1RBQA

Human gar tfase complex structure with 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human GAR Tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
total genus 63
structure length 200
sequence length 200
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1rbqA00
1MEOA 5J9FA 5CJJA 4ZYZA 1MEJA 3NRBA 1S3IA 3DCJA 3AUFA 1ZLXA 4TTSA 4ZZ3A 4ZYXA 3TQRA 1CDEA 3LOUA 1RC0A 3GARA 1RBZA 4ZYUA 4YFYA 4TS4A 3TQQA 1GRCA 1CDDA 3AV3A 2FMTA 1FMTA 4Q12A 1RBMA 4QPDA 1YRWA 4EW1A 4EW2A 3P9XA 4R8VA 4NV1A 4ZZ2A 2BW0A 1JKXA 1RC1A 3OBIA 1RBQA 1RBYA 1MENA 4TT8A 2CFIA 3KCQA 4IQFA 4EW3A 4ZYVA 3Q0IA 1NJSA 4DS3A 1GARA 1ZLYA 4S1NA 3N0VA 3R8XA 1C2TA 1ZGHA 4ZYTA 1C3EA 3O1LA 3W7BA 4ZZ0A 4PZUA 4YFVA 2YWRA 3DA8A 2GARA 2BLNA 4ZYWA 4ZYYA 5J63A 4QPCA 4ZZ1A
chains in the Genus database with same CATH superfamily
2J7PD 3AUKA 4ZOLB 1LDMA 5DV9A 1IEXA 2FOIA 1UBMS 2ZJ7A 3RJZA 4F7WA 4IL5A 5I6DA 3RTGA 1ACMA 1RYYA 4KLCA 2A1IA 4GDFA 3GFVA 2VDWA 4AJ1A 5FPYA 5CXQA 4BU1A 4UDOA 4RTOA 3NHFA 4JA0A 1PKXA 1Z37A 5D3QA 2NVUA 1S6YA 4P3YA 3N8DA 3S5UA 2WWGA 3TTXA 1V8BA 2RKOA 3UJNA 3TLAA 4ABYA 4CT5A 1EIWA 5DYWA 4HWRA 3OZ7A 3MINA 1EJBA 3JQAB 4M9XA 5GPBA 2P6MA 1MV5A 2AMJA 4F3CA 1K27A 4FQ7A 4KMRA 1GU0A 3GPIA 3PCXA 5AKKA 2P6RA 4WJKB 4QEDA 4QFCA 2WYUA 2A0YA 3JWEA 4ILEA 4MH0R 5I3CA 1JHZA 1MTOA 2HTFA 3H8SA 2FUEA 1KJWA 3DEFA 3T4PA 1CQJB 2XE4A 4ZVUA 3ZE7A 5FDFA 2H9AA 4R4JA 4BB5A 4I36A 3S8YA 2X15A 5JMOA 3C6BA 4IDGA 4EQZA 4MQEA 1G2IA 1RADA 2OAEA 3I8SA 2XQJA 3TIIA 4FILA 5LNK1 3A06A 1FE8A 4X1YB 1TVKA 4JA2A 1KQPA 2DGDA 3FYCA 3O8OB 3B20A 4C14A 4YRKA 2ZZNA 5A3QA 2Q49A 3F6EX 4WDQA 1WZCA 2AIRA 2WA2A 2BR5A 4TRMA 1KIFA 1ZUNB 1LH0A 4L8LA 4XWTA 2P3SA 2ALJA 1XEXA 2QE7D 2XUFA 4M76B 4MS4B 3VO2A 4YYEA 3UFXB 1ESEA 3LWZA 1XEFA 1DOAA 3FKSA 5DZSA 1WD5A 3D9QX 3UW1A 5FPQA 4CR6A 4R1QA 1K98A 1UPAA 3ICWA 5ALZA 5CLJA 2V96A 2AZDA 2BUCA 2JLRA 3UMFA 4DLVA 1ZIOA 1K8XB 3BUSA 4E07A 4M1KA 1FFCA 5CVDA 4H08A 1Y8QB 3B6JA 2HI0A 3LK7A 1OGYA 1AB6A 1A9YA 1U0EA 3PT5A 4NBWA 3GBVA 2IX9A 2VHQA 3HKCB 1PTKA 1M6EX 2NVOA 3QVGB 4RY2A 2P6PA 3ZY5A 2VPYA 2X0RA 3CO5A 4UU7A 4A2WA 3WA7A 1NI4A 3CX4A 3GJ7A 2IZ0A 4YMGA 2ZAOA 2G5CA 1NXVA 4M1EA 3C7KA 1JALA 3K09A 4PPYA 4TSFD 1DZIA 2EYUA 1C2TA 5EGNA 1OWPA 2FEMA 1E1RD 3HP4A 1IBSA 1MIHA 1REQB 2B83A 1TVEA 2M6RA 2SHKA 4EHAA 2CT8A 5TE9A 1W36C 1E2GA 2XQIA 4FSHA 1SOMA 3HG7A 3NHWA 3NS7A 4V39A 3RNOA 2AYZA 2HBZA 3LZDA 3WS7A 3NBMA 3ZDQA 4U8GA 1M6HA 2IU0A 2E4UA 1BGXT 1DB3A 1T5HX 2FSVA 2A92A 3BBPA 4DIDA 1JG3A 3EBPA 4QNRA 3C8ZA 5BUSA 5C9ZA 3M83A 4QD3A 2GA9A 1NKVA 3GNSA 4H7JA 1PJRA 2BRUC 1VLMA 1IOZA 3F6SA 4IS3A 2AEJA 1K3TA 2HUNA 2O0HA 2JIOA 2IA5A 2XB8A 1X1SA 2Y1WA 3EWSA 2HT1A 4K9RA 3HL4A 2XUDA 3QPDA 5FBWB 3EIEA 4TVBA 1A8IA 2PQ0A 2OC9A 2Z58A 4IDOA 2NQ8A 1W5BA 1YL5A 3LFHA 4Z0PA 4C7XA 1TK2A 1V8DA 1W4AA 3BFKA 3DC7A 4JJ8A 4F72A 3HN6A 1AXGA 3I64A 1UAAA 1OFTA 4XB6B 3W8FA 3W1EA 1F2TB 3ZXIA 3IVRA 3JX9A 1RQGA 3I6QA 3VPSA 2DTEA 2PT7A 4YJDA 1D6SA 1Z7BA 2P9BA 1NZJA 4L95C 1PK7A 4B8ZA 4D42A 1NL3A 3HB1A 1DADA 2G40A 3ICOA 4TTQA 4PR3A 2B4RO 4QASA 1O9BA 1T5SA 2IE0A 2PA0A 1HQKA 3QXHA 4LC0A 1H5UA 1XXHE 3STTA 1ISHA 1Q6YA 1GGHA 2RBGA 2YYYA 1U9IA 3FOEC 4PC3A 3K1AA 5KYUA 3T7IA 3GBPA 3T7SA 1VMIA 1GQ2A 1X7XB 1S7CA 4L5BA 4M22A 4HDSA 2UXCB 3I61A 5GTDA 2DKFA 4KITB 4IJKA 1YVRA 2GVNA 1BTOA 1M0TA 3FGZA 4PR0A 1MHPA 2A9JA 3WYNA 7MHTA 1AQ6A 2XXAA 2N1MA 4MWTA 3TQHA 1U5BA 3AJRA 1NBOA 2WTAA 1OX5A 2B5OA 4RXMA 1DFGA 3OJLA 4GZ6A 1H23A 1CQPA 1MNAA 1OKKA 2XCIA 3EEYA 1TU4A 3AVQA 2P2YA 2VF2A 4ZIRB 4GRDA 3VR2D 4UQPA 5HQ3B 3OPVA 4DJ5X 3P96A 5TQ2A 5JSYA 4ANFA 4CI0B 1OIVA 2QY6A 3HHEA 4OBXA 3RU9A 3A8TA 3TMKA 4WINA 1FU8A 3KWJA 1Y1TA 1EVIA 4CWAA 5KNBD 4WK0B 3HCPA 3HACA 2WDPA 1EMDA 2IV2X 3EARA 2QUBA 3DL4A 4NBNA 1SBQA 3A9CA 3KEGA 4B4OA 4MV7A 5IAGA 4YRGA 3K70B 2AJLI 1FDUA 5AI8A 4M1QA 3TKYA 1EP3B 3VVMA 1ZQ9A 3K0SA 1NVBA 2VRBA 3JPWA 2BMAA 4CLHA 4G0VA 2CFRA 5NULA 4UUOA 4LDPA 5AVWA 2NO5A 2GKOA 3E2PA 1AK2A 1KP9A 2JJ2D 1YE3A 2NU9A 4Q6BA 2F3UA 2IF0A 3GARA 4Q1CA 4XWYA 1KMIY 1PV4A 1EVQA 2R60A 5BVHA 2P6NA 3C85A 3Q7PA 4EDHA 5C37A 1U1DA 4PG5A 1YF3A 4BAZA 1EXMA 3NDJA 5JC1A 1CUVA 1W4LA 5LVAA 4P0QB 1I4EB 2LBPA 3FETA 3FNFA 1WEHA 4TRRA 4B5KA 1KRHA 1KQOA 1V1RB 3GAMA 4R1MA 1GPMA 5K8LA 1QP4A 2JLXA 5I7FA 4II2A 3HGTA 2NZJA 2PZJA 3I1YA 1Q44A 3LY5A 3W2IA 5H68A 9LDBA 5JFGA 2Y1XA 4KXFB 4P92A 3UAYA 1J90A 4YRFA 3NHAA 4RZSA 2VOEA 1L7VC 4EMUA 2OB2A 3WMGA 2PVCA 4DWJA 3ABZA 2B21A 1IOLA 1I80A 3U3DA 1D2CA 5AOVA 2EC5A 4BLRA 5KMGB 4O4HF 4G84A 4MWSA 3KQKA 1ZNXA 4YGYA 5FBVB 1VIYA 2Q0SA 2CNBA 4OGWA 3EIHA 2ZSAA 1SKUA 3F90A 3KVYA 5AW4A 1QBKC 4CLDA 4JXKA 4C7OB 3SF0A 1MGOA 4G0NA 2H4JA 2WMDA 4U0JA 2IS1A 1A82A 1BWQA 4OQMA 1FLDA 4C0LA 4ZT4A 2TMKA 1E3MA 2W6OA 4QYWA 2ZIEA 3L02A 2XRYA 3FHTA 2XTZA 4XLZA 1F48A 2ZTHA 5T4BA 4EB0A 4OREX 3ETJA 1PR1A 4OQDA 1XMOB 1RJDA 1WJGA 2DQSA 3LP8A 3P8ZA 2ZJYA 4NPCA 5BVGB 4KSYA 4TXLA 1CP2A 1EM8B 1K5DA 3D7MA 1GCIA 3P0JA 4EJ0A 4NBUA 2GXQA 1E59A 4X20A 3X1ZA 4F1KA 3AR9A 2O3TA 4MNTA 4UASA 2VDWB 3KB6A 4W1PA 3N2YA 4BLWA 1QTNA 4GKJB 1DIAA 2C88A 3H18A 1II8A 4U1RA 3UC5A 2A0KA 3GJYA 4GOOD 3VTAA 4DMLA 1DO8A 1L4EA 1TLFA 3ZVRA 3NH9A 2BE7A 3LUCA 4I4IA 4AF7A 1XZPA 3DHEA 1YI1A 1WNTA 3AJDA 3ESCA 4IR7A 5LQAA 1FRFS 4CT4B 1L7RA 3AOEA 1TQ6A 4X8LA 3IPAA 3HFSA 1RJEA 3C6KA 4FC7A 3G85A 5ALKA 1JNYA 2P6OA 2PXHA 3L49A 3M7IA 5ISMA 3K0KA 1E0KA 3DMRA 1FP2A 1DIBA 2EFJA 1CS4C 4ISCA 1XKLA 1OC4A 1T5LA 4H7PA 4UBNA 5DXAA 1UM9B 1KC3A 2WRZA 4NU5A 3TG8A 1XRNA 3HNOA 2A88A 2MINA 3P32A 5ELLA 4C76A 4N0EA 2E5WA 4YR9A 1P31A 3E3NA 1ZIXA 3RT1A 2FW7A 1JR3D 3WLQA 3WKAA 4DMMA 3AFHA 4Q9DA 1K97A 2O9JA 1ZGZA 1IDOA 1CSEE 1P7PA 1IOVA 2X7JA 3CG4A 1B0PA 1UFQA 4RKYA 5HFNA 4ZOQI 1LB1B 4BNDB 4F6LA 1WEKA 1EX6A 1YGPA 4EA7A 2YHSA 3UHPA 1CYEA 2LPMA 3ZWQA 3BKWA 2JFWA 2HHLA 1IJKA 5DM2A 4MDFA 2Z09A 1LSOA 4JVNA 4RZHA 4GKVA 1M1YE 5CLGA 3L6CA 1I5RA 3W5IA 4LRSB 4JLVA 1CVIA 1ZQ1A 2A0WA 4MRMA 2H8GA 1QHHA 3DKVA 3NVKI 2FRVA 5BSRA 1PT5A 5T3UA 4ZK6A 5CVTA 1L9XA 4IHAA 4WX2B 1NC3A 2E6KA 3TTSA 1QWOA 2DYKA 1D1QA 4IIJF 3AKZA 1O6FA 1R9JA 2GKSA 3CLRD 3QLVC 2QENA 4ND3A 5YASA 2AF3C 1A04A 3PI7A 3BJEA 2ZPUA 3I3OA 4G09A 1WCWA 3FCUB 4MB0A 4UTPA 4RTMA 2E4WA 3JQDA 3MCAA 4QLOA 3E84A 1OZFA 4Z9AA 3ZHUA 1HFKA 1YB7A 2H06A 2JGRA 1RWOA 3IJEB 2BJWA 3HR7A 3PIRA 1CRZA 4GLJA 1NW3A 3EXHB 1FUEA 1ZLXA 4DSZA 3S81A 3REGA 4N76A 3UUEA 3D2LA 4WNAA 2IYEA 3FZQA 3G7NA 4NCNA 5TGZA 1E98A 4EA6A 2WF7A 4EG4A 3GGCA 1PFWA 2N46A 3G13A 2MT9A 3HABA 4MTCA 3SS9X 3TI9A 1I24A 4G26A 4DUGA 1N0VC 3C6XA 3GNQA 4JLMA 3SQDA 3WLMA 2RBEA 2YIMA 3N0XA 1WUTA 1M2EA 2GCIA 4KQCA 5DTEA 1NE2A 1RWNA 3L7LA 4XRGA 4GWKA 3F98A 3SC2A 4M1WA 1UR5A 1IZ7A 4D4GA 2NU7A 2JAHA 3U7HB 2NUPA 3BICA 1IM5A 4RF5A 2I71A 3NIFB 1XEXB 3WMFA 4BRZA 1PFGA 1L8QA 2P75A 5ECGC 1G18A 4M55A 1QNLA 2Z8YA 2OHFA 1LVHA 2HEIA 1JSXA 1LS1A 2V6MA 1GRRA 3D7SA 4N3CA 3UXMA 3W5SA 5EWLB 4C4SA 2K6GA 2W2TA 2PPLA 4M38A 1IC6A 4DLWA 4B79A 4QVIA 1RI1A 1XCPA 3U9TA 1FP4B 3GJSA 3M2PA 2W2XA 2H08A 5CDHA 5A9RA 5I5EA 5IJ0A 2REBA 3PA8A 3V2UA 3IILA 2Q6OA 1CEEA 5IDXA 2IZ6A 3VDQA 3KKOA 1HLDA 5JQGB 3LFUA 1ONOA 2W6NA 4PNZA 5COBA 3QPBA 2QX9A 2GZ1A 3R3JA 2V6JA 2QVGA 3FSRA 1KGDA 2VHEA 4FMDF 1YRYE 5CK5A 4LYYA 1J8QA 4HDSB 5LBUA 2P65A 2Q6IA 2DF8A 1NUAA 3FLEA 3DYIA 2CLFB 3GOHA 1MQSA 1QRAA 2AWNA 3OFKA 1AA6A 4C2UA 3LP5A 1W4ZA 2PT9A 1FVHA 3HFJA 3Q3IA 1JLHA 3W6ZA 2QQ5A 4UCFA 4A3SA 1V9LA 3CZ9A 1KH3A 4PBRA 5EXPA 4RJLA 1FTGA 4MOWA 2RH8A 1HNXB 1E0AA 1UQTA 4F2HA 3AOGA 4O1IA 5CDGA 4CKCB 3JYHA 4WERA 4CM1A 2XRFA 4PZAA 4QARA 2E37A 4TMKA 5FF9A 1W36D 1CY0A 1O9GA 1RPJA 2PRYA 1YZLA 3G9TA 2QJFA 2Q8NA 3B5EA 4LBVA 4F5DA 2P27A 2PMWB 1CE8A 3K9FC 1BHJA 1GNRA 3K0AB 5IANA 1ZHFA 3AUYA 3O9VA 3V8PA 1UODA 2D2XA 4RPJA 3HDVA 2WJGA 4U6NA 1VI5A 1E1RA 5IH7A 3T1YB 3AVOA 3K5HA 1U5CA 1MKYA 2C4UA 2J7PA 2OHIA 4HRYA 2NZ8A 2X5NA 3SNHA 3GLGB 5K6AC 1G42A 4K6KA 4R2XA 4WVLA 3PX7A 1FOEB 5PGMA 1W9HA 5HKBA 2ZBPA 3GGSA 5FOVA 3NJRA 2P2SA 2X0EA 3B85A 3FF1A 2Q5EA 2YVKA 4IGFA 4I6JA 4FWTA 5CUQA 1NPTO 3FJOA 2GX6A 4HNVA 1RT9A 3OIUA 4XUGB 1U2DC 4ARZA 1DEAA 1I14A 1OY1A 5ALQA 2YYSA 4BMCA 2PH1A 1M1YB 2Q4DA 4Q21A 2PSSA 4QRHA 4OI0A 2ZUBA 4TXNA 16PKA 1BU5A 2PV0A 1LX6A 1VC2A 2VRCA 4FLMA 1JHVA 1RWQA 4JHLA 4Q01A 1E3QA 4PM4A 2CL6X 2J9ZB 4XJTA 4BB9A 1G2OA 1E7QA 3CLTC 2XAUA 2Z2IA 1Y0BA 1UKCA 2ZG6A 1E32A 4TWIA 3HVHA 2XUGA 3BRWD 4HWPA 4H77A 3H2YA 2FPKA 4KIWA 3BRSA 3VDRA 1W96A 3A1UA 4I08A 3DBLB 1T8WA 4E2WA 2A6PA 1ZSVA 4LOLA 5A4KA 2ZRMA 2Z5VA 1N2GA 3B6EA 5B5SA 4INOA 3F5DA 1ESCA 3WWOA 3BMCA 1EJ2A 2WFMA 3BGSA 3BWEA 1O95C 2IOYA 4I0WB 4H6VA 1CZLA 3TEMA 4I8DA 4ARBA 1M8KA 1WOYA 4P31A 4OGFA 3HU2A 1TZJA 4I4TA 721PA 1QQ7A 1DKPA 2PX8A 2DLCX 3OUTA 1IJFA 2JGEA 3GCDA 5IVKA 2FG7C 2R2GA 2QX8A 2QLJA 1U2EA 3E9RA 3CMMA 2K4MA 3IULA 1WZNA 1QP0A 1RMYA 3LVRE 5BN4A 3F5SA 3LIIA 1C7RA 4M0LA 3KEOA 2EDCA 1K3UB 3IESA 3MW8A 4I4TF 4RZIA 1R0KA 3MERA 4DTCA 1C7FA 2Q9BA 4PHCA 3LDAA 2DFTA 3IDOA 5LL6P 3RVLA 3VR6A 2XNDD 4QU9A 4YJ2F 5CX1B 4G86A 5LP6A 3LX6A 2FPOA 3PIDA 4LRQA 4CNQA 1U5BB 4Q00A 1G20B 1E7SA 5GOTA 2VTBB 4KFRA 3KSZO 1DCFA 1SQ5A 5JBIA 4JB0A 5EJIA 4B0PA 4M8NE 1U0SY 2BBWA 3FZNA 4KKXB 4GBJA 3SXUA 4DDUA 4EG0A 1W87A 2QKYA 4BV8A 4K9NA 1N1EA 1PT7A 1PL6A 2LTAA 5HMMA 3QHPA 4OHFA 3ZHOA 1Q19A 2AI1A 3AVVA 1OWMA 2J3LA 2ZS7A 4KR0A 4DA0A 1OH8A 1KS2A 4LXGA 3TRHA 1I4LD 1JDPA 3F2VA 1XTRA 1R6BX 4DNQA 1K0UA 2FEXA 3PFWO 5JRDS 3H42B 2ZI5A 3GEDA 5KTRA 1P2DA 3BIXA 1P7WA 2GYVA 5IUKC 3GMDA 3U0VA 1U6JA 4HZUB 4F12A 1YZKA 3D7KA 3L4SO 1ECBA 2Z4RA 3RSCA 4LOJA 1JHOA 2GXSA 4LOIA 4BNXA 4BX0A 4RTNA 2CV1A 4FD2A 5LXTF 3CF6R 4NKRA 1R27A 1G38A 4XH9B 3RTAA 4TXHA 2HZBA 3H75A 1KKUA 4NONA 1DC6A 1MX5A 3TR0A 5F9FA 3AL2A 1USGA 4HXGA 1WY5A 5EE3A 4DNXA 1L7DA 1A5BB 2IU3A 2ZWVA 4MGZR 4MIEA 3DPIA 5JWRA 3MM4A 3KKQA 4QJBA 4CLRA 1O0CA 4ER7A 5AJZA 1DPGA 3LF2A 5EMMA 1R4AA 3A6EA 3DHYA 4Q37A 3WIVA 4HS4A 3ZTYA 1P18A 4KQXA 1RJWA 3RRZA 3TPFA 3VNVA 3TVYA 2CZGA 3FTQA 3LT1A 3MFQA 4LGYA 3BE6A 1YB5A 3OQNA 1N2CE 4K40A 2IYUA 3GY0A 3TE7A 3GRVA 2Q41A 1U7TA 3BQMB 4MI3A 4A92A 3TBFA 4NU0A 1T9ZA 2ZAIA 5LWHA 4OLAA 4F4CA 1YQ9A 3VYVA 3OE1A 3CSUA 4QBIA 1B7GO 1UP7A 4H59A 5TVGA 1OUMA 1PUJA 2OZLA 1JIIA 1OB2A 3DWIA 4NDNE 3JQ9A 5ECYA 3HUFA 1VL2A 2WF9A 4Q39A 3ULKA 5F2OA 1LBIA 1ZWKA 1KL7A 2JA2A 3NG1A 2P9GA 1KFCB 1IXSB 4L8YA 4ESOA 1AHIA 1B74A 4PYNA 3DM9B 2CFSA 3JXEA 5DBIA 3Q41A 4TTPA 2Y9PB 3DLBA 1OF1A 2BKXA 3HVJA 1KI6A 3JS5A 1B6TA 2XWPA 4TMZA 1W73A 3OHMA 2G0NA 3VSAA 2Q5QA 1JLRA 5BMVA 5IFLA 2NYUA 4ZYZA 2O8FB 2C58A 4ZVTA 3QLJA 1MB0A 3E81A 4EY6A 1SA0B 4NX2A 5B4TA 1RJFA 2OECA 2RAVA 4GS5A 3P4YA 5IKEA 3NJ8A 4QRDA 3R5HA 4GI7A 9ABPA 3ZDDA 4I5GA 3PE3A 4HAIA 2OUIA 4UPDA 3DEJA 3ST7A 1E2KA 1FFWA 1A3CA 4HH1A 1AS3A 4UHDA 2GB4A 2GHTA 2OM2A 4Y6RA 1XMXA 3BE8A 4DV2B 4RVSA 4G0YA 4LBZA 5JLAA 5T4HA 3F1LA 2ZJAA 3GAFA 3UB4A 1H85A 4EELA 1YZQA 2DY1A 2VP4A 2FEAA 2ABWA 1ZH2A 2Q2VA 5DNYB 3QEAZ 2OKCA 2OXCA 4GQIA 4BEJA 5EFOA 1FX0B 4NV0A 1A9TA 2HMTA 1NF3A 2WJPA 1O96A 4KP7A 4TYMA 4XDZA 4DEXA 2X2FA 1I32A 5A5FA 3KNZA 2QN9A 4KGXA 3P7MA 1DKLA 3RJTA 4BNJA 4GI5A 2AOTB 2HV8A 2RGBA 4XLTA 4IJQA 5TQ2B 2PS3A 3C3DA 3GIWA 3NGLA 3CLRC 5HCNA 4PQYA 1TM1E 3DE5X 2CYBA 1GY8A 4HLNA 1BEUB 3GDFA 4Y67A 5H8WA 3Q0IA 3PICA 2NAFA 4YONB 2WFZA 5DGXA 5EEGA 5HILA 4FOTA 4MWCA 1OHHD 2BMVA 3RFUA 1J8FA 3JCZA 3FVWA 3V1MA 1FPQA 3V7YA 5EZYF 4BKPA 1JAYA 3DSRA 2FNAA 3L5OA 3RS9A 5EGSA 1NBMA 4FS3A 5DHUA 5DCLA 4CMGA 3THYA 1J00A 3A4TA 1XZFA 5EP4A 4JP3A 4Z7NB 3SR4A 5JYBA 1ISFA 4ZI7B 3L46A 1R66A 1W85B 3IKJA 4N5IX 5ITWA 4UHEA 3M2TA 1XN4A 4DNPA 3O95A 3ZUPA 3O93A 2D5BA 3ECCA 3HMQA 4JMPA 3PRHA 4KYVA 4WBNA 6GPBA 2YV5A 1P9NA 4C1NA 3I76A 1Y98A 4LYAA 2I3AA 1BQ3A 1SU4A 3CGWA 3G9XA 4N54A 3VKFA 3MGKA 4AJ4A 1APBA 3F1KA 1GSHA 3UV6A 1RI3A 5LKRA 4FLEA 4OHKA 3ZGLA 1G5PA 1C7ZA 2FCRA 1Z15A 1E62A 3RFCA 5K4AA 3STXA 4V0OA 1WR8A 1E2NA 5ECDA 3ZLVA 2P30A 3D3EA 4WOKA 4O33A 1OBVA 4MDYA 3DCJA 1UT8A 1YKGA 3PB3A 3A4IA 2IV7A 4DOMA 3CN9A 3K2IA 1P9LA 2F48A 2VWGA 4WRRA 4UM9B 1T9CA 2QEQA 4YMIA 3KWLA 2XA9A 2XMZA 4AJHA 4IIVA 1T9BA 2NP6A 1J2RA 4PSCA 1EB8A 1H6DA 4YT8A 4JKIA 5AVKA 1OXBB 3LF1A 1RWPA 3PRKE 2GF9A 5IJ9A 2V8BA 3W8EA 1TTTA 5A9TA 2PV7A 4HQFA 1S8AA 4UAUA 1GTMA 1II0A 3A26A 1MOZA 1AHHA 4H0CA 3VSBA 2HW8A 1KH2A 3RNLA 2XH8A 1JR3A 1QHSA 1FSSA 1QH8B 3K6RA 4MR7A 1EYZA 2ZOSA 2QMZA 4MA5A 5IJWA 4BFSA 1ZKDA 1YBMA 1XL0A 4BVKA 1G20E 4NXNB 3CR7A 1QK4A 3QX7A 3TKAA 2I78A 4QGAA 4YAGA 1I3CA 2FQQA 1N8SA 1L5KA 4RSRA 2LWIA 2Y0EA 3D6MA 5IYZA 2IYQA 4FYPA 1G60A 1O7JA 4J75A 1LDYA 4MK4A 4BEVA 5B7PA 4WACA 2D8MA 5NLLA 5JMWA 1ZGJA 5FPPA 2HBQA 4BQOA 3UPDA 5BWNA 5F3DA 1CJBA 3H99A 5SICE 2BF4A 1YJ5A 1JHMA 5AICA 4LZJA 1DIHA 4Q4HA 4NNPA 2JEZA 1BD4A 2WFLB 3T95A 2CK3A 1JWBB 3TBKA 2ZXFA 3DXYA 3BGWA 1U1EA 2PBRA 2VDLB 4HMPA 4ARZB 1K68A 3M4JA 4IUCS 5DDIP 2AC7A 2I2XB 3SIRA 1U7ZA 4QTZA 4RZXA 4RPHA 2O54A 4UHFA 2H18A 4LVNA 3QUQA 1RKVA 5KNCH 1RLIA 4AL4A 1QO0A 1T13A 1ZCBA 1UJ6A 2CBXA 3KKMA 2ZPAA 4FONA 1QIHA 3IT3A 1GD1O 6PFKA 2JK0A 4RORA 3PC4A 4I1RA 3UBTA 1FMTA 5EXDA 2QTBA 1S8NA 4RKQA 5CFOA 5EUCA 1CK4A 4OSEA 3TL6A 4PTLA 1TQ2A 3CKLA 4PLFA 1PW7A 3RBZA 4G4SP 3KT6A 1CUEA 2GN4A 3GVHA 3TCXB 3UANA 1Q0PA 4J2HA 1CR2A 3F3YA 5FJIA 1XN1A 3TGWA 4KLRA 4IDBA 2IGBA 2VH1A 2WAAA 1EVKA 3EXHC 5DP2A 1Y42X 3FWPA 1HOXA 4PNPA 2A1UB 121PA 1WU8A 2RDMA 3TXYA 4K9SA 4NAUA 1X42A 3QU2A 4Q9KA 3NV7A 4ZGBA 5IPFA 3R09A 3GLSA 5JS2A 2NXWA 2QXTA 4HWOA 1LBTA 2BEUB 2R87A 4D6YA 2DUUA 3UAWA 3Q6NA 5CHYA 4LEIA 4TMYA 4MCIA 1R88A 4RMGA 2BVNA 3NHKA 2BM9A 5AKEA 4PVDA 3DOUA 1ILEA 1BC5A 3AY3A 1Q15A 4EOGA 4RHXA 1LY1A 4K9OA 4BNTA 3W3ZB 3WWYA 4P3OA 4V0RA 1QHGA 2Q62A 4DDWA 2PGIA 5D5HA 4E2ZA 4B3GA 1AZWA 1XPUA 3ESAA 1K7EB 1U8XX 1ZOOA 6REQB 1NF8A 3IOMA 1VDMA 4IKEA 4KWTA 3IPRA 2WHPA 5A71A 1ODTC 4KAAA 1NN0A 2EL7A 2FN3A 4PTZA 1OLUA 4IHQA 4BEWA 4YN3A 3G1UA 3OIFA 1A9PA 1YUBA 3HI6A 5K51A 4AKTA 4AS3A 3NALA 4YUXA 2J09A 3U7IA 1RYEA 2IJGX 1Q0UA 2CUKA 4RIIA 1CCWA 1OA1A 3UMBA 5IDQA 1BQ4A 1I6MA 5CMLA 4M8KA 3UJ8A 1ODFA 2TSYB 1LKZA 1E2UA 2O2HA 5IAKA 1O54A 1C3VA 2IYOA 3EXIA 4EHLA 5ALIA 1HE4A 3I58A 3MRXA 4MKHA 3OOSA 4RHCA 2RCYA 1T5DX 4PE5B 1P45A 3TCKA 3IA7A 1RXYA 3G5LA 1PJ3A 1QIMA 3ICCA 2OHVA 4HAUA 1H42A 1JFFB 3WYBA 1IJBA 4YLEA 3Q4GA 3Q7RA 5I9SA 3T3PB 5BUQA 2O4UX 2XGSA 2EBWA 3HUTA 3OHPA 4FOOA 4G8CA 4YFYA 5TARA 3WGHA 4HK4A 4KRFA 3T4UA 2AK2A 3RFVA 1AX9A 2RGRA 3CF4G 4LGVA 4WY8A 1ZGCA 5U4XA 1UXGA 2WB2A 2IYAA 3D4IA 3LLSA 1J1IA 4DSNA 4NXMB 3S2SA 4DZZA 1Z6ZA 4MQEB 1HDOA 1FIUA 1KBOA 3PE6A 1ZIDA 3WTBA 4LE2A 1S8OA 1SC4A 2BFCB 2MR6A 1XEWX 2QSUA 2W37A 4HNRA 4O5AA 3IB3A 3OPQA 1G59A 1IXYA 3VDMA 1IY2A 1HDIA 3GDWA 3OPXA 4LI0A 2ZUWA 4U9HS 4Z0TA 3GJRA 5IBQA 2R0QC 1GXSB 5WRFA 3R8FA 2PUFA 3BQNB 2FDRA 1ZDMA 3VKUA 2JH8A 2B9EA 3BSYA 3VA7A 2PMKA 2A5JA 2DFDA 2IZ1A 3D3JA 4XPIB 3PGJA 3PFBA 1X1QA 4G5OA 2XCTB 3IHTA 1Z4NA 2D4AA 1R8XA 2E55A 2ON6A 2Y1GA 3A1SA 5DBGA 2H85A 3FKJA 4B2PA 1EG2A 5A9SA 5CG1A 3IMEA 2UYHA 2FSIA 3EISA 3EODA 1EJ0A 1XPJA 3PRYA 4ZI5A 3WZLA 4R8RA 4CCWA 1QQ6A 3TEFA 1M66A 2ACVA 3AY7A 3I1IA 4GMKA 4WK4B 1Z34A 3K0AA 5E2AA 3UATA 2J5XA 3H5NA 2OGWA 3T7AA 1M2GA 2R6JA 3QOYA 3DCIA 5IKMA 3D0RA 3LBIA 3QFSA 3RVJA 3JQCA 1YS1X 1E9DA 4J90A 1RQRA 3P4XA 8MHTA 4TM7A 1CZNA 4DLYA 1P7ZA 4JNKA 3LNCA 4QUGA 2GD2A 1VMDA 5F7JA 1DQYA 4N41A 1BGWA 1TEXA 1VGQA 5BR8B 3TZQA 5TEWA 3SZLA 3W9SA 2EWMA 1U8FO 2DWQA 4MGKR 4QEZA 1IB0A 2B20A 2R5FA 2B69A 2RKWA 4J0QA 4PG4A 3RVSA 3UQZA 4BO0A 4C30A 1C1HA 1CUCA 1HSZA 2R2AA 3VYUB 4JUFA 1NF2A 1XQYA 3V97A 4L85A 4I1YA 1SUBA 3WGZA 3LS2A 2ZBQA 3MILA 4RIGA 4CR7A 2QG4A 2QRJA 4YRMA 3GZJA 3KV1A 3O4JA 1W6UA 2ID7A 1QRDA 3GRZA 1W0KA 2R6R1 3PUYA 5TSDA 3W5BA 2OFWA 4IEEA 4HJXA 4YMUA 2GPYA 3H11A 2YMLA 1PI3A 2W0SA 2J6IA 3I9V1 1AQYA 1NMQA 3NBXX 2PXCA 3PX2A 5J4KA 3QBVA 2RHGB 2Z56A 1J1ZA 1YRLA 1R7RA 1A7UA 1YJBA 1LD3A 3ZWDA 4ZVNA 4R6WA 4L5IA 1A9OA 4G24A 4R7TA 3IURA 1YO6A 5J5VA 3D3KA 1Z39A 4H6XA 2REOA 4O2LA 4KN8A 4LYDA 1QHNA 2VK2A 5SY6A 2BEWB 5EKXA 4L3OA 4ZOBA 3HSYA 1QCDA 3FDFA 3U4GA 4EPWA 1US8B 3QKSB 2WJYA 5DHPA 2DPHA 4GUAA 1XLTC 2GPTA 4WFQA 1L5OA 1Z6YA 3W5VA 3G0GA 4HBZA 4I50A 3QA9A 4OJMX 5KSWB 5KYXA 3GA0A 1MOQA 1NJ5A 5KNDD 2HXSA 3QVSA 4ZU6X 3T7TA 4BKRA 3RC8A 1Z4KA 1B41A 4C22A 1W46A 4LXXA 4ZAFA 5CXSA 5B57C 3OM9A 4EKEA 3O7MA 3LIPA 3MNFA 3N8GA 3SI7A 5F77A 4MRMB 4KR2A 3S2EA 3VH2A 1Z5UA 3L93A 1LSUA 4YMVA 1ULUA 2ZI3A 4GM0A 3TOZA 2CY0A 2JGKA 4UNSA 4RTRA 3GEBA 4CCYB 4AJIA 2NUAA 4HOYA 4R84A 4DCTA 3PYXA 2ECFA 2OCBA 2XR1A 4U7DA 4GIBA 3WXBA 4TUYF 5JCPA 4GLLA 4BU0A 2F2TA 2C96A 1O87A 1Q7EA 1KI2A 4EJSB 1M0EA 1XQ9A 4X20B 3NUQA 2Q8QA 1TUGA 2FMHA 2PEZA 4TS1A 1P19A 3V8RA 4B6EA 4KNYA 1BDIA 4OB7A 2KJQA 4ZCIA 4F3TA 4BZXA 4BMVA 3UBMA 3OIWA 4XCXA 1RIIA 2B8NA 2PX2A 3PEFA 4ARSA 5EJ5A 2ZTLA 4XUEA 2ES4A 3ZY4A 1CT9A 5F35A 3P9SA 4YLGA 2DFPA 2IY9A 3KVNA 1YD7A 3EEIA 2VRNA 4RA6A 3S27A 2IEAA 3TO5A 3M6MD 2AVDA 4QATA 2VUHB 1U7XA 1QR2A 2QRMA 3N2ZB 3P9KA 1G20A 2WYIA 5FUYA 4IO1A 4WN3A 3T1NA 2FW8A 3WKDA 2AN5A 4NQZA 5CIYA 2JJYA 5ADUS 2AFIE 2CE2X 4FOPA 3SD7A 1Y4AE 2ZYTX 1E3SA 4X6YA 2V8OA 5ABPA 2X9GA 1X8KA 2PGAA 1QGED 3QNMA 4YP5A 5F4BA 3UGJA 1O5IA 2QZPA 3F49S 3I6ZA 5E6RB 5KYKA 2PX0A 2WSSA 3M1AA 4N7MA 4PRLA 4B8WA 4I3FA 5A0FA 4IDAA 2G1KA 4X45A 1QTQA 5SY4A 5AVSA 4GGMX 2CL7X 2QPTA 4OQEA 3O92A 3MQFA 2LNDA 4B6FA 4XQGA 4EECA 4LNUA 4LXHA 4MX8A 1Z0IA 4YAJA 1Z88A 4HTFA 4KXYA 3RRNA 2QS9A 2XGGA 3OIYA 2WLSA 3A14A 1MRSA 3EVTA 4OHMA 1J2YA 2UZ4A 1OTXA 4NSNA 4UC0A 3ME5A 3Q10A 2FI1A 2VT6A 3ETLA 1KFBB 3PEVA 3NFYA 1ZM7A 3JQQA 5DX1A 5FV4A 2IBTA 1U1GA 5TEVA 4L5CA 4NZOA 3K0HA 3IUNA 2Y4NA 4U3JB 5JC8A 2R6CA 2AGVA 2NTYC 3GGJA 2VF8A 4MRRA 1ML3A 2VT2A 4LVOA 2IQIA 3R4CA 2FCAA 3C3WA 2C5LA 3DOOA 5IKXA 2OOSA 3OCYA 1I4DD 1IMJA 3FPHA 2EG5A 3WBFA 2L0XA 5KDDA 1GUYA 4B3JA 1KETA 4FZ3A 3QI2A 4LJ5A 4DRZA 3H16A 5EHZA 5KOHB 2FZCA 4AJ2A 3CPJB 3Q3HA 5TVKA 2Q6KA 4YJFA 1D0IA 4F8JA 3KETA 4WJLA 3RANA 5A02A 2DWUA 4DWVA 3ZOKA 5G02A 3OCXA 1R64A 3PENA 1M5RA 2GNAA 3EGDA 1IUPA 3IMGA 3IUPA 5J47A 3VR5A 4D9NA 1N8KA 4QWMA 1P0FA 4CMIA 2HQOA 3EFBA 4ZHSA 5T57A 4LDAA 1NOIA 4HEQA 4S1TA 5B7GA 5BR1A 1GJRA 5LQMA 4TKZA 1FYXA 2Y77A 3CURA 1XVAA 4JBHA 1SD2A 3TQIA 5DOZA 1UBKS 5GQSA 4M36A 3QMVA 4IFEA 3SFTA 1ZINA 3KQLA 4KZKA 1W4BA 3WKEA 3ONEA 3KQSA 1G3MA 2BGGA 1DRWA 2BUAA 2P2ZA 3W04A 1SHJA 2YH2A 2QBYA 4S1PA 1Z56C 2WKWA 4LTDA 5DNCA 3V4RA 1KR5A 3C4JA 4X90A 1BZYA 3B51X 3L07A 5LA6B 1N4AA 3ZLUA 2DJIA 4RVCA 1UH5A 1EK0A 2H51A 2ISCA 1E61A 4GEGA 4R2HA 1JPVA 3HZOA 5DFAA 2XCSB 4GR5A 2AN3A 1E9SA 1BVHA 3DUFA 1J06A 1RQ2A 3QHQA 1GVHA 3ET4A 5JDCC 1C1YA 2ZYHA 5A05A 5JEDA 4RFSB 5EJEA 1VBMA 1UPFA 2XCUA 1C30B 3G1TA 3D0OA 3G8CA 2C82A 5AK6A 1AY0A 3K0FB 2ZQZA 4TTVA 3RAGA 3TZHA 1A9SA 2AI3A 2CKMA 4LE1A 5FPSA 1A7AA 3EZXA 2G1PA 1Y9JA 4JBXA 4KGVA 2I9KA 1RZRA 4V2IA 3V8QA 5F7XA 1I13A 5JY6A 5KVVA 2H4ZA 4C6TA 1UPCA 2VT3A 2BL4A 2VQDA 4L7QA 4YCAA 2IS4A 4UTVA 1N2BA 2EWVA 4WCFA 3KAQA 4ENWA 4CEIA 3A2MA 2H52A 4MUIA 1V96A 1HT1E 4GX2A 1ESDA 3WI7A 4DV4B 1U02A 4RK1A 4NFHA 5JD4A 2XDYA 4E03A 2HU5A 2IW1A 1B8UA 3RSHA 4YRBA 1ECJA 4A16A 3K9QO 5D5PA 3GF4A 2UVPA 3LPDA 3QZUA 5DTMA 1I33A 4UU0A 1L5NA 1P2SA 1ILWA 3O4IA 5DHTA 4IXTA 2O3QA 4RHEA 4YRRA 3O21A 5ETJA 3ZGNA 4WKPA 4LI3X 4P86A 3RYCB 2WSSD 3P0EA 4ZVSA 2DBRA 3D1LA 2A7XA 3HGMA 3EQ7A 3PTLA 1DX4A 4PX2A 2ORYA 4FHGA 4X64B 4B74A 3KT3A 3Q7TA 1TU3A 3ND9A 4H35A 1MAWA 1X80A 3OSZA 1S3FA 5J2UB 5LP6B 1KU0A 1JH8A 1MBZA 1SY7A 2B3DA 3R20A 4JP8A 3VR4D 5I7EA 1XZIA 1HURA 1MH1A 4DCPA 5C5CA 3QBEA 2ACKA 3AF4A 3NDBB 1EESA 4EATA 5TQJA 2OG2A 3GGDA 4BVLA 1C1XA 2B94A 4NG5A 2AEFA 3R76A 3MB5A 1ZOPA 4PS1A 3H5AA 5JVDB 2OUKA 3MT9A 4I50F 2PU5A 4JOSA 3SFVA 2PKRA 3PPXA 4RLFA 4G56A 4BLSA 4Y1RA 4J2TA 1ADBA 3QWIA 4C05A 8GPBA 5KCZA 2V55B 4KXWA 3Q0TA 1QMGA 3BCRA 4EZIA 4GOKA 4JLBA 2JHAA 3T0FA 1N3IA 4EY5A 1MJ5A 4JC0A 3E7DA 1I01A 4E21A 1DQRA 2Q4EA 2Q9UA 2XF2A 3I6YA 5B1HA 3TPZA 5CLFA 4GLOA 2CJPA 2AJ8A 3JVIA 3UMRA 1L6IA 5C1PA 3CHYA 4ARUA 4EB6A 3MMZA 5I7UA 2G9UA 3NOXA 3DZHA 1W0CA 1EM6A 3F46A 1WZEA 3QUCA 3TTYA 1S2OA 3O9ZA 1JYSA 3COSA 2HK8A 3O1IC 3WY9A 4H7HA 3A6ZA 4FHEA 4K9DA 4TV8A 1Z18A 3LUPA 3WE7A 1PJLA 4EHJA 2PJRA 3N7UA 3CSDA 2ZJ5A 2VP5A 3EAFA 4JU9A 3JVDA 2PLNA 4KDFA 4QXPA 3RK1A 1EWTA 4F85A 2YXPX 3BWYA 5GJWC 2P4QA 3WLTA 4BNDA 4NCKA 4AMVA 3BS4A 3UKOA 1PDOA 3DONA 3FM9A 3HLYA 2GK6A 4MW2A 4WZZA 1T2VA 2NACA 4OHOA 4H3KB 3CRNA 3LBNA 2CD9A 1JDZA 4Q47A 5EQFA 1MX3A 5A3VA 1GPBA 2CJFA 2ZR9A 1L5MA 5HF5A 4N7JA 4PG8A 2FVXA 2RHOA 2HXYA 2QVBA 1K5HA 2VP3A 3TM5A 3G2NA 3O8CA 1A97A 2QSYA 3Q3CA 2H16A 2NU8B 1KAEA 1H05A 1E6LA 1XSEA 2B4QA 3WIDA 1JZTA 3ZBTA 1T2AA 4P0PB 1OIXA 2ZAMA 4L28A 4MVCA 5P8WA 4OFWA 3UWMA 3U0BA 4TLBA 5EQTA 4D5EA 1CQJA 1U5AA 4LOHA 3B2NA 2Z3VA 1B93A 1AXRA 1BDBA 1TJ4A 1JBQA 1U0TA 2G1AA 1QH0A 2VAMA 2AHOA 5FHRA 3BHMA 3GPCA 4DB4A 3P27A 5HTOA 3AINA 4MJXA 3WLAA 1W2HA 2DHCA 1IAVA 4QXMA 5JPDA 1VP3A 4BO9A 2I1WA 1GGJA 2ZRHA 4D3SA 5CW1A 2XUQA 1THTA 4TVSA 5BR7A 1N36B 3RTEA 3ILSA 3ICVA 4W6QA 3A36A 4KTVE 2OL4A 4PZZA 1QOQB 3R3XA 1N8TA 2YZMA 5ITSA 2HLHA 2K7ZA 4MR8B 3OTOB 2CUNA 3KYCA 1NNEA 4REQA 3I1FA 1M2NA 1MENA 1SVWA 2RMKA 1GZ6A 1WDLA 2XDWA 5B2ZA 2ZIVB 3H9UA 3JYNA 4HQRA 1AK9A 4O4JF 4X1IA 1EVYA 3C8MA 2DQYA 1DJQA 2BGKA 2HU2A 3MZ0A 5KYVA 5T6BA 4JCOA 1BXRA 3K2EA 4HDOB 1M3SA 1KHTA 3DMTA 4G07A 4QVKA 4UXHA 1HY3A 1BE8A 2DQZA 1KEZA 2I2BA 4OV6B 4PV7A 3KIPA 5E8RA 1K7YA 4BX3A 3WICA 3KPUA 1C29B 2NNWB 3UJPA 3ZC3A 2PMEA 1G8KA 1XD2B 2I0FA 4FS8A 3FF4A 4C7MA 4DXDA 1JEJA 5G41A 1QPGA 5DU2A 1Z3IX 3ELUA 3ZJVA 2P0EA 2JBWA 2MTBA 3IVXA 3MWYW 3V34A 5LZ4A 1KEEA 3PYMA 4XFKA 1PNRA 1AKQA 4ZO4A 4JLNA 4E7OA 1B73A 1UWVA 2R6GA 2FPWA 1TTQB 1C7JA 4XA8A 4MVXA 1MDFA 1PVVA 3VGJA 3KVOA 3IBGA 2EATA 3BEOA 3GR6A 2CGEA 1MX9A 1JT2A 5F78A 4UDYX 2IHKA 2AFIA 2BFOA 4WKNA 5ED0A 4X6UA 1CU1A 4OI1A 1ZNQO 3VHXA 5KYYB 5ESDA 4FI3F 4FK8A 3PE4A 2EZ4A 4G23A 4QL3A 5TJ9A 3JAMA 2BYTA 2W2KA 1T8SA 5BP7A 1VL6A 4IFTA 2A33A 1TYBE 1QHIA 2XZTA 1XGKA 5AKXA 3ROGA 1EDDA 4P4UA 1D1SA 2ODQA 3WLIA 2ZE8A 4IIEA 1HRDA 1VLLA 3EG9B 3LQ4A 4IEIA 3UG7A 4DSUA 3R9WA 2VI5A 3VUEA 3GJZA 2VKTA 2X42A 3WKCA 2AG6A 2CUTA 5LOVA 3S2IA 3DLAA 3VQTA 3ZKWB 2GEFA 3OWXA 2YMQA 1Z4OA 2VHYA 1HFJA 3CS3A 3CF4A 3GLIB 2CZQA 2D0IA 4YNBA 1KQ3A 2LIVA 3PXDA 4UDNA 1G21A 2V9PA 4UOZA 5B1EA 1Z82A 5DO9A 3AI1A 2ZZMA 1G5HA 2FWAA 1Z6QA 2ZRKA 1RFGE 3HY4A 2FOXA 3OSUA 4EEKA 5A7FA 2VN8A 2ZITA 4R9RA 4DTIA 2RGWA 2EW8A 4Q3LA 2ZUUA 3I9LA 4IVPA 3BORA 1P0MA 1MQAA 4GW3A 1XXHB 2IYYA 3IQXA 4UAJA 1FDSA 3VR1A 5ALTA 5JYCA 5LZ2A 4NK4A 4JZKA 2OVFA 1KYIA 3RRMA 3A6HA 2OYCA 1OREA 2H7CA 3QX3A 4OI4A 4U2KA 5E7QA 4PO1A 1XCJA 1GITA 4C6HA 1EKXA 3VV2A 1D8TA 1D9ZA 1I3LA 2JCXA 3C41J 2WM8A 4CG1A 5J1SB 4MA4A 2DG2A 5SZHB 5L3RA 4W9NC 4PWYA 1Y6QA 3EEFA 4DM3A 4DZTA 3CLUD 3A6LA 3KPVA 3RODA 4RJTA 4ZYTA 4HAVA 3CVVA 3WIOA 2X77A 4TLAA 2QRVA 1JYEA 3TMYA 5BN5B 1KYYA 4X3PA 2I6UA 2QV7A 3DKRA 1WDMA 4FTWA 2HF7A 1NJ8A 3DVSX 4IO0A 4ZQEA 1JQLB 3GWGA 1QCCA 2AHRA 3UIEA 2V58A 2WM2A 3BXEA 3IIKA 3RHTA 2XQVA 3RC2A 1WZIA 3ZHSA 1JDNA 2VHWA 1JXMA 5E6RA 2ST1A 4RK6A 1JHDA 4UD2A 3AFGA 1QBGA 4PGMA 2Z2KA 3KX2A 1ZR4A 2FPPB 4R0MA 3F3SA 4HYEA 3E8SA 3BK2A 4WWHA 5IARA 3F0TA 2PAFA 4EY4A 2YKGA 4ZAZA 3H4VA 3ZU2A 4E3WA 2ANBA 3DB2A 2X3FA 4Q3CA 1T36B 3UEOA 5K0ZA 4F2DA 5KWJA 3M6UA 4IM7A 4ITRC 4L0DA 2WAYA 5HIAA 1YRAA 2AT1A 3V1TC 2Q1UA 1UEXC 5DOVA 4QDKA 4JVOA 4EFNA 5KOJB 3FPSA 1UJMA 4B4VA 4W5JA 2E82A 4ZVRA 1N7JA 2EKBA 2I4TA 2VJPA 3U4QA 3KCNA 1QRUA 1AJEA 1L9KA 3HYLA 4G81A 4MGYR 4DLAA 5IYZF 1M8JA 2GDJA 5CM2Z 1V3UA 3G0DA 3ZN2A 3BM5A 1A96A 5HGJA 1C30A 4BVJA 2IC5A 3C1AA 1JLLA 1GADO 1GTJ1 2W6PA 3DZ8A 3O3NB 4YQYA 4F9FA 5C46F 1N5RA 3KSUA 4UZFA 4AZTA 3F3MA 2YV2A 3FSEA 3EOAI 5JNSA 4KR7A 5K6AA 3E9EA 5C8ZA 5FWXB 2N47A 4CT0A 1CR4A 2VOJA 2DBZA 3AERA 5JWHA 3QKSA 4RM2A 1F6DA 2FPUA 1PJSA 2Q45A 3MOIA 4M53A 3OLZA 5F23A 1ODKA 1W75A 4QYTA 4IKOA 3PGLA 4R98A 2N3ZA 2BI4A 3BGDA 1O5TA 2CN1A 2QZ9A 3EK2A 1YAJA 2R7AA 3I12A 5A1JA 3LLMA 5L51A 2EP7A 4RV9A 3UWSA 3ZI7A 1FJHA 4XYMA 1GL7A 1SULA 4N82A 3CLVA 4GC9A 4ALNA 2YY6A 1JSCA 2XWJI 1R0CA 1X1BA 2P9FA 4QQKA 4R1UA 4JFRA 3P9QA 5FI3A 2VJCA 3IBCA 2JCBA 4EUSA 4N8EA 3W9UA 2Q4BA 4KMMA 4RZ3A 5ALMA 3PCRB 4FYXA 1R0XA 3WYEA 4PYOA 2PS9A 3OT1A 1WQ3A 4OIFA 4B3RB 2FFRA 2JHCA 4LF9B 2OZPA 1N75A 1RTKA 3A2NA 1EE9A 1SG0A 1ZVKA 3OJWA 4LHVA 2EJUA 3FRJA 3STYA 1PL7A 2X0JA 1HTBA 2W00A 1VJ5A 2W2MA 1WW2A 1S3GA 2GYYA 1FBTA 4L5JA 2IHVA 4S1WA 1IYZA 3LSTA 4LTMA 3T3NA 1UKAA 4M7OA 3V8VA 3QUTA 3I0NA 1G4HA 1M74A 4I81A 1TO2E 4INZA 5E0OA 5THXA 2JHGA 3A1WA 4YDQA 2JLBA 4OQQA 4CM9A 5ERXA 1W59A 3AT1A 3HLTA 4G1MB 5KVQA 3SICE 3Q8LA 3GLIE 1HE5A 3PKIA 1N7IA 4H1WA 1W0JA 3KCQA 1LDEA 4OBEA 2PSHA 3SR0A 3UYLA 2PH5A 2MU1A 3N0TA 4YRTA 3KO8A 3ECAA 4JH0A 2W71A 4CCYA 3UWDA 3RT7A 2I65A 3E5RA 3AIIA 2DLNA 4IDEA 4MW9A 2C7QA 1PQYA 2Y66A 1IB6A 1JG1A 2GZAA 3A1EA 3HU5A 3PHLA 3QYAA 5HPYB 1WKCA 1JAHA 1E4VA 1U3CA 1Z8NA 2RGNA 2WUVA 3I8XA 3B38A 1C3LA 5CP8A 4CQMA 3LH5A 1U1IA 3HBJA 3M6WA 3N87A 5BW5A 1HC7A 5KJFA 2B2CA 1V8FA 1IHYA 3QEMA 2JAUA 1UBUS 1J0BA 5GZ1A 2ZK7A 3D1JA 1EUQA 4KPEC 2I4MA 4LUCA 3OE7D 5EN4A 4FGUA 3BMNA 3KE8A 4YBZA 1T8TA 3ONDA 1UJ2A 4QUIA 4RCYA 3AUSA 2D0PB 4CKBB 2XNKA 4YO7A 5F1PA 2E1PA 1Z0SA 1Y34E 4ESVA 4G1UC 4KRXA 2WOJA 4YFVA 3OTHA 3PJDA 2BFCA 3P0IA 3GUUA 3P97A 3VR6H 3MUFA 1PSZA 3ENVA 4YMWA 1VG1A 5HMLA 4PICA 4PSKA 3HVUA 5IT4A 4ZQCB 5FLKA 2BFWA 1VE1A 3NHYA 5EIWA 3G1WA 5AM0A 3SX4A 5JZVA 3N5KA 4GXNA 4Y2XA 3VKGA 1XKTA 1A5AB 1NJ1A 4ND8B 4S0ZA 4GM1A 4XE5A 3TH5A 5HZHA 4RX1A 3W8RA 3HS3A 2UU9B 1FFYA 5JFTA 5CX4A 4UEOA 2PRKA 1K4KA 4YQZA 5BMVF 1FDIA 1PDWA 1VJ0A 3B53X 1HE8B 1D2GA 4PHHA 2R68A 1A76A 1F12A 4PLZA 4I1IA 2DR3A 4X94A 3RVDA 3O2JA 3ZIAD 5BR4A 1U7HA 5FWYA 1D5WA 4J0GA 2NU6B 3BN3A 1DQNA 1YQEA 2C4TA 2IY7A 4JEIA 1E8DA 1DRVA 2COKA 2FSHA 4RH0A 2G88A 4HUQA 2XVXA 4Y0VA 3EQZA 5DGDA 3WV4A 3HO1A 3FX2A 4LZAA 3VR5H 1KY4A 5K3OA 4GR9A 4RL6A 4F0JA 3KXLA 1DQSA 5T67A 4C6RA 1W5FA 2OWEA 3U9LA 2EF1A 2OKGA 4HJRA 3BHJA 1Z68A 821PA 3UXEA 4PXAA 3OECA 3TM4A 1UXKA 1AH2A 2C1XA 4NENA 3NPAA 1RRFA 1J39A 3RYIB 1J21A 221PA 2WG0A 5FTKA 2I6XA 1Z74A 3TUIC 1NDUA 1YFLA 5DNWA 2EKQA 2XT6A 1GILA 1USKA 1N7HA 2O2ZA 3AX6A 2N42A 4GRAA 4KQ2A 4NU6A 4HKTA 4UMEA 1BXRB 1QHXA 2O2DA 3OQBA 3SU8A 4EKGA 3JR7A 3Q3JB 4NWIA 2V3CC 5A4FS 2WAOA 2XLBA 4INAA 4ASUD 1X39A 1CG6A 1VIVA 2PH7A 2P4HX 1F8UA 4DAOA 2AFHB 3NOQA 1P3DA 1F6BA 2Q4TA 1IY1A 1P2FA 2FPLA 2JEOA 2WYWA 3GQVA 5KI6A 5CA0F 5CB4A 4F93B 3L6BA 1DRUA 1YS9A 2I1LA 5AW7A 1AS0A 5L3QA 1GNSA 2HUPA 2P62A 4LHSA 4N5MA 4N6GA 2ZM5A 1WNFA 4JJZA 4PZPA 3INYA 4PN7A 4DJDC 1T4CB 4C06A 1ATIA 2PLAA 4KX5A 1WTCA 2ZIWB 4OQPA 1TGYA 2OGZA 1WS6A 1KQFA 1M2VB 5TXGA 1N5OX 3UA4A 3L6DA 1KDRA 1WMDA 4C2BA 1ZZGA 2H7YA 1Z0UA 3KDPA 3PC2A 1YR1A 2WVHA 5LLTA 4MGIR 2V7WA 4S1VA 3R0XA 3ZQKA 5B3KA 3V4PB 1I10A 1ZCJA 4JI6B 3ZJ5A 1LZKA 2PNFA 3PLRA 5EHNA 2CBGA 1WM1A 1PJCA 3EZGA 5D3KA 3FNHA 4H0NA 5HF6A 1E2JA 4LXYA 4MR8A 4R2JA 4DRXB 4D26A 1A2KC 2IPXA 5K9ZA 4WSOA 1A8SA 1H2ZA 1YZ3A 3FD8A 1Y81A 1OHHA 3MRSA 3HDTA 3IAM1 3K6SB 1CVRA 1C14A 2ZANA 4S3MA 3FB4A 1VRVA 2PZFA 4RVOA 1CHNA 5DASA 3PFHA 2HLPA 2PMDA 2RK3A 5I7OA 2V59A 3ZCSA 3UWKA 3WAGA 3IUYA 1A8HA 5G2OA 3NTXA 1FFDA 1IU9A 4TV9F 3UQYS 3L0CA 1DVRA 1E66A 4QHSA 4DDKA 3UJCA 4FCVA 3V80A 1G19A 5ICCA 2QDXA 3K96A 1RJGA 3FMPB 4ONEA 5CCBA 4AUMA 5IDWA 2X8JA 1C0IA 2PSEA 3DR3A 5G1NA 3HDGA 4IIDA 5IEBA 4A36A 4YR7A 1DIOB 4KYIB 3BWXA 1JDTA 4Y2SA 5EPUA 3ZY2A 1FNBA 3CNOA 1JDVA 2Z1DA 2CDRA 2EQBA 3MMNA 4OQLA 4PNHA 1RBQA 4IXMA 5DBFA 3A4VA 2V7TA 1T8PA 3OOYA 4V1CI 3IHWA 1OPRA 3ROXA 4F04A 3C43A 1EUCB 1LJUA 4TUYB 3G8BA 2R8ZA 1DKNA 1WIWA 3E3LA 1PR2A 4O3FA 4OYHA 4R5HA 3W79A 5G3YA 3SM9A 4CKEB 3U6KA 3R7DA 4UOEA 4CQNA 1SPXA 5BNIA 4BGUA 2AMFA 1J2JA 3KLBA 3EUAA 4QUDA 5FWXA 2FSUA 3ZIAA 3G2LA 2F9MA 3IDQA 4DLUA 3BH6A 4XR4A 3IC5A 1O6BA 1GZ3A 2CJYA 1I3OA 2JFOA 1ULTA 3CGGA 1CD5A 2I6FA 1QFXA 3NHZA 3NQ41 3QVGA 3TCNA 1N6NA 3BXGA 2JCSA 1NSTA 2V5AA 3GUZA 2OCLA 3ELYA 1IK6A 1C1XB 2IXGA 3Q5DA 2CL0X 4MVJD 5AP9A 4JDUA 3BFVA 3QTLA 4GDMA 5CW2A 3IVGA 5HS4A 3WZ2A 2MSNA 4BWGA 1OYWA 4UTNA 2MMCA 2FR8C 3B1VA 3MOSA 1O94C 4QXQA 2DMRA 1V11A 1X7YB 2VNHA 1Y8QA 2VTVA 3HGQA 2VK8A 4GQBA 1JAIA 3AQ4A 4C08A 1H3FA 1ZM9A 4OA5A 2NSDA 4MV8A 1PWEA 5GP1A 3WSWA 2LP4Y 3GB9A 1J2EA 1CUBA 4ZC8A 1KOFA 2IDMA 1RU3A 4TUYA 3WVNA 1HNNA 1N2XA 1PLJA 2YUTA 4B3XA 4D45A 4F5EA 2HV9A 4Q4AA 3RIGA 1O4WA 1V2GA 4A15A 4RJIA 5DT9A 1Z2AA 2EFCB 2R4UA 1P39A 4IIFA 4K03A 4NAHA 3PFKA 4PLYA 2GK7A 5DXFA 5FTLA 3AB8A 1ZXLA 1U9IC 1KXJA 3FPFA 5KSYA 5IM4F 2HHAA 1GZ7A 1RYHA 2R79A 3ZCXA 1QK5A 4A6DA 4I1SA 1JXOA 1FCJA 2DPMA 4PC6A 1OQAA 4NECA 3IUMA 2G0AA 4PAMA 2BH2A 3HVIA 3UO8B 5IG2A 5DIFA 5B1DA 1M2JA 3RS0A 1I7NA 4Q4HB 4L5YA 4OH1A 1HNZB 4Z9XA 4EG7A 5C32A 3WIEA 1GAQA 1Y33E 3IS3A 4YLYA 2Q0XA 3ANNA 1R10A 2B1JA 3HWRA 5FTMA 5JXIA 4FEGA 4JQSA 3KXDA 1RZVA 1F0NA 1ZXBA 1U1FA 2JKVA 3UKJA 3L6UA 4JT9A 4X71A 1X3LA 3CT6A 4YJHA 4HDQB 2CE7A 2B34A 4HH0A 1JTEA 2XGMA 1R4NA 3LPCA 2P6UA 4KU4A 3K7EA 3CWCA 3MJTA 3GRAA 2OXTA 4WGFA 1B8OA 3IQEA 1C9KA 3VNQA 1UZLA 3B12A 2IODA 1NVTA 1RAGA 4JI4B 2AYYA 1IWBB 1RJ9A 1V25A 5AW3A 1P77A 1FVOA 1PZMA 2VTDA 4HQLA 3PNKA 3DDHA 3PIIA 4DC9A 4JITA 5L6MB 2X3YA 5LA6A 2O1XA 1T9KA 1V8ZA 2H1SA 4GXTA 4NENB 2O4CA 5EPOA 1ISSA 3L01A 3L7DA 4QUBA 4D41A 2OZEA 2X8AA 3DKIA 1YBVA 5AVZA 4RENA 3K4HA 1DQZA 1IUKA 3HO6A 3WHIA 4N3GA 1QANA 1D1PA 1F8YA 1NUQA 2EP8A 2PKQO 3F5FA 4HN9A 4B81A 3C24A 4GG1A 3G8DA 4JJEA 5JH7B 5CXUA 3BMOB 1B26A 5G4LA 4EAQA 1W49A 1NPYA 3BA1A 3BTUA 4CR8A 1M7BA 3T4XA 4LTNA 2X8LA 1KKLA 2AV6A 1YXMA 1ZM4A 1AS2A 2J59A 1RHMA 1U3WA 1F3OA 2P1RA 2AOUA 4WN9B 2ZI4A 4JSTA 4KI0A 4IICA 2NTNA 2GBLC 1OI7A 2JGJA 2B30A 1XMJA 5EZQA 3L0SA 1XJQA 2PGXA 3OZRA 1DJMA 1EFUA 3E7WA 3Q8WA 2H5JA 2BM0A 4JYBA 3SBDA 1S4MA 4YQFA 3VR3A 4EMBA 3L6RA 1EUDB 2H07A 5KNLA 4FSXA 2PQ6A 3FOBA 3HKDB 1KEEB 1ZJZA 3OTIA 4DQUA 1KORA 4LVCA 4UXJA 4FE7A 2FGJA 3EZYA 3S3TA 3G0HA 1VKOA 2YR0A 2VDVE 1U90A 3ADDA 5DRTA 3VVCA 3BWVA 1V47A 1NIJA 4BJ1A 1G5FA 2EKDA 3WGUA 4W5TA 4FEEA 5EWJB 1EIZA 5EKDA 2EQ5A 3HR8A 5L7YA 4CTKA 3ZVLA 1HT0A 5COQA 2BGRA 4YCMA 1FYEA 1G7CA 3VO9A 1C8KA 5HIKA 1SNYA 3RW9A 4P81A 3FVQA 3GEMA 4EAAA 4ZFNA 1CEYA 4BQPA 3QWBA 3S29A 3LE8A 1E58A 2JFYA 3DBLA 3ADBA 5FI0B 1EU1A 1H0SA 1IEVA 2P78A 4MQ6A 4L50A 4ROSA 4LK2A 5FOXA 3Q1LA 4OQYA 3CWQA 3JTEA 1PG0A 3DLCA 2UZIR 4R8VA 5I4IA 1JMKC 3NHSA 5EESA 3KJQA 5DULA 4BPBA 3HCAA 5TLSA 1NM5A 4V0KA 3U7EB 1Z2PX 3UMSA 4MKFA 4N18A 1UBOS 3MJSA 3TAUA 3L1VA 2RAUA 3IIEA 3PWTA 1E5TA 3BTOA 2JFXA 4GSLA 2YV4A 4E1BA 1ZAYA 4R3NA 1LQUA 1FS5A 4RF3A 3VNUA 2G80A 3P9PA 1KJZA 2YS7A 4DWOA 4YAEA 4X44A 4MGEA 4DUPA 5DM70 4JXJA 2XSZD 3BXFA 3MJFA 3MVEA 3CWZA 3VISA 1ZJWA 2VYVA 4EB8A 4F91B 2PKEA 3PXXA 1UMDB 1S02A 3RF7A 1L4UA 4F4HA 3WDMA 3SSNA 5JFOA 2HLDD 1N8NA 3B36A 3GT7A 4QECA 2R1ZA 3KAKA 3THXB 1FSPA 1UWCA 3ROQA 1EFVB 3UT0A 3PDIA 5EIBD 5AKYA 1TVCA 1P8AA 1A50B 2OESA 3D2AA 3P2EA 2Y0PA 3URKA 1A4RA 5FQNA 3EW7A 3J81k 2JAPA 5A4DA 1EFRD 1WXFA 3DZCA 3FGPA 3KOYA 4NFSA 1KQGA 2C7PA 2ZYAA 2QTZA 3PQFA 3O38A 3D59A 3MTGA 4CFZA 1Q0ZA 3IALA 1KDPA 1QORA 4NE7A 5AHWA 5IVIA 3V2HA 4BO7A 2ZSKA 4DA6A 4FHDA 5JECA 4FWBA 3TAXA 4R1TA 2IPOA 2VRCD 1MLDA 2C9MA 3B13B 4MV1A 1JHRA 4D9BA 4GPBA 3NXKA 1EK2A 1OW3B 4RWEA 2JDID 4B7AA 5BXQC 2X9VA 3RVNA 2YZNA 3RYFA 1GKUB 4RDCA 5F2KA 4CV1A 1UDCA 2BCEA 1HGXA 5LNK6 1ESNA 3WL4A 1C4KA 4HTAA 2O59A 1L5HB 4B0OA 2GBIA 1R50A 4Z4CA 5AKGA 1YAHA 1FQOA 3B8HA 1FMFA 4LJ4A 3W3AA 1IXZA 4KWIA 3L1HA 3Q11A 2J07A 1YUMA 3QVXA 2QBYB 2G6TA 1GPKA 3AOEC 2HGSA 4EYKA 2J0SA 1P5JA 1DOHA 3FCEA 4RV4A 5CK4A 4JGIA 4JVMA 4NMXB 3U4DA 7REQA 4HLUA 1LTHR 3O94A 1KO4A 2HX1A 2GRJA 3CLSC 2ZJ8A 3RQIA 2F4NA 1UT5A 3AJEA 1X7GA 4TKUB 3UK0A 3GFRA 3AETA 3ZBQA 4P93A 1DTWB 1GGFA 2R7KA 4HEJA 1KO8A 3DBVO 4ASUA 4P7FA 1M8PA 1JSRA 2WIGA 2I55A 3LZ6A 4UNQA 3STHA 4EHFA 2IYSA 3M9LA 5FX2A 1YWGO 5KQLA 4P33A 1YTUA 3I30X 4QXOA 4RPCA 4FZJA 1GSOA 4L5AA 5DPMA 5I01A 3JYOA 1EGMB 2ODWA 4UU8A 3S2ZA 2OCIA 2VAXA 4JL6A 3PVCA 4ON9A 4LOAA 3L8ZA 4DV5B 2IOFK 4MEJA 2ID4A 4PC2A 1KAOA 4ZU3A 1WQ4A 4FUTA 4I5IA 1L5HA 3V8MA 5ICGA 4MRNA 5JAQA 2PDAA 2C3UA 1H2EA 2H4WA 3H1GA 1I30A 2CBZA 4AY2A 1SRQA 3NTVA 1PZNA 4PF1A 2RJNA 5IK2A 4D97A 3AEQB 4QODA 4K6HA 3REFA 4CEHA 3W4JA 1LC3A 5JYDA 1QLJA 3ABRB 3WO0A 4U7GA 1KMHB 2GZHA 2WHRA 1LX7A 3HU3A 1ZNWA 3JRNA 4OGLA 4RV5A 1VRCA 4LRWA 4J16A 4EQ6B 1SC6A 4E4YA 1KO7A 4X1IB 2IX3A 2B61A 1QO7A 1T2DA 2ODPA 3NBZC 1D7AA 3TD9A 4YUAA 3COWA 1M2WA 1LPAB 4Y98A 3IELA 2C7BA 2ZVQX 4AROA 3R3UA 4MVWA 1T6NA 4BATA 3GPLA 1E3IA 1J1UA 1MC8A 2Q5LA 4TWRA 4EGQA 4ER5A 3IXLA 1LF0A 3W9BA 2G36A 5JD6A 3HI4A 3HKEB 4RUKA 5BNFA 1BJTA 1I3NA 1RQLA 5GV7A 1ND5A 1O58A 2H8KA 2HK6A 5JSKA 5F9MA 3DLTA 4G5SA 5ALHA 2IWRA 3HB9A 4FR5A 1AGPA 3EZ7A 1Z47A 5F33A 2QLLA 5F2EA 3OLXA 4LX8A 4BIIA 4D8WA 1P3Y1 1UBSB 2JJ1D 2ACWA 4KHPB 5KYWB 4Q3NA 1WBBA 1NQTA 3UWPA 1E64A 1R8YA 3DHWC 5TPZD 1Q77A 1DWOA 1KZ9A 2XITA 4NATA 4CNBA 3FYTA 4JT8A 2EFHB 2NYVA 4X65B 1Y9DA 2B7BA 5H4GA 2J3EA 3K1AB 2XKAA 1DG1G 1J9ZA 1DBSA 1X7XA 2CMKA 2C42A 3HH8A 3IDZA 3JQAA 4LAFA 4ZYUA 1SQSA 4YT2A 3GCGA 3R23A 2JI7A 1J0DA 3I04M 3GAAA 1HLPA 3JZMA 4DBLC 4NCHA 1RE1A 1JECA 2J6HA 3RHFA 2VF4X 5ALLA 4NHEA 4AXXA 4MO9A 1DXOA 1RHJA 1N5MA 2NO6A 1E20A 4YXFA 4RD4A 1X9HA 3VKHA 3AKEA 2JLSA 3P45A 5FBQB 1S2IA 4DEVA 4CIXA 3A1NA 3OCCA 3Q88A 5TF0A 3THOA 3HN7A 3M6VA 3M9WA 1Y6GA 1E2PA 2GUGA 4AZ3B 1B42A 3W3AD 2EV9A 1PK8A 1RI4A 2I3GA 2O8VA 4F60A 1PJQA 3HFRA 3REQA 2IS2A 1VYTA 1WKBA 3BTVA 1FJ2A 5BY2A 3GRCA 1EWKA 4AWXA 1BHO1 1Q91A 3ANTA 4U5XA 4KFCA 1C4WA 2V65A 3G2MA 1GYQA 4BQFA 1OC2A 3KTOA 1GTZA 1KP3A 4C04A 2WI8A 1EFDN 5AXAA 1T5BA 1JFSA 3WGJA 2WYHA 3GLUA 3NHMA 2XTMA 1W1UA 2W6MA 1VPTA 1JV2B 2JI4A 1QR6A 4Q7QA 4ZQBA 1FVFA 2QU7A 4KPUA 5JW6A 2DPYA 1EFCA 3ENQA 1T3GA 4B6PA 2F43B 4JXXA 5D3ZA 3R3HA 1XRPA 5FA8A 1W93A 3MOGA 4M88A 5FWDA 1OE0A 4KBFA 1BYUA 2YN2A 3V2GA 3AR5A 4MI9A 2AD5A 3F8TA 5AI9A 2EX0A 2NTEA 2GSWA 2A58A 1V3TA 1ZU5A 3T7DA 1NWCA 3LT0A 3LW8A 5E9AA 5IN5A 1T8RA 2Q3CA 4I5FA 1DUVG 2ZBVA 1E8MA 2IUEA 5K3DA 3BPSA 2Y1OA 1QZ3A 3ZDBA 3QV2A 2ZETA 4QPNA 4C4OA 2OHXA 3RWBA 3ZDEA 2XB4A 1DWPA 1IUOA 4URXR 4F4DA 2O2XA 3C3BA 2JGFA 3EMKA 3QLEA 5H3HA 2OD7A 1N3LA 2VXCA 5BW6B 5INTA 3NM4A 3FPBA 4IINA 1JEAA 3NLLA 1CUSA 1YCHA 2G17A 1SOVA 3MFYA 3PD0A 2COEA 3BK7A 3UMVA 1RQ7A 1L1EA 1JT9A 3R7LA 4OAOA 2WPDA 4ITVA 4LZOA 2OE2A 1T0HB 4QFMA 4HPXB 4WY2A 1B1AA 2VATA 3LUGA 1UJNA 1MPTA 3OP4A 4XDYA 4YCBA 1JG4A 4QPJC 1L7NA 4C4TA 1YR9A 5K09A 3A6JA 1BXGA 2WU4A 3TQFA 5IHXA 4DLSA 1XD2A 3UMYA 3W4IA 3HKDA 3AU8A 2D2VA 1YQGA 3HK2A 3KSAC 3KYDB 4DGSA 2YTZA 4IDFA 3OE5A 4Q24A 2IYZA 3P9CA 1AB5A 2I91A 2XXAB 4XRRA 2QQEA 2VJDA 4C2TA 2Q8PA 3VJMA 1JKMA 1EDZA 5B1SA 1ZHOA 4G25A 4QOIA 5D01A 2MMGA 4PVCA 3ZE9A 3HJHA 2H2IA 1C8LA 3LHKA 1JVBA 1XTZA 1H9BA 3PDIB 1T5OA 1YZTA 4LC9A 3BL6A 3FAZA 4GUDA 4RPKA 2P9HA 2O20A 5K8UA 2FPPA 2CKDA 4ZK2A 2BIFA 4JGBA 4KR9A 4C07A 2NTJA 4YBRA 1CUYA 1E96A 2YQ4A 2OHOA 1LBQA 3KZVA 4CGZA 4C0QC 2PBFA 3PHHA 3K1ZA 4KIFA 4B9AA 4B4DA 5K8JB 3QKRB 4F21A 4R0VA 2WTUA 2BY4A 3A31A 3CNBA 3WV5A 4PXYA 4WFKA 1YBAA 5FI5A 1CZKA 3NIDB 3Q7EA 3F96A 2QM0A 3LKDA 2WWYA 3H0EA 2DECA 3CXRA 1OD6A 3TTVA 5DI3B 1NJGA 1DFHA 3AR4A 2ZU0C 3IAUA 2C8JA 5AHOA 3DXXA 2JHFA 3OZFA 3ZVNA 3ONWA 4ZGGA 2C9BA 3H3JA 3L3BA 1TYCA 1U31A 1PS8A 4EHKA 2IHYA 1Q2XA 3CRQA 2NADA 1X7WA 2IPNA 3K8OE 3AKDA 4CIDA 1XV5A 2DR2A 1D5CA 4RF2A 5BRNA 1LS6A 2ZVJA 2CFCA 2ZI7A 3F6BX 2FQWA 1ENYA 1NGSA 1QZZA 1JDUA 3L82B 1HR0B 3L6EA 1VSQA 4C0SA 2C4KA 4B3CA 2OK8A 3EDOA 3HDHA 5AVVA 5JBNA 3N59A 5K8VA 1JPJA 2ACEA 5GWXA 4CLOA 4DS3A 2GM4A 4Y8VA 1GTSA 1L7BA 4JBNA 3RD5A 1PHPA 3IVMA 1PTJC 4L51A 1HDXA 4FGJA 4DYHA 2EXXA 4NYJR 5KVSA 2W58A 3B3JA 4GMHA 1H8EA 1V7PC 1Z13A 2P90A 3E61A 4MUBA 4AULA 3IP5A 4GWLA 3MWLA 4PX3A 4UBOA 5CFQA 3AR7A 1QP8A 2PD4A 4RY8A 5DEIA 5JISA 3FLBA 4FGKA 4QBGB 3GLRA 2IHJA 4QYIA 1PO7A 4UATA 1SUCA 2MOKA 3H1TA 4CM7A 3GYBA 3HRIA 4ZA2A 4DILA 1UM9A 3KQVA 4B73A 5IBCA 3GLGA 1HWYA 1L5YA 1O77A 3KEMA 3X1YA 4G01B 2PWAA 1IBRA 1JZSA 2EKLA 2WVGA 4U3JA 3JQ6A 4XIFA 4OFXA 4X84A 3W6OA 1URPA 2NZYA 3TN7A 3GZTB 3WNCA 3ZNQA 4ECEA 4GKBA 4HNAB 3VOBA 5LIPA 3RSGA 4HB4A 4BVHA 3AL0C 3AFIA 1T6ZA 1ZUWA 2IELA 5JAIA 3L4JA 1QKJA 1HEIA 1Y7HA 2OPBA 4NP6A 3OJXA 2WD8A 3RSSA 5IC4A 4Q7JB 1FFXA 3VO8A 4JBYA 5HZKA 1Q3HA 4NS1A 3BXXA 3NWOA 1M75A 1E9AA 2ZT6A 4LGMA 1E2LA 4OJNA 3MHTA 1OFIA 5KOHA 3R3ZA 2DUNA 4YJGA 4EGAA 3EMDA 1YHZA 3QKRA 1TPZA 4GP7A 5HYVA 2AZXA 2H1WA 2V6BA 2KS6A 1W34A 3T34A 3EB9A 3M4XA 2P8SA 3SEZA 2Z6VA 4ZMRA 4F5YA 2M6KA 2D59A 3F9CA 2Q0HA 1TEHA 2Q29A 4QPZA 1SD1A 4B3BA 1T15A 2QMHA 3COPA 4N5HX 3PHGA 1P1CA 5HHTA 1VCOA 2GI4A 3OI7A 2A0XA 2NX2A 3V42A 5T41A 3IPLA 1AF4A 2B1IA 5A5EA 1F1BA 3N39C 4ADSG 3L7NA 1JWAB 2FWIA 4HMQA 4KQGA 5IVPA 4NF2A 3L0YA 4LNAA 3W8NA 3OICA 1VM6A 3CH7A 5LUBA 4PLPA 3I8OA 1L8OA 1T1EA 3KB2A 3PDCA 4NARA 4R1SA 4KI7A 1Q16A 3TYXA 2BEJA 2CMHA 2XA1A 4BKUA 1TAQA 2PTGA 2O14A 4HDNA 2FZ4A 1DWUA 4B85A 4MDHA 4V0MA 3WK9A 1TMOA 2VJMA 3KDAA 1KEWA 2GLTA 3M3PA 1FDRA 1K7SN 3T94A 5F7OA 4J94A 1TAUA 2JFQA 2OOKA 2NZ2A 1C81A 3OZBA 4L4RA 5ITZB 3LL7A 4IWXA 1OVMA 1NQVA 4Y3UA 5AJXA 4TKVA 4CMJA 3O83A 1RIFA 4B7ZA 4CMKA 1DG3A 1Q0QA 3EJWA 1KI7A 2JF0A 3GLHB 3EZFA 4PWZA 1YL7A 1Z62A 3D6NB 2C07A 3UCEA 1FZTA 1V41E 2JIZA 6ADHA 4MYDA 1GAJA 5B30A 5EINA 1OFUX 3V1YA 2CLOB 4DBZA 4FI3C 1X0XA 5IWAB 2CXSA 1PR9A 1DHTA 4QLBA 1Y3FE 1VFNA 1HYEA 2GRUA 1CZHA 1KI3A 3LQ1A 5HP4A 3IV6A 3GT3A 4RMJA 1TM2A 2A5LA 1PJ2A 4ZAVA 2PBLA 5KX5F 2HIMA 1L4HA 4FMDB 1G17A 1AIPA 2A57A 5LQRA 1S01A 2H54A 4YRDA 2HRBA 4HGYA 2ZTMA 3LVFO 3DOCA 1NLZA 4HUJA 4CM5A 1YQDA 1O6ZA 4ECAA 1QF6A 1WTAA 3D5QA 5CAEB 1W44A 3T61A 4CFSA 5BW8A 5ULLA 3EGDB 1HMYA 3CXUA 4QOSA 4J1NA 5IABA 2JCVA 2V7GA 4KQWA 3HQ4O 4DCCA 3BIJA 3W7VA 1CUJA 1UADA 4YQEA 3ICQB 4IDPA 4TXJA 4KODA 4RS4A 2WG2A 1PT9A 1SHKA 2BDUA 3FMIA 5FWNA 4DV1B 1JI3A 5CB6A 2JLWA 4DV7B 4BIMA 3NORA 2IP4A 2P9QA 2RI6A 1EUDA 3UH0A 4Z4HA 1B23P 2HC9A 1GVNB 3LWNA 3A3PA 4AY5A 3SZUA 1QUEA 1QV9A 3MWGA 1H4TA 2QVXX 1ZL2A 2Y67A 3O8BA 4M9UA 4NBKA 3ZHCA 1MGPA 5DK6A 3SDZA 3BTSA 1ZU4A 3P2MA 4YC7A 3TW8A 1V39A 3OC0A 4BO3A 4XVCA 5CDFA 2DULA 1AKVA 2BGNA 3BXOA 3BFPA 4J91A 3MJCA 1SEVA 1X2EA 3CTPA 1RKQA 1KIAA 1QHFA 3LI2A 1IQ0A 5BSGA 1U8EA 4O4LB 3DBRB 4LZLA 3ZQUA 4V1CA 5MGBA 4NPHA 2VYFA 3ZHTA 1XRQA 3IAM6 3WRWA 4DCGA 2YHBA 4M1SA 1E3LA 2E9SA 3RYHB 3IP1A 2H1VA 4RQBA 2G82A 5EOVA 1U81A 4E7PA 3X1WA 5JNUA 4DR2B 1WDTA 4GPTA 3FYDA 2UVDA 1ZUD1 2C3OA 4EJSA 1I51A 2FWMX 4CUJA 3MG9A 4NLLA 2Z6UA 1ZYUA 3FYUC 3RASA 1TT5A 2AL7A 1RAAA 3A2LA 4CLEA 4DDMA 3JRXA 4TL9A 1NNUA 4LV6A 1XJWA 1WMAA 5IVHA 2NUTB 1C9JA 4I9GA 4KK4A 1XZQA 1FYFA 5IJZA 2QN7A 3UVEA 1KA9H 5C81A 2Y92A 1MO5A 1K9VF 2AN4A 4BTEA 1QRSA 4X9XA 1DAHA 4LSGA 1LC0A 1XF1A 3KC2A 3KLPX 2HA0A 4O2AA 2FEKA 2D5LA 1SIBE 3N2GA 4EGCB 5FWYB 3FA2A 2GNOA 4RA6B 4B1FA 3FR8A 3X1DA 4EJ6A 1Y6RA 2OCKA 3FNRA 1MG5A 4JC4A 1LPMA 3NKFA 4N9WA 3LCVB 3TOXA 3BMOA 5K01A 5LQNA 4A0HA 3K6SA 5FUMA 1FMJA 5FO1A 1J2UA 1MW9X 3GT0A 3C6YA 5TMEA 3TNFA 3M0EA 4LPKA 5HM6A 2HO5A 2X1MA 2HBYA 1ZC3A 2HJVA 4OYRA 1UOEA 1HZJA 3PFFA 4NZYA 3UT5B 1PGQA 3X1XA 2BW0A 1KEUA 3OZEA 5BN3B 3QK7A 4D74A 5A2GA 4CXMA 2IF2A 2VUSA 4ALKA 3TG2A 3SMVA 5JTUA 3OM1A 5FPKA 1Q50A 1YC2A 2D2FA 1S2NA 2GZSA 2XMRA 3F5MA 4BZZA 2GF2A 3ROMA 1P0IA 5D2CA 5LXTB 3RS7A 3DG9A 3PGA1 1LFDB 1T91A 2AKYA 2NV6A 3RF6A 1NKTA 5E1MA 5G40A 4MYRA 2LCQA 4K28A 4OUDA 1EWYA 2IQ5A 3ROTA 1XMPA 3E9NA 4TXMA 3RK4A 4OK6A 3HKBA 1E6CA 3PS9A 1QS0B 4M8IA 2WIJA 4OUKX 3GEIA 2A14A 2WJVA 3R7SA 4FQ8A 5IC6A 2HZ7A 2GBLA 2ZSIA 3ZLTA 1NA5A 1E9RA 1DMRA 3E70C 4INJA 4EYQA 2AFHA 5CEJA 1EP9A 1PQUA 1CS0B 4JLAA 3BSWA 5ICMA 5EI5A 2ZXUA 1RVDA 4FMCB 4MMZB 4PN3A 1OI3A 3C87A 4UW9A 1D4ZA 1FSGA 1DDIA 1SHTX 1GUDA 5AT1A 5JCJD 3KBBA 5ER6A 3NATA 4H7KA 3KOZA 4FR2A 1G8HA 1HORA 1KY3A 1QYCA 5FRDA 2R97A 5JJCA 5D3MB 1AZSC 4Z1OA 3EDCA 3SHTA 4PFSA 2XYHA 2GO1A 1JQAA 2J7KA 4J0CA 1KDZA 1I7DA 4OHRA 2HNBA 3OCUA 3OJOA 3T7EA 2GZMA 3BAZA 1HEYA 4FDTA 4BBJA 4E15A 1NBME 4EGJA 4F9TA 1JP7A 3MK31 1PV1A 4PO8A 1PBTA 1XTIA 4JELA 3DT8A 3A32A 4QYIB 4DV6B 3KS9A 5LLSA 2HTEA 1DC4A 2ZUCA 3O03A 5C4IA 1OLUB 2G8NA 1P91A 4PCAA 1P1BA 2SKEA 4JLPA 4U63A 4MPDA 1QYIA 3ASYA 4MYSA 4U7FA 4PY2A 3VX4A 1R0WA 3PL5A 2WICA 4BV3A 2PUBA 1UDRA 2QM3A 4ZO7A 2JJ8A 1H5NA 1YNSA 2RJ3A 3IE2A 3W9YA 2HNKA 1Q0HA 4S04A 2JKZA 1TF2A 2ZAYA 4U7TB 4G97A 1N6LA 2HA3A 1Y9ZA 3HFGA 4GX0A 2VIIA 2WHXA 4PZDA 5E1DA 3RBAA 1LBHA 3S7ZA 2B4AA 2BEVB 4KXVA 1CY2A 2ZYIA 1L5QA 3LXUX 3FDZA 2XDQB 2QZ4A 3ILYA 2UYYA 4O4IF 4DV3B 4RVNA 2H65A 3VGPA 1E92A 2VDJA 3H5TA 3OCVA 4M3NA 1PJ4A 1TEZA 3RU3A 5TY0A 1TUBA 2PQ2A 2QXYA 1XWFA 1GOTA 2QMOA 3K9CA 2YYAA 4HNSA 4YROA 4TYYA 2O3RA 4L76A 3WK7A 1GPH1 2SKDA 3GT4A 4F96A 3U3OA 2HGZA 4I8XA 2H1RA 4F4IA 1GL3A 1L5SA 5LMCA 3GLHE 1VECA 1RCUA 2AD1A 2IEBA 1WSBA 5FEUA 3KOWA 1VSTA 2P9YA 4MXDA 5CJJA 3KKPA 1P1FA 1ULHA 4A8JC 4B3TB 1QLWA 2ARKA 3UJ6A 5IXSA 5JV5A 1L5RA 4FYIA 4PZYA 1KAGA 2PTHA 3NEYA 1MR3F 3H1EA 3OFVA 3UMCA 3WNBA 4RD2A 1QIKA 2O8NA 2FP4A