1RB9A

Rubredoxin from desulfovibrio vulgaris refined anisotropically at 0.92 angstroms resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
51
structure length
51
Chain Sequence
KKYVCTVCGYEYDPAEGDPDNGVKPGTSFDDLPADWVCPVCGAPKSEFEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Anisotropic Refinement of Rubredoxin from Desulfovibrio Vulgaris
rcsb
source organism Desulfovibrio vulgaris subsp. vulgaris str. hildenborough
molecule tags Iron-sulfur protein
total genus 8
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1997-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1rb9A00
1BFYA 1SMMA 1JYBA 4ME3A 2LCQA 1CAAA 1SMWA 1IRNA 1YUZA 3KYWA 1R0IA 3PZAA 2RDVA 4POFA 6RXNA 1RWDA 1LKPA 1FHHA 5RXNA 3RZTA 1QYBA 1S2ZA 1B2JA 4K9FA 3RYGA 1LKMA 2MS3A 3SS2A 5IY0A 1RB9A 8RXNA 1RDVA 3KYYA 2PVEA 1E8JA 2K2DA 1NNQA 4POGA 2VL6A 1B71A 1BQ9A 1T9QA 3A44A 4YWMA 1BE7A 2PVXA 1RDGA 1YK4A 4AR3A 5AI2A 1ZRPA 1FHMA 1T9PA 2HR5A 4AR4A 2DSXA 1B13A 2KN9A 1QCVA 3PWFA 2V3BB 3RZ6A 1C09A 1IU6A 1VCXA 2QL0A 4RXNA 4YWLA 1R0FA 7RXNA 1LKOA 4AR5A 1DVBA 1H7VA 1R0JA 1LTLA 1IROA 1BQ8A 5AI3A 1YK5A 1DX8A 1S30A 1B2OA 2GMGA 4AR6A 1YUXA 1RYTA 1IU5A 1CADA 3KYUA 3QVDA 1S24A 1SMUA 1R0HA 3MPSA 4TPUA 3KYXA 1T9OA 2M4YA 1BRFA 1R0GA 1YV1A 2KKDA 2PYAA 3KYVA
chains in the Genus database with same CATH superfamily
1VZIA 2ERJA 1SMMA 3MSUA 4ME3A 2LCQA 2R92L 3WWNB 3KYWA 3VPBE 3LWQB 2WAQP 2JA7L 4POFA 1Y1WL 6RXNA 1FHHA 5H1Sc 2EY4E 3M3YL 3RZTA 3HOVL 4Y52L 1WJVA 2MS3A 5IP9L 2Z3QB 3HJYB 3KYYA 3P8BA 2K2DA 5FLML 5M5YL 1BQ9A 1PFUA 1PZXA 2CR8A 2XJRA 2A68D 4A3IL 2M6OA 1FHMA 2DSXA 5GAEc 2M4VA 2ERSA 2V3BB 3PIO1 2QL0A 1LKOA 3MQKB 1R0JA 2A6HD 3IU3I 1DX8A 2B5ID 2ZIXA 1I6HL 2NVTL 4E6YA 3LPEB 1WCML 1TWHL 1S24A 3NFPI 2C6AA 2M4YA 1BRFA 1R0GA 3FKIL 3S17L 5GAHc 4X6AL 4AI0A 2JI3A 1JYBA 3H0GL 1PFWA 1R9TL 3WWLA 4AI1A 1K83L 1CAAA 2JI1A 1SMWA 3H99A 4G6BA 1YUZA 4LHLA 5IP7L 3GTPL 2CKAA 2XJPA 3J7Z1 1OWCA 3P2AA 2B63L 3S1QL 2L0ZA 1RB9A 4WFN1 1RDVA 3H9CA 2NVXL 4JADA 1E8JA 1NNQA 4POGA 2AUSB 4ZN3B 4YWMA 5M5WL 2PVXA 4BY7L 3J7Y1 3HAXC 2E2HL 4AR3A 2XJTA 5AI2A 1ZRPA 4BY1L 4ZN1B 4C3HL 1I50L 4A3GL 2A69D 1SFOL 4A3EL 3PWFA 4UY81 5IYBL 4RXNA 4YWLA 4AI3A 1Z92B 3S14L 3S2DL 2XJVA 2AQCA 1DVBA 3PL5A 4A3KL 5JVG1 1LTLA 1IROA 1YK5A 3GTLL 1B2OA 2V0EA 5EINC 2XJQA 2JA8L 1IU5A 3S1RL 1TWCL 4AI2A 4AHZA 3GTOL 2J9UB 3H9BA 1SMUA 4A3BL 5C4JL 5MFZA 2O5JD 5M3ML 3KYXA 3S1ML 5IYDL 1T9OA 3S16L 1I3QL 1PFVA 2WB1P 1VZHA 1BFYA 4C3IL 5AN9H 4A3ML 5GADc 3LNLA 3HOZL 4BBSL 1R0IA 3PZAA 2RDVA 4BBRL 1RWDA 1P7PA 3H97A 2V0FA 3GTML 1QYBA 4K9FA 3RYGA 3GTQL 1LKMA 3SS2A 2R7ZL 2H12A 5IY0A 5MGNA 5K2ME 3PKIA 5M5XL 2PVEA 5MFPA 2JA6L 2VL6A 1B71A 4A3LL 3RZOL 1T9QA 3A44A 1NXGA 1BE7A 1RDGA 1YK4A 3K35A 4TVMA 3K7AL 2KN9A 3PO2L 5FJ8L 3I4NL 1QCVA 1OWBA 1IU6A 1TWGL 4JAFA 1R0FA 3GTKL 5C44L 7RXNA 5DM71 4AR5A 3S15L 5IYCL 2R93L 1ODHA 3PIP1 2AYJA 4A3JL 2GMGA 4AR6A 4LHNA 2E2IL 4A3DL 3HOWL 1YUXA 1RYTA 5C4XL 3B08B 3LWOB 3KYUA 5DM61 3S1NL 2RFKB 4Y7NL 3QQCE 2YU9L 3MPSA 2XJUA 5EIOC 2NVQL 3GTJL 3LWVB 1TWFL 5C3EL 2JA5L 3LWRB 5M3FL 4JAEA 5GAGc 3B0AB 1YV1A 2KKDA 4V196 2C6BA 4A3CL 2HVYC 2M6PA 3RZDL 2PPTA 3GTGL 1IRNA 3ZG6A 2XJSA 4C3JL 1PFYA 4XXBB 1LKPA 4C2M1 5RXNA 1S2ZA 1B2JA 2JI2A 4GS7D 3HJWB 1NXEA 8RXNA 1RYQA 1TWAL 4AYBP 5JVH1 3PKJA 1IW7D 3S2HL 2A6ED 2PMZP 4B8CD 4AHXA 3PO3L 1T9PA 2HR5A 4AR4A 4BXXL 3HOUL 1B13A 3HOXL 5MLC3 3H3VM 3I4ML 2BE5D 3RZ6A 1C09A 4A93L 1VCXA 2Z3RB 3HOYL 2NVYL 1H7VA 2VUML 5MF6A 4AHWA 4JAGA 1BQ8A 5AI3A 1S30A 2Y0SP 2CKCA 3HKZP 3M4OL 1CADA 3CQZL 3JR7A 3QVDA 3LWPB 4QIWP 1F4LA 1R0HA 3FDJA 4TPUA 1QQTA 4XGHA 2APOB 4A3FL 2PSMC 4AHYA 2NYDA 1Y1VL 4U671 2E2JL 1VZGA 2PYAA 3KYVA
chains in the Genus database with same CATH topology
4AI0A 1VZHA 2JI3A 1VZIA 2ERJA 1BFYA 1SMMA 1JYBA 3MSUA 3WWLA 4AI1A 4ME3A 2LCQA 2PPTA 1CAAA 2JI1A 1SMWA 1IRNA 5AN9H 4G6BA 1YUZA 3ZG6A 4LHLA 3WWNB 5GADc 3LNLA 2XJSA 3KYWA 1R0IA 3VPBE 3PZAA 2RDVA 2CKAA 4POFA 2XJPA 3J7Z1 1OWCA 6RXNA 1RWDA 4XXBB 1LKPA 1FHHA 2V0FA 3P2AA 5RXNA 5H1Sc 3RZTA 1QYBA 1S2ZA 1B2JA 4K9FA 3RYGA 1WJVA 1LKMA 2JI2A 2MS3A 2L0ZA 4GS7D 3SS2A 2H12A 2Z3QB 5IY0A 5MGNA 1NXEA 1RB9A 1RDVA 3KYYA 8RXNA 5K2ME 4WFN1 1RYQA 3PKIA 2PVEA 5JVH1 3P8BA 4JADA 1E8JA 2K2DA 3PKJA 1NNQA 5MFPA 4POGA 2VL6A 1B71A 1IW7D 1BQ9A 1T9QA 3A44A 1NXGA 4ZN3B 4YWMA 1BE7A 2PVXA 2CR8A 3J7Y1 2A6ED 2XJRA 1RDGA 1YK4A 2A68D 2M6OA 2XJTA 4AR3A 5AI2A 1ZRPA 4B8CD 1FHMA 4AHXA 3K35A 4TVMA 1T9PA 2HR5A 4ZN1B 4AR4A 2DSXA 1B13A 2KN9A 2A69D 5GAEc 2M4VA 5MLC3 2ERSA 1QCVA 3PWFA 4UY81 2V3BB 1OWBA 2BE5D 1C09A 3RZ6A 3PIO1 1IU6A 1VCXA 2QL0A 2Z3RB 4RXNA 4YWLA 4JAFA 4AI3A 1R0FA 1Z92B 7RXNA 5DM71 2XJVA 1LKOA 4AR5A 1DVBA 1H7VA 1R0JA 5MF6A 4AHWA 2A6HD 5JVG1 1ODHA 4JAGA 1LTLA 3IU3I 1IROA 1BQ8A 5AI3A 3PIP1 2AYJA 1YK5A 1DX8A 1S30A 1B2OA 2GMGA 2B5ID 4AR6A 2ZIXA 4LHNA 2CKCA 2V0EA 5EINC 1YUXA 2XJQA 1RYTA 1IU5A 1CADA 4E6YA 3B08B 3LPEB 3KYUA 4AI2A 4AHZA 5DM61 3QVDA 1S24A 3NFPI 3QQCE 2J9UB 1SMUA 1R0HA 3MPSA 2XJUA 4TPUA 4XGHA 2C6AA 5EIOC 2PSMC 5MFZA 2O5JD 3KYXA 4AHYA 2NYDA 4U671 1T9OA 2M4YA 1BRFA 3B0AB 4JAEA 1VZGA 1R0GA 5GAGc 1YV1A 2KKDA 4V196 5GAHc 2PYAA 2C6BA 3KYVA 2M6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BFY A;  1SMM A;  1JYB A;  4ME3 A;  2LCQ A;  1CAA A;  1SMW A;  1IRN A;  1YUZ A;  3KYW A;  1R0I A;  3PZA A;  2RDV A;  4POF A;  6RXN A;  1RWD A;  1LKP A;  1FHH A;  5RXN A;  3RZT A;  1QYB A;  1S2Z A;  1B2J A;  4K9F A;  3RYG A;  1LKM A;  2MS3 A;  3SS2 A;  5IY0 A;  1RB9 A;  8RXN A;  1RDV A;  3KYY A;  2PVE A;  1E8J A;  2K2D A;  1NNQ A;  4POG A;  2VL6 A;  1B71 A;  1BQ9 A;  1T9Q A;  3A44 A;  4YWM A;  1BE7 A;  2PVX A;  1RDG A;  1YK4 A;  4AR3 A;  5AI2 A;  1ZRP A;  1FHM A;  1T9P A;  2HR5 A;  4AR4 A;  2DSX A;  1B13 A;  2KN9 A;  1QCV A;  3PWF A;  2V3B B;  3RZ6 A;  1C09 A;  1IU6 A;  1VCX A;  2QL0 A;  4RXN A;  4YWL A;  1R0F A;  7RXN A;  1LKO A;  4AR5 A;  1DVB A;  1H7V A;  1R0J A;  1LTL A;  1IRO A;  1BQ8 A;  5AI3 A;  1YK5 A;  1DX8 A;  1S30 A;  1B2O A;  2GMG A;  4AR6 A;  1YUX A;  1RYT A;  1IU5 A;  1CAD A;  3KYU A;  3QVD A;  1S24 A;  1SMU A;  1R0H A;  3MPS A;  4TPU A;  3KYX A;  1T9O A;  2M4Y A;  1BRF A;  1R0G A;  1YV1 A;  2KKD A;  2PYA A;  3KYV A; 
#chains in the Genus database with same CATH topology
 1VZI A;  2ERJ A;  1SMM A;  3MSU A;  4ME3 A;  2LCQ A;  2R92 L;  3WWN B;  3KYW A;  3VPB E;  3LWQ B;  2WAQ P;  2JA7 L;  4POF A;  1Y1W L;  6RXN A;  1FHH A;  5H1S c;  2EY4 E;  3M3Y L;  3RZT A;  3HOV L;  4Y52 L;  1WJV A;  2MS3 A;  5IP9 L;  2Z3Q B;  3HJY B;  3KYY A;  3P8B A;  2K2D A;  5FLM L;  5M5Y L;  1BQ9 A;  1PFU A;  1PZX A;  2CR8 A;  2XJR A;  2A68 D;  4A3I L;  2M6O A;  1FHM A;  2DSX A;  5GAE c;  2M4V A;  2ERS A;  2V3B B;  3PIO 1;  2QL0 A;  1LKO A;  3MQK B;  1R0J A;  2A6H D;  3IU3 I;  1DX8 A;  2B5I D;  2ZIX A;  1I6H L;  2NVT L;  4E6Y A;  3LPE B;  1WCM L;  1TWH L;  1S24 A;  3NFP I;  2C6A A;  2M4Y A;  1BRF A;  1R0G A;  3FKI L;  3S17 L;  5GAH c;  4X6A L;  4AI0 A;  2JI3 A;  1JYB A;  3H0G L;  1PFW A;  1R9T L;  3WWL A;  4AI1 A;  1K83 L;  1CAA A;  2JI1 A;  1SMW A;  3H99 A;  4G6B A;  1YUZ A;  4LHL A;  5IP7 L;  3GTP L;  2CKA A;  2XJP A;  3J7Z 1;  1OWC A;  3P2A A;  2B63 L;  3S1Q L;  2L0Z A;  1RB9 A;  4WFN 1;  1RDV A;  3H9C A;  2NVX L;  4JAD A;  1E8J A;  1NNQ A;  4POG A;  2AUS B;  4ZN3 B;  4YWM A;  5M5W L;  2PVX A;  4BY7 L;  3J7Y 1;  3HAX C;  2E2H L;  4AR3 A;  2XJT A;  5AI2 A;  1ZRP A;  4BY1 L;  4ZN1 B;  4C3H L;  1I50 L;  4A3G L;  2A69 D;  1SFO L;  4A3E L;  3PWF A;  4UY8 1;  5IYB L;  4RXN A;  4YWL A;  4AI3 A;  1Z92 B;  3S14 L;  3S2D L;  2XJV A;  2AQC A;  1DVB A;  3PL5 A;  4A3K L;  5JVG 1;  1LTL A;  1IRO A;  1YK5 A;  3GTL L;  1B2O A;  2V0E A;  5EIN C;  2XJQ A;  2JA8 L;  1IU5 A;  3S1R L;  1TWC L;  4AI2 A;  4AHZ A;  3GTO L;  2J9U B;  3H9B A;  1SMU A;  4A3B L;  5C4J L;  5MFZ A;  2O5J D;  5M3M L;  3KYX A;  3S1M L;  5IYD L;  1T9O A;  3S16 L;  1I3Q L;  1PFV A;  2WB1 P;  1VZH A;  1BFY A;  4C3I L;  5AN9 H;  4A3M L;  5GAD c;  3LNL A;  3HOZ L;  4BBS L;  1R0I A;  3PZA A;  2RDV A;  4BBR L;  1RWD A;  1P7P A;  3H97 A;  2V0F A;  3GTM L;  1QYB A;  4K9F A;  3RYG A;  3GTQ L;  1LKM A;  3SS2 A;  2R7Z L;  2H12 A;  5IY0 A;  5MGN A;  5K2M E;  3PKI A;  5M5X L;  2PVE A;  5MFP A;  2JA6 L;  2VL6 A;  1B71 A;  4A3L L;  3RZO L;  1T9Q A;  3A44 A;  1NXG A;  1BE7 A;  1RDG A;  1YK4 A;  3K35 A;  4TVM A;  3K7A L;  2KN9 A;  3PO2 L;  5FJ8 L;  3I4N L;  1QCV A;  1OWB A;  1IU6 A;  1TWG L;  4JAF A;  1R0F A;  3GTK L;  5C44 L;  7RXN A;  5DM7 1;  4AR5 A;  3S15 L;  5IYC L;  2R93 L;  1ODH A;  3PIP 1;  2AYJ A;  4A3J L;  2GMG A;  4AR6 A;  4LHN A;  2E2I L;  4A3D L;  3HOW L;  1YUX A;  1RYT A;  5C4X L;  3B08 B;  3LWO B;  3KYU A;  5DM6 1;  3S1N L;  2RFK B;  4Y7N L;  3QQC E;  2YU9 L;  3MPS A;  2XJU A;  5EIO C;  2NVQ L;  3GTJ L;  3LWV B;  1TWF L;  5C3E L;  2JA5 L;  3LWR B;  5M3F L;  4JAE A;  5GAG c;  3B0A B;  1YV1 A;  2KKD A;  4V19 6;  2C6B A;  4A3C L;  2HVY C;  2M6P A;  3RZD L;  2PPT A;  3GTG L;  1IRN A;  3ZG6 A;  2XJS A;  4C3J L;  1PFY A;  4XXB B;  1LKP A;  4C2M 1;  5RXN A;  1S2Z A;  1B2J A;  2JI2 A;  4GS7 D;  3HJW B;  1NXE A;  8RXN A;  1RYQ A;  1TWA L;  4AYB P;  5JVH 1;  3PKJ A;  1IW7 D;  3S2H L;  2A6E D;  2PMZ P;  4B8C D;  4AHX A;  3PO3 L;  1T9P A;  2HR5 A;  4AR4 A;  4BXX L;  3HOU L;  1B13 A;  3HOX L;  5MLC 3;  3H3V M;  3I4M L;  2BE5 D;  3RZ6 A;  1C09 A;  4A93 L;  1VCX A;  2Z3R B;  3HOY L;  2NVY L;  1H7V A;  2VUM L;  5MF6 A;  4AHW A;  4JAG A;  1BQ8 A;  5AI3 A;  1S30 A;  2Y0S P;  2CKC A;  3HKZ P;  3M4O L;  1CAD A;  3CQZ L;  3JR7 A;  3QVD A;  3LWP B;  4QIW P;  1F4L A;  1R0H A;  3FDJ A;  4TPU A;  1QQT A;  4XGH A;  2APO B;  4A3F L;  2PSM C;  4AHY A;  2NYD A;  1Y1V L;  4U67 1;  2E2J L;  1VZG A;  2PYA A;  3KYV A; 
#chains in the Genus database with same CATH homology
 4AI0 A;  1VZH A;  2JI3 A;  1VZI A;  2ERJ A;  1BFY A;  1SMM A;  1JYB A;  3MSU A;  3WWL A;  4AI1 A;  4ME3 A;  2LCQ A;  2PPT A;  1CAA A;  2JI1 A;  1SMW A;  1IRN A;  5AN9 H;  4G6B A;  1YUZ A;  3ZG6 A;  4LHL A;  3WWN B;  5GAD c;  3LNL A;  2XJS A;  3KYW A;  1R0I A;  3VPB E;  3PZA A;  2RDV A;  2CKA A;  4POF A;  2XJP A;  3J7Z 1;  1OWC A;  6RXN A;  1RWD A;  4XXB B;  1LKP A;  1FHH A;  2V0F A;  3P2A A;  5RXN A;  5H1S c;  3RZT A;  1QYB A;  1S2Z A;  1B2J A;  4K9F A;  3RYG A;  1WJV A;  1LKM A;  2JI2 A;  2MS3 A;  2L0Z A;  4GS7 D;  3SS2 A;  2H12 A;  2Z3Q B;  5IY0 A;  5MGN A;  1NXE A;  1RB9 A;  1RDV A;  3KYY A;  8RXN A;  5K2M E;  4WFN 1;  1RYQ A;  3PKI A;  2PVE A;  5JVH 1;  3P8B A;  4JAD A;  1E8J A;  2K2D A;  3PKJ A;  1NNQ A;  5MFP A;  4POG A;  2VL6 A;  1B71 A;  1IW7 D;  1BQ9 A;  1T9Q A;  3A44 A;  1NXG A;  4ZN3 B;  4YWM A;  1BE7 A;  2PVX A;  2CR8 A;  3J7Y 1;  2A6E D;  2XJR A;  1RDG A;  1YK4 A;  2A68 D;  2M6O A;  2XJT A;  4AR3 A;  5AI2 A;  1ZRP A;  4B8C D;  1FHM A;  4AHX A;  3K35 A;  4TVM A;  1T9P A;  2HR5 A;  4ZN1 B;  4AR4 A;  2DSX A;  1B13 A;  2KN9 A;  2A69 D;  5GAE c;  2M4V A;  5MLC 3;  2ERS A;  1QCV A;  3PWF A;  4UY8 1;  2V3B B;  1OWB A;  2BE5 D;  1C09 A;  3RZ6 A;  3PIO 1;  1IU6 A;  1VCX A;  2QL0 A;  2Z3R B;  4RXN A;  4YWL A;  4JAF A;  4AI3 A;  1R0F A;  1Z92 B;  7RXN A;  5DM7 1;  2XJV A;  1LKO A;  4AR5 A;  1DVB A;  1H7V A;  1R0J A;  5MF6 A;  4AHW A;  2A6H D;  5JVG 1;  1ODH A;  4JAG A;  1LTL A;  3IU3 I;  1IRO A;  1BQ8 A;  5AI3 A;  3PIP 1;  2AYJ A;  1YK5 A;  1DX8 A;  1S30 A;  1B2O A;  2GMG A;  2B5I D;  4AR6 A;  2ZIX A;  4LHN A;  2CKC A;  2V0E A;  5EIN C;  1YUX A;  2XJQ A;  1RYT A;  1IU5 A;  1CAD A;  4E6Y A;  3B08 B;  3LPE B;  3KYU A;  4AI2 A;  4AHZ A;  5DM6 1;  3QVD A;  1S24 A;  3NFP I;  3QQC E;  2J9U B;  1SMU A;  1R0H A;  3MPS A;  2XJU A;  4TPU A;  4XGH A;  2C6A A;  5EIO C;  2PSM C;  5MFZ A;  2O5J D;  3KYX A;  4AHY A;  2NYD A;  4U67 1;  1T9O A;  2M4Y A;  1BRF A;  3B0A B;  4JAE A;  1VZG A;  1R0G A;  5GAG c;  1YV1 A;  2KKD A;  4V19 6;  5GAH c;  2PYA A;  2C6B A;  3KYV A;  2M6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...