ILFA 1SBFA 2XJPA 3KQRA 4AW7A 2OA2A 4KG8A 1V70A 1CAVB 3PLQA 1MR5A 3IIAA 1WD4A 4IV1A 5ABJC 2DVFA 2PFWA 3D8CA 4Q0QA 4AQ2A 4ATEA 4X8NA 3ZO0B 2WC2A 4QPIB 4HT1T 1OFSA 2GN3A 1VB4A 1ULEA 1AYN3 1DLLA 1G9BA 4XMAA 1S2KA 3OBRA 2PQQA 1ZBE3 3HBZA 1VIWB 2R071 5HI0A 5GJ6A 4QGNA 2C9AA 5JZGA 2R043 4D3WA 2VMGA 1JN2P 1VBE1 1GYKA 1W0PA 2Q4SA 4QM8A 5J98B 2YDEA 1AR83 1DZTA 1S0FA 1XYNA 1ZZ8A 1YI7A 2GNBA 3IT8A 2E7TA 5DZEA 5K7PA 3B93A 2FHRA 1YWKA 2Q30A 1DU3D 1RUF2 4E27A 1LEDA 1IKPA 4Q26A 4WM7A 4OHYA 1QNYA 4YVWC 4R9BA 4XDQA 3SH5A 4XYXA 5I0TA 3T1MA 3ZN6B 1MS9A 2PELA 3ZSMA 4FT8A 1ZZCA 5H9QA 1WLCA 2RR12 3VL9A 2ZOEB 4C90A 1UIKA 1Q8PA 4YW1A 1OLQA 1QMJA 1ZRCA 1JOJA 2ZCWA 3AZZA 5FAXA 4AVVA 1AYN1 1Q8OA 2JG9B 1QOTA 1UL9A 4R4ZA 4YVSA 2ZAHA 3I59A 3VDDC 2NYYA 3THTA 2F6BA 2HYKA 1KDMA 4P5HA 4R9CA 1H2KA 3D82A 3HT1A 2B9UA 3NKGA 4PJYA 1H8TA 3URFA 2ZHMA 4YFWA 5BNNA 5K8SA 4MV2A 1XU1A 3OJBA 4LBLA 3IMNA 1R1A2 2XHKA 2WZR1 4COWA 3IBMA 3BOPA 5FPXA 1KJRA 5F5QA 1K5MC 1WBFA 3GZAA 4HPKB 1DQ4A 1LHWA 1HV1A 3WHUA 2VNRA 4Z2WA 2NZ9A 2D3PA 1B35A 2VG9A 1YJLA 3SXWA 3VHRA 2HWE2 2RM22 5LRSA 4YW2A 1V6MA 1RGSA 4LO8A 4Q2FA 5FOJB 1FOD1 3M1HA 2A3WA 1EPWA 4DINB 1DGRA 4OVEA 4HVRA 3AYEA 1ZREA 3WD5A 3U0ZA 4N53B 5I0SA 1DG6A 1F8VA 1WLWA 1W6MB 3TB0A 4A7KA 4IEXA 2BTVC 1VBB2 4R9DA 3WQ1A 3KCXA 3O5SA 3TNQA 4P14A 3ZXGA 1KFUL 1ULGA 3E97A 1U0AA 3WX5A 3POSA 4I09A 4DFSA 1K5MB 2ZMKA 4JCKA 4UW3A 1OQEA 5GZEA 1NCQC 1RMU3 2WQZC 2C1FA 5C8CC 4UBHA 1TME3 4LBQD 3ZMNA 4Z82A 1I6XA 4LBKA 4QM9A 2Z79A 4NN0A 4AHWA 1F31A 2R30A 5BYNA 1RHI1 3N4MA 1W6PB 1SLCA 4CRQA 3VDDB 3H9AA 4DZGA 3MI8A 4QGLA 1GZWA 2GH8A 3ZYJB 3LA2A 1AR73 3AP6A 4HZFA 1VBD3 2ENRA 1WMEA 2PAKA 3WP5A 4I3PA 3MW3A 4Z07A 1QJU2 2RS51 2XPJA 2ZMLA 2WZPP 3VZOA 1FATA 4P9XA 2RS32 4LLOA 3ELNA 3PJYA 1AX1A 1C8M2 4EWAA 4AEDA 3RRDA 4AQTA 4LA2A 4Q1RA 1W6NB 3JBG1 1H9PA 1ZBA1 1PIV1 1AXYA 1RINA 1C1FA 4JGZB 2WNUA 4YGDA 5L73A 4BQ1A 1AL23 4AI3A 1PVC2 3W58A 1FMD3 4L2NA 3VBUA 3V0BB 3VHNA 4YM3A 1DZRA 2ZX3A 4Z8BA 1Z7S3 1ZA4A 1LCLA 1YFYA 3VBHC 1XE7A 1NQJA 5KXCA 2JEMA 3M4FA 4GMP0 5I93A 1H2NA 5CADA 1VBA1 3QACA 4I01A 2ZZJA 4AFBA 3AB0A 4Z92B 4KU7A 4BPZA 1SBEA 2YPJA 2JE7A 2A6YA 1DFQA 3SMHA 2XG3A 3U10A 2ZGKA 3AZVA 3DPRA 3GBFA 4DY3A 5CG8A 1WUVA 1QF3A 1X82A 3GYDA 2WFF2 3DPRB 2PLV3 2GMEA 1LU2A 1VP6A 2YGLA 2D6OX 2WSVA 1LESA 2A6XA 5AFBA 1MS5A