1RB8G

The phix174 dna binding protein j in two different capsid environments.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
187
structure length
187
Chain Sequence
b'MYQNFVTKHDTAIQTSRFSVTGNVIPAAPTGNIPVINGGSITAERAVVNLYANMNVSTSSDGSFIVAMKVDTSPTDPNCVISAGVNLSFAGTSYPIVGIVRFESASEQPTSIAGSEVEHYPIEMSVGSGGVCSARDCATVDIHPRTSGNNVFVGVICSSAKWTSGRVIGTIATTQVIHEYQVLQPLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title The phiX174 Protein J Mediates DNA Packaging and Viral Attachment to Host Cells.
pubmed doi rcsb
source organism Enterobacteria phage phix174
molecule tags Virus/dna
total genus 36
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02306 Phage_G Major spike protein (G protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rb8G00
1AR81 2R063 4YVWB 5CFCB 1QQP2 1BEV2 4PDWB 1FOD1 5AC91 5ABJA 3J8F3 4CDWC 1QJZA 1RUF2 1NCQC 1VRH2 4RR3B 4FTEA 4RQPB 1H8TC 4WM8A 1RB8G 5BNPA 1CJDA 1WCDJ 4QPIA 1QJX2 1F8VA 2HWF2 1HXS1 3VDDC 2MEV1 3VBRC 1PO23 4GB33 5LK7B 4Y4YA 1FMD2 4GH4C 1AL23 2TBVA 3HAGA 2HWC1 3TN91 2HWB1 5ACA1 1AYM2 1V9U2 1PGL1 1OPOA 1R081 1ZBE2 2FZ2A 5BNOA 4CDXB 1C8M1 2RS11 2XBO2 1R091 5ABJC 3CJIB 1AR73 2WS92 2RR12 5A32A 2R041 1VBA2 1IHMA 1NCRA 4WM8C 3ZFGB 2WZR3 1RUE2 2RMU2 4RHV2 1TME1 1RUF3 1VRH3 1RUC3 1VBE2 4CEYB 1VBB1 3IDEA 1PIV2 4AEDC 1ND2C 5C4WC 4FTSA 1QJY2 4NWWA 2HWE1 3ZFFB 1FMD3 1E57A 1RVF2 4CEWA 3JBG1 1FOD3 1K5MC 1EAH2 1RUJ1 4IV1A 4Q4X2 1M06G 3J8F1 5BNOC 1VBC2 3VBFB 1AYM3 1V9U3 4WM7C 2XBO3 1RUG2 5C8CC 2WS93 2RR13 4JGZC 1PO21 1D4M2 1HXS3 4GB31 5BNNB 3CJIA 1AYN1 2RM22 1RUE3 1PGW1 4RHV3 1POV0 3ZFGA 1VBE3 1BMV1 4CEYA 4IV1C 1QJY3 4CDUA 1QQP1 1BEV1 1W39A 1RVF3 2RS52 1EAH3 3VBHA 5K0UC 2R043 3FBMA 1AL0G 4Q4Y2 4FTBA 3ZFFA 5C9AA 1RUF1 1VRH1 4Q4W2 1TME3 5FMOS 1NOVA 3VBFA 1VBB3 2HWD2 2BPA2 2HWF1 2FZ1A 5L7OB 1RUG3 4JGYB 1PO12 2DF7A 1RMU2 1ND3B 1D4M3 4AEDB 2X5IA 1FMD1 1RUD2 4RS5B 2HWE3 4Z92B 2GSYA 5BNNA 2BFUS 3JBG3 1RUJ3 4YVSC 1HRI2 1QJU2 3VBUC 1AYM1 1MQTC 1V9U1 1AR62 5CFDC 1ZBE1 4CDQA 4N53A 2XBO1 3VBOA 2VQ0A 3VBHC 3JB4C 4QPGB 3VBSB 2WS91 2RR11 1NY72 2PLV2 1VBA1 4GMP0 2RS53 5C8CB 4Q4Y3 1RUE1 2RMU1 3DPRA 4RHV1 4JGZB 1AYN3 2IZWA 4Q4W3 1VBE1 1Z7S2 1BBT2 1GFF2 1PIV1 4IV3B 2HWD3 2X5IC 1NG0A 1PO13 4N43A 1QJY1 1RMU3 5D8AB 5L7OA 4JGYA 1QQP3 1NA1B 1BEV3 1RVF1 1RUD3 1EAH1 4YVWA 4Q4X1 1R1A2 1VB4A 2BUKA 4GMP3 5CFCA 1B35B 4PDWA 5BNPC 1EV12 1VBC1 4CDQC 4RS5A 1QJU3 4N53C 4QPIC 1POV1 4Q4V2 1VBD2 3ZFEB 3ZXAC 1F2NA 4RR3A 1OOPB 1RUG1 1QJX3 4RQPA 1FPN2 1HRV2 2HWF3 3DPRC 1D4M1 5JZGB 4QPGA 3JD72 3VBSA 2XPJA 3NAPB 2RM21 1PVC2 1AR92 4IV3A 1ZBE3 2HWB2 4YVWC 3JB8A 1COV2 3VBUB 4CDWB 1NCRC 1NCQB 1DDLA 5CFCC 4EJRA 4PDWC 1H8TB 1TMF2 4CDXA 2RS51 2RS12 1R092 5D8AA 1R1A3 1VBA3 4Q4Y1 1NA1A 1EV13 2RMU3 4RR3C 3VDDB 4Q4W1 3VBRB 4BCUA 5FOJB 4Q4V3 1ZBA2 2RS32 3LOBA 1VBD3 2HWD1 4GH4B 2R072 1PIV3 1SMVA 1MEC2 1PO11 4CEWC 1RMU1 1OOPA 3JD73 5FMOL 1RUD1 2R062 1PVC3 4GMP1 5ABJB 4Q4X3 1HRI1 1HX6A 1QJU1 1AUYA 1VBC3 1AR61 2WFF2 1AR93 2ZAHA 1POV3 4WM8B 4CDXC 3M8LA 2BFUL 4RFT0 1QJX1 3CJIC 1ASJ2 1NY71 1NCQA 1VAKA 4FSJA 4LLFA 1H8TA 3ZFGC 1ND2B 5C4WB 2RM23 1RHI2 1Z7S1 1ZBA3 4CEYC 1BBT1 1AL22 3VDDA 4CDUC 2ZZQA 2R073 1K5MB 5BNOB 5DDJ2 3ZFFC 5C9AC 4WM7B 5A32B 1R1A1 1NCRB 1AR72 1EV11 3VBFC 4Q4V1 2WFF3 1A6CA 2WZR2 1VBD1 1C8NA 1RUI2 1RUC2 1FPN1 1HRV1 1ASJ3 1RUH2 3JD71 5BNNC 2QQPA 1PVC1 4CEWB 1AR82 1ND3A 4IV1B 1RHI3 4AEDA 1ND2A 5C4WA 1FOD2 1HRI3 3VBOC 1AR91 5GKAC 5AC92 2BBVA 1AR63 5K0UB 1X33A 1COV1 1K5MA 2WWSA 1TMF1 5DDJ3 4Y5Z0 5A33B 2PLV3 4WM7A 1HXS2 2MEV2 1ZBA1 2RS31 5C8CA 1Z7S3 4JGZA 4N43C 1BBT3 2R071 1RUI3 5L7OC 1MEC1 4JGYC 1VB2A 1RUH3 2HWC2 4YVSB 3TN92 1ND3C 1CD3G 4CDUB 1MQTB 5ACA2 5CFDB 1PGL2 2R061 4RS5C 1R082 1AR83 1C8M2 3VBHB 2ZTNA 5C9AB 2WFF1 5AC93 2R042 4RQPC 1B35A 3S6PA 1HQNA 1TME2 4QPGC 3VBSC 5K0UA 1ASJ1 1FPN3 1HRV3 3ZFEA 1VBB2 1X36A 2X5IB 5A33A 5JZGA 2MEV3 1RHI1 3NAPA 1AL21 2HWE2 4IV3C 3JBG2 1RUJ2 2Y26A 3J8F2 5BNPB 4CDQB 2HWC3 4N53B 3TN93 3VBOB 2HWB3 1OHFA 4QPIB 5D8AC 1COV3 5J98B 5DDJ1 5ACA3 1NA1C 4YVSA 1TMF3 1R083 2PLV1 3VBUA 4CDWA 1MQTA 1C8M3 1AR71 2RS13 1R093 1B35C 5CFDA 3DPRB 2WLPA 1PO22 2WZR1 4SBVA 4GB32 5J96B 1AYN2 2RS33 3ZFEC 1PGW2 1RUI1 1RUC1 1OOPC 3VBRA 2GH8A 4NWVA 1RUH1 1MEC3 4N43B 1BMV2 5JZGC 4GH4A 3NAPC
chains in the Genus database with same CATH superfamily
4R9AA 4S2HA 4P9IA 3BODA 4R4ZA 3ZOIA 4JRAA 1FXZA 1IS3A 1QQP2 1BHGA 1QY4A 3M1HA 4PDWB 3RYKA 4FAGA 5CFCB 3FUQA 3LZZA 3D82A 5AC91 2Y6LA 2ZHMA 3WNXA 2HJIA 4K8FA 5L9RA 2ZHNA 1SQ4A 5ABJA 3H8RA 5T5JA 3KSCA 4M01A 2DU0A 1SBDA 1QJZA 1VRH2 2FCUA 4PF5A 4XUOA 4ZXEA 1H8TC 2G4IA 3PURA 1PMIA 1CPNA 1UD1A 3FBYA 3I2GA 1HDKA 4QDQA 3TWIA 2HWF2 1F8VA 4IGQA 2JWPA 4XDOA 2VVEA 3GF6A 1UU6A 5FRAA 2K9ZA 3ECQA 4Q0PA 2MEV1 2VOXA 1JZ8A 2BTVC 3RI9A 1PO23 3MPBA 4PJYA 2WAAA 3GZUC 3NNGA 2P4EA 3ZXDA 4YARA 4LTAA 4MX3A 5IT6A 5SV5A 2EALA 3HNMA 3U10A 1FMD2 4GH4C 3N7KA 1AL23 1XNCA 1E5RA 3Q8FA 1MACA 2BWAA 5FZMA 5C71A 1JOPA 3H8XA 2RDRA 4YWAA 2Q8OA 2HWC1 4BIOA 3ZN4A 3LA3A 5GZEA 1GBGA 1V9U2 3PUQA 5A3LA 2EXJA 2J22A 1MZEA 1OPOA 1R081 2P1BA 1Q8PA 2WNUB 4XJ9A 1H0BA 4ZU5A 5FYMA 4YW6A 5BNOA 1C8M1 4UFMA 2Y34A 3WY6A 5ABJC 3ZSMA 1LHWA 1AR73 4V1PA 5FBJA 5A32A 1PK6A 3MLLA 3M3QA 3TNPB 4OI4A 5JIAA 1OA4A 1UY2A 2CAVA 4NR1A 4YYOA 5F8PA 2WZR3 2DCYA 2QZ2A 2RMU2 3LEKA 1H2MA 5FZLA 2DVBA 2QKDA 1ZRIA 1VRH3 1WA4A 4UF0B 4MOAA 4WBBA 1RIRA 2VZTA 4H2AA 2LRPA 2C9KA 1PIV2 1OKOA 4QQHA 4D0QA 3ZX7A 4DNYA 5KXEA 3BTXA 4XCAA 5FY5A 4XAAA 3GCWA 5DG1A 4NPRA 3S5QA 3ZYRA 4A42A 4QHOA 5IVCA 2ZGOA 3AZVA 1GNHA 3B00A 4L11A 1FMD3 4YG3A 3DF0A 3P3PA 1G7YA 3OEBA 5BYNA 3PJYA 1N3OA 3B93A 5F5CA 5BNOC 2DVDA 1JYNA 3MF9A 4QB2A 1V9U3 3PL0A 4MGYE 1S1AA 4WM7C 1H9WA 4YW7A 4YW1A 5F32A 2Q8CA 3RMXA 3ZN5A 5HV4A 1Q56A 3OGJA 3R4DB 3JZVA 2XWBB 4CCJA 3I54A 3I59A 2OQ7A 1WLTA 3TOJA 4MGZE 1YQ8A 1HXS3 2BQPA 5BNNB 1OA3A 2EIBA 2ZGQA 2RM22 3H3LA 2D6PA 3LWCA 2NP0A 3KWVA 4E8DA 4CCEA 5JMOA 4R9CA 5BY5A 3TEWA 2WR9A 3HT2A 3POIA 3RGBA 3NQHA 1WKYA 5GZFA 1WUVA 3VB9A 1FX5A 3E97A 3FLRA 1PNGA 3PTYA 1D2QA 3WLUA 2Q1ZB 1UYXA 2QBXA 5FP3A 3APBA 4R4XA 2QQIA 4YRDA 2HEVF 5KXCA 5LZ6A 5LK5A 3VZOA 1XU2A 4XVHA 5IW0A 4YZ5A 1H1MA 5I8TA 5LEJA 1O4TA 4TYSA 3RPQA 3FZ3A 1HW5A 3SCFA 2RS52 2GP5A 4NPMA 2W1SA 4Q4Y2 3WOGA 3WF3A 2LALA 3GALA 4IQPA 4Q4W2 1D0GA 5C3SA 4HKOA 2KD7A 4J25A 4XJUA 4XZUG 5DQ0A 4CU7A 1WMEA 1XBFA 4B29A 2BPA2 3AVRA 4CXXA 5L7OB 5JVVA 5H9RA 2UWBA 4E4ZA 1OURA 1UL9A 3RDIA 3OUHA 4XFIA 2DF7A 1MS9A 1BK1A 2VY0A 2R6QA 5FO9B 3BKZA 2BGPA 1YQ2A 3K4AA 4MHRA 4TN7A 3WV6A 4BXFA 3Q9OA 1QDCA 3DV8A 4JQTA 4CPBA 1DCSA 2GSYA 3KCYA 5T50A 3JBG3 2ID4A 5FUPA 5I93A 3E5QA 1HRI2 1OUXA 3FWEA 3OBAA 4F8AA 2GP3A 5CFDC 5JCTA 4YM2A 1GWMA 1LCLA 4MXWB 1W0OA 1W2OA 4I01A 4MXVA 4QPGB 3J7HA 3L2YA 2WS91 4LE4A 1OF4A 2RR11 4HZFA 1ENRA 1LTEA 2WQ8A 3CLPA 3EHKA 4FP2A 4Z1VA 5FY4A 2PTMA 3RG0A 2RS53 3EMRA 4XBLA 1QIQA 4YGDA 3TB0A 4Q4Y3 3GYDA 4RHV1 2I45A 2XJSA 5A7SA 4EN9B 2BU9A 3AXEA 1GKBA 4FFHA 4Q4W3 1FV3A 1VBE1 2W52A 3PU3A 5FP4A 4IE5A 2W5FA 1GFF2 4IV3B 4OFGA 1AZDA 2KR2A 3HD8B 1M4WA 1ENXA 2WNVB 1XYPA 1W2AX 1HIXA 2B5HA 2WSVA 5A3OA 1SLCA 3K4DA 3CL1A 2FQPA 1T6GC 3IMMA 2QQOA 1YFXA 4BDVB 4BLJA 4IEXA 1WW6A 4B7EA 1UOJA 3IIIA 4IETA 3WNOA 1EAH1 1CZTA 1UY1A 1WBFA 4Q4X1 4Q5OA 2BUKA 2FDKA 1AX0A 4GMP3 5BNPC 2WT1A 1LR5A 1ULCA 2P34A 4QPIC 1POV1 3A23A 3P6BA 2WFPA 5CB7A 4EN6B 4YFZA 3VD9A 3SITA 5L9VA 5GLUA 3LQCA 5F3CA 4RR3A 5CZKA 3NV1A 1GZWA 5J36A 4QDSA 4HL0A 3TBDA 4YNIA 1AVBA 4EQVA 2XPJA 2WO1A 1U5XA 3FC0A 1JTZX 4NHKA 2YU1A 4ONUA 3UT0A 3EB7A 3ZVXA 4AFCA 1JYWA 3KCCA 4K20A 4JQRA 2AUYA 4MVTA 2JIJA 3GHNA 2UYBA 1ULEA 1XXNA 1SLTA 3VV1A 3WDVA 1US3A 4XJZA 3KZ4C 1A8MA 4ZXKA 2VUDA 5LBCA 3RFRA 4EN8B 4LITA 5LBFA 1OLQA 2NQYA 3AM2A 1ZBE3 4XABA 3MO4A 3JQWA 2C4XA 2WZPP 3UKVA 1ALYA 3W20A 2UURA 4EJRA 1H8TB 2OQ6A 2JDYA 1EP0A 4DOUA 4CDXA 2O0OA 4W50A 1NA1A 1UXZA 5J3UA 5J09A 2B4KA 1IQDC 4RR3C 4A3XA 3N9LA 4BCUA 3MIFA 1DYOA 3ZYHA 3L9JT 1F4AA 2RS32 3RZKA 1DQ2A 4P02B 2PYTA 1C3HA 5D21A 2PAEA 3O0XA 4GH4B 4LKDA 3ZKUA 3BUCA 3DL3A 1O4ZA 3AMHA 4FXKB 4OUMA 4AFBA 3TEXA 1PO11 1S0IA 4Y24A 4CEWC 4OZOA 5DG2A 1RMU1 4AW7A 1AJKA 3WCSA 4BISA 4NMIA 2LTNA 4ZZ8A 2VVFA 4XE9A 5FMOL 1Q43A 1W9SA 2BP6A 2R1DA 3WG3A 3WNPA 1E5IA 1RUD1 3W5MA 2R062 4P9XA 3WD5A 1KXGA 3CJXA 4O7XA 1ZZ9A 4FO9A 4OI2A 4AVAA 3K48A 4MGIE 4O61A 5FK8A 5ABJB 1ZRCA 1F15A 1HX6A 2GC3A 5FP7A 3SHRA 4LT5A 1CN1A 5FPLA 2J1EA 3AP6A 1ZRDA 3ELNA 4E9KA 2ZAHA 4BM8A 3VKOA 2VQTA 3IDBB 1TZOA 4A6OA 3D6EA 3LFMA 4CDXC 2GMPA 3SH3A 2BFUL 3AYDA 2AENA 4RFT0 4V2WA 1XQNA 2VZ3A 3OY8A 4GKYA 2OPKA 3CJIC 5CKMA 3LIGA 3DYPA 3WXPA 1NCQA 2R0FA 1VAMA 3CHXA 4LLFA 3ZFGC 2Y38A 2DYCA 2P6CA 3E5UA 1KJRA 4AXOA 4BHPA 1AX2A 1GLHA 4D7TA 2ZACA 1RHI2 5E16A 4QQ2A 4C91A 5JUVA 3SCGA 4CEYC 2VW1A 2GNBA 2VL4A 1Q3EA 2OKXA 4YGBA 1NZIA 1STMA 3FX3A 3I3EA 4QB1A 2ZZQA 5EWSA 2BVVA 4XEZA 2Y0OA 1OUSA 3NV2A 1YQ5A 2K46A 4COZA 3M70A 5BNOB 3VD5A 1TNFA 5H9QA 1UWWA 4HT1T 1W0NA 3BPSA 1MZ5A 2W68A 3MGUA 2ZCWA 3D5OA 5C9AC 4WM7B 2GH2A 5A32B 3HN3A 2BRTA 5IATA 1R1A1 4JAAA 4QKFA 4ATFA 3I3BA 4XOGA 2XKPA 3OUJA 3WCRA 4YGCA 3PVEA 4LLOA 1W6QA 2XL9A 5A7NA 4Q4V1 3TEYA 4D6QA 4L99A 4PT6A 2WINB 5I0DA 1DF0A 2CDOA 1OC1A 2Q4SA 2WDBA 3G7DA 5T54A 3UK9A 3VKFC 1C8NA 3THTA 1C1LA 2EXHA 2RJKA 2EXIA 1FPN1 1OQDA 1RJ8A 4E4SA 5KXDA 1N1YA 1RUH2 1MR5A 4LBNA 1ACCA 4M4PA 1U12A 1LOBA 3R0RA 2IUWA 4Y1VA 2QDNA 4YM1A 2JDMA 3N9NA 5IK8A 2QQPA 3ZM8A 1AR82 4JTOA 4AEKA 1RHI3 4AEDA 4A7YA 2XJRA 4MGQA 3WF2A 1D2SA 5FZ3A 4DZGA 1QOOA 4WVZA 5F6KA 1FOD2 5AFBA 3VBOC 4BZ4A 4EWDA 4CXYA 1FV2A 2BBVA 2TUNA 2JG8A 3MLKA 1D0HA 2VPVA 3WNNA 1X33A 3WDWA 2GC1A 2VMCA 2XH6A 3KT7A 5IVVA 2WQZC 1W2NA 1TMF1 2UWAA 2PHFA 3I8TA 4TWTA 3I59B 2ZS6B 1NX9A 2P5BA 4H7MA 5CU1A 4FQ4A 1RGSA 3D8CA 3SXWA 5DUVA 3KVBA 3NV3A 3QBQA 2VBBA 4Q29A 2A71A 4XCBA 4BWOA 1ZYBA 4Y4RA 3GBWA 2L9LA 2WIIB 5J37A 1C1FA 5C8CA 4XUPA 2E63A 4Y33A 3F2ZA 2XXZA 4JGZA 5C8WA 3WNMA 1BBT3 1Z78A 2R071 3VHRA 1G9DA 5DZGA 5F39A 4AFAA 4PBPA 3NL1A 4W6XA 4XFCA 1MEC1 4L9BA 5A7PA 3BCWA 1RUH3 4LORA 3VLBB 2X09A 2YBSA 5ACA2 1YIPA 4IERA 5FLIA 3PMSA 5CFDB 1REFA 2J1TA 1XU1A 2E51A 1JZ6A 5LBEA 4TZDA 4OLLA 1AR83 2XDVA 3GM8A 2BBAA 4DMIA 4Y5TA 1Z0HA 3LPGA 4I0BA 2WO3A 3BYWA 1U5YA 2R042 3I4IA 2E53A 3N7MA 1TME2 1O3SA 3WVJA 4LJHA 4YZ4A 5DN2A 3U0ZA 5K0UA 2XLAA 2YG0A 3M3EA 4ARYA 3OGRA 5CG9A 1HRV3 1UMIA 2PQQA 2W39A 2AR6A 1F35A 4I0AA 1YWKA 3GZEA 4W6YA 4FBFA 1GR3A 1JYCA 4MV2A 5JR2A 4XZPA 1AF9A 3NAPA 3A0NA 4XACA 3OBZA 1OSGA 1POQA 3KHBA 1AL21 1CAXA 1JYVA 3WUDA 4E4DX 3B9CA 4OMCA 3N7JA 3GDBA 1RUJ2 1K12A 2F4PA 4QM8A 1PMJX 1GP4A 2PFWA 4PIXA 1UZVA 5BNPB 3KF5A 5JOYA 3UETA 2DVAA 4AL9A 2HWB3 1J83A 4QPIB 4XBNA 4XXAA 5D8AC 3VDAA 5ACA3 5FOBB 3FL7A 1IGOA 5IAXA 4YVSA 4ARXA 2PLV1 3VBUA 4YG6A 4K1ZA 4P5HA 4CDWA 1MQTA 3D0JA 1OH4A 1AR71 2B39A 2RS13 2Z4FA 1OFSA 2W08A 1QXPA 3VD3A 3VUOA 3T0DA 1NLQA 5FZHA 4KI5M 3FLPA 4AFMA 2G9FA 4OULA 3QCWA 5B4XA 1HN1A 1A3KA 4ZHNA 1LB2A 2WZR1 4SBVA 1X9TA 3BN6A 4GB32 1LOGA 1LOEA 1W90A 4LHSA 4YFWA 5HCHA 5A3UA 1PGW2 1RUI1 1XNBA 2WZ8A 1OOPC 4TSVA 2GH8A 1PM4A 2DFCA 2VUCA 4U2AA 5FMBA 3B3QE 4E2GA 4F3JA 1VMFA 5LASA 3FE5A 4UOJA 1BMV2 1Q8VA 2OIIA 4JHZA 3NAPC 4QX8A 1TEIA 2W1QA 3H3ZA 5FZOB 2R7EB 3HOBA 1G86A 4X8NA 4KBBA 2DWRA 2MPFA 1BEV2 5IK4A 3ES4A 3NW4A 1VPHA 5E6HA 3GHMA 4CU8A 4LBQB 4L8QA 1IG0A 2CU5A 4LHKA 4PBOA 3RYRA 4A7ZA 5HXVA 4CDWC 1RUF2 4FTEA 4RR3B 2IXJA 4NAOA 5LATA 2W95A 5APAA 4FPGA 1OF3A 2IVJA 1CJDA 2VQUA 3R05A 5EP9A 4K1YA 1J3RA 3NJZA 4CYDA 3G6JB 3AP4A 1HXS1 1S2KA 4IE7A 3VDDC 4QU1A 3D0SA 1D7PM 4LHNA 3RYPA 2JIGA 3IBMA 1W06A 5F5IA 1SPPA 2ARXA 2OA2A 3LEMA 2QQVA 4GB33 4GZ9A 4Y4YA 5L9BA 5LK7B 4FT8A 4YZ2A 2WN2A 4LO5B 1SBEA 3HBZA 4XETA 5GJ6A 3N4MA 3ST7A 5BNQA 2DV9A 4XQDA 1V6JA 1DYKA 3OGSA 3GCXA 4MO3M 1AYM2 1RUNA 1WCKA 4GA9A 4MHUA 4QM9A 5KBFA 1QOSA 4AVTA 2A3WA 4CVUA 2W87A 3LSEA 2D6OX 4CDXB 2H6CA 2ZMLA 4LHLA 1R091 3AP9A 3ZDSA 4BQXA 3C3VA 1JYXA 3CJIB 3FJSA 3O0VA 4N8MA 3VZKA 5LW9A 1VBA2 1IHMA 1LECA 1NCRA 3HNYM 3OEAA 1KD7A 3O12A 3ZFGB 4CCMA 1LJ7A 3D3AA 3Q8EA 3I49A 3THCA 1RUF3 2VBDA 3DXUA 1CONA 2ET1A 1DZRA 3MUY1 1HB1A 4CEYB 2Y0IA 1Y3TA 2W1WA 4HSJA 2ADDA 1A78A 2D97A 5JAXA 2JDNA 1ND2C 5C4WC 1UKRA 2ENRA 3TRSB 4P9LA 4EYUA 4QB6A 1DP0A 5FYYA 2VMHA 1Q8OA 1WCSA 2NZ9A 1IG3A 2VXRA 4AQ6A 3LA2A 4HOOA 5DAVA 1NYWA 2QQUA 3JBG1 1X9PA 1OVSA 4D94A 4ASMB 2FHRA 1CR7A 1IPJA 4FFIA 3J8F1 1GP6A 3BOWA 5KXBA 3WINE 4XJ8A 1VBC2 3WQ0A 3WQ1A 3OY8B 4LO4B 1AYM3 3J7LA 2V09A 1XNTA 1FNZA 4P14A 3VHPA 2W9XA 1RUG2 5CYYA 3CIHA 4A45A 1QEXA 1ULDA 2ZZJA 4WVVA 3ME2A 5KWRA 3HN1A 4FI9A 1D4M2 4QAWA 5F3EA 4RN5A 4K8RB 4Q0UA 4BE3A 2ERFA 3OYWA 1POV0 4OHWA 4FXGB 1XC6A 2R16A 2CHHA 4K7JA 1G8WA 5ANNA 3MZHA 1CAUB 1U5ZA 4E8CA 2DUQA 5JR7B 1PM7A 3CDZB 2BWCA 4CDUA 2WA3A 5T52A 2BZDA 3HNBM 1XNKA 5E8AA 1WW5A 1W6QB 5H9PA 2Z5WA 4XF0A 1DGWX 1GQGA 1L7RA 4LXLA 5CVRA 3VBUB 2FBEA 1AL0G 3VBHA 3ZFFA 4LR4A 5HCBA 5FO7B 4FAHA 4QX7A 3WHTA 4XPVA 2GNTA 2D3RA 2ZGLA 3PUHA 4HK9A 4LK7A 1W8NA 3ZXFA 4H7LA 4XF4A 4PHZA 3ETQA 4SLIA 3VBFA 1VBB3 2HWD2 2CGPA 3CNAA 2R30A 5FYTA 1RUG3 3O1OA 1GZ9A 1ST8A 5IVEA 2ZABA 4TLGA 1OD3A 1D4M3 3NSTA 4BK4A 4KWKA 4EN0A 1KDMA 5SV8A 1L3JA 1ODNA 3ZR5A 3FHAA 4AEDB 1NKGA 2XVGA 1YCIA 2WKKA 4AI3A 4DO0A 2AC1A 4Z92B 2HWE3 3EJKA 4CTEA 2V5YA 1UX7A 4FQZA 4MYEA 2JG8B 3WF4A 5EJ3A 1E5SA 1QJU2 5IVYA 5A6XA 5CISA 4E27A 4LPLA 4XUTA 5JSOA 3CU7A 2ZEXA 1AR62 1KDKA 3T4HB 1ZBE1 4KMQA 1ZA7A 4AI9A 4N53A 2XBO1 1O3TA 2HBUA 3F95A 3VBHC 3MW4A 2XGXA 3PUAA 2B42B 3OSDA 4Q1PA 1APNA 2VG9A 5IFTA 2G9GA 1NY72 4QKNA 2PLV2 1RYYA 4NIIA 1W03A 4MUVA 4DY5A 5C8CB 1RUE1 1NT0A 1S0DA 3QACA 4HPKA 4JGZB 1AYN3 3C2UA 3H1WA 4QX0A 5AVAA 3AC0A 5FPAA 2IZWA 2D44A 3H1MA 3MF6A 3QD6A 1Z7S2 5FYZA 1A8DA 5A7QA 1LHNA 2Z42A 5F1RA 1Y9GA 1SBFA 1JODA 2HWD3 5FY0A 2CWMA 1KEXA 1U5IA 2R49A 5KR7A 4AHYA 3HQRA 3MDPA 4HK8A 1QJY1 4N43A 2C9AA 4RFRB 2C6SA 4UW4A 5FZ1A 4LIVA 4JDNA 3V0BA 4KWLA 5D8AB 4JGYA 3ZYBA 4Z82A 5B4NA 1QQP3 3MUZ1 1RVF1 4M0NA 3UESA 4AEJA 5FUNA 3SC7X 3VHNA 2VOTA 4YVWA 3K4ZA 5K9YA 1EY2A 3VL9A 5GLVA 5GM0A 4CXWA 3WUCA 4RS5A 1QJU3 3CQOA 4N53C 2KXLA 2OS2A 3UJQA 3ZN6A 4OHYA 3AMQA 1XSRA 1VBD2 2XHKA 1O8SA 2ZOEB 4NE9A 1F2NA 2X53S 2W2IA 1O91A 1OOPB 2GU9A 2QJVA 3NVCA 1T6BX 4NHMA 2HWF3 4OVEA 3QH7A 4K40A 1OA2A 3JD72 3VBSA 1QGLA 2BGCA 3NAPB 2ZGRA 1UZ0A 5A3NA 2ARAA 5ERLA 4LA2A 2BW8A 4OQ9A 3ZO0B 1OI6A 3PIJA 4EWEA 3B69A 5KHIA 4GD4A 3S30A 2W91A 1YQCA 3IAPA 3GGLA 2I74A 2AEZA 1PK6C 5FJKA 2DCJA 4YVWC 1COV2 2YBPA 4XC9A 1QWRA 3PJQA 2DBIA 4OHXA 2Y6JA 4CDWB 3U78A 2V5DA 3H9AA 4R52A 4AHZA 1DDLA 2GNDA 2E26A 3OJBA 3AX4A 5LY1A 1H30A 2DCZA 1ULFA 2PA7A 4PQQA 5JMCA 5GLZA 1R092 1XE0A 4Y26A 5F7UA 2RMU3 3VDDB 3MI8A 3KV9A 4JVAA 5FOJB 2DUOA 1LNSA 4GULA 4G4FA 4GWNA 4OYUA 4CU9A 1CIYA 1L7QA 2Q0AA 2ZGPA 1VBD3 2WO7A 2XHNA 3IPVA 4PLNA 5HV0A 1PIV3 2VC9A 4RL7A 5C7GA 4AK3A 1GWKA 2ADEA 1JI6A 5FO8B 2WO2A 2DDUA 2V72A 1BVP1 5F6LB 4FPHA 4EROA 1MS8A 2JEMA 3WF0A 1WZXA 1YNAA 2A3YA 2YXSA 3E6BA 5I0TA 3JD73 4HVOA 4BQWA 4EZ4A 3T30A 1IKPA 3PLQA 2JD9A 4P00B 3WNLA 5FAXA 2G9ZA 5HPOA 1JH5A 1C4RA 1K5JA 5FTTC 3SISA 3KLSA 1AUYA 5G04L 5FPUA 1RXFA 5JOWA 1LRHA 1HB3A 4LNVA 4BLIA 1YI7A 2BNMA 4Y1UA 2NMOA 2W94A 3M8LA 4Q8LA 2XKOA 1OPMA 2YDEA 2Z2SB 5FZEA 1QJX1 4AYUA 4FFGA 1SCSA 4HMZA 4IUGA 4LOTA 4B4QA 4E4HA 1V6IA 1ASJ2 1W6MB 1FNYA 1W9WA 1WMDA 4NIGA 2VZQA 5DPNA 4YW4A 1VAKA 2E31A 2HEYF 4CUCA 1C5HA 1SPPB 2ETEA 4UI9L 1DLLA 3RMYA 4BQYA 1ND2B 5C4WB 2RM23 3AKRA 1LGCA 4Q0SA 1BBT1 3AYCA 4HG6B 1YEWA 4L92A 4ZS2A 3UYJA 3ZSEA 2ZEWA 5FIXA 3LFIA 2JDPA 4NHXA 1JZ3A 3USSA 1CAVB 1I5ZA 2CAUA 4NVPA 5T3NA 5LB6A 2GC2A 1JOBA 3OB8A 5DDJ2 4Z07A 2WL1A 4Q27A 1N3PA 3LEIA 2QQJA 3AKSA 1W9YA 2PELA 5LY2A 1NCRB 1QJEA 2E7TA 2MNGA 1EV11 5FXVA 5FKCA 4XHXA 3HMYA 3W5NA 3QOPA 1W05A 5FFOC 3POEA 2HH9A 4F7ZA 1W2TA 2WN3A 1KFUL 3OBTA 5FP9A 1XYOA 1JYTA 5FY8A 3LCPA 3A0KA 1C57A 1JU4A 1UQXA 3J7NA 4J6GA 4S2FA 2AH2A 4A3ZA 1JHNA 5J1XA 4UFHA 1RUC2 2BGOA 2Y8KA 2ZEZA 4FPCA 1HRV1 4IE6A 4ES9A 4LO7A 1YUDA 3HEIA 1ASJ3 3O14A 4AGVA 4JHTA 5EQUA 2I2SA 1S0GA 1LHUA 3AVSA 4G3YC 4DUXA 4K9SA 5FLHA 4IEWA 1PVC1 4DUVA 3C8XA 1ND3A 5FZ7A 4ZS3A 2BOIA 5FREA 2V4VA 2GAUA 4XUQA 3RJRA 1HRI3 1H1AA 4V2VA 2WJSA 1AR91 4IEUA 5F2SA 1S55A 3USUB 5AC92 2RVAA 1C28A 5IWFA 5FPXA 4AAPA 1GYKA 3MEPA 3ZXKA 2JDKA 2BVBA 1K5MA 3VD7A 3P5BA 4AQ2A 4A41A 5DDJ3 4Y5Z0 2ZAAA 4AQTA 3IAQA 4XXPA 2W47A 4AZZA 4UYBA 5A33B 4NN0A 2J1RA 2NPIA 3N9QA 2W1UA 1PMHX 2IC1A 1KITA 1W8UA 3OYWB 3TAYA 2MEV2 1I9RA 4AVVA 1ZBA1 4ET7A 4XIOA 3U75A 2UU8A 1QDOA 4AG4A 1UYYA 4MADA 1VB2A 2HWC2 1ND3C 1UXXX 4UW3A 4R9DA 4AOCA 4CDUB 1U0AA 1QF3A 1UIJA 1VMHA 2G1MA 3T09A 3LAGA 3V0AA 2CSGA 2WWUA 3HBKA 1R082 4FP3A 3AYAA 4BQ5A 4XJAA 1C8M2 3VBHB 2D3SA 2KA3A 4P9YA 3SKVA 5CA6A 1REEA 3A22A 1EYBA 4HVRA 1LESA 2JG9A 4YM0A 2JKXA 3MIBA 2WFF1 4CP9A 5AC93 4CA9A 5IYYA 1B35A 2R1BA 3OG2A 3S6PA 3CEWA 1WCUA 1P8JA 1YFUA 1QJFA 3POFA 4AE2A 3AK0A 3S0MA 2J42A 2CL2A 2H6BA 3BALA 4C1XA 4LBJA 1X8EA 3DGTA 5FXZA 3SH4A 4AHXA 3MLJA 3NWKA 2WNOA 4MGKE 4AVBA 4RGKA 1S0EA 1QH7A 2UY9A 4M3CE 3VZNA 4MLOA 5C3QA 4URAA 4KH9A 4Q0VA 3T08A 1GU3A 1UZYA 1QOTA 2MEV3 4URTA 3TYJA 3I2OA 1IPSA 5FYUA 1QHDA 3A21A 3NNLA 2R32A 5JXGA 3MV11 4YW2A 3M3OA 5EYXA 2H0BA 3ZIXA 3V65A 1IOAA 2Y26A 1I1EA 5EYYA 1VAVA 1H6XA 3MBWA 3NJYA 2LROA 1HN0A 2WNEA 3MIDA 2HWC3 3I3QA 4N53B 4QQOA 1OHFA 2VM9A 1IS5A 3M3IA 1I5PA 4N9IA 1S0JA 4M00A 4ATEA 1TE1B 1NA1C 1PVXA 3ETPA 3RZGA 2YU2A 1R083 4WVMA 2WZEA 5EV7A 1C8M3 1B35C 3LDBA 5EIYB 2PAKA 2WLPA 4BB3A 2YHJA 4QXCA 3HPNA 5A3TA 1GSLA 2XG3A 5J96B 2D3PA 2RS33 4N9HA 2BJSA 4LK6A 5A6ZA 4D7SA 3VL8A 1BJQA 5IJRA 3OD4A 1JS9A 1YC61 2Y60A 3ILNA 1F31A 4N43B 4RGAA 4XMAA 4Y1XA 3RQ0A 4BOWA 3FFQA 3V0BB 2AZ5A 3J26N 1F9KA 5DAXA 4EV0A 5A3WA 5K4LA 1PK6B 2R063 4ITCA 4YVWB 3THDA 4ZZ5A 1W9FA 2CTVA 3AZWA 3PMEA 4IGOA 1LULA 4XDQA 3ZN6B 2VH9A 1LENA 4M3CA 5FZGA 3AP7A 4WVWA 3A7QA 1NCQC 3OPWA 5FV3A 5JXJA 1BYHA 5T5OA 1HV1A 3POSA 4IEYA 4LO6B 1NQJA 3AJYA 3AZZA 1RB8G 2YROA 1WCDJ 5A7WA 1V6MA 3WDXA 1CAWA 4P9WA 4QX3A 3ZR6A 2QCSB 1QJX2 1N1SA 2CGOA 2XL7A 2JDHA 1MPXA 3V56A 5FDBA 3JQXA 3CKHA 4JC1A 1GICA 3PU8A 4HKLA 1XB9A 1PZ9A 2OYZA 1VLNA 2E7QA 3HVDA 5DAWA 5LBBA 2IWGB 4BK5A 3ZYIB 5FZ0A 2J7MA 1DFQA 3H50A 2GNMA 3HAGA 3LIHA 1J59A 3LDRA 3B01A 3NNFA 1N1VA 5FUIA 2WT0A 4UBGA 3TN91 3T2TA 1WBLA 3PUSA 1NE4A 5FZKA 4X8PA 4Y22A 4C0HA 3M2MA 4BQ2A 1PGL1 2YUEA 1JYIA 1RUOA 2YZ4A 3ACIA 1ZX5A 4WZCA 2FZ2A 5IVJA 1OLME 4D8MA 4NOTA 4C8DA 1SCRA 3UV9A 4COUA 1ZZBA 2IXKA 1WWYA 1IKQA 2RR12 2WS92 3KM5A 3KQRA 4IESA 2ATFA 2ZBJA 3ES1A 4DXTA 4CCDA 1QU0A 4JDOA 4OZXA 4RHV2 5J7MA 2WT2A 3MIHA 1KQRA 4XURA 1VBE2 1NLRA 1VBB1 3IDEA 1J3QA 4K21A 5A7OA 1L7LA 1UN1A 4AEDC 4XFFA 5FYVA 5IVFA 2WQ4A 2PAMA 1W8TA 3DN7A 3H0OA 2RDNA 2A1XA 3FHQA 4DEQA 4NWWA 5KHJA 4CPBD 3MFCA 2JG8C 3TEZA 2HWE1 3JU9A 4PIZA 4P9JA 2UYAA 4YLZA 1GV9A 2ZGUA 1FOD3 1EAH2 3AL6A 4Q4X2 3T2PA 1ENQA 1W28A 3ALQA 4CRQA 4FOYA 4QX2A 5LA1A 1RL3A 1RJ7A 1NZCA 4HN1A 2JDUA 2QQNA 5C8CC 3QLQA 2ZKNA 1OMIA 3PTRB 3AZXA 2WS93 5C5UA 2RR13 4JGZC 3KD4A 3I2HA 1PO21 4PQ9A 5FZCA 1JZ5A 3BIWE 5I0RA 3ZSJA 5JPMB 3UGFA 5C70A 1AYN1 1NLSA 4CUAA 1ZZ6A 4YPJA 3U11A 2ZXQA 4RHV3 1MS0A 2OVUA 1OLMA 2E33A 4OHVA 3WW4A 1DZTA 2C26A 2E32A 1VBE3 2ZX3A 5EHDA 4NPLA 5LRRA 3THPA 3PUIA 3LDKA 3J4UH 3VZLA 2JE9A 4BYYA 1S0BA 3PVOA 3KV4A 2HEWF 3H3UA 3IKWA 4GXLA 4LUKA 1OD5A 4CCNA 1DGWA 1H8VA 4NIAA 4ASKA 1QQP1 2CWSA 5K7PA 1WD3A 3SEPA 1W39A 2XVLA 3PVBB 4KWUA 1XNAA 2XONA 1EAH3 2P3KA 5LWBA 5K0UC 1I6XA 2R043 4LBQD 2A6YA 3ZXJA 1HJFA 4KGGA 1VRH1 3KB5A 1OQ1A 4AI1A 4LBLA 5IAVA 1TME3 3W21A 1AX1A 2N7GA 1PNFA 2F4LA 4QXHA 3KHCA 5FCCA 2D5FA 2HWF1 1UYPA 3PIGA 2EA7A 5EXOA 4DXRA 2A3XA 2EF6A 2J1AA 1GZTA 2XQXA 1PO12 3ZYPA 2HLEA 1RMU2 1ND3B 1Y9QA 3E5XA 4UXAA 3INAA 4HANA 1QXJA 4XW3A 5FLJA 4EZHA 4IL7A 2RV9A 4XILA 1FMD1 1HV0A 1UPIA 1RUD2 1DGRN 1NUKA 4D6SA 2ZX1A 4XJWA 4B1LA 4CP1A 4CCCA 3FHIB 5BNNA 5BUVA 1BCXA 1J84A 1RUJ3 2ZX0A 4Q1RA 3S7EA 4DXSA 1IQAA 4YVSC 4MGSA 5IUQA 2BNOA 3VBUC 5JI9A 1F4HA 1V9U1 1MQTC 3NKTA 4Y20A 4KG0A 2B9VA 4CUGA 3N7LA 1GZWB 1SDWA 5KHGA 2Y6KA 3O5SA 4CDQA 1F5FA 4FPEA 4UFIA 3JB4C 4FOWA 2AYHA 5DAPA 1URXA 3RS6A 3A4UA 1QNYA 1W6PA 4DFSA 4HLTA 3K46A 3S5AA 4B4RA 2RJ2A 5FY1A 3CBNA 4UFKA 2RMU1 1G9CA 1XOYA 1BVVA 3WP5A 2OW4A 2Z69A 2F17A 3KS7A 1SG3A 1HB2A 2CYFA 4FPFA 3I7DA 4PCRA 3LPFA 4KU8A 1PIV1 2A73B 4IEVA 5F3IA 1RITA 3ZSLA 1O59A 2IFRA 1CX1A 3OD0A 4QPYA 3V0AB 4AWDA 5FP8A 1PO13 3AYEA 2YFUA 1AHSA 1RMU3 3RZHA 3MPPG 1EPZA 5L7OA 4NHLA 3SKJE 1NA1B 1BEV3 2YGMA 1RUD3 1SZBA 1W8FA 4CP9B 4MGTA 1XSQA 1R1A2 1PX3A 1VB4A 4KG8A 3OF1A 4I30A 3SQOA 5IK7A 5AVPA 1S4CA 1B35B 1UW8A 3JUUA 3I3MA 5FWEA 4CDQC 1JMUB 2QZ3A 2ZMNA 4H3WA 3WW1A 4Q4V2 2ET7A 4IDZA 1JZ4A 2GN3A 1LU1A 2E6VA 2ZJCA 3I2FA 2Q8EA 2VD7A 1ODMA 4CSWA 3Q8BA 3O1RA 3ZXAC 3W59A 3SLIA 1ZRFA 4JX0A 3POYA 3SCHA 2O14A 2VBPA 4GWJA 1FPN2 4RQPA 4C90A 1A34A 2UWCA 3SNMA 4MXWA 2VZOA 4MSVA 1Q8SA 1YRZA 4QPGA 3WR0A 1GANA 5GLWA 2P3IA 3HIFA 4YG0A 4NRMA 2RM21 1JUIA 1PX4A 2D5HA 3R4SA 3W9AA 3I3DA 3LA7A 2XVKA 4NJ4A 5KC5A 4NRQA 2IXIA 1VRBA 4YM3A 3NMBA 4TXWA 4JZRA 2GDFA 1DGLA 3ZDVA 1GQPA 2DTWA 3M4FA 4IV3A 1CVNA 1H4GA 3JB8A 2EIEA 1XJAA 1NCRC 1NCQB 2QQKA 5T5PA 5DMYA 2WNVA 1LAJA 1TMF2 1AXYA 4FPOB 3ACGA 3LSDA 5CEHA 2RS51 4I0WB 2YBKA 1R1A3 5FZBA 1VBA3 4Q4Y1 2X8KA 5FZFA 1J58A 2P2KA 4FPKA 3WW2A 5LEKA 3B9IA 3RZZA 4PLMA 1MVQA 4Q4W1 4GWIA 2DURA 4YW5A 3WQ7A 4CZSA 2WA4A 2X29A 2ARBA 4Q4V3 5BPXA 3LOBA 2QQMA 1R1ZA 3ACHA 2QQWA 1PZ8A 5G05L 1UPSA 2WWJA 2R072 3WP3A 1X82A 1G9FA 2OUHA 4FFFA 3N35A 3I2IA 1MEC2 1V00A 4Z2WA 1REDA 1BK0A 5GZDA 3T3YA 4XQ4A 4KU7A 4I3GA 4OUSA 1O8PA 4LOSA 2P6HA 1ZM1A 2C0ZA 4Q8KA 5FK7A 4GMP1 2GALA 4IE0A 5F5AA 4M3CB 1KGYA 1YJKA 2LW8A 1LHVA 2YGLA 3NV4A 1HRI1 4AAXA 2E9QA 1VBC3 1ZZCA 2NLRA 2VU9A 3AMPA 3WDUA 4XDPA 4Y1ZA 4HFSA 4QKDA 1K3IA 3ORJA 2IXCA 1W8HA 5A1AA 5A7WB 4PLOA 1CAWB 1G9AA 3ZMOA 2P17A 2VNVA 3MYXA 4K3UA 4NUBA 2CGNA 1UMZA 2W46A 2ZA9A 4N7IA 3ZLIA 1GQHA 4FVVA 1DQ0A 4FSJA 4C0BA 2JENA 1OVPA 1H8TA 1S0FA 3SH5A 1CQ9A 3RVHA 5GZGA 2XJUA 2JX9A 5JSRA 5T55A 2VMIA 5IK5A 3GBFA 4F83A 2QTWB 2XR4A 4E2SA 1W8OA 1AL22 4XBQA 2EAKA 4CDUC 4BQ4A 2R073 4Y22B 3MHZA 1ULOA 2ORXA 3LOIA 4DIQA 3BU0A 1LEMA 3WW3A 5C6CA 3OPTA 4CCLA 1HLCA 2RJLA 1TVGA 3ZFFC 1ZREA 2VNGA 1JXNA 3LB9A 3B5LB 1K42A 1AR72 2ES3A 1NXMA 4X6QB 3AXDA 5CIRA 1UAIA 1V0AA 3VBFC 1ZNPA 3NJVA 1A6CA 2WZR2 4D69A 1XPWA 4NIDA 1JZ7A 2QDRA 1RUI2 4XMIA 3VKLA 1Q8QA 4IGPA 2B7YA 2Y6FA 4ZONA 3MV01 2D6MA 2D98A 4BQ1A 2C5DA 5GZCA 2PMWB 3NRUA 3CZJA 3MW2A 2ZGNA 2I07B 2W0XA 2FDHA 2JDAA 1SLBA 4BPZA 3CF6E 4LO8A 2YFZA 3E1F1 2O8QA 3K3OA 3WZ1A 2FDGA 5GKAC 2JE7A 4LQRA 4ORFA 1AR63 2D6NA 4S2DA 5K0UB 3N9OA 3EQEA 2VZSA 4D7YA 1UIKA 4LBKA 2JXAA 4GWMA 2WWSA 4XFAA 2OZJA 5I8YA 4R8HA 4W8JA 4DEVA 2DU1A 4UT5A 4I09A 2PLV3 2VZPA 1YLLA 5L73A 5JPNB 4MZUA 1FI2A 3ON7A 5LA2A 3MW3A 4WM7A 1YFYA 1CAXB 2PHXA 1HXS2 1SFYA 4D6RA 5FBZA 1BZWA 1JN2P 1W6NA 2RS31 3IDCB 1GNZA 2Q8DA 5FQ0A 1Z7S3 4YGEA 4N43C 1WCQA 1LHOA 2FMYA 1RUI3 3MFAA 2ZX2A 1WGPA 4JGYC 3VKMA 4DY3A 5IHRA 3O1UA 4M4RA 4YVSB 5A3PA 3EBRA 1CD3G 5FYIA 2VCCA 1J3PA 1MQTB 2NYYA 5TSWA 5C3PA 2IXHA 5D2AA 2Q1FA 2R061 4RS5C 3ACLA 5FZAA 4B8EA 3H8UA 4NRPA 3BTAA 5JIUA 1DHKB 1N47A 1NE6A 4J1WA 4HSLA 2EIDA 3ILRA 1WD4A 2JB4A 2KM2A 5I0SA 2A6VA 5C33A 2EICA 2OZ6A 3HWJA 1X8MA 1LU2A 2A70A 1UZZA 2NMNA 3POJA 3POGA 5F3GA 3H7YA 3WG2A 1NQDA 4AVSA 5L36A 4AI0A 3VBSC 1SLIA 3OOXA 3V64A 2ZGSA 3GZAA 3ZFEA 3NJXA 2QVSB 3ZXGA 1QH6A 3RZJA 4HONA 4LBMA 3IB3A 4QU2A 1WA6X 4XUNA 2A6WA 3PNAA 1UU5A 5JZGA 1RHI1 1UMHA 1YQ6A 3ZYFA 3RWNA 1H1IA 3IIAA 5FYBA 4KNCA 2Z79A 4CCOA 4AQSA 2C24A 2OX0A 4Y20B 3JBG2 1BQPA 1LKNA 3J8F2 3GNEA 3K3NA 4XF1A 4CDQB 2A6ZA 4AR2A 4JTNA 2XMLA 5LCWL 5J98B 4E2QA 2IVIB 1COV3 2Q1MA 1AJOA 4PIYA 1YO8A 2VZ1A 3JCIA 3HQUA 3KQ4B 4LULA 3U4SA 2D6KA 4U36A 1W6PB 2VOVA 2VULA 2VMEA 2YMZA 4Q0QA 4DQAA 5AFEA 4XFGA 5F9TA 2UY8A 4QGMA 5I8SA 1YYNA 1R093 2HYKA 2SBAA 3BB6A 5CFDA 4BH9A 1D4VB 4OMDA 2WYFA 1DQ4A 2FCTA 2PXJA 1OH3A 2YV8A 3ZFEC 1SFPA 3HQXA 1G9BA 2DVGA 4OCTA 1OKQA 3U07A 3VBRA 2QUOA 4CCKA 3B02A 2OT7A 1Y9MA 3KGZA 1DYPA 5DZFA 3AMMA 3T1MA 1RUH1 5LRSA 3DYMA 5JZGC 1WLDA 3VN4A 1ZRRA 5BV6A 1GOHA 2ARCA 2ZHKA 4KL1A 4ZU4A 2VW0A 4ZU7A 4OQ8A 1OBNA 4I3PA 1AR81 1W2UA 2VR4A 2BOJA 2EAAA 1LGNA 3BPZA 4DXZA 3ZYJB 1W6OA 2EIGA 4ISRA 4C1WA 1SEFA 2VXJA 1ZVFA 4PI2A 1DBNA 3KGLA 5E88A 5C5TA 1FOD1 1W99A 1DIWA 1XE7A 1SACA 4HVQA 4LIUA 4AF9A 3T0BA 2JJ6A 3J8F3 4GAZA 2VE1A 3N36A 2YC2A 5FYHA 5FR3A 3ENRA 3BIEA 1W0PA 3AB0A 1DQ6A 4RQPB 1UX6A 4WM8A 1VP6A 3GBGA 1JHJA 3FUOA 3UJOA 5BNPA 5JXIA 5EJ1B 4JDMA 4BA6A 4FPYA 2YPDA 3P3NA 4QPIA 3UL2A 3N9PA 4QX1A 4QDRA 4QWNA 1ONAA 1V6LA 1S2BA 4QHZA 3VD4A 3NNMA 3H1YA 3VBRC 3O1SA 2VQAA 1KFXL 2ZPXA 4ZKTB 5FKBA 1XYNA 3JXSA 2ZMKA 2TBVA 4FPJA 3IWZA 5LA0A 3BTYA 1XNDA 2P3YA 2BNNA 1CESA 1Y43B 3T2QA 3VGIA 2HWB1 3IZOA 3OGVA 2XWJB 1XRUA 3N9MA 3ZXLA 5ACA1 4B1MA 2VUJA 5CNAA 3WP4A 4JKLA 1DQ1A 2F6BA 3B94A 1ZBE2 3M3CA 2CNAA 5A6YA 2RS11 2XBO2 5A6QA 4H55A 3FMGA 2SLIA 5F37A 1J1TA 4LEJA 5FZOA 1LGBA 1O3RA 3PDQA 2R041 4N7UA 4XTPA 1X50A 4QQPA 4WM8C 3Q8AA 2VTXJ 4COYA 5ISLA 1RUE2 5DZEA 3FFZA 1F5JA 1TME1 2JB8A 2ZKLA 4LBQA 1KS4A 2DTYA 2QFEA 1W3XA 5E1RA 4O65A 4KWJA 1RUC3 4BXSV 4ISQA 2XJPA 3T2OA 2GC0A 1NXD1 1W04A 4ZPIA 3WSOA 5F2WA 2TEPA 2LM3A 5DABA 4XFBA 4FOVA 5HXMA 4RA0A 2DBNA 3CZUA 1UO9A 2AEYA 3K51A 1MS5A 4FTSA 2FDFA 5DXDA 2YB7A 5JSPA 1QJY2 2YY1A 3LD8A 1NAEA 3N3HA 4QKBA 1FATA 2VOKA 4A6SA 2VGDA 4EE2A 1DGRA 3ZFFB 5A3MA 1RVF2 1E57A 4PI0A 3I2KA 4CEWA 1QMJA 4META 1K5MC 1RUJ1 4IV1A 1Y7BA 2VW2A 3B7MA 1M06G 2B8MA 3O1VA 5K8SA 4CP2A 2CDPA 2D6LX 2W3JA 4Y3OA 3AFGA 3RZLA 1IPKA 3GZTB 3VBFB 1H6YA 4I02A 1GNYA 1OT5A 1VMJA 4UAPA 4A44A 5IVBA 1PHMA 1UZWA 3H42B 2OPWA 2RE9A 2XBO3 2VAUA 4G9SB 4QXBA 3T0AA 4I2OA 3R6SA 1WW7A 5C3OA 3D4KA 3FN9A 2RHPA 3WX5A 4A7KA 2PHUA 2BDRA 3ABZA 1VR3A 3C7HA 3UNPA 1EUUA 3HR9A 4RYDA 3VHOA 4CE8A 4GB31 3NNJA 2RG4A 3CJIA 1JBCA 2PHRA 3WEZA 3DKQA 1BLZA 1RUE3 1PGW1 3BGAA 4GJYA 1LOFA 2Y64A 4ES8A 1DZQA 4DINB 5C3RA 5EPAA 3ZFGA 1OFNA 2A7AA 1BMV1 1UYZA 4FPLA 2XJTA 5IFPA 4MG2A 2GZWA 2AREA 4DB5A 1S2EA 4QQLA 4CEYA 5KHKA 1HKDA 5D1IA 2JG9C 2D93A 5DUXA 2B9UA 5DAQA 4IV1C 1UCXA 1QJY3 2QE3A 3RSJA 3W58A 3OPZA 1IS4A 3WF1A 1BEV1 5H9SA 2K2SA 1WLWA 1GWLA 4HPKB 1RVF3 1UKGA 3UGHA 2FDJA 4NHYA 4QXKA 2XQRA 4IEPA 3BU7A 3AFKA 1ULPA 4IW3A 2GMMA 1FYUA 1UOBA 3FBMA 4JCKA 4FTBA 2QNKA 4S2GA 4UWDA 1MS1A 5C9AA 3LF7A 3Q8CA 4LMFA 1RUF1 3EYPA 1GP5A 4P5YA 3J9SA 1FAYA 4A4AA 1ZZ7A 4LKEA 4P9GA 4QX5A 5FMOS 1NOVA 3EXUA 5CADA 1IS6A 2FZ1A 3EO6A 3PHMA 2YC0A 4JGYB 2V4AA 1J1LA 4RGGA 2TNFA 2LS6A 2VCBA 1LOFC 4UW5A 2K0GA 5A80A 2ZGTA 1US2A 4M0HA 3OBRA 3T4VA 1TQ5A 2X5IA 4DPNA 1CIWA 3UKTA 4RS5B 3L2HA 5JWPA 2VJXA 4WZFA 4B4PA 2YYOA 1YFWA 2BFUS 3ATGA 1W8ZA 4K6BA 3I2JA 2JDZA 4Z8BA 4B7KA 1AXKA 1E5HA 1AYM1 2Y33A 4FOQA 3I97A 4KGQA 4L0PA 3ZYGA 1CZVA 1SFNA 5HCFA 3VZJA 4YSFA 4M3CF 2X05A 3VBOA 1O3QA 2VQ0A 3POBA 3GJAA 2C1FA 3U37A 2R0HA 1CAUA 3VBSB 5GLTA 1HJGA 4DUWA 5FXWA 1VBA1 3O1TA 3BOPA 4GMP0 1JZ2A 1OQEA 1W6NB 3ZIWA 2AACA 5FQ0B 1GUIA 2CY6A 3DPRA 5CKQA 5F5QA 4P08A 1V70A 4COVA 4Z2AA 2PQSA 1PZ7A 2ZEYA 2LUWA 1BBT2 2HKXA 3KT1A 5L19A 4YZ3A 1JUHA 3IN9A 1UY0A 2X5IC 5KC6A 3U1XA 4Y1YA 1NG0A 2VOWA 2VVDA 3KV5A 4O9GA 3DXTA 4W4ZA 3M7AA 1YHFA 3BVCA 4JRLA 5DUWA 2ZX4A 3ZPOA 4IE4A 3ROUA 1JU3A 4LBOA 1RTVA 1EUTA 4TTGA 2B46X 4AGRA 5CFCA 3K77A 2FDIA 4PDWA 4JV4A 1H4HA 1EV12 1VBC1 1QNWA 2VZRA 5FJHA 3WG4A 4YZ1A 2DCKA 3SMHA 2BERA 2FCVA 2VTXA 1VALA 3IPVB 1KRIA 4XF9A 4XAEA 3LE0A 3O1MA 3WP6A 4HBNA 3ZFEB 3OCPA 1XE8A 1RUG1 1QJX3 3RNSA 3OGGA 1HRV2 1HQLA 3DPRC 1O7FA 4NO4A 1D4M1 4YW3A 5JZGB 3C7FA 1BXHA 4XYXA 4XQWA 2WBKA 4GQ7A 1MVEA 4RSUA 1PVC2 4OHZA 4GJZA 1CGPA 3GXUA 5HI0A 1VIWB 2YPJA 3POWA 1ENSA 5HCAA 3BI3A 2ZGKA 4NROA 2HYXA 1AR92 1HQWA 4EWAA 3GJBA 4D3WA 2HWB2 4LKSA 1CX4A 1V6NA 3S7IA 5CFCC 2WLQA 3IT8A 4PDWC 5JOXA 4QMAA 2IFWA 2WNUA 3ILFA 2VCAA 2D40A 4DRVA 2RS12 1UOFA 5D8AA 3VDBA 1SHWB 3X29B 4XHBA 1VJ2A 4CP0A 1EV13 4QT6A 5JOZA 1N1TA 3ITQA 2ORZA 5JXHA 3VBRB 3KV6A 1LODA 2Q5TA 1WW4A 1ZBA2 3WDTA 1IZ3A 4XFHA 4UFJA 2WUHA 2HWD1 1MZ6A 5JLVA 1H2KA 3ACFA 3O7OA 4UF0A 1Q5OA 1SMVA 1DU3D 4L97A 5T5LA 5CAZA 4FCAA 3WHUA 1Y4WA 2OUJA 5A70A 1OOPA 2Q30A 4HETA 1W6OB 5FYCA 2V73A 2VO5A 3AKPA 1O5LA 4KBZA 1PVC3 1SLAA 2H0VA 2QQLA 5GALA 3E6CC 3T1LA 3WT3A 2X10A 3C7GA 4Q4X3 3PVNA 2A6XA 2GN7A 1QJU1 3DUIA 2JKBA 3P1IA 3UGGA 4BMBA 1AR61 2WFF2 4O9EA 1AR93 5ANQA 1HB4A 1KJLA 1POV3 4WM8B 2WNUC 1OLRA 5FXXA 1MZFA 1JOJA 5B2GB 1N3QA 4ZY9A 2D43A 1GMMA 2JD4A 2YC4A 1NY71 4WV8A 2RDQA 3VKNA 1WLCA 3DCQA 1MS4A 3TNQA 4AFDA 3HT1A 1LOAA 1JW6A 1QKQA 3AKQA 4GKXA 4LKFA 1UU4A 1H2NA 5A1FA 1CWPA 1RC6A 2PHDA 2FD8A 1Z7S1 2ILMA 2J1VA 1ZBA3 1I3HA 1VE0A 3IM0A 1SLLA 3NKGA 3OTFA 4QPWA 5JI7A 3VDDA 2D7FA 2JICA 2DCTA 3CO2A 1QXRA 1K5MB 3SEEA 5FMDA 4BJ0A 1CJPA 2FMDA 2VZUA 3RI8A 2A5ZA 2DUPA 3U4XA 1RXGA 3ASIA 1LOCA 4AHWA 1TNRA 1YXWA 3ZMNA 2DVFA 1YI9A 5A1LA 3C7EA 5FMCA 1EPWA 1ULGA 2XB6C 3ZSKA 4OI1A 2BEOA 4QGLA 2VMGA 2WC2A 3KCXA 1WMFA 2VMDA 4J1XA 2WFF3 3UKNA 1O5UA 3FLTA 2E7AA 4UBHA 3CMGA 5FY9A 1VBD1 1YIFA 5FZ9A 4IEQA 1ZZ8A 2EVXA 1UY3A 3O0WA 4IXLA 2RDSA 1DLCA 4HN0A 5EJZB 3MIEA 2MHFA 2OXBA 2Y6GA 3JD71 5I0UA 5BNNC 2VZVA 3IMNA 1W6MA 3LEGA 4N90A 4UW6A 4CEWB 1UOGA 2JG9B 2XJVA 3AL5A 4L2NA 4IV1B 1K45A 1R64A 4OUEA 4UFLA 2G19A 3I2DA 2JECA 5JDBA 3VDCA 1ND2A 5C4WA 3VZMA 4OI0A 3KF3A 4GIQA 1UY4A 4INDA 1AXZA 4B3NA 3AMNA 4XIKA 5CBLA 5CKNA 1COV1 5FZ4A 1RINA 3H7JA 3KT4A 3OUIA 1DG6A 4PF1A 5DUUA 2WYSA 1CAVA 1YJLA 5E89A 4CU6A 2VCMA 2Y6HA 1ZA4A 2PHWA 1CZSA 5EZWA 5FY7A 5FZDA 3C7OA 4X6RB 3ZKYA 2HBTA 4A2UA 2IXLA 2XUEA 2P3JA 1V6OA 4MH0E 4KQ7A 2BV4A 4BQ3A 4IEZA 5LA9A 4AGGA 3K75B 3WQBA 4XTMA 2AGSA 3DECA 3LKJA 1X7NA 4IEOA 4AI2A 5J48A 1H2LA 2XLGA 4ASLA 5L7OC 4HKWA 5FZ6A 3KVAA 2ZHLA 4AEMA 1GOFA 3TN92 4WVMB 4DRRA 2NN8A 1LEDA 2J1SA 2W92A 3DYOA 4NIHA 3URFA 2DFBA 2PHLA 4BMEA 2WRAA 1PGL2 3HJRA 3MIGA 3H8OA 2VUAA 4NAMA 2VECA 1GOGA 2ZTNA 4BIFA 3RZMA 5C9AB 2O8OA 1MS3A 5FPZA 3WDYA 4Q2FA 2B45X 4RQPC 5FZIA 5HBAA 4R9BA 4HXCA 3K2OA 1HQNA 3USUA 1O6UA 1W8WA 1WMXA 1SDDB 4QPGC 3WG1A 2A75A 1CPMA 1G6NA 4LUMA 1ASJ1 4QHBA 3RRDA 1FPN3 1W9TA 4LA3A 4Y5SA 1VBB2 1DQ5A 3LGRA 4BU2A 1X36A 3ZXEA 2X5IB 3O1PA 3KMHA 5A33A 1OXCA 3E6DA 5FPBA 1W3VA 2PN5A 3ZPYA 4DS0A 1V6KA 2HWE2 4IV3C 4RD7A 2EXKA 3J7MA 3R4UA 4GALA 1KS5A 4JKKA 2XJQA 3U14A 4CUBA 3S57A 1PGSA 3AP5A 3RJ2X 2VTFA 2WNVC 4QD2A 4W6WA 5M0TA 1C5IA 5FWJA 2XOMA 2VNRA 4COWA 4H14A 2VMFA 3DEMA 2JE8A 1O4YA 2WABA 3TN93 1S0CA 3VBOB 1T2XA 5DDJ1 5I91A 2PHTA 2O1QA 4AVCA 1TMF3 3NO8A 4TLFA 1B09A 2BYVE 2WAOA 2ZGMA 3QH6A 1GZCA 4XF3A 4EN7B 1UNBA 2XUMA 4JKMA 2J1UA 3AKTA 4Q26A 4QGNA 3DPRB 1BKZA 2P37A 3IDAA 2WSUA 3WNKA 1PO22 1TG7A 4W65A 5CG8A 4AI8A 5FPVA 2XLFA 1AYN2 2NM1A 5FYSA 1RUC1 5BXXA 2CV6A 3BTZA 4NWVA 2GMEA 3AJZA 1FT9A 1MEC3 2VNOA 3AZYA 4LE3A 5FZ8A 1H9PA 1UF2C 3MICA 4GH4A 5KHHA 5EFUA 3RWKX 3DKWA
chains in the Genus database with same CATH topology
4R9AA 4S2HA 4P9IA 3BODA 4R4ZA 4JRAA 1FXZA 1IS3A 1QQP2 1QY4A 3M1HA 4PDWB 3RYKA 4FAGA 5CFCB 3FUQA 3LZZA 3D82A 5AC91 2ZHMA 3WNXA 2HJIA 4K8FA 5ABJA 2ZHNA 1SQ4A 5T5JA 3KSCA 4M01A 2DU0A 1SBDA 1QJZA 1VRH2 4PF5A 1H8TC 2G4IA 1PMIA 1CPNA 1UD1A 3FBYA 3TWIA 1HDKA 1F8VA 2HWF2 2VVEA 3GF6A 1UU6A 5FRAA 2K9ZA 3ECQA 4Q0PA 2MEV1 2VOXA 2BTVC 3RI9A 1PO23 3MPBA 4PJYA 3ZXDA 3GZUC 4YARA 5IT6A 4LTAA 4MX3A 5SV5A 2EALA 3U10A 1FMD2 4GH4C 3N7KA 1AL23 1XNCA 1MACA 2BWAA 2Q8OA 2HWC1 4BIOA 3ZN4A 3LA3A 5GZEA 1GBGA 1V9U2 5A3LA 2EXJA 1MZEA 1OPOA 1R081 4ZU5A 1Q8PA 2WNUB 4XJ9A 1H0BA 5BNOA 1C8M1 3WY6A 5ABJC 3ZSMA 1LHWA 1AR73 4V1PA 5A32A 1PK6A 3MLLA 3M3QA 3TNPB 4OI4A 5JIAA 1OA4A 2CAVA 4NR1A 4YYOA 2WZR3 2DCYA 2QZ2A 2RMU2 1H2MA 2DVBA 2QKDA 1VRH3 1WA4A 4WBBA 1RIRA 1PIV2 4QQHA 3ZX7A 4DNYA 5KXEA 5DG1A 3ZYRA 4NPRA 2ZGOA 3AZVA 1GNHA 3B00A 4L11A 1FMD3 4YG3A 3DF0A 3P3PA 1G7YA 5BYNA 3PJYA 1N3OA 3B93A 5BNOC 2DVDA 3MF9A 1V9U3 4MGYE 1S1AA 4WM7C 1H9WA 4YW1A 3RMXA 3ZN5A 1Q56A 3OGJA 3R4DB 3JZVA 2XWBB 3I54A 3I59A 1WLTA 3TOJA 4MGZE 1HXS3 2BQPA 5BNNB 1OA3A 2ZGQA 2RM22 3LWCA 2D6PA 2NP0A 4R9CA 5BY5A 3HT2A 5GZFA 1WUVA 1FX5A 3E97A 3FLRA 1PNGA 3PTYA 1D2QA 3WLUA 2Q1ZB 3APBA 4R4XA 5KXCA 4YRDA 2HEVF 5LK5A 3VZOA 1XU2A 4YZ5A 5I8TA 1H1MA 5LEJA 1O4TA 4TYSA 3RPQA 3FZ3A 1HW5A 3SCFA 2RS52 4Q4Y2 3WOGA 2LALA 3GALA 4IQPA 4Q4W2 1D0GA 4HKOA 4XJUA 1WMEA 4B29A 2BPA2 5L7OB 5JVVA 5H9RA 2UWBA 4E4ZA 1UL9A 3RDIA 4XFIA 2DF7A 1MS9A 1BK1A 2VY0A 2R6QA 5FO9B 3WV6A 3Q9OA 1QDCA 3DV8A 2GSYA 3KCYA 5T50A 3JBG3 5I93A 3E5QA 1HRI2 3FWEA 4F8AA 5CFDC 5JCTA 4YM2A 1LCLA 4MXWB 1W0OA 4I01A 4MXVA 4QPGB 3L2YA 2WS91 4LE4A 2RR11 4HZFA 1ENRA 1LTEA 3CLPA 3EHKA 4FP2A 4Z1VA 2PTMA 3RG0A 2RS53 4XBLA 4YGDA 3TB0A 4Q4Y3 3GYDA 4RHV1 2I45A 2XJSA 4EN9B 3AXEA 1GKBA 4Q4W3 1FV3A 1VBE1 2W52A 1GFF2 4IV3B 4OFGA 1AZDA 3HD8B 1M4WA 1ENXA 2WNVB 1XYPA 2B5HA 1HIXA 2WSVA 1SLCA 3CL1A 2FQPA 1T6GC 1YFXA 4BLJA 4IEXA 1WW6A 4B7EA 4IETA 1EAH1 1WBFA 4Q4X1 2BUKA 1AX0A 4GMP3 5BNPC 2WT1A 1LR5A 1ULCA 2P34A 4QPIC 1POV1 2WFPA 5CB7A 4EN6B 4YFZA 3SITA 5GLUA 4RR3A 3NV1A 1GZWA 5J36A 4HL0A 3TBDA 4YNIA 1AVBA 2XPJA 1U5XA 3FC0A 1JTZX 4NHKA 4ONUA 3E6CC 3ZVXA 4AFCA 3KCCA 4K20A 4JQRA 2AUYA 4MVTA 3WDVA 3GHNA 2UYBA 1ULEA 1XXNA 1SLTA 3VV1A 4XJZA 3KZ4C 1A8MA 4ZXKA 4EN8B 1OLQA 2NQYA 3AM2A 1ZBE3 3JQWA 3UKVA 2WZPP 1ALYA 2UURA 4EJRA 1H8TB 1EP0A 4DOUA 4CDXA 2O0OA 1NA1A 5J3UA 5J09A 4RR3C 4A3XA 4BCUA 3MIFA 3L9JT 2RS32 1DQ2A 2PYTA 1C3HA 2PAEA 3O0XA 4GH4B 3DL3A 1O4ZA 3AMHA 4FXKB 4OUMA 4AFBA 1PO11 1S0IA 4Y24A 4CEWC 5DG2A 1RMU1 4AW7A 1AJKA 3WCSA 2LTNA 2VVFA 4XE9A 5FMOL 1Q43A 3WG3A 2R1DA 1RUD1 2R062 4P9XA 3WD5A 1KXGA 3CJXA 1ZZ9A 4FO9A 4OI2A 4AVAA 3K48A 4MGIE 5ABJB 1ZRCA 1HX6A 2GC3A 3SHRA 4LT5A 1CN1A 1ZRDA 3AP6A 3ELNA 4E9KA 2ZAHA 4BM8A 3VKOA 3IDBB 3D6EA 4CDXC 2GMPA 3SH3A 2BFUL 3AYDA 2AENA 4RFT0 1XQNA 3OY8A 4GKYA 2OPKA 3CJIC 3WXPA 1NCQA 2R0FA 1VAMA 4LLFA 3ZFGC 2Y38A 2DYCA 3E5UA 4AXOA 1KJRA 4BHPA 4D7TA 1AX2A 1GLHA 2ZACA 1RHI2 5E16A 4QQ2A 4C91A 3SCGA 4CEYC 2VW1A 2GNBA 1Q3EA 4YGBA 3FX3A 2ZZQA 5EWSA 2BVVA 4XEZA 2Y0OA 3NV2A 3M70A 5BNOB 1TNFA 5H9QA 4HT1T 1MZ5A 2W68A 3MGUA 2ZCWA 3D5OA 5C9AC 4WM7B 2GH2A 5A32B 1R1A1 4JAAA 4ATFA 4XOGA 2XKPA 3WCRA 4YGCA 3PVEA 4LLOA 1W6QA 2XL9A 4Q4V1 4L99A 2WINB 1DF0A 2Q4SA 3VKFC 5T54A 3G7DA 3UK9A 1C8NA 3THTA 1C1LA 2EXHA 2RJKA 2EXIA 1FPN1 1OQDA 1RJ8A 4E4SA 5KXDA 1N1YA 1RUH2 1MR5A 4LBNA 1U12A 1LOBA 3R0RA 4Y1VA 2QDNA 4YM1A 2QQPA 5IK8A 1AR82 4JTOA 4AEKA 1RHI3 4AEDA 4A7YA 2XJRA 1D2SA 4DZGA 1QOOA 4WVZA 5F6KA 1FOD2 5AFBA 3VBOC 4BZ4A 4EWDA 1FV2A 2BBVA 2TUNA 2JG8A 3MLKA 1D0HA 2VPVA 1X33A 3WDWA 2GC1A 2XH6A 3KT7A 2WQZC 1TMF1 2UWAA 2PHFA 3I8TA 4TWTA 3I59B 2ZS6B 4H7MA 5CU1A 4FQ4A 1RGSA 3D8CA 3SXWA 5DUVA 3NV3A 3QBQA 4Q29A 4BWOA 2A71A 1ZYBA 3GBWA 2WIIB 5J37A 1C1FA 5C8CA 2E63A 5C8WA 4JGZA 1BBT3 1Z78A 2R071 3VHRA 1G9DA 5DZGA 4AFAA 4PBPA 3NL1A 4W6XA 4XFCA 1MEC1 4L9BA 3BCWA 1RUH3 3VLBB 5ACA2 1YIPA 4IERA 5FLIA 3PMSA 5CFDB 1REFA 4TZDA 1XU1A 2E51A 4OLLA 1AR83 4DMIA 1Z0HA 4I0BA 1U5YA 2R042 3I4IA 2E53A 3N7MA 1TME2 1O3SA 3WVJA 3U0ZA 4YZ4A 5K0UA 2XLAA 3M3EA 5CG9A 1HRV3 2PQQA 2W39A 2AR6A 4I0AA 1YWKA 4W6YA 4FBFA 1GR3A 1JYCA 4MV2A 4XZPA 1AF9A 3NAPA 3A0NA 1OSGA 1AL21 1CAXA 3WUDA 4E4DX 3B9CA 3N7JA 1RUJ2 2F4PA 4QM8A 2PFWA 4PIXA 5BNPB 5JOYA 2DVAA 2HWB3 4XBNA 4QPIB 4XXAA 5D8AC 5ACA3 5FOBB 1IGOA 4YVSA 2PLV1 3VBUA 4YG6A 4K1ZA 4P5HA 4CDWA 1MQTA 3D0JA 2RS13 1AR71 2B39A 3VUOA 1OFSA 2W08A 1QXPA 4AFMA 3FLPA 2G9FA 4OULA 3QCWA 1A3KA 1LB2A 2WZR1 4SBVA 4GB32 1LOGA 1LOEA 4YFWA 1PGW2 1RUI1 1XNBA 1OOPC 4TSVA 2GH8A 2DFCA 4U2AA 3B3QE 4E2GA 4F3JA 1BMV2 3FE5A 1Q8VA 2OIIA 3NAPC 1TEIA 3H3ZA 1G86A 4X8NA 4KBBA 2DWRA 2MPFA 1BEV2 5IK4A 3ES4A 3NW4A 3GHMA 4LBQB 4L8QA 4LHKA 4PBOA 3RYRA 4A7ZA 5HXVA 4CDWC 1RUF2 4FTEA 4RR3B 2IXJA 4FPGA 1CJDA 3R05A 4K1YA 1J3RA 3NJZA 4CYDA 3G6JB 3AP4A 1HXS1 1S2KA 3VDDC 3D0SA 4LHNA 3RYPA 3IBMA 4GB33 2ARXA 2OA2A 5LK7B 4Y4YA 4FT8A 4YZ2A 4LO5B 1SBEA 3HBZA 4XETA 5GJ6A 3N4MA 3ST7A 5BNQA 2DV9A 4XQDA 1V6JA 1DYKA 1RUNA 1AYM2 1WCKA 4GA9A 4QM9A 5KBFA 1QOSA 4AVTA 2A3WA 3LSEA 2D6OX 4CDXB 2H6CA 2ZMLA 4LHLA 1R091 3AP9A 3ZDSA 3C3VA 3CJIB 3FJSA 3O0VA 3VZKA 1VBA2 1IHMA 1LECA 1NCRA 1KD7A 3O12A 3ZFGB 1LJ7A 1RUF3 1CONA 2ET1A 1DZRA 4CEYB 2Y0IA 1Y3TA 4HSJA 1A78A 2D97A 5JAXA 1ND2C 5C4WC 1UKRA 2ENRA 3TRSB 4P9LA 2VMHA 1Q8OA 1WCSA 2NZ9A 2VXRA 4AQ6A 3LA2A 1NYWA 3JBG1 4D94A 4ASMB 2FHRA 1CR7A 1IPJA 3J8F1 3BOWA 5KXBA 3WINE 4XJ8A 1VBC2 3WQ0A 3WQ1A 3OY8B 4LO4B 1AYM3 2V09A 1FNZA 4P14A 3VHPA 1RUG2 1ULDA 2ZZJA 4WVVA 3ME2A 5KWRA 3HN1A 1D4M2 4Q0UA 4BE3A 2ERFA 3OYWA 1POV0 4OHWA 4FXGB 2R16A 4K7JA 1G8WA 3MZHA 1CAUB 1U5ZA 2DUQA 5JR7B 1PM7A 2BWCA 4CDUA 2WA3A 5T52A 1XNKA 5E8AA 1WW5A 1W6QB 5H9PA 2Z5WA 4XF0A 1DGWX 1GQGA 5CVRA 3VBHA 2FBEA 1AL0G 3ZFFA 4LR4A 5HCBA 5FO7B 3WHTA 4XPVA 2GNTA 2D3RA 2ZGLA 4HK9A 3ZXFA 4H7LA 4XF4A 3ETQA 4SLIA 3VBFA 1VBB3 2HWD2 2CGPA 3CNAA 2R30A 1RUG3 1GZ9A 2ZABA 1D4M3 3NSTA 4EN0A 4KWKA 1KDMA 5SV8A 1L3JA 4AEDB 5K9YA 2XVGA 1YCIA 2WKKA 4AI3A 4Z92B 2HWE3 3EJKA 4CTEA 2V5YA 4FQZA 4MYEA 2JG8B 5EJ3A 1QJU2 4E27A 5JSOA 3CU7A 1AR62 1KDKA 1ZBE1 1O3TA 4N53A 2XBO1 3VBHC 3MW4A 2XGXA 2B42B 4Q1PA 1APNA 2VG9A 2G9GA 1NY72 2PLV2 4MUVA 4DY5A 5C8CB 1RUE1 3QACA 1S0DA 4HPKA 4JGZB 1AYN3 3C2UA 3H1WA 5AVAA 2IZWA 2D44A 3H1MA 3MF6A 3QD6A 1Z7S2 1A8DA 1LHNA 2Z42A 5F1RA 1SBFA 2HWD3 2CWMA 1U5IA 2R49A 4AHYA 3MDPA 4UW4A 4HK8A 1QJY1 4N43A 2C9AA 4JDNA 3V0BA 4KWLA 5D8AB 4JGYA 4Z82A 1QQP3 4M0NA 1RVF1 4AEJA 3VHNA 4YVWA 1EY2A 5GLVA 5GM0A 3WUCA 4RS5A 1QJU3 4N53C 2KXLA 3UJQA 3ZN6A 4OHYA 3AMQA 2XHKA 1VBD2 2ZOEB 1F2NA 2X53S 1O91A 1OOPB 2GU9A 2QJVA 3NVCA 4NHMA 2HWF3 4OVEA 3QH7A 4K40A 1OA2A 3JD72 3VBSA 1QGLA 2BGCA 3NAPB 2ZGRA 4LA2A 2BW8A 3ZO0B 1OI6A 4EWEA 3B69A 5KHIA 3S30A 2I74A 1PK6C 2DCJA 4YVWC 1COV2 3VBUB 4CDWB 1QWRA 3PJQA 4OHXA 4COZA 1DDLA 3H9AA 4R52A 4AHZA 2GNDA 3OJBA 3AX4A 1H30A 2DCZA 1ULFA 2PA7A 5JMCA 5GLZA 1R092 4Y26A 2RMU3 3VDDB 3MI8A 4JVAA 5FOJB 2DUOA 4GULA 4G4FA 4GWNA 2Q0AA 2ZGPA 1VBD3 3IPVA 4PLNA 1PIV3 4RL7A 4AK3A 5FO8B 5F6LB 1BVP1 4FPHA 4EROA 1MS8A 2JEMA 1YNAA 2A3YA 2YXSA 3E6BA 5I0TA 3JD73 4HVOA 1IKPA 3PLQA 5FAXA 1JH5A 1C4RA 5FTTC 3SISA 3KLSA 1AUYA 5JOWA 1LRHA 4LNVA 4BLIA 1YI7A 2BNMA 4Y1UA 2NMOA 3M8LA 4Q8LA 2XKOA 1OPMA 2YDEA 2Z2SB 4AYUA 1QJX1 4B4QA 1SCSA 4HMZA 1V6IA 1ASJ2 1W6MB 1FNYA 1WMDA 4YW4A 1VAKA 2HEYF 1C5HA 2ETEA 1DLLA 3RMYA 1ND2B 5C4WB 2RM23 3AKRA 1LGCA 4Q0SA 1BBT1 3AYCA 4L92A 3ZSEA 3USSA 1CAVB 1I5ZA 2CAUA 4NVPA 5T3NA 2GC2A 5DDJ2 4Z07A 2WL1A 4Q27A 1N3PA 3AKSA 2PELA 1NCRB 2E7TA 2MNGA 1EV11 4XHXA 3HMYA 3QOPA 5FFOC 4F7ZA 1KFUL 3OBTA 1XYOA 3LCPA 3A0KA 1C57A 4J6GA 4S2FA 2AH2A 1JHNA 1RUC2 4FPCA 1HRV1 4ES9A 4LO7A 1YUDA 1ASJ3 3O14A 4AGVA 2I2SA 1S0GA 1LHUA 4G3YC 4K9SA 5FLHA 4IEWA 1PVC1 1ND3A 5FREA 2GAUA 3RJRA 1H1AA 1HRI3 2WJSA 1AR91 4IEUA 3USUB 1S55A 5AC92 1C28A 5FPXA 1GYKA 3MEPA 3ZXKA 2BVBA 1K5MA 4AQ2A 5DDJ3 4Y5Z0 2ZAAA 4AQTA 4XXPA 5A33B 4NN0A 2NPIA 2IC1A 1KITA 3OYWB 3TAYA 2MEV2 1I9RA 4AVVA 1ZBA1 4XIOA 2UU8A 1QDOA 4AG4A 1VB2A 2HWC2 1ND3C 4UW3A 4R9DA 4CDUB 1U0AA 1QF3A 1UIJA 3LAGA 3V0AA 1R082 4FP3A 3AYAA 4XJAA 1C8M2 3VBHB 2D3SA 2KA3A 4P9YA 5CA6A 1REEA 1EYBA 4HVRA 1LESA 2JG9A 4YM0A 3MIBA 2WFF1 5AC93 1B35A 2R1BA 3S6PA 3CEWA 4AE2A 1YFUA 3AK0A 3S0MA 2CL2A 2H6BA 3BALA 4C1XA 4LBJA 1X8EA 3DGTA 4AHXA 3SH4A 3MLJA 3NWKA 4MGKE 4AVBA 3VZNA 1S0EA 1QH7A 2UY9A 4M3CE 4MLOA 4KH9A 4Q0VA 1UZYA 1QOTA 2MEV3 4URTA 3TYJA 1QHDA 2R32A 4YW2A 3M3OA 5EYXA 2H0BA 3ZIXA 3V65A 1IOAA 2Y26A 1I1EA 5EYYA 1VAVA 2WNEA 3MIDA 2HWC3 4N53B 4QQOA 1OHFA 3M3IA 1IS5A 4N9IA 1S0JA 4M00A 4ATEA 1TE1B 1NA1C 1PVXA 1R083 4WVMA 5EV7A 1C8M3 1B35C 2PAKA 2WLPA 2YHJA 1GSLA 2XG3A 5J96B 2D3PA 2RS33 4N9HA 4D7SA 3VL8A 1BJQA 3OD4A 4XMAA 3ILNA 4N43B 1F31A 4Y1XA 4RGAA 3RQ0A 4BOWA 3FFQA 3V0BB 2AZ5A 3J26N 1F9KA 4EV0A 1PK6B 2R063 4ITCA 4YVWB 2CTVA 3AZWA 3PMEA 4XDQA 1LULA 3ZN6B 2VH9A 1LENA 4M3CA 3AP7A 4WVWA 1NCQC 1BYHA 5T5OA 1HV1A 3POSA 4IEYA 4LO6B 1NQJA 3AJYA 3AZZA 1RB8G 2YROA 1WCDJ 1V6MA 3WDXA 1CAWA 4P9WA 2QCSB 1QJX2 1N1SA 2CGOA 2XL7A 3V56A 5FDBA 3JQXA 4JC1A 1GICA 4HKLA 2OYZA 1PZ9A 1VLNA 2E7QA 2IWGB 3ZYIB 3HAGA 1DFQA 3H50A 2GNMA 1J59A 3B01A 1N1VA 2WT0A 4UBGA 3TN91 1WBLA 1NE4A 4X8PA 4Y22A 4C0HA 3M2MA 1PGL1 2YUEA 1JYIA 1RUOA 2YZ4A 1ZX5A 4WZCA 2FZ2A 4NOTA 1SCRA 3UV9A 4COUA 1ZZBA 2IXKA 2WS92 1IKQA 2RR12 3KM5A 3KQRA 4IESA 2ATFA 2ZBJA 3ES1A 1QU0A 4JDOA 4OZXA 4RHV2 5J7MA 2WT2A 3MIHA 1KQRA 1VBE2 1NLRA 1VBB1 3IDEA 1J3QA 4K21A 1UN1A 4AEDC 4XFFA 2WQ4A 2PAMA 3H0OA 3DN7A 4NWWA 5KHJA 3MFCA 2JG8C 2HWE1 3JU9A 4PIZA 4P9JA 2UYAA 4YLZA 1GV9A 2ZGUA 1FOD3 1EAH2 4Q4X2 1ENQA 3ALQA 4CRQA 4FOYA 1RL3A 1RJ7A 1NZCA 4HN1A 5C8CC 3QLQA 2ZKNA 1OMIA 3AZXA 2WS93 2RR13 4JGZC 3KD4A 1PO21 4PQ9A 3BIWE 5I0RA 3ZSJA 5JPMB 1AYN1 1NLSA 1ZZ6A 3U11A 4RHV3 1MS0A 2OVUA 4OHVA 3WW4A 1DZTA 1VBE3 2ZX3A 5LRRA 3THPA 3J4UH 3VZLA 2JE9A 4BYYA 1S0BA 3PVOA 4LUKA 2HEWF 3H3UA 3IKWA 4GXLA 1OD5A 1DGWA 1H8VA 1QQP1 2CWSA 5K7PA 1WD3A 1W39A 2XVLA 3PVBB 1EAH3 2P3KA 5K0UC 1I6XA 2R043 4LBQD 2A6YA 3ZXJA 4KGGA 1VRH1 3KB5A 1OQ1A 4AI1A 4LBLA 1TME3 1AX1A 2N7GA 1PNFA 5FCCA 2D5FA 2HWF1 5EXOA 2EA7A 2A3XA 2EF6A 1PO12 3ZYPA 1RMU2 1ND3B 1Y9QA 3E5XA 4UXAA 3INAA 4HANA 1QXJA 4XW3A 5FLJA 4IL7A 4XILA 1FMD1 1HV0A 1UPIA 1RUD2 1DGRN 2ZX1A 4XJWA 5BUVA 4CP1A 3FHIB 5BNNA 1BCXA 1RUJ3 2ZX0A 4Q1RA 3S7EA 1IQAA 4YVSC 5IUQA 5JI9A 2BNOA 3VBUC 1V9U1 1MQTC 3NKTA 4Y20A 4KG0A 3N7LA 1GZWB 1SDWA 5KHGA 3O5SA 4CDQA 1F5FA 4FPEA 3JB4C 4FOWA 2AYHA 1URXA 3RS6A 3A4UA 1QNYA 1W6PA 4DFSA