1RBUA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADNKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 51
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbuA00
3VQEA 3K58A 1HJRA 3DOKA 4HCCA 2ZD1A 3FFIA 4DTNA 5HROA 3MECA 1RDDA 4FJHA 3CFPA 1TK0A 2EX3A 4DTSA 4KHQA 2KFZA 1QE1A 1C1CA 1K6YA 4CJVA 1REVA 3NGIA 5HLFA 4C8KA 4KI6A 1U48A 4FVMA 3LWMA 1TAQA 1QSLA 1SL1A 4CHOA 1HQEA 3AVGA 1UOCA 4DSFA 3SUOA 3AA4A 3NF6A 3VQCA 3V9UA 4H4MA 3OYLA 1T8EA 1IG9A 3QEWA 4JRQA 4B08A 2XY7A 4B9VA 2YNGA 4FCYA 2HMIA 4CHNA 4DU3A 3TI0A 2RN2A 1BCOA 3HK2A 4FW1A 3AV9A 3C6TA 3VQ6A 1RT4A 3TAPA 2F8SA 4MQ3A 4W5RA 1J53A 4FJMA 1W9HA 2HHTA 1B9DA 2VG5A 4DFPA 4DQRA 3SQ2A 5J1EA 1I39A 3AVBA 4KHWA 1ZBUA 4ID5A 4CEEA 4CGJA 4CFDA 3L2WA 3RMAA 1U49A 3RR7A 4N76A 1UA0A 1C0UA 2YNFA 5CYQA 5I42A 4FJJA 2NUBA 4CJWA 3SCXA 4HCBA 3P5JA 4B8AB 3ZSVA 1Q9YA 4HUGA 4KRFA 1A5VA 1HYVA 4KTWA 4DS4A 4PQUA 2I5JA 3LPTA 5C25A 4GMJB 4AHUA 3RMDA 1BIUA 3L2VA 4FM1A 3I0RA 4CEFA 1ZBHA 3MXJA 1VRTA 3TAEA 4L8RB 3KLIA 2D0CA 3ULDA 4KTZA 3QEXA 3LAMA 2E6MA 3T19A 2OZMA 3SI6A 3RWUA 1NK9A 3AVHA 2P5OA 4FXDA 1KLMA 3JYTA 4CGHA 3SYZA 1WAFA 3VQ5A 3AO4A 3QLHA 4Q5VA 4CEBA 4UQGA 1Q9XA 4DSLA 3VQ8A 1C6VA 4M45A 3KLFA 4E7KA 3O3GA 2X6NA 3QIOA 4E7LA 3ZSXA 3DRRA 3MEDA 4OKKA 4CGDA 4R5PA 4CESA 3VQ4A 4LH4A 5HRPA 4CGGA 1WNSA 3VQQA 3ZT4A 1NJWA 3HSTB 4RW7A 3NE6A 4F2RA 3O4NA 3ZT2A 3G0ZA 4CJKA 3PO4A 4CEZA 4AHTA 3VQDA 3OYBA 3L2QA 3HP6A 4DQSA 1O1WA 4NCGA 3KLGA 1BGXT 1WN7A 2O4GA 1RTJA 4CEQA 4CIFA 3HPOA 4N56A 1ITGA 4W5QA 2DFHA 3K59A 3ZT3A 4FLXA 1GOAA 1DLOA 3LANA 4AHVA 4AHCA 3OS2A 3OYIA 5JS1A 1JLEA 2Z1HA 2A1SA 4DFKA 3QERA 3ITHA 5HRSA 2XY6A 3CG7A 4I2QA 1CXUA 3C95A 4TSXA 3BDPA 4FM0A 1EP4A 2A1RA 1J54A 4M41A 1TKDA 3I8DA 4BWJA 2YHAA 4DSEA 3V6DA 4B9MA 2KZMA 1RDBA 1TGOA 4FJKA 3HP9A 3M8RA 1NOZA 2PZSA 4RW6A 2YKMA 3PY8A 2OYQA 3L2UA 2IC3A 4F3OA 3RMCA 4CERA 4JS5A 4M3RA 1RT7A 3ZT0A 4CEDA 4FZXC 1GOBA 1YT3A 1HNIA 1HYZA 2G8WA 4DQIA 4CJUA 3NBPA 1KVBA 4OJRA 1S9EA 4CF8A 2QXFA 3NGYA 1ZBIA 3DMJA 3NHGA 3VA3A 3CQ8A 3ZSZA 3AA5X 1NKCA 1LWCA 1VSKA 4MFBA 3U3YA 3LZJA 3BGRA 2HW3A 1JL2A 5HRRA 4W5TA 4FJ8A 4DQPA 1Q8IA 1YTAA 3ZSYA 4CJQA 3NDKA 1NK8A 4CHQA 5FRMA 4Z4GA 1RCHA 1RT5A 3VQ9A 1NK6A 2ITGA 4Q0BA 4FLYA 1TAUA 2JLEA 3KKSA 4B3OA 4OPKA 1R0AA 1Z26A 2HVIA 3SPYA 3DYAA 1SUQA 4DTPA 3K5OA 4IFVA 4B9SA 1VSJA 3EZ5A 1KSPA 1RTIA 3AO3A 4Z0UA 1IKVA 3IG1A 3V1QA 4YFUA 3O3HA 4I9LA 2Y1JA 1QSYA 4BDYA 2PYJA 4IBNA 3OYCA 4DTUA 4ICLA 1XI1A 2EHGA 3HPHA 3NFAA 4RW9A 5HBMA 4KV8A 1LW0A 1TL3A 3K5LA 3EYZA 3QNOA 1C0MA 4ELUA 1KCFA 4CGFA 4KAZA 4J2AA 2HHXA 2KW4A 2IOCA 4JRPA 1BL3A 1S1TA 3PUFA 3AVNA 3KK3A 1KFDA 4OVLA 4E7IA 1JXEA 4E3SA 3QESA 4FJIA 2HHSA 1CXQA 2IGIA 3AVMA 3A2FA 3OYEA 2QKKA 4O0IA 4J2BA 3LALA 1YTUA 1EETA 4NCAA 4RW4A 3EY1A 1TK8A 3OYDA 4OGEA 3HXMA 3DOLA 4CF2A 3F73A 4FLWA 4FK4A 4ZTFA 1KLNA 4E19A 4DTMA 3P1GA 4DU1A 3V4IA 1JLQA 5SZTA 3NGZA 2XHBA 4C8NA 3HL8A 4DSIA 2XRIA 4F4KA 2D0BA 5KTQA 3ZCMA 4B9UA 2DFFA 3SJJA 1ASWA 4NCBA 3L3UA 1RBUA 1LWFA 2P1JA 1F21A 4CIEA 5KGXA 4KHSA 2RPIA 4M3UA 2HHWA 4I7FA 2BANA 1EX4A 5HP1A 4KB0A 2YV0X 4KPYA 3RTVA 3V81A 4FJXA 2VG7A 1WSJA 4E1NA 4CJEA 1RDAA 2G8UA 4BE2A 4PA1A 1S1UA 4CJFA 1A5XA 3NCIA 4DU4A 3TAFA 3MXIA 1XWLA 1VSHA 3AVJA 3TANA 3S3OA 1IH7A 1J5OA 1HRHA 4F2SA 1ZBLA 3DLHA 4M3ZA 3VN5A 3K57A 4M3WA 4FW2A 1KTQA 4H4OA 2KFNA 3QETA 1A5WA 1L3VA 3IRXA 1T05A 4BDPA 1RBVA 2ETJA 2FBTA 1MU2A 2HHVA 5J2PA 4FJNA 4F8RA 4AILC 1B9FA 3WNHA 1RT2A 3B6PA 3DLKA 4O55A 3OYJA 2DY4A 4AHRA 2OA8A 4O5BA 2F8TA 2XO7A 4FJ5A 1RDCA 3IS9A 3KLHA 3LWLA 4ZTJA 3AVCA 2QKBA 2PYLA 1RT6A 2LSNA 1JLAA 2Z1GA 3ASMA 1WLJA 4B9LA 1S6PA 2QK9A 3AA2A 3SV4A 3ALYA 4C8MA 4K8XA 4DSJA 4FM2A 1S5JA 3T1AA 3KKRA 4RG8A 2YKNA 3K2PA 1W0HA 4IDKA 2HNYA 2GUIA 2VWKA 4CE9A 4CCHA 2VWJA 3KK1A 1NKEA 4Z4EA 1BQMA 4CJLA 1JL1A 2YNIA 1JLCA 2E4LA 1C1BA 4XIUA 3O3FA 2O4IA 1CZBA 4NYNA 5CY4A 2G8FA 2IS3A 1JKHA 3QIPA 4LSLA 4HTUA 4ELVA 2ZE2A 4C8LA 4IKFA 3SZ2A 4N41A 4KI4A 2WOMA 4CJTA 4CFBA 4FLTA 3LZIA 1BQNA 1U47A 2DTUA 2OPQA 3HYFA 3SUPA 4FK2A 1L5UA 1RT1A 3M8QA 3SPZA 1S6QA 2Z1JA 2GV9A 1TVRA 1QQCA 1IO2A 3RRHA 2PY5A 4PUOA 3AVIA 4EP4A 2VG6A 4NYFA 2W42A 1HNVA 4KHUA 3PX0A 1RBRA 3G10A 1NK7A 3CM6A 1L3UA 4CFCA 3OYKA 4E7HA 3QINA 1X9MA 4CF0A 3L2RA 4CECA 1VSMA 3OYMA 1KFSA 4KB1A 2F96A 2OPRA 3WNGA 4KTQA 1NJYA 4B9NA 4DTRA 2BE2A 1SL0A 3SUNA 3M8PA 4M3XA 1EKEA 3RRGA 3KD1E 4FZZA 4CFAA 4Z4HA 3KTQA 4FJ9A 3QO9A 1HYSA 3C94A 4W5OA 1CLQA 1SKRA 3NH2A 2HVHA 3ZSRA 1WSIA 1G15A 4YNQA 3OS1A 4E0DA 3OJSA 1XHZA 4DTOA 5SWMA 2HNDA 1RTDA 1X9WA 2IAJA 5KRTA 1J9AA 1SL2A 3KLEA 3PV8A 3VQPA 4Z4FA 3MEEA 2B4JA 1D5AA 4CF9A 1KVCA 1VSDA 1NK4A 3SQ1A 1NJZA 4CJ5A 3KK2A 2KTQA 4J2EA 3OS0A 1T03A 4IG3A 3LAKA 1NK0A 1N5YA 4AHSA 1YVUA 1SKSA 1L3SA 1S1WA 1S9GA 1DTQA 1U4BA 2G8VA 1LAVA 4O0JA 3AO1A 1Y97A 1JLGA 1FKOA 3CM5A 4JLHA 2D5RA 4KHYA 4O4GA 2G8IA 3QNNA 1U04A 1JLBA 1BCMA 4BE1A 3VQBA 4IFYA 4M42A 3DLEA 4DFMA 4CJ3A 4M3YA 4DFJA 2BGGA 3MEGA 5CYMA 4KREA 3SUQA 4J2DA 4OKEA 3U6FA 4LD0A 4RW8A 1JLFA 4CF1A 4KFBA 1FK9A 1BI4B 4QAGA 3I0SA 3CYMA 3MAQA 2FBVA 4F3TA 3UIQA 3V1RA 3K5MA 1GOCA 4Y1CA 2RF2A 3V1OA 2P51A 1LAWA 2GBZA 4C8OA 2ZQBA 3V9ZA 3KJVA 3LDSA 1B92A 2Q3SA 4CGIA 4N5SA 2YNHA 3B6OA 3TR8A 1TKTA 4FLVA 4EZ9A 4CJPA 4DTJA 3V9XA 2JGUA 3O4QA 1SV5A 1IKWA 1TKZA 3IAYA 5CZ2A 3OYFA 2Y1IA 3AO2A 4CK1A 1EXQA 1TV6A 4LY7A 1T7PA 2RKIA 1TL1A 3K5NA 4BE0A 1WAJA 4Z4CA 3KIOA 3H08A 3L3VA 2Z1IA 1RILA 3OY9A 3OYNA 4CJ4A 3OYAA 1NJXA 4ID1A 3OVNA 3ZSWA 4KO0A 4FK0A 3LP3A 3SQ0A 3PX6A 1QTMA 4JS4A 1U45A 4KKOA 2R7YA 3TARA 3RR8A 2G8KA 3QEPA 1QS4A 4HUEA 4G1QA 1C1AA 1N6QA 3TAGA 1BIZA 3NH1A 1NOYA 4QOZB 1BI4A 3AA3A 3RMBA 1KRPA 4OGCA 3DRPA 4CHPA 4GVMA 4CEAA 2E6LA 3S9HA 3VQAA 4HVJA 2D0AA 4BACA 1TKXA 4FJ7A 4CJRA 1VSFA 4I2PA 3ZSQA 5C42A 5KRSA 4DLEA 2WONA 4DF8A 1XC9A 3HJFA 4CHZA 3DLGA 3JSMA 1VSLA 3M8SA 3QEIA 3NF7A 4B9TA 2YHBA 4HUFA 3DLBA 1VRUA 1VSIA 4DTXA 1NK5A 1UWBA 3AVLA 4DS5A 2OZSA 3SV3A 3SQ4A 1I3AA 4M3TA 5J2MA 4WE1A 1ASVA 4HHTA 4DQQA 1S1VA 1VK0A 1QHTA 4CHYA 3MXMA 5D3GA 4QCLA 3AVAA 4CK2A 5FRNA 3OJUA 4DF4A 4GW6A 5CZ1A 5DMRA 3HM9A 1L3TA 1LV5A 3CFOA 1HPZA 4H8KA 4KHNA 4O44A 3ZSOA 3S3MA 1ZBFA 1FKPA 4BDZA 4FJLA 2FBYA 2B6AA 3THVA 2X74A 4OPJA 4CK3A 3NH0A 1HMVA 3V9SA 5T7BA 1BHLA 3D0PA 3SNNA 4FZYA 1IKXA 3TAQA 3C6UA 3DM2A 1D9DA 2IDOA 4PWDA 3PX4A 3T3FA 3E01A 4E89A 5J2NA 1C0TA 4Z4IA 3NF8A 3AO5A 2XY8A 2FBXA 4CIGA 2DFEA 2ATQA 4OLAA 3DI6A 4FYDA 1QSSA 2B5JA 4DSKA 1VSEA 4B8CA 4DMNA 4DWIA 2HHUA 1RTHA 1LW2A 3U3GA 4W5NA 1WSEA 3VA0A 5DK5A 3ZT1A 3HPGA 5K14A 4PY5A 1RT3A 2HNZA 4LSNA 5FROA 3HVTA 4CJSA 1WSFA 3LPUA 4FJGA 1IKYA 1JXBA 4DG1A 2X6SA 3TWHA 1NKBA 4FLZA 1X1PA 3DRSA 3OYHA 2HB5A 3DLRA 3P83D 3L8BA 1FXXA 4DLGA 3HT3A 4CEOA 3KD5E 3NAEA 1KVAA 3TABA 3PO5A 2G8HA 1X9SA 1WSGA 5FDLA 1HQUA 1LWEA 4AH9A 1SKWA 4EP5A 4OLBA 2KQ2A 1RBTA 5EU7A 4ZHRA 3OYGA 1D8YA 5J2QA 2BDPA 4E1MA 4BWMA 3VQ7A 4FLUA 3LP0A 3HVRA 1CZ9A 1RNHA 4EZ6A 3CFRA 3V9WA 3LP2A 3QEVA 3D45A 2XY5A 4I9QA 3AVFA 3ISNC 3F9KA 5E41A 3HO1A 2KZZA 1ZYQA 2AJQA 4K8ZA 4LH5A 5I3UA 1D9FA 1UAXA 2HHQA 1DTTA 3NF9A 2OPSA 1Z25A 1RBSA 5JS2A 4E7JA 2P5GA 1BISA 5C24A 3WNEA 5HRNA 1TK5A 4OKJA 3TAMA 5KGWA 2OPPA 2FC0A 4ELTA 1UA1A 4N47A 3LP1A 2X78A 1XHXA 4Y1DA 1ASUA 1S1XA 3WNFA 3AVKA 4IG0A 3S3NA 5KI6A 1WSHA
chains in the Genus database with same CATH superfamily
2UXBK 3F9MA 5HROA 3CXCM 3MECA 3CJ7A 2KFZA 1U48A 1VQ7N 3LWMA 4NLBA 4WQ5C 4DSFA 3AA4A 4IJAA 3OYLA 1C0FA 3QEWA 3T69A 4CHNA 3TI0A 4JK9A 2F8SA 3VQ6A 3H46O 1XC3A 5AQVA 3QDKA 4JI5K 1NG9A 2VG5A 3VEXA 2O8DA 2NRVA 3AVBA 4V19S 3HRGA 4CEEA 1NGAA 4CFDA 4MDBA 3NVMA 4OPAA 2YNFA 3U8XA 5CYQA 2ZGZA 3ZEUB 4FPAA 3HZ6A 4DS4A 5F2RA 3C0BA 3L2VA 4FM1A 1VQPN 5AQPA 1U2VB 1VRTA 1OVQA 4DV7K 3KLIA 2D0CA 2V7YA 2QWLA 3T19A 5H1SQ 3RWUA 5BR9A 3AVHA 2P5OA 3J7AP 1KLMA 3JYTA 2V52B 3SYZA 3EKSA 3AO4A 3PSFA 3CJAA 3VTIA 3O4WA 4E7LA 4YORA 3ZSXA 4OKKA 4R5PA 3VQ4A 5C2FA 5HRPA 5M1FA 3ZT4A 4FSVA 2NRRA 3NE6A 4F2RA 3O4NA 4CZMA 3PO4A 3L2QA 2F7TA 5FPDA 1BGXT 1MWMA 2O4GA 1RTJA 4CIFA 4A5BA 2BTFA 1RDWX 3H3NO 4U67L 4FLXA 3J7YP 3LANA 3MX5A 4X62K 2Z1HA 2A1SA 4DFKA 3ITHA 2XY6A 4IEEA 4FM0A 2A1RA 4M41A 4FO0A 2YHAA 4JD2A 2WC9A 3PY8A 2P9PB 3L2UA 3EZWA 2UYTA 1GOBA 1YT3A 2CH5A 1HYZA 4EHTA 3NGYA 4GNIA 3NHGA 3CQ8A 1NKCA 1LWCA 1VSKA 3TU5A 4DHYA 4W5TA 1YTAA 3NDKA 2ASOA 1NK6A 4KBOA 4PHTX 3W3DA 3WEEB 1NGFA 3DYAA 3O6WA 3K5OA 4YFUA 1IKVA 3V1QA 2GWKA 1VQMN 2EWSA 4I9LA 1QSYA 2V51B 3ZX0A 4BDYA 2OTLN 1IJJA 2IVNA 3OYCA 4ICLA 1DEJA 1P90A 4RW9A 1LW0A 3K5LA 1KCFA 3B8AX 2KW4A 2J4RA 4YHHK 1S1TA 2E1YA 3AVNA 3THWB 3QESA 1GLLO 1NGIA 4J2BA 3DXMA 1EETA 4H0OA 1BA1A 3HXMA 1C0GA 4CF2A 3ENHA 4E19A 2CGLA 3P1GA 4DU1A 3C7NB 2P9IB 3ZYYX 4C8NA 2D1KA 2PBDA 3ZCMA 4NCBA 2QXLA 3CC4N 2P1JA 2RPIA 2HHWA 4H5TA 5JLFA 1EX4A 2CH6A 4FWNA 3V81A 3LM2A 4BRAA 5BPNA 4E1NA 2O8EA 3MXIA 1S1UA 1SL0A 5AQLA 1VHXA 3TAFA 3KTQA 2VGNA 3AVJA 5AFUH 4F2SA 1ZBLA 3HI0A 4H4OA 1KTQA 3IFRA 2RE2A 4CD1A 1L3VA 1HUXA 1MU2A 3SK3A 1QVFM 4F8RA 1RT2A 3B6PA 2IVOA 3CQYA 3OYJA 4AHRA 4B1WB 5BRDA 1YHQN 3LWLA 4ZTJA 3FZHA 1XUPO 2PYLA 2LSNA 1YJNN 1JLAA 1WLJA 3VOVA 4GKJK 4JKDA 3AA2A 3SV4A 1LOTB 2QEXN 3K2PA 1W0HA 4CE9A 1XNQK 1NKEA 3MK6A 3HOTA 3CCMN 3R8EA 2FSKA 3E9LA 1CZBA 2G8FA 5CY4A 3R6MA 3ULEB 4DV6K 2UU9K 3SBTA 2ZE2A 4C8LA 4IKFA 4FLTA 3FLCO 3HYFA 3SUPA 1XMQK 1VQ8N 5C12A 2PY5A 1IO2A 4PUOA 3E1YA 4EP4A 4NYFA 4ILGB 4X65K 2W42A 1VAZA 4KHUA 1X3NA 4O8KA 4IO9L 1OKJA 4CF0A 4KB1A 2QWRA 4GV6A 1NJYA 2I7NA 2BE2A 4DB3A 3M8PA 4M3XA 1YXQA 3KD1E 5BR8K 2HVHA 3ZSRA 4GY2B 3OS1A 4E0DA 3OJSA 1XHZA 4CVNE 4NO7A 5SWMA 1KAZA 1J9AA 4Z4FA 3MEEA 2B4JA 4JI8K 1KVCA 4CJ5A 4IG3A 3LAKA 1N5YA 5EX5A 1YVUA 1SKSA 1G99A 1L3SA 1S1WA 1S9GA 1LAVA 1FKOA 3CM5A 3M3ZA 3G71N 4JLHA 2G8IA 4CZIA 2UUAK 4LD0A 1JLFA 1FK9A 1BI4B 2P9UA 3MAQA 2FBVA 4LF5K 3KWGA 1GOCA 3T7ZA 3CMAN 3IDHA 5C15A 4C8OA 2ZQBA 2E1ZA 1TKTA 4DTJA 5HOOA 1SV5A 4B3RK 3IAYA 3AGRA 5CZ2A 4OX9K 1TV6A 4LY7A 1VQON 2RKIA 4H0VB 3PIOL 1WAJA 3DWLA 3OYNA 3OVNA 5LL6Z 2QM1A 4KO0A 3PX6A 1U45A 2ZGYA 3TARA 4OPHA 3QEPA 5BRHA 4G1QA 4K41A 1KRPA 4AF1A 4M63C 2FXUA 4CHPA 4HVJA 2D0AA 4FJ7A 3J80O 1HJOA 2WONA 4YOTA 1BU6O 4AQYK 4B1UB 4B9TA 1BWFO 1VSIA 2QA4N 1Q81O 1J6ZA 3AVLA 3SV3A 3SQ4A 1I3AA 5C2DA 3CJ9A 1ASVA 4JD2B 1VK0A 2NNWA 3AVAA 4CK2A 3MMVA 5CZ1A 4BC5A 4H8KA 1ZBFA 4JN4A 1M90O 3TTDA 5GADP 3V9SA 3K0SA 5LJVA 4E89A 1C0TA 2XY8A 3DI6A 4O8UA 4FYDA 1QSSA 4WYBA 1RTHA 3WXKA 3U3GA 4W5NA 1WSEA 3VA0A 2HOEA 2HNZA 3LPUA 4FJGA 4K43A 1X1PA 4BQZA 2HB5A 3QBWA 3P83D 4JKAA 4IO8A 2A42A 1QZ6A 3HT3A 4BRPA 1KVAA 3TABA 3PO5A 1X9SA 1WSGA 5FDLA 2WUSA 4EP5A 5EU7A 1YJ9N 1D8YA 4BWMA 5ADXA 3WQUA 4A57A 3A8YA 3HVRA 3NMUA 1RNHA 2KLAA 3V9WA 4CZJA 3SMPA 1WB9A 2QI2A 2Q97A 3AVFA 3ISNC 3DXMB 3F9KA 4WFAL 4DCHA 3KK7A 4K8ZA 3I33A 4LH5A 5I3UA 1NMDA 2HF4A 2P9KA 4IFEA 5C24A 3BUZB 5KGWA 2FC0A 1UA1A 3VEVA 3LP1A 4JKEA 3UB5A 1XHXA 3O1WA 2KKZA 3O9RA 5HL7L 3MN9A 3FZMA 4BGAA 4CZEA 1S1XA 3KLFA 4KI6A 5KI6A 3EKUA 1WSHA 3K58A 1HJRA 3DOKA 2P9SB 3FFIA 5FLXO 2EX3A 3LL3A 5HLFA 4C8KA 1TAQA 1QSLA 4B1VA 3AY9A 1UOCA 3D2FA 3VQCA 3SAGA 3WXJA 3H1QA 4B9VA 2VYPA 2HMIA 4DU3A 2RN2A 3EEQA 3HK2A 3O80A 1S72N 4F9OA 2E20A 4LFCK 5DM6L 3IUCA 1YITN 4Y0WA 4DQRA 4ISGA 3OTOK 5J1EA 2ZWHA 3RR7A 3L2WA 4BRKA 4FJJA 1ATNA 2NUBA 3SCXA 4HUGA 3KHYA 3U9ZA 3EE9A 3ENOA 3LPTA 4GMJB 4JI2K 5LJWA 2ZJPL 3I0RA 4CEFA 5BPMA 3TAEA 1ILYA 4K42A 3ULDA 3LAMA 2OZMA 4FXDA 5AJ3K 3CCQN 3VQ5A 2QWNA 4Q5VA 2YJEA 3VQ8A 4IZ9A 3O8MA 4BGBA 2A41A 3QIOA 4CD3A 3DRRA 2ZJQL 3MEDA 1KAYA 1WNSA 1K9MO 3VETA 4RW7A 4FWSA 1NNEA 1KAXA 4CJKA 3KLGA 3G6EN 4N56A 4W5QA 2DFHA 4AHCA 3OYIA 2UUBK 4A62A 3QERA 5HRSA 1EP4A 1ZBSA 1TKDA 4B9MA 3V6DA 4DSEA 1RDBA 2ASMA 5F1XA 1NMNA 3TSUA 1NGHA 1W97L 1RT7A 1SZ2A 4FZXC 1HNIA 5EY4A 3NBPA 3RVCA 4BR7A 2QXFA 3DMJA 4PKIA 2UUCK 3AA5X 2O8FB 4MFBA 3U3YA 2V7ZA 2NZTA 3ZSYA 4CJQA 2HSTA 5CHIA 4Z4GA 2HMPA 1RCHA 5GAEP 2ITMA 2FF6A 2ITGA 1TAUA 2JLEA 1R0AA 1Z26A 2HVIA 2P9UB 4B9SA 1HR0K 1YF5L 5EXWA 4Z0UA 3TSPA 1T3VA 4JKHA 3O3HA 3ATVA 2Y1JA 5AQRA 5AZJA 1KXPA 4FWPA 3RSEB 1TYQB 3CIPA 1XI1A 3O1BA 2EHGA 2FLOA 3NFAA 5HBMA 4YDUA 1TL3A 1C0MA 3J8AA 4J2AA 4JRPA 1ZC6A 4WF9L 1BL3A 3PUFA 4HCBA 1KFDA 2HHSA 4H0PA 1CXQA 1Q18A 3AVMA 3OYEA 2W40A 3L4IA 2QKKA 3LALA 1GLJO 3MCPA 4BVPA 4RW4A 4DV5K 1W2BM 5BREA 2GWJA 1IBLK 4ZTFA 2BH1A 3MN7A 4I6MA 3VPZA 3V4IA 3NGZA 4DSIA 2D0BA 3MWPA 3DLLL 3SJJA 2E88A 1S3XA 4CIEA 1RBUA 1LWFA 4I7FA 3A0IX 2GX9A 2BANA 3WXIA 4KPYA 2YV0X 3RTVA 2VG7A 3SAFA 4BRMA 1QVGM 1OVYA 1RDAA 3CETA 5I9EB 3T1YK 2G8WA 1A5XA 4DQIA 2HBMA 1VQ4N 1XWLA 4M3ZA 1IH7A 3VN5A 3QMLA 3QETA 4A59A 3D7EO 2FBTA 2NRZA 2HHVA 5J2PA 3DLKA 2XO7A 1EWRA 1RDCA 3CJ1A 3ZLJA 3KLHA 4YDUC 2Z1GA 3ASMA 1X3MA 4CBUA 4H03B 4LF8K 3VTHA 2VGMA 4K8XA 3T1AA 3KKRA 2YKNA 1YUWA 4WQ4A 3QFPA 1JL1A 2YNIA 5GIOA 4FWQA 4H5RA 2Q36A 4DV4K 4NYNA 2O4IA 2AP1A 4BR4A 3QIPA 4LSLA 4HTUA 4ELVA 3C65A 3SZ2A 3IMXA 1TUYA 2QWMA 4FK2A 3M8QA 4BR0A 1Q86O 5FPMA 2Z1JA 5JVGL 1I94K 1KD1O 2NRXA 4ISFA 2P9KB 1L3UA 4CFCA 3QINA 2ASPA 2OPRA 4HTLA 4B9NA 4FZZA 4Z4HA 4FJ9A 1VQ5N 4MO4A 2ZF5O 4R79A 1WSIA 4YNQA 3Q7BA 5BPLA 4DTOA 1SQKA 3GDQA 4BG8A 3LDOA 1RTDA 3AAPA 1X9WA 5KQ8A 1NK4A 2IIRA 1VSDA 4A2BA 4J2EA 3OS0A 4BQLA 1NK0A 2GTDA 4IXCA 4O5FA 1DTQA 1U4BA 2G8VA 3ZX3A 2QTDA 1WBBA 2D5RA 4WQ4C 4JK7A 3DLEA 1JCFA 4ILHA 4M3YA 4DFJA 5CYMA 3SUQA 3U6FA 4UY8O 4ILJA 3UIQA 2Q2RA 3N4PA 4Y1CA 4KH5A 5AQKA 3JAMO 2FSJA 3V9ZA 4WFNL 3KJVA 4FLVA 3TR8A 1OH8A 3O4QA 4H0XB 2WTUA 2Y1IA 4CK1A 2NRWA 1EXQA 4EHUA 2NRTA 4JI0K 4B1ZA 3OY9A 1RILA 1WOQA 4CJ4A 2QWQA 4ID1A 1NWKA 4FK0A 4YOVA 3LP3A 1QTMA 2VWBA 3RR8A 4RTFD 1N6QA 4IOAL 4GV3A 3ENBA 1YAGA 4CEAA 4A61A 3S9HA 3MX2A 4CJRA 4DV0K 5LY3A 3ZSQA 4DF8A 3HJFA 3P38A 1VSLA 1DGKN 2E2PA 3E66A 1UWBA 4GVEA 4WE1A 4HHTA 4DQQA 4EIAA 5D3GA 4CHYA 3C6HA 4DF4A 1L3TA 3CFOA 1JCGA 3CPWM 5AQIA 1GLBG 2B6AA 5KPZA 2X74A 1HMVA 1XQSC 1NGEA 5T7BA 4X64K 3SNNA 3THYB 1IKXA 1D9DA 2Q31A 4LC9B 3OW2M 5IWAK 4JHDA 4Z4IA 3NF8A 3AO5A 4OLAA 1BA0A 2B5JA 4DSKA 4B8CA 4BRFA 4PY5A 1RT3A 3VERA 4LSNA 1KQSM 3HVTA 3MCAB 5AQNA 4CJSA 4JYAK 2YCHA 3DRSA 4FOEA 5AZJB 1FXXA 1N32K 3NAEA 2G8HA 1HQUA 1LWEA 4AH9A 1SKWA 4OLBA 1HKBA 3H6EA 3VMFB 4ZHRA 4BRNA 3NVKA 3CD6N 1YJWN 3VQ7A 4FLUA 5F0XA 3IKMA 2HBLA 3R9PA 3QICA 3QEVA 3D45A 4LF6K 3GG4A 3FZLA 1ZYQA 1D9FA 3LDPA 1EQYA 5A2QO 3O9TA 1Z25A 4I6MB 5MLCQ 1BISA 3WNEA 4ISEA 1TK5A 2O8DB 3P31A 3GE1A 3P4IA 4PL7A 5DM7L 4GKKK 5CR4A 3WNFA 3O08A 3AVKA 1J5OA 3CCRN 3VQEA 3BF3A 4HCCA 1WUAA 4DTNA 1RDDA 4FJHA 3CFPA 1TK0A 1QE1A 1E4GT 1C1CA 3NGIA 1REVA 1HQEA 3AVGA 3V9UA 1HNXK 3EN9A 4H4MA 1T8EA 1IG9A 4B08A 3VENA 1VQNN 2YNGA 5C10A 1ATSA 4FW1A 2WFBA 3C6TA 1TUUA 1RT4A 3TAPA 3CF5L 1J53A 4CZGA 2HHTA 1GLAG 4DFPA 3VF4A 1ZBUA 1U49A 4CGJA 4PKGA 4N76A 1NBWA 1C0UA 1ESVA 1FW6A 3EL2A 4B8AB 2FF3B 3ZSVA 1Q9YA 4KRFA 4FL9A 1BIUA 1QZ5A 2CGJA 2F4VK 1ZBHA 3MXJA 4L8RB 1IG8A 4KTZA 3QEXA 2E6MA 3PSIA 4QS7A 3E9PA 3A5LC 1WAFA 1IV0A 4UQGA 2OANA 1Q9XA 4M45A 3FGUA 4CGDA 4LH4A 3UKRA 3VQQA 1K8AO 1NJWA 3HSTB 1NGCA 1SS6A 2P9NA 3ZT2A 3G0ZA 4DV3K 3WXLA 3R1XA 4AHTA 4A2AA 3VQDA 4CEZA 3OYBA 1O1WA 4CEQA 3HSCA 3K59A 1N36K 1DLOA 5JS1A 1JLEA 4I2QA 3Q7CA 1CXUA 3C95A 3BDPA 1Z05A 3I8DA 2KZMA 4FJKA 3HP9A 4FWRA 4RW6A 1ATRA 2YKMA 3BEXA 4F3OA 3RMCA 1EWQA 1BDGA 4CERA 5AQGA 3ZT0A 2I7PA 1BO5O 4CF8A 1S9EA 3ZSZA 4BC4A 3VEWA 3LZJA 3BGRA 2HW3A 5FRMA 1Q8IA 2A40A 1NGJA 1RT5A 3VQ9A 3KKSA 5KQDA 1P8ZA 2QWPA 3SPYA 1SUQA 4DTPA 2D4WA 4IFVA 4YOXA 3QB0A 1RTIA 3AO3A 3IG1A 5BN8A 4IBNA 3U9DA 4DTUA 2YHXA 2YJFA 2P9LA 5AFUA 2P9PA 4NXMK 4LF4K 3CCJN 3QNOA 4ELUA 5GAGP 4CGFA 3F5TA 2O8EB 1V4TA 3VEOA 1QQMA 3BZCA 3OHRA 4OVLA 4E3SA 4E7IA 4CZKA 2IGIA 3A2FA 4C1NK 4NCAA 1TK8A 4H5WA 3EY1A 3OYDA 1DKGD 4FLWA 5FPEA 1KLNA 3WQTA 4LF7K 3HBTA 3AARA 4IDHA 5SZTA 2XHBA 3A5OC 5E84A 3HL8A 3SAHA 1YI2N 4F4KA 5KTQA 1H1VA 3L3UA 4KHSA 1F21A 5KGXA 4M3UA 4BY9C 2AA4A 2GUPA 5JVHL 4KB0A 4FJXA 3BZKA 1WSJA 2G8UA 5AQOA 4BE2A 1GLCG 4PA1A 3NCIA 5AQWA 1VSHA 3TANA 4BRQA 4MO5A 3I56N 4FW2A 4M3WA 2KFNA 1A5WA 2HHHK 3IRXA 4BDPA 2ETJA 4NLCA 3A5MC 4JHDB 1B9FA 3WNHA 3UE5A 2YX6A 4IOXA 5EVZA 2P9IA 1NM1A 4O55A 2DY4A 4O5BA 4BRLA 4JI4K 5AQUA 3IS9A 2E2QA 3BF1A 3AVCA 3CJCA 4B9LA 1RGIA 1S6PA 2QK9A 4JKGA 5BN9A 4C8MA 1O13A 3O5BA 3I8BA 3AAQA 1ZXOA 4IDKA 2GUIA 4CCHA 2VWJA 4XIUA 3O3FA 1JLCA 1C1BA 2IS3A 1YVNA 4JKCA 1NGBA 4BROA 4N41A 2WOMA 3TSQA 3M5RA 4CJTA 4CJ7A 2DTUA 1U47A 1K73O 1L5UA 3SPZA 4NB4A 1TVRA 1QQCA 3RRHA 3ZETA 2VG6A 1HNVA 3PX0A 1RBRA 3G10A 1NK7A 2HBKA 3OYKA 3L2RA 1K8KA 3OYMA 1KFSA 3WNGA 4QS8A 1KC8O 1IBKK 1BG3A 4DTRA 3SUNA 1EKEA 3RRGA 3OA9A 1XNRK 2O8CA 3CI5A 3HM8A 3QO9A 1HYSA 3C94A 2JWKA 3CHWA 1CLQA 3NH2A 1G15A 3KWIA 4EFHA 4JK8A 2IAJA 3KLEA 4MDAA 5GAHP 1NJZA 4CF9A 3N4QA 3SQ1A 2YHYA 4AHSA 4O0JA 3CCEN 4QS9A 3J81O 4IFYA 4DFMA 4CJ3A 3MEGA 5GIPA 4KREA 4J2DA 4OKEA 4CF1A 4G9ZA 3CYMA 1BUPA 5AQZA 3GOIA 3V1RA 3K5MA 4F3TA 2RF2A 1LAWA 2O8BA 2GBZA 1IBMK 3LDSA 4CGIA 2Q3SA 2YNHA 3B6OA 3M6GA 5AQYA 4CJPA 2JGUA 3U4LA 3AO2A 1NGDA 1T7PA 5AZIA 3K5NA 4Z4CA 3ZX2A 4RCHA 3OYAA 2Z1IA 1NJXA 3UKRB 4JS4A 2R7YA 4U7BA 1HKGA 4HUEA 3FZKA 3TAGA 1BIZA 2P9NB 1NOYA 4QOZB 1BI4A 3AA3A 3RMBA 4OGCA 3DRPA 4GVMA 3MN6A 2E6LA 1NU0A 3VQAA 3DXKA 4I2PA 5KRSA 3L4QA 3K9KA 3M8SA 3NF7A 1X9JA 2YHBA 3DLBA 1VRUA 5M1PA 4M3TA 4JI7K 5J2MA 3MXMA 1S1VA 5TKWA 1QHTA 4QCLA 3OJUA 4GW6A 5M1KA 3HM9A 2A5XA 5JMVA 1VQ6N 4KHNA 4YOWA 3GL1A 1MDUB 3THVA 2UXCK 2E2OA 3VESA 4OPJA 4CK3A 4DV2K 3C6UA 2IDOA 4PKHA 3FFKB 5GINA 3PX4A 2E8AA 2DFEA 3SJHA 4B3MK 1VSEA 4DWIA 4AM7A 3O9SA 3HPGA 3ZT1A 5KPTA 5FROA 1XMOK 2HF3A 1WSFA 1SAZA 3CPEA 1IKYA 3WUHA 2X6SA 3TWHA 1NKBA 1LCUA 3OYHA 3DLRA 2JWLA 4DQ8A 3TTFA 2F9WA 4DLGA 4IEIA 3C6AA 1HPMA 2P9LB 4YOYA 2KQ2A 1RBTA 3CQXA 4JV5K 1WBDA 2BDPA 4AM6A 1HX1A 4E1MA 2ZM6K 1VQ9N 1CZ9A 4EZ6A 4A5AA 1HKCA 3CFRA 3D2FB 3HO1A 2KZZA 2AJQA 3WT0A 3G4SN 1DTTA 4BRDA 4CZFA 4BR2A 2OPSA 3BY5A 1RBSA 4DUZK 3UKUA 4OKJA 4B3TK 1HNWK 4ELTA 2DPNA 4KHPK 4Y1DA 1ASUA 2W6KA 3CC2N 2D0OA 4BVOA 3RMAA 4IG0A 4WCEL 3R3LA 2NRHA 3FZFA 2ZD1A 4CBWA 3CJBA 4DTSA 4KHQA 1K6YA 4CJVA 4DR4K 4FVMA 2FSNA 1SL1A 4CHOA 3SUOA 3NF6A 5ELZA 5AQHA 4KH4A 3J7ZO 5ADXH 5TKYA 4JRQA 2XY7A 5E26A 1CZAN 4FCYA 1Q7YO 1BCOA 3AV9A 1QQOA 3G25A 4MQ3A 4W5RA 4DR2K 4FJMA 1W9HA 1B9DA 3SQ2A 1Q82O 1I39A 4KHWA 4ID5A 4H0TB 1UA0A 3JS6A 5I42A 4CJWA 3P5JA 4JKGB 4JKBA 1A5VA 1HYVA 4KTWA 1OH5A 4PQUA 2P9SA 4CW7B 2I5JA 1VQKN 5C25A 4AHUA 2ZJRL 3RMDA 2YI1A 4JEPA 4XH4A 4FWMA 3SI6A 1NK9A 1EO1A 3OBWA 3CERA 1JCEA 3DJCA 4CGHA 3QLHA 4CEBA 4DSLA 1C6VA 4E7KA 3O3GA 2X6NA 2BUPA 4J8FA 3L0QA 4CESA 3ZETB 4CGGA 4B1YB 4EAHD 3SMSA 1K8KB 2UXDK 3HP6A 4DQSA 4NCGA 3CCUN 1WN7A 3HPOA 3ATUA 1ITGA 3THXA 3A5NC 3ZT3A 1GOAA 4AHVA 2O8CB 3OS2A 5AQMA 3CG7A 4TSXA 1J54A 4BWJA 2IVPA 1TGOA 3M8RA 1NOZA 2PZSA 3VGMA 2YHWA 2OYQA 4WFBL 1JJ2M 2IC3A 3SLCA 4JS5A 4M3RA 4GV9A 4CZLA 4CEDA 4CJUA 4OJRA 1KVBA 5EOYA 1ZBIA 3VA3A 1OH6A 4LFBK 4CI6A 4C23A 5AQFA 1JL2A 5HRRA 4FJ8A 4DQPA 1NK8A 4CHQA 3T1HK 5CE3A 4Q0BA 4FLYA 3DAWA 5AQJA 4B3OA 4JAXA 3VEYA 4OPKA 1BOTO 3TPQA 1VSJA 3EZ5A 1KSPA 5C0YA 1N8RO 5B8HA 2O8BB 2PYJA 3VGLA 4DKWA 5JLHA 4M7YA 2E2NA 1N34K 1NGGA 3HPHA 2OCEA 4BRHA 5AQTA 4DR5K 4KV8A 3EYZA 4IWVA 4KAZA 5AZIB 2HHXA 2IOCA 3O9QA 3VEZA 3KK3A 4FJIA 3WXMB 1JXEA 4BREA 2O8FA 4BC2A 4BR9A 4O0IA 3D2EA 1YTUA 1VQLN 4OGEA 3I55N 3DOLA 3F73A 4H5NA 4FK4A 1GLDG 1M1KO 4DTMA 1MA9B 4HWIA 1JLQA 4LF9K 3SBGA 2XRIA 3DXKB 4B9UA 2DFFA 1NJIO 1ASWA 3CMEN 3RSEA 2GELA 5AR0A 1GLFO 1TYQA 5HP1A 4X66K 4CJEA 3AGKA 4JKFA 4CJFA 2VQFK 4DU4A 3S3OA 1HRHA 3DLHA 3K57A 5BRFA 3F2KA 1T05A 1RBVA 4DR3K 4FJNA 4AILC 1V4SA 2NLXA 4JNEA 3VF6A 2OA8A 4KH6A 2F8TA 4FJ5A 2PAVA 4Z94A 4MLHA 2QKBA 1RT6A 4JI3K 5JICA 3PLAA 3W0LA 4NXNK 4BR5A 3ZEUA 1E3MA 3ALYA 3VF2A 4DSJA 4FM2A 1S5JA 4DR1K 4RG8A 1NLVA 2E5LK 1U2VA 2F9TA 1FJGK 2HNYA 2VWKA 3KK1A 4Z4EA 1BQMA 3JXUA 3QFUA 4B3SK 4CJLA 2E4LA 4BRCA 4FWLA 3HOSA 1JKHA 1E4FT 2HBJA 4KI4A 4CFBA 3LZIA 1BQNA 2GEMA 3HTVA 4DUYK 2OPQA 4LFAK 3LDQA 1RT1A 1S6QA 5LMNK 2GV9A 3M1FA 3K9JA 3AVIA 1QHAA 3CCVN 2VCPA 3CM6A 4IJNA 4E7HA 1X9MA 3UKUB 4CECA 1VSMA 2F96A 4KTQA 3QBXA 4CFAA 3PIPL 1RDUA 4W5OA 1SKRA 4XEIA 3GBTA 2HNDA 5KRTA 1SL2A 3PV8A 3VQPA 1D5AA 4FOIA 2OTJN 3KK2A 2KTQA 1T03A 1HLUA 2Q0RA 1QQNA 3AO1A 4YOUA 1Y97A 1JLGA 4B1XB 2RHKA 1U6ZA 2Q1NA 4KHYA 4O4GA 3ID6A 3QNNA 4FPBA 1U04A 1JLBA 1BCMA 4BE1A 3VQBA 4M42A 1J5EK 5KPRA 2BGGA 4FVUA 4FWKA 3S41A 2W41A 4RW8A 4KFBA 5M1QA 4QAGA 3WEEA 4JI1K 3I0SA 2KHOA 3V1OA 2P51A 1B92A 4N5SA 1Y64A 4B9QA 4EZ9A 3V9XA 3L6QA 1IKWA 5AQXA 1TKZA 4YY3K 3OYFA 3FE1A 4IOCL 3LDNA 4CZHA 3H45C 3MWTA 1TL1A 2H3GX 4BE0A 3TTCA 5AQQA 3KIOA 3H08A 3L3VA 3THWA 3ZSWA 3SQ0A 3P39A 4K0KK 4MLEA 4KKOA 2G8KA 1QS4A 1W7AA 1C1AA 1YIJN 3NH1A 4BRGA 3H3OB 1MWKA 3C7NA 1N33K 4FWOA 4CBXA 4BACA 1TKXA 4DV1K 1VSFA 3THXB 1XC9A 5C42A 2PFUA 4DLEA 1S22A 4CHZA 3DLGA 3JSMA 3FR0A 3MN5A 4RWTA 3QEIA 4BG9A 4HUFA 2QWOA 3ID8A 4DTXA 1NK5A 2OZSA 4DS5A 4JI6K 2D0PA 1R59O 3E9OA 3EO3A 5FRNA 1LV5A 5DMRA 1HPZA 4O44A 3ZSOA 3S3MA 2A6AA 1FKPA 4BDZA 4FJLA 2FBYA 4H5VA 3NH0A 1Z6RA 3D0PA 1BHLA 4FZYA 3TAQA 3DM2A 4PWDA 4E1JA 3T3FA 3E01A 5J2NA 2WBNA 4CIGA 2FBXA 2A3ZA 2ATQA 3CCLN 3VGKA 4DMNA 2QW9A 2HHUA 1LW2A 5DK5A 4PL8A 4WQ5A 5K14A 3OBYA 2W6LA 2CGKA 4K25A 1JXBA 1RFQA 4DG1A 3BP8A 4FLZA 3L8BA 3EE8A 3O9UA 3LDLA 4CEOA 3KD5E 3H1VX 3MDQA 4H0YB 5FPNA 1DT9A 3OYGA 5J2QA 3ULEA 3THYA 5AQSA 1D4XA 2Q0UA 3LP0A 3KVGA 3KZBA 3CC7N 4M7XA 3LP2A 4XH1A 2VQEK 2XY5A 4DR6K 5M1OA 1T6CA 4I9QA 5E41A 5IT9O 3D2EB 1UAXA 2HHQA 4XH5A 3NF9A 4DR7K 1T44A 5JS2A 4BRIA 5M1NA 3CCSN 4C1NI 4E7JA 2P5GA 3LM9A 1OH7A 5HRNA 4BC3A 3TAMA 2OPPA 1HNZK 1GLEG 4N47A 2X78A 5LMUK 4OO1J 1T6DA 4L3QA 3D6RA 3S3NA
chains in the Genus database with same CATH topology
3VQEA 3K58A 1HJRA 3DOKA 4HCCA 2ZD1A 3FFIA 4DTNA 5HROA 3MECA 1RDDA 4FJHA 3CFPA 1TK0A 2EX3A 4DTSA 4KHQA 2KFZA 1QE1A 1C1CA 1K6YA 4CJVA 1REVA 3NGIA 5HLFA 4C8KA 4KI6A 1U48A 4FVMA 3LWMA 1TAQA 1QSLA 1SL1A 4CHOA 1HQEA 3AVGA 1UOCA 4DSFA 3SUOA 3AA4A 3NF6A 3VQCA 3V9UA 4H4MA 3OYLA 1T8EA 1IG9A 3QEWA 4JRQA 4B08A 2XY7A 4B9VA 2YNGA 4FCYA 2HMIA 4CHNA 4DU3A 3TI0A 2RN2A 1BCOA 3HK2A 4FW1A 3AV9A 3C6TA 3VQ6A 1RT4A 3TAPA 2F8SA 4MQ3A 4W5RA 1J53A 4FJMA 1W9HA 2HHTA 1B9DA 2VG5A 4DFPA 4DQRA 3SQ2A 5J1EA 1I39A 3AVBA 4KHWA 1ZBUA 4ID5A 4CEEA 4CGJA 4CFDA 3L2WA 3RMAA 1U49A 3RR7A 4N76A 1UA0A 1C0UA 2YNFA 5CYQA 5I42A 4FJJA 2NUBA 4CJWA 3SCXA 4HCBA 3P5JA 4B8AB 3ZSVA 1Q9YA 4HUGA 4KRFA 1A5VA 1HYVA 4KTWA 4DS4A 4PQUA 2I5JA 3LPTA 5C25A 4GMJB 4AHUA 3RMDA 1BIUA 3L2VA 4FM1A 3I0RA 4CEFA 1ZBHA 3MXJA 1VRTA 3TAEA 4L8RB 3KLIA 2D0CA 3ULDA 4KTZA 3QEXA 3LAMA 2E6MA 3T19A 2OZMA 3SI6A 3RWUA 1NK9A 3AVHA 2P5OA 4FXDA 1KLMA 3JYTA 4CGHA 3SYZA 1WAFA 3VQ5A 3AO4A 3QLHA 4Q5VA 4CEBA 4UQGA 1Q9XA 4DSLA 3VQ8A 1C6VA 4M45A 3KLFA 4E7KA 3O3GA 2X6NA 3QIOA 4E7LA 3ZSXA 3DRRA 3MEDA 4OKKA 4CGDA 4R5PA 4CESA 3VQ4A 4LH4A 5HRPA 4CGGA 1WNSA 3VQQA 3ZT4A 1NJWA 3HSTB 4RW7A 3NE6A 4F2RA 3O4NA 3ZT2A 3G0ZA 4CJKA 3PO4A 4CEZA 4AHTA 3VQDA 3OYBA 3L2QA 3HP6A 4DQSA 1O1WA 4NCGA 3KLGA 1BGXT 1WN7A 2O4GA 1RTJA 4CEQA 4CIFA 3HPOA 4N56A 1ITGA 4W5QA 2DFHA 3K59A 3ZT3A 4FLXA 1GOAA 1DLOA 3LANA 4AHVA 4AHCA 3OS2A 3OYIA 5JS1A 1JLEA 2Z1HA 2A1SA 4DFKA 3QERA 3ITHA 5HRSA 2XY6A 3CG7A 4I2QA 1CXUA 3C95A 4TSXA 3BDPA 4FM0A 1EP4A 2A1RA 1J54A 4M41A 1TKDA 3I8DA 4BWJA 2YHAA 4DSEA 3V6DA 4B9MA 2KZMA 1RDBA 1TGOA 4FJKA 3HP9A 3M8RA 1NOZA 2PZSA 4RW6A 2YKMA 3PY8A 2OYQA 3L2UA 2IC3A 4F3OA 3RMCA 4CERA 4JS5A 4M3RA 1RT7A 3ZT0A 4CEDA 4FZXC 1GOBA 1YT3A 1HNIA 1HYZA 2G8WA 4DQIA 4CJUA 3NBPA 1KVBA 4OJRA 1S9EA 4CF8A 2QXFA 3NGYA 1ZBIA 3DMJA 3NHGA 3VA3A 3CQ8A 3ZSZA 3AA5X 1NKCA 1LWCA 1VSKA 4MFBA 3U3YA 3LZJA 3BGRA 2HW3A 1JL2A 5HRRA 4W5TA 4FJ8A 4DQPA 1Q8IA 1YTAA 3ZSYA 4CJQA 3NDKA 1NK8A 4CHQA 5FRMA 4Z4GA 1RCHA 1RT5A 3VQ9A 1NK6A 2ITGA 4Q0BA 4FLYA 1TAUA 2JLEA 3KKSA 4B3OA 4OPKA 1R0AA 1Z26A 2HVIA 3SPYA 3DYAA 1SUQA 4DTPA 3K5OA 4IFVA 4B9SA 1VSJA 3EZ5A 1KSPA 1RTIA 3AO3A 4Z0UA 1IKVA 3IG1A 3V1QA 4YFUA 3O3HA 4I9LA 2Y1JA 1QSYA 4BDYA 2PYJA 4IBNA 3OYCA 4DTUA 4ICLA 1XI1A 2EHGA 3HPHA 3NFAA 4RW9A 5HBMA 4KV8A 1LW0A 1TL3A 3K5LA 3EYZA 3QNOA 1C0MA 4ELUA 1KCFA 4CGFA 4KAZA 4J2AA 2HHXA 2KW4A 2IOCA 4JRPA 1BL3A 1S1TA 3PUFA 3AVNA 3KK3A 1KFDA 4OVLA 4E7IA 1JXEA 4E3SA 3QESA 4FJIA 2HHSA 1CXQA 2IGIA 3AVMA 3A2FA 3OYEA 2QKKA 4O0IA 4J2BA 3LALA 1YTUA 1EETA 4NCAA 4RW4A 3EY1A 1TK8A 3OYDA 4OGEA 3HXMA 3DOLA 4CF2A 3F73A 4FLWA 4FK4A 4ZTFA 1KLNA 4E19A 4DTMA 3P1GA 4DU1A 3V4IA 1JLQA 5SZTA 3NGZA 2XHBA 4C8NA 3HL8A 4DSIA 2XRIA 4F4KA 2D0BA 5KTQA 3ZCMA 4B9UA 2DFFA 3SJJA 1ASWA 4NCBA 3L3UA 1RBUA 1LWFA 2P1JA 1F21A 4CIEA 5KGXA 4KHSA 2RPIA 4M3UA 2HHWA 4I7FA 2BANA 1EX4A 5HP1A 4KB0A 2YV0X 4KPYA 3RTVA 3V81A 4FJXA 2VG7A 1WSJA 4E1NA 4CJEA 1RDAA 2G8UA 4BE2A 4PA1A 1S1UA 4CJFA 1A5XA 3NCIA 4DU4A 3TAFA 3MXIA 1XWLA 1VSHA 3AVJA 3TANA 3S3OA 1IH7A 1J5OA 1HRHA 4F2SA 1ZBLA 3DLHA 4M3ZA 3VN5A 3K57A 4M3WA 4FW2A 1KTQA 4H4OA 2KFNA 3QETA 1A5WA 1L3VA 3IRXA 1T05A 4BDPA 1RBVA 2ETJA 2FBTA 1MU2A 2HHVA 5J2PA 4FJNA 4F8RA 4AILC 1B9FA 3WNHA 1RT2A 3B6PA 3DLKA 4O55A 3OYJA 2DY4A 4AHRA 2OA8A 4O5BA 2F8TA 2XO7A 4FJ5A 1RDCA 3IS9A 3KLHA 3LWLA 4ZTJA 3AVCA 2QKBA 2PYLA 1RT6A 2LSNA 1JLAA 2Z1GA 3ASMA 1WLJA 4B9LA 1S6PA 2QK9A 3AA2A 3SV4A 3ALYA 4C8MA 4K8XA 4DSJA 4FM2A 1S5JA 3T1AA 3KKRA 4RG8A 2YKNA 3K2PA 1W0HA 4IDKA 2HNYA 2GUIA 2VWKA 4CE9A 4CCHA 2VWJA 3KK1A 1NKEA 4Z4EA 1BQMA 4CJLA 1JL1A 2YNIA 1JLCA 2E4LA 1C1BA 4XIUA 3O3FA 2O4IA 1CZBA 4NYNA 5CY4A 2G8FA 2IS3A 1JKHA 3QIPA 4LSLA 4HTUA 4ELVA 2ZE2A 4C8LA 4IKFA 3SZ2A 4N41A 4KI4A 2WOMA 4CJTA 4CFBA 4FLTA 3LZIA 1BQNA 1U47A 2DTUA 2OPQA 3HYFA 3SUPA 4FK2A 1L5UA 1RT1A 3M8QA 3SPZA 1S6QA 2Z1JA 2GV9A 1TVRA 1QQCA 1IO2A 3RRHA 2PY5A 4PUOA 3AVIA 4EP4A 2VG6A 4NYFA 2W42A 1HNVA 4KHUA 3PX0A 1RBRA 3G10A 1NK7A 3CM6A 1L3UA 4CFCA 3OYKA 4E7HA 3QINA 1X9MA 4CF0A 3L2RA 4CECA 1VSMA 3OYMA 1KFSA 4KB1A 2F96A 2OPRA 3WNGA 4KTQA 1NJYA 4B9NA 4DTRA 2BE2A 1SL0A 3SUNA 3M8PA 4M3XA 1EKEA 3RRGA 3KD1E 4FZZA 4CFAA 4Z4HA 3KTQA 4FJ9A 3QO9A 1HYSA 3C94A 4W5OA 1CLQA 1SKRA 3NH2A 2HVHA 3ZSRA 1WSIA 1G15A 4YNQA 3OS1A 4E0DA 3OJSA 1XHZA 4DTOA 5SWMA 2HNDA 1RTDA 1X9WA 2IAJA 5KRTA 1J9AA 1SL2A 3KLEA 3PV8A 3VQPA 4Z4FA 3MEEA 2B4JA 1D5AA 4CF9A 1KVCA 1VSDA 1NK4A 3SQ1A 1NJZA 4CJ5A 3KK2A 2KTQA 4J2EA 3OS0A 1T03A 4IG3A 3LAKA 1NK0A 1N5YA 4AHSA 1YVUA 1SKSA 1L3SA 1S1WA 1S9GA 1DTQA 1U4BA 2G8VA 1LAVA 4O0JA 3AO1A 1Y97A 1JLGA 1FKOA 3CM5A 4JLHA 2D5RA 4KHYA 4O4GA 2G8IA 3QNNA 1U04A 1JLBA 1BCMA 4BE1A 3VQBA 4IFYA 4M42A 3DLEA 4DFMA 4CJ3A 4M3YA 4DFJA 2BGGA 3MEGA 5CYMA 4KREA 3SUQA 4J2DA 4OKEA 3U6FA 4LD0A 4RW8A 1JLFA 4CF1A 4KFBA 1FK9A 1BI4B 4QAGA 3I0SA 3CYMA 3MAQA 2FBVA 4F3TA 3UIQA 3V1RA 3K5MA 1GOCA 4Y1CA 2RF2A 3V1OA 2P51A 1LAWA 2GBZA 4C8OA 2ZQBA 3V9ZA 3KJVA 3LDSA 1B92A 2Q3SA 4CGIA 4N5SA 2YNHA 3B6OA 3TR8A 1TKTA 4FLVA 4EZ9A 4CJPA 4DTJA 3V9XA 2JGUA 3O4QA 1SV5A 1IKWA 1TKZA 3IAYA 5CZ2A 3OYFA 2Y1IA 3AO2A 4CK1A 1EXQA 1TV6A 4LY7A 1T7PA 2RKIA 1TL1A 3K5NA 4BE0A 1WAJA 4Z4CA 3KIOA 3H08A 3L3VA 2Z1IA 1RILA 3OY9A 3OYNA 4CJ4A 3OYAA 1NJXA 4ID1A 3OVNA 3ZSWA 4KO0A 4FK0A 3LP3A 3SQ0A 3PX6A 1QTMA 4JS4A 1U45A 4KKOA 2R7YA 3TARA 3RR8A 2G8KA 3QEPA 1QS4A 4HUEA 4G1QA 1C1AA 1N6QA 3TAGA 1BIZA 3NH1A 1NOYA 4QOZB 1BI4A 3AA3A 3RMBA 1KRPA 4OGCA 3DRPA 4CHPA 4GVMA 4CEAA 2E6LA 3S9HA 3VQAA 4HVJA 2D0AA 4BACA 1TKXA 4FJ7A 4CJRA 1VSFA 4I2PA 3ZSQA 5C42A 5KRSA 4DLEA 2WONA 4DF8A 1XC9A 3HJFA 4CHZA 3DLGA 3JSMA 1VSLA 3M8SA 3QEIA 3NF7A 4B9TA 2YHBA 4HUFA 3DLBA 1VRUA 1VSIA 4DTXA 1NK5A 1UWBA 3AVLA 4DS5A 2OZSA 3SV3A 3SQ4A 1I3AA 4M3TA 5J2MA 4WE1A 1ASVA 4HHTA 4DQQA 1S1VA 1VK0A 1QHTA 4CHYA 3MXMA 5D3GA 4QCLA 3AVAA 4CK2A 5FRNA 3OJUA 4DF4A 4GW6A 5CZ1A 5DMRA 3HM9A 1L3TA 1LV5A 3CFOA 1HPZA 4H8KA 4KHNA 4O44A 3ZSOA 3S3MA 1ZBFA 1FKPA 4BDZA 4FJLA 2FBYA 2B6AA 3THVA 2X74A 4OPJA 4CK3A 3NH0A 1HMVA 3V9SA 5T7BA 1BHLA 3D0PA 3SNNA 4FZYA 1IKXA 3TAQA 3C6UA 3DM2A 1D9DA 2IDOA 4PWDA 3PX4A 3T3FA 3E01A 4E89A 5J2NA 1C0TA 4Z4IA 3NF8A 3AO5A 2XY8A 2FBXA 4CIGA 2DFEA 2ATQA 4OLAA 3DI6A 4FYDA 1QSSA 2B5JA 4DSKA 1VSEA 4B8CA 4DMNA 4DWIA 2HHUA 1RTHA 1LW2A 3U3GA 4W5NA 1WSEA 3VA0A 5DK5A 3ZT1A 3HPGA 5K14A 4PY5A 1RT3A 2HNZA 4LSNA 5FROA 3HVTA 4CJSA 1WSFA 3LPUA 4FJGA 1IKYA 1JXBA 4DG1A 2X6SA 3TWHA 1NKBA 4FLZA 1X1PA 3DRSA 3OYHA 2HB5A 3DLRA 3P83D 3L8BA 1FXXA 4DLGA 3HT3A 4CEOA 3KD5E 3NAEA 1KVAA 3TABA 3PO5A 2G8HA 1X9SA 1WSGA 5FDLA 1HQUA 1LWEA 4AH9A 1SKWA 4EP5A 4OLBA 2KQ2A 1RBTA 5EU7A 4ZHRA 3OYGA 1D8YA 5J2QA 2BDPA 4E1MA 4BWMA 3VQ7A 4FLUA 3LP0A 3HVRA 1CZ9A 1RNHA 4EZ6A 3CFRA 3V9WA 3LP2A 3QEVA 3D45A 2XY5A 4I9QA 3AVFA 3ISNC 3F9KA 5E41A 3HO1A 2KZZA 1ZYQA 2AJQA 4K8ZA 4LH5A 5I3UA 1D9FA 1UAXA 2HHQA 1DTTA 3NF9A 2OPSA 1Z25A 1RBSA 5JS2A 4E7JA 2P5GA 1BISA 5C24A 3WNEA 5HRNA 1TK5A 4OKJA 3TAMA 5KGWA 2OPPA 2FC0A 4ELTA 1UA1A 4N47A 3LP1A 2X78A 1XHXA 4Y1DA 1ASUA 1S1XA 3WNFA 3AVKA 4IG0A 3S3NA 5KI6A 1WSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQE A;  3K58 A;  1HJR A;  3DOK A;  4HCC A;  2ZD1 A;  3FFI A;  4DTN A;  5HRO A;  3MEC A;  1RDD A;  4FJH A;  3CFP A;  1TK0 A;  2EX3 A;  4DTS A;  4KHQ A;  2KFZ A;  1QE1 A;  1C1C A;  1K6Y A;  4CJV A;  1REV A;  3NGI A;  5HLF A;  4C8K A;  4KI6 A;  1U48 A;  4FVM A;  3LWM A;  1TAQ A;  1QSL A;  1SL1 A;  4CHO A;  1HQE A;  3AVG A;  1UOC A;  4DSF A;  3SUO A;  3AA4 A;  3NF6 A;  3VQC A;  3V9U A;  4H4M A;  3OYL A;  1T8E A;  1IG9 A;  3QEW A;  4JRQ A;  4B08 A;  2XY7 A;  4B9V A;  2YNG A;  4FCY A;  2HMI A;  4CHN A;  4DU3 A;  3TI0 A;  2RN2 A;  1BCO A;  3HK2 A;  4FW1 A;  3AV9 A;  3C6T A;  3VQ6 A;  1RT4 A;  3TAP A;  2F8S A;  4MQ3 A;  4W5R A;  1J53 A;  4FJM A;  1W9H A;  2HHT A;  1B9D A;  2VG5 A;  4DFP A;  4DQR A;  3SQ2 A;  5J1E A;  1I39 A;  3AVB A;  4KHW A;  1ZBU A;  4ID5 A;  4CEE A;  4CGJ A;  4CFD A;  3L2W A;  3RMA A;  1U49 A;  3RR7 A;  4N76 A;  1UA0 A;  1C0U A;  2YNF A;  5CYQ A;  5I42 A;  4FJJ A;  2NUB A;  4CJW A;  3SCX A;  4HCB A;  3P5J A;  4B8A B;  3ZSV A;  1Q9Y A;  4HUG A;  4KRF A;  1A5V A;  1HYV A;  4KTW A;  4DS4 A;  4PQU A;  2I5J A;  3LPT A;  5C25 A;  4GMJ B;  4AHU A;  3RMD A;  1BIU A;  3L2V A;  4FM1 A;  3I0R A;  4CEF A;  1ZBH A;  3MXJ A;  1VRT A;  3TAE A;  4L8R B;  3KLI A;  2D0C A;  3ULD A;  4KTZ A;  3QEX A;  3LAM A;  2E6M A;  3T19 A;  2OZM A;  3SI6 A;  3RWU A;  1NK9 A;  3AVH A;  2P5O A;  4FXD A;  1KLM A;  3JYT A;  4CGH A;  3SYZ A;  1WAF A;  3VQ5 A;  3AO4 A;  3QLH A;  4Q5V A;  4CEB A;  4UQG A;  1Q9X A;  4DSL A;  3VQ8 A;  1C6V A;  4M45 A;  3KLF A;  4E7K A;  3O3G A;  2X6N A;  3QIO A;  4E7L A;  3ZSX A;  3DRR A;  3MED A;  4OKK A;  4CGD A;  4R5P A;  4CES A;  3VQ4 A;  4LH4 A;  5HRP A;  4CGG A;  1WNS A;  3VQQ A;  3ZT4 A;  1NJW A;  3HST B;  4RW7 A;  3NE6 A;  4F2R A;  3O4N A;  3ZT2 A;  3G0Z A;  4CJK A;  3PO4 A;  4CEZ A;  4AHT A;  3VQD A;  3OYB A;  3L2Q A;  3HP6 A;  4DQS A;  1O1W A;  4NCG A;  3KLG A;  1BGX T;  1WN7 A;  2O4G A;  1RTJ A;  4CEQ A;  4CIF A;  3HPO A;  4N56 A;  1ITG A;  4W5Q A;  2DFH A;  3K59 A;  3ZT3 A;  4FLX A;  1GOA A;  1DLO A;  3LAN A;  4AHV A;  4AHC A;  3OS2 A;  3OYI A;  5JS1 A;  1JLE A;  2Z1H A;  2A1S A;  4DFK A;  3QER A;  3ITH A;  5HRS A;  2XY6 A;  3CG7 A;  4I2Q A;  1CXU A;  3C95 A;  4TSX A;  3BDP A;  4FM0 A;  1EP4 A;  2A1R A;  1J54 A;  4M41 A;  1TKD A;  3I8D A;  4BWJ A;  2YHA A;  4DSE A;  3V6D A;  4B9M A;  2KZM A;  1RDB A;  1TGO A;  4FJK A;  3HP9 A;  3M8R A;  1NOZ A;  2PZS A;  4RW6 A;  2YKM A;  3PY8 A;  2OYQ A;  3L2U A;  2IC3 A;  4F3O A;  3RMC A;  4CER A;  4JS5 A;  4M3R A;  1RT7 A;  3ZT0 A;  4CED A;  4FZX C;  1GOB A;  1YT3 A;  1HNI A;  1HYZ A;  2G8W A;  4DQI A;  4CJU A;  3NBP A;  1KVB A;  4OJR A;  1S9E A;  4CF8 A;  2QXF A;  3NGY A;  1ZBI A;  3DMJ A;  3NHG A;  3VA3 A;  3CQ8 A;  3ZSZ A;  3AA5 X;  1NKC A;  1LWC A;  1VSK A;  4MFB A;  3U3Y A;  3LZJ A;  3BGR A;  2HW3 A;  1JL2 A;  5HRR A;  4W5T A;  4FJ8 A;  4DQP A;  1Q8I A;  1YTA A;  3ZSY A;  4CJQ A;  3NDK A;  1NK8 A;  4CHQ A;  5FRM A;  4Z4G A;  1RCH A;  1RT5 A;  3VQ9 A;  1NK6 A;  2ITG A;  4Q0B A;  4FLY A;  1TAU A;  2JLE A;  3KKS A;  4B3O A;  4OPK A;  1R0A A;  1Z26 A;  2HVI A;  3SPY A;  3DYA A;  1SUQ A;  4DTP A;  3K5O A;  4IFV A;  4B9S A;  1VSJ A;  3EZ5 A;  1KSP A;  1RTI A;  3AO3 A;  4Z0U A;  1IKV A;  3IG1 A;  3V1Q A;  4YFU A;  3O3H A;  4I9L A;  2Y1J A;  1QSY A;  4BDY A;  2PYJ A;  4IBN A;  3OYC A;  4DTU A;  4ICL A;  1XI1 A;  2EHG A;  3HPH A;  3NFA A;  4RW9 A;  5HBM A;  4KV8 A;  1LW0 A;  1TL3 A;  3K5L A;  3EYZ A;  3QNO A;  1C0M A;  4ELU A;  1KCF A;  4CGF A;  4KAZ A;  4J2A A;  2HHX A;  2KW4 A;  2IOC A;  4JRP A;  1BL3 A;  1S1T A;  3PUF A;  3AVN A;  3KK3 A;  1KFD A;  4OVL A;  4E7I A;  1JXE A;  4E3S A;  3QES A;  4FJI A;  2HHS A;  1CXQ A;  2IGI A;  3AVM A;  3A2F A;  3OYE A;  2QKK A;  4O0I A;  4J2B A;  3LAL A;  1YTU A;  1EET A;  4NCA A;  4RW4 A;  3EY1 A;  1TK8 A;  3OYD A;  4OGE A;  3HXM A;  3DOL A;  4CF2 A;  3F73 A;  4FLW A;  4FK4 A;  4ZTF A;  1KLN A;  4E19 A;  4DTM A;  3P1G A;  4DU1 A;  3V4I A;  1JLQ A;  5SZT A;  3NGZ A;  2XHB A;  4C8N A;  3HL8 A;  4DSI A;  2XRI A;  4F4K A;  2D0B A;  5KTQ A;  3ZCM A;  4B9U A;  2DFF A;  3SJJ A;  1ASW A;  4NCB A;  3L3U A;  1RBU A;  1LWF A;  2P1J A;  1F21 A;  4CIE A;  5KGX A;  4KHS A;  2RPI A;  4M3U A;  2HHW A;  4I7F A;  2BAN A;  1EX4 A;  5HP1 A;  4KB0 A;  2YV0 X;  4KPY A;  3RTV A;  3V81 A;  4FJX A;  2VG7 A;  1WSJ A;  4E1N A;  4CJE A;  1RDA A;  2G8U A;  4BE2 A;  4PA1 A;  1S1U A;  4CJF A;  1A5X A;  3NCI A;  4DU4 A;  3TAF A;  3MXI A;  1XWL A;  1VSH A;  3AVJ A;  3TAN A;  3S3O A;  1IH7 A;  1J5O A;  1HRH A;  4F2S A;  1ZBL A;  3DLH A;  4M3Z A;  3VN5 A;  3K57 A;  4M3W A;  4FW2 A;  1KTQ A;  4H4O A;  2KFN A;  3QET A;  1A5W A;  1L3V A;  3IRX A;  1T05 A;  4BDP A;  1RBV A;  2ETJ A;  2FBT A;  1MU2 A;  2HHV A;  5J2P A;  4FJN A;  4F8R A;  4AIL C;  1B9F A;  3WNH A;  1RT2 A;  3B6P A;  3DLK A;  4O55 A;  3OYJ A;  2DY4 A;  4AHR A;  2OA8 A;  4O5B A;  2F8T A;  2XO7 A;  4FJ5 A;  1RDC A;  3IS9 A;  3KLH A;  3LWL A;  4ZTJ A;  3AVC A;  2QKB A;  2PYL A;  1RT6 A;  2LSN A;  1JLA A;  2Z1G A;  3ASM A;  1WLJ A;  4B9L A;  1S6P A;  2QK9 A;  3AA2 A;  3SV4 A;  3ALY A;  4C8M A;  4K8X A;  4DSJ A;  4FM2 A;  1S5J A;  3T1A A;  3KKR A;  4RG8 A;  2YKN A;  3K2P A;  1W0H A;  4IDK A;  2HNY A;  2GUI A;  2VWK A;  4CE9 A;  4CCH A;  2VWJ A;  3KK1 A;  1NKE A;  4Z4E A;  1BQM A;  4CJL A;  1JL1 A;  2YNI A;  1JLC A;  2E4L A;  1C1B A;  4XIU A;  3O3F A;  2O4I A;  1CZB A;  4NYN A;  5CY4 A;  2G8F A;  2IS3 A;  1JKH A;  3QIP A;  4LSL A;  4HTU A;  4ELV A;  2ZE2 A;  4C8L A;  4IKF A;  3SZ2 A;  4N41 A;  4KI4 A;  2WOM A;  4CJT A;  4CFB A;  4FLT A;  3LZI A;  1BQN A;  1U47 A;  2DTU A;  2OPQ A;  3HYF A;  3SUP A;  4FK2 A;  1L5U A;  1RT1 A;  3M8Q A;  3SPZ A;  1S6Q A;  2Z1J A;  2GV9 A;  1TVR A;  1QQC A;  1IO2 A;  3RRH A;  2PY5 A;  4PUO A;  3AVI A;  4EP4 A;  2VG6 A;  4NYF A;  2W42 A;  1HNV A;  4KHU A;  3PX0 A;  1RBR A;  3G10 A;  1NK7 A;  3CM6 A;  1L3U A;  4CFC A;  3OYK A;  4E7H A;  3QIN A;  1X9M A;  4CF0 A;  3L2R A;  4CEC A;  1VSM A;  3OYM A;  1KFS A;  4KB1 A;  2F96 A;  2OPR A;  3WNG A;  4KTQ A;  1NJY A;  4B9N A;  4DTR A;  2BE2 A;  1SL0 A;  3SUN A;  3M8P A;  4M3X A;  1EKE A;  3RRG A;  3KD1 E;  4FZZ A;  4CFA A;  4Z4H A;  3KTQ A;  4FJ9 A;  3QO9 A;  1HYS A;  3C94 A;  4W5O A;  1CLQ A;  1SKR A;  3NH2 A;  2HVH A;  3ZSR A;  1WSI A;  1G15 A;  4YNQ A;  3OS1 A;  4E0D A;  3OJS A;  1XHZ A;  4DTO A;  5SWM A;  2HND A;  1RTD A;  1X9W A;  2IAJ A;  5KRT A;  1J9A A;  1SL2 A;  3KLE A;  3PV8 A;  3VQP A;  4Z4F A;  3MEE A;  2B4J A;  1D5A A;  4CF9 A;  1KVC A;  1VSD A;  1NK4 A;  3SQ1 A;  1NJZ A;  4CJ5 A;  3KK2 A;  2KTQ A;  4J2E A;  3OS0 A;  1T03 A;  4IG3 A;  3LAK A;  1NK0 A;  1N5Y A;  4AHS A;  1YVU A;  1SKS A;  1L3S A;  1S1W A;  1S9G A;  1DTQ A;  1U4B A;  2G8V A;  1LAV A;  4O0J A;  3AO1 A;  1Y97 A;  1JLG A;  1FKO A;  3CM5 A;  4JLH A;  2D5R A;  4KHY A;  4O4G A;  2G8I A;  3QNN A;  1U04 A;  1JLB A;  1BCM A;  4BE1 A;  3VQB A;  4IFY A;  4M42 A;  3DLE A;  4DFM A;  4CJ3 A;  4M3Y A;  4DFJ A;  2BGG A;  3MEG A;  5CYM A;  4KRE A;  3SUQ A;  4J2D A;  4OKE A;  3U6F A;  4LD0 A;  4RW8 A;  1JLF A;  4CF1 A;  4KFB A;  1FK9 A;  1BI4 B;  4QAG A;  3I0S A;  3CYM A;  3MAQ A;  2FBV A;  4F3T A;  3UIQ A;  3V1R A;  3K5M A;  1GOC A;  4Y1C A;  2RF2 A;  3V1O A;  2P51 A;  1LAW A;  2GBZ A;  4C8O A;  2ZQB A;  3V9Z A;  3KJV A;  3LDS A;  1B92 A;  2Q3S A;  4CGI A;  4N5S A;  2YNH A;  3B6O A;  3TR8 A;  1TKT A;  4FLV A;  4EZ9 A;  4CJP A;  4DTJ A;  3V9X A;  2JGU A;  3O4Q A;  1SV5 A;  1IKW A;  1TKZ A;  3IAY A;  5CZ2 A;  3OYF A;  2Y1I A;  3AO2 A;  4CK1 A;  1EXQ A;  1TV6 A;  4LY7 A;  1T7P A;  2RKI A;  1TL1 A;  3K5N A;  4BE0 A;  1WAJ A;  4Z4C A;  3KIO A;  3H08 A;  3L3V A;  2Z1I A;  1RIL A;  3OY9 A;  3OYN A;  4CJ4 A;  3OYA A;  1NJX A;  4ID1 A;  3OVN A;  3ZSW A;  4KO0 A;  4FK0 A;  3LP3 A;  3SQ0 A;  3PX6 A;  1QTM A;  4JS4 A;  1U45 A;  4KKO A;  2R7Y A;  3TAR A;  3RR8 A;  2G8K A;  3QEP A;  1QS4 A;  4HUE A;  4G1Q A;  1C1A A;  1N6Q A;  3TAG A;  1BIZ A;  3NH1 A;  1NOY A;  4QOZ B;  1BI4 A;  3AA3 A;  3RMB A;  1KRP A;  4OGC A;  3DRP A;  4CHP A;  4GVM A;  4CEA A;  2E6L A;  3S9H A;  3VQA A;  4HVJ A;  2D0A A;  4BAC A;  1TKX A;  4FJ7 A;  4CJR A;  1VSF A;  4I2P A;  3ZSQ A;  5C42 A;  5KRS A;  4DLE A;  2WON A;  4DF8 A;  1XC9 A;  3HJF A;  4CHZ A;  3DLG A;  3JSM A;  1VSL A;  3M8S A;  3QEI A;  3NF7 A;  4B9T A;  2YHB A;  4HUF A;  3DLB A;  1VRU A;  1VSI A;  4DTX A;  1NK5 A;  1UWB A;  3AVL A;  4DS5 A;  2OZS A;  3SV3 A;  3SQ4 A;  1I3A A;  4M3T A;  5J2M A;  4WE1 A;  1ASV A;  4HHT A;  4DQQ A;  1S1V A;  1VK0 A;  1QHT A;  4CHY A;  3MXM A;  5D3G A;  4QCL A;  3AVA A;  4CK2 A;  5FRN A;  3OJU A;  4DF4 A;  4GW6 A;  5CZ1 A;  5DMR A;  3HM9 A;  1L3T A;  1LV5 A;  3CFO A;  1HPZ A;  4H8K A;  4KHN A;  4O44 A;  3ZSO A;  3S3M A;  1ZBF A;  1FKP A;  4BDZ A;  4FJL A;  2FBY A;  2B6A A;  3THV A;  2X74 A;  4OPJ A;  4CK3 A;  3NH0 A;  1HMV A;  3V9S A;  5T7B A;  1BHL A;  3D0P A;  3SNN A;  4FZY A;  1IKX A;  3TAQ A;  3C6U A;  3DM2 A;  1D9D A;  2IDO A;  4PWD A;  3PX4 A;  3T3F A;  3E01 A;  4E89 A;  5J2N A;  1C0T A;  4Z4I A;  3NF8 A;  3AO5 A;  2XY8 A;  2FBX A;  4CIG A;  2DFE A;  2ATQ A;  4OLA A;  3DI6 A;  4FYD A;  1QSS A;  2B5J A;  4DSK A;  1VSE A;  4B8C A;  4DMN A;  4DWI A;  2HHU A;  1RTH A;  1LW2 A;  3U3G A;  4W5N A;  1WSE A;  3VA0 A;  5DK5 A;  3ZT1 A;  3HPG A;  5K14 A;  4PY5 A;  1RT3 A;  2HNZ A;  4LSN A;  5FRO A;  3HVT A;  4CJS A;  1WSF A;  3LPU A;  4FJG A;  1IKY A;  1JXB A;  4DG1 A;  2X6S A;  3TWH A;  1NKB A;  4FLZ A;  1X1P A;  3DRS A;  3OYH A;  2HB5 A;  3DLR A;  3P83 D;  3L8B A;  1FXX A;  4DLG A;  3HT3 A;  4CEO A;  3KD5 E;  3NAE A;  1KVA A;  3TAB A;  3PO5 A;  2G8H A;  1X9S A;  1WSG A;  5FDL A;  1HQU A;  1LWE A;  4AH9 A;  1SKW A;  4EP5 A;  4OLB A;  2KQ2 A;  1RBT A;  5EU7 A;  4ZHR A;  3OYG A;  1D8Y A;  5J2Q A;  2BDP A;  4E1M A;  4BWM A;  3VQ7 A;  4FLU A;  3LP0 A;  3HVR A;  1CZ9 A;  1RNH A;  4EZ6 A;  3CFR A;  3V9W A;  3LP2 A;  3QEV A;  3D45 A;  2XY5 A;  4I9Q A;  3AVF A;  3ISN C;  3F9K A;  5E41 A;  3HO1 A;  2KZZ A;  1ZYQ A;  2AJQ A;  4K8Z A;  4LH5 A;  5I3U A;  1D9F A;  1UAX A;  2HHQ A;  1DTT A;  3NF9 A;  2OPS A;  1Z25 A;  1RBS A;  5JS2 A;  4E7J A;  2P5G A;  1BIS A;  5C24 A;  3WNE A;  5HRN A;  1TK5 A;  4OKJ A;  3TAM A;  5KGW A;  2OPP A;  2FC0 A;  4ELT A;  1UA1 A;  4N47 A;  3LP1 A;  2X78 A;  1XHX A;  4Y1D A;  1ASU A;  1S1X A;  3WNF A;  3AVK A;  4IG0 A;  3S3N A;  5KI6 A;  1WSH A; 
#chains in the Genus database with same CATH topology
 2UXB K;  3F9M A;  5HRO A;  3CXC M;  3MEC A;  3CJ7 A;  2KFZ A;  1U48 A;  1VQ7 N;  3LWM A;  4NLB A;  4WQ5 C;  4DSF A;  3AA4 A;  4IJA A;  3OYL A;  1C0F A;  3QEW A;  3T69 A;  4CHN A;  3TI0 A;  4JK9 A;  2F8S A;  3VQ6 A;  3H46 O;  1XC3 A;  5AQV A;  3QDK A;  4JI5 K;  1NG9 A;  2VG5 A;  3VEX A;  2O8D A;  2NRV A;  3AVB A;  4V19 S;  3HRG A;  4CEE A;  1NGA A;  4CFD A;  4MDB A;  3NVM A;  4OPA A;  2YNF A;  3U8X A;  5CYQ A;  2ZGZ A;  3ZEU B;  4FPA A;  3HZ6 A;  4DS4 A;  5F2R A;  3C0B A;  3L2V A;  4FM1 A;  1VQP N;  5AQP A;  1U2V B;  1VRT A;  1OVQ A;  4DV7 K;  3KLI A;  2D0C A;  2V7Y A;  2QWL A;  3T19 A;  5H1S Q;  3RWU A;  5BR9 A;  3AVH A;  2P5O A;  3J7A P;  1KLM A;  3JYT A;  2V52 B;  3SYZ A;  3EKS A;  3AO4 A;  3PSF A;  3CJA A;  3VTI A;  3O4W A;  4E7L A;  4YOR A;  3ZSX A;  4OKK A;  4R5P A;  3VQ4 A;  5C2F A;  5HRP A;  5M1F A;  3ZT4 A;  4FSV A;  2NRR A;  3NE6 A;  4F2R A;  3O4N A;  4CZM A;  3PO4 A;  3L2Q A;  2F7T A;  5FPD A;  1BGX T;  1MWM A;  2O4G A;  1RTJ A;  4CIF A;  4A5B A;  2BTF A;  1RDW X;  3H3N O;  4U67 L;  4FLX A;  3J7Y P;  3LAN A;  3MX5 A;  4X62 K;  2Z1H A;  2A1S A;  4DFK A;  3ITH A;  2XY6 A;  4IEE A;  4FM0 A;  2A1R A;  4M41 A;  4FO0 A;  2YHA A;  4JD2 A;  2WC9 A;  3PY8 A;  2P9P B;  3L2U A;  3EZW A;  2UYT A;  1GOB A;  1YT3 A;  2CH5 A;  1HYZ A;  4EHT A;  3NGY A;  4GNI A;  3NHG A;  3CQ8 A;  1NKC A;  1LWC A;  1VSK A;  3TU5 A;  4DHY A;  4W5T A;  1YTA A;  3NDK A;  2ASO A;  1NK6 A;  4KBO A;  4PHT X;  3W3D A;  3WEE B;  1NGF A;  3DYA A;  3O6W A;  3K5O A;  4YFU A;  1IKV A;  3V1Q A;  2GWK A;  1VQM N;  2EWS A;  4I9L A;  1QSY A;  2V51 B;  3ZX0 A;  4BDY A;  2OTL N;  1IJJ A;  2IVN A;  3OYC A;  4ICL A;  1DEJ A;  1P90 A;  4RW9 A;  1LW0 A;  3K5L A;  1KCF A;  3B8A X;  2KW4 A;  2J4R A;  4YHH K;  1S1T A;  2E1Y A;  3AVN A;  3THW B;  3QES A;  1GLL O;  1NGI A;  4J2B A;  3DXM A;  1EET A;  4H0O A;  1BA1 A;  3HXM A;  1C0G A;  4CF2 A;  3ENH A;  4E19 A;  2CGL A;  3P1G A;  4DU1 A;  3C7N B;  2P9I B;  3ZYY X;  4C8N A;  2D1K A;  2PBD A;  3ZCM A;  4NCB A;  2QXL A;  3CC4 N;  2P1J A;  2RPI A;  2HHW A;  4H5T A;  5JLF A;  1EX4 A;  2CH6 A;  4FWN A;  3V81 A;  3LM2 A;  4BRA A;  5BPN A;  4E1N A;  2O8E A;  3MXI A;  1S1U A;  1SL0 A;  5AQL A;  1VHX A;  3TAF A;  3KTQ A;  2VGN A;  3AVJ A;  5AFU H;  4F2S A;  1ZBL A;  3HI0 A;  4H4O A;  1KTQ A;  3IFR A;  2RE2 A;  4CD1 A;  1L3V A;  1HUX A;  1MU2 A;  3SK3 A;  1QVF M;  4F8R A;  1RT2 A;  3B6P A;  2IVO A;  3CQY A;  3OYJ A;  4AHR A;  4B1W B;  5BRD A;  1YHQ N;  3LWL A;  4ZTJ A;  3FZH A;  1XUP O;  2PYL A;  2LSN A;  1YJN N;  1JLA A;  1WLJ A;  3VOV A;  4GKJ K;  4JKD A;  3AA2 A;  3SV4 A;  1LOT B;  2QEX N;  3K2P A;  1W0H A;  4CE9 A;  1XNQ K;  1NKE A;  3MK6 A;  3HOT A;  3CCM N;  3R8E A;  2FSK A;  3E9L A;  1CZB A;  2G8F A;  5CY4 A;  3R6M A;  3ULE B;  4DV6 K;  2UU9 K;  3SBT A;  2ZE2 A;  4C8L A;  4IKF A;  4FLT A;  3FLC O;  3HYF A;  3SUP A;  1XMQ K;  1VQ8 N;  5C12 A;  2PY5 A;  1IO2 A;  4PUO A;  3E1Y A;  4EP4 A;  4NYF A;  4ILG B;  4X65 K;  2W42 A;  1VAZ A;  4KHU A;  1X3N A;  4O8K A;  4IO9 L;  1OKJ A;  4CF0 A;  4KB1 A;  2QWR A;  4GV6 A;  1NJY A;  2I7N A;  2BE2 A;  4DB3 A;  3M8P A;  4M3X A;  1YXQ A;  3KD1 E;  5BR8 K;  2HVH A;  3ZSR A;  4GY2 B;  3OS1 A;  4E0D A;  3OJS A;  1XHZ A;  4CVN E;  4NO7 A;  5SWM A;  1KAZ A;  1J9A A;  4Z4F A;  3MEE A;  2B4J A;  4JI8 K;  1KVC A;  4CJ5 A;  4IG3 A;  3LAK A;  1N5Y A;  5EX5 A;  1YVU A;  1SKS A;  1G99 A;  1L3S A;  1S1W A;  1S9G A;  1LAV A;  1FKO A;  3CM5 A;  3M3Z A;  3G71 N;  4JLH A;  2G8I A;  4CZI A;  2UUA K;  4LD0 A;  1JLF A;  1FK9 A;  1BI4 B;  2P9U A;  3MAQ A;  2FBV A;  4LF5 K;  3KWG A;  1GOC A;  3T7Z A;  3CMA N;  3IDH A;  5C15 A;  4C8O A;  2ZQB A;  2E1Z A;  1TKT A;  4DTJ A;  5HOO A;  1SV5 A;  4B3R K;  3IAY A;  3AGR A;  5CZ2 A;  4OX9 K;  1TV6 A;  4LY7 A;  1VQO N;  2RKI A;  4H0V B;  3PIO L;  1WAJ A;  3DWL A;  3OYN A;  3OVN A;  5LL6 Z;  2QM1 A;  4KO0 A;  3PX6 A;  1U45 A;  2ZGY A;  3TAR A;  4OPH A;  3QEP A;  5BRH A;  4G1Q A;  4K41 A;  1KRP A;  4AF1 A;  4M63 C;  2FXU A;  4CHP A;  4HVJ A;  2D0A A;  4FJ7 A;  3J80 O;  1HJO A;  2WON A;  4YOT A;  1BU6 O;  4AQY K;  4B1U B;  4B9T A;  1BWF O;  1VSI A;  2QA4 N;  1Q81 O;  1J6Z A;  3AVL A;  3SV3 A;  3SQ4 A;  1I3A A;  5C2D A;  3CJ9 A;  1ASV A;  4JD2 B;  1VK0 A;  2NNW A;  3AVA A;  4CK2 A;  3MMV A;  5CZ1 A;  4BC5 A;  4H8K A;  1ZBF A;  4JN4 A;  1M90 O;  3TTD A;  5GAD P;  3V9S A;  3K0S A;  5LJV A;  4E89 A;  1C0T A;  2XY8 A;  3DI6 A;  4O8U A;  4FYD A;  1QSS A;  4WYB A;  1RTH A;  3WXK A;  3U3G A;  4W5N A;  1WSE A;  3VA0 A;  2HOE A;  2HNZ A;  3LPU A;  4FJG A;  4K43 A;  1X1P A;  4BQZ A;  2HB5 A;  3QBW A;  3P83 D;  4JKA A;  4IO8 A;  2A42 A;  1QZ6 A;  3HT3 A;  4BRP A;  1KVA A;  3TAB A;  3PO5 A;  1X9S A;  1WSG A;  5FDL A;  2WUS A;  4EP5 A;  5EU7 A;  1YJ9 N;  1D8Y A;  4BWM A;  5ADX A;  3WQU A;  4A57 A;  3A8Y A;  3HVR A;  3NMU A;  1RNH A;  2KLA A;  3V9W A;  4CZJ A;  3SMP A;  1WB9 A;  2QI2 A;  2Q97 A;  3AVF A;  3ISN C;  3DXM B;  3F9K A;  4WFA L;  4DCH A;  3KK7 A;  4K8Z A;  3I33 A;  4LH5 A;  5I3U A;  1NMD A;  2HF4 A;  2P9K A;  4IFE A;  5C24 A;  3BUZ B;  5KGW A;  2FC0 A;  1UA1 A;  3VEV A;  3LP1 A;  4JKE A;  3UB5 A;  1XHX A;  3O1W A;  2KKZ A;  3O9R A;  5HL7 L;  3MN9 A;  3FZM A;  4BGA A;  4CZE A;  1S1X A;  3KLF A;  4KI6 A;  5KI6 A;  3EKU A;  1WSH A;  3K58 A;  1HJR A;  3DOK A;  2P9S B;  3FFI A;  5FLX O;  2EX3 A;  3LL3 A;  5HLF A;  4C8K A;  1TAQ A;  1QSL A;  4B1V A;  3AY9 A;  1UOC A;  3D2F A;  3VQC A;  3SAG A;  3WXJ A;  3H1Q A;  4B9V A;  2VYP A;  2HMI A;  4DU3 A;  2RN2 A;  3EEQ A;  3HK2 A;  3O80 A;  1S72 N;  4F9O A;  2E20 A;  4LFC K;  5DM6 L;  3IUC A;  1YIT N;  4Y0W A;  4DQR A;  4ISG A;  3OTO K;  5J1E A;  2ZWH A;  3RR7 A;  3L2W A;  4BRK A;  4FJJ A;  1ATN A;  2NUB A;  3SCX A;  4HUG A;  3KHY A;  3U9Z A;  3EE9 A;  3ENO A;  3LPT A;  4GMJ B;  4JI2 K;  5LJW A;  2ZJP L;  3I0R A;  4CEF A;  5BPM A;  3TAE A;  1ILY A;  4K42 A;  3ULD A;  3LAM A;  2OZM A;  4FXD A;  5AJ3 K;  3CCQ N;  3VQ5 A;  2QWN A;  4Q5V A;  2YJE A;  3VQ8 A;  4IZ9 A;  3O8M A;  4BGB A;  2A41 A;  3QIO A;  4CD3 A;  3DRR A;  2ZJQ L;  3MED A;  1KAY A;  1WNS A;  1K9M O;  3VET A;  4RW7 A;  4FWS A;  1NNE A;  1KAX A;  4CJK A;  3KLG A;  3G6E N;  4N56 A;  4W5Q A;  2DFH A;  4AHC A;  3OYI A;  2UUB K;  4A62 A;  3QER A;  5HRS A;  1EP4 A;  1ZBS A;  1TKD A;  4B9M A;  3V6D A;  4DSE A;  1RDB A;  2ASM A;  5F1X A;  1NMN A;  3TSU A;  1NGH A;  1W97 L;  1RT7 A;  1SZ2 A;  4FZX C;  1HNI A;  5EY4 A;  3NBP A;  3RVC A;  4BR7 A;  2QXF A;  3DMJ A;  4PKI A;  2UUC K;  3AA5 X;  2O8F B;  4MFB A;  3U3Y A;  2V7Z A;  2NZT A;  3ZSY A;  4CJQ A;  2HST A;  5CHI A;  4Z4G A;  2HMP A;  1RCH A;  5GAE P;  2ITM A;  2FF6 A;  2ITG A;  1TAU A;  2JLE A;  1R0A A;  1Z26 A;  2HVI A;  2P9U B;  4B9S A;  1HR0 K;  1YF5 L;  5EXW A;  4Z0U A;  3TSP A;  1T3V A;  4JKH A;  3O3H A;  3ATV A;  2Y1J A;  5AQR A;  5AZJ A;  1KXP A;  4FWP A;  3RSE B;  1TYQ B;  3CIP A;  1XI1 A;  3O1B A;  2EHG A;  2FLO A;  3NFA A;  5HBM A;  4YDU A;  1TL3 A;  1C0M A;  3J8A A;  4J2A A;  4JRP A;  1ZC6 A;  4WF9 L;  1BL3 A;  3PUF A;  4HCB A;  1KFD A;  2HHS A;  4H0P A;  1CXQ A;  1Q18 A;  3AVM A;  3OYE A;  2W40 A;  3L4I A;  2QKK A;  3LAL A;  1GLJ O;  3MCP A;  4BVP A;  4RW4 A;  4DV5 K;  1W2B M;  5BRE A;  2GWJ A;  1IBL K;  4ZTF A;  2BH1 A;  3MN7 A;  4I6M A;  3VPZ A;  3V4I A;  3NGZ A;  4DSI A;  2D0B A;  3MWP A;  3DLL L;  3SJJ A;  2E88 A;  1S3X A;  4CIE A;  1RBU A;  1LWF A;  4I7F A;  3A0I X;  2GX9 A;  2BAN A;  3WXI A;  4KPY A;  2YV0 X;  3RTV A;  2VG7 A;  3SAF A;  4BRM A;  1QVG M;  1OVY A;  1RDA A;  3CET A;  5I9E B;  3T1Y K;  2G8W A;  1A5X A;  4DQI A;  2HBM A;  1VQ4 N;  1XWL A;  4M3Z A;  1IH7 A;  3VN5 A;  3QML A;  3QET A;  4A59 A;  3D7E O;  2FBT A;  2NRZ A;  2HHV A;  5J2P A;  3DLK A;  2XO7 A;  1EWR A;  1RDC A;  3CJ1 A;  3ZLJ A;  3KLH A;  4YDU C;  2Z1G A;  3ASM A;  1X3M A;  4CBU A;  4H03 B;  4LF8 K;  3VTH A;  2VGM A;  4K8X A;  3T1A A;  3KKR A;  2YKN A;  1YUW A;  4WQ4 A;  3QFP A;  1JL1 A;  2YNI A;  5GIO A;  4FWQ A;  4H5R A;  2Q36 A;  4DV4 K;  4NYN A;  2O4I A;  2AP1 A;  4BR4 A;  3QIP A;  4LSL A;  4HTU A;  4ELV A;  3C65 A;  3SZ2 A;  3IMX A;  1TUY A;  2QWM A;  4FK2 A;  3M8Q A;  4BR0 A;  1Q86 O;  5FPM A;  2Z1J A;  5JVG L;  1I94 K;  1KD1 O;  2NRX A;  4ISF A;  2P9K B;  1L3U A;  4CFC A;  3QIN A;  2ASP A;  2OPR A;  4HTL A;  4B9N A;  4FZZ A;  4Z4H A;  4FJ9 A;  1VQ5 N;  4MO4 A;  2ZF5 O;  4R79 A;  1WSI A;  4YNQ A;  3Q7B A;  5BPL A;  4DTO A;  1SQK A;  3GDQ A;  4BG8 A;  3LDO A;  1RTD A;  3AAP A;  1X9W A;  5KQ8 A;  1NK4 A;  2IIR A;  1VSD A;  4A2B A;  4J2E A;  3OS0 A;  4BQL A;  1NK0 A;  2GTD A;  4IXC A;  4O5F A;  1DTQ A;  1U4B A;  2G8V A;  3ZX3 A;  2QTD A;  1WBB A;  2D5R A;  4WQ4 C;  4JK7 A;  3DLE A;  1JCF A;  4ILH A;  4M3Y A;  4DFJ A;  5CYM A;  3SUQ A;  3U6F A;  4UY8 O;  4ILJ A;  3UIQ A;  2Q2R A;  3N4P A;  4Y1C A;  4KH5 A;  5AQK A;  3JAM O;  2FSJ A;  3V9Z A;  4WFN L;  3KJV A;  4FLV A;  3TR8 A;  1OH8 A;  3O4Q A;  4H0X B;  2WTU A;  2Y1I A;  4CK1 A;  2NRW A;  1EXQ A;  4EHU A;  2NRT A;  4JI0 K;  4B1Z A;  3OY9 A;  1RIL A;  1WOQ A;  4CJ4 A;  2QWQ A;  4ID1 A;  1NWK A;  4FK0 A;  4YOV A;  3LP3 A;  1QTM A;  2VWB A;  3RR8 A;  4RTF D;  1N6Q A;  4IOA L;  4GV3 A;  3ENB A;  1YAG A;  4CEA A;  4A61 A;  3S9H A;  3MX2 A;  4CJR A;  4DV0 K;  5LY3 A;  3ZSQ A;  4DF8 A;  3HJF A;  3P38 A;  1VSL A;  1DGK N;  2E2P A;  3E66 A;  1UWB A;  4GVE A;  4WE1 A;  4HHT A;  4DQQ A;  4EIA A;  5D3G A;  4CHY A;  3C6H A;  4DF4 A;  1L3T A;  3CFO A;  1JCG A;  3CPW M;  5AQI A;  1GLB G;  2B6A A;  5KPZ A;  2X74 A;  1HMV A;  1XQS C;  1NGE A;  5T7B A;  4X64 K;  3SNN A;  3THY B;  1IKX A;  1D9D A;  2Q31 A;  4LC9 B;  3OW2 M;  5IWA K;  4JHD A;  4Z4I A;  3NF8 A;  3AO5 A;  4OLA A;  1BA0 A;  2B5J A;  4DSK A;  4B8C A;  4BRF A;  4PY5 A;  1RT3 A;  3VER A;  4LSN A;  1KQS M;  3HVT A;  3MCA B;  5AQN A;  4CJS A;  4JYA K;  2YCH A;  3DRS A;  4FOE A;  5AZJ B;  1FXX A;  1N32 K;  3NAE A;  2G8H A;  1HQU A;  1LWE A;  4AH9 A;  1SKW A;  4OLB A;  1HKB A;  3H6E A;  3VMF B;  4ZHR A;  4BRN A;  3NVK A;  3CD6 N;  1YJW N;  3VQ7 A;  4FLU A;  5F0X A;  3IKM A;  2HBL A;  3R9P A;  3QIC A;  3QEV A;  3D45 A;  4LF6 K;  3GG4 A;  3FZL A;  1ZYQ A;  1D9F A;  3LDP A;  1EQY A;  5A2Q O;  3O9T A;  1Z25 A;  4I6M B;  5MLC Q;  1BIS A;  3WNE A;  4ISE A;  1TK5 A;  2O8D B;  3P31 A;  3GE1 A;  3P4I A;  4PL7 A;  5DM7 L;  4GKK K;  5CR4 A;  3WNF A;  3O08 A;  3AVK A;  1J5O A;  3CCR N;  3VQE A;  3BF3 A;  4HCC A;  1WUA A;  4DTN A;  1RDD A;  4FJH A;  3CFP A;  1TK0 A;  1QE1 A;  1E4G T;  1C1C A;  3NGI A;  1REV A;  1HQE A;  3AVG A;  3V9U A;  1HNX K;  3EN9 A;  4H4M A;  1T8E A;  1IG9 A;  4B08 A;  3VEN A;  1VQN N;  2YNG A;  5C10 A;  1ATS A;  4FW1 A;  2WFB A;  3C6T A;  1TUU A;  1RT4 A;  3TAP A;  3CF5 L;  1J53 A;  4CZG A;  2HHT A;  1GLA G;  4DFP A;  3VF4 A;  1ZBU A;  1U49 A;  4CGJ A;  4PKG A;  4N76 A;  1NBW A;  1C0U A;  1ESV A;  1FW6 A;  3EL2 A;  4B8A B;  2FF3 B;  3ZSV A;  1Q9Y A;  4KRF A;  4FL9 A;  1BIU A;  1QZ5 A;  2CGJ A;  2F4V K;  1ZBH A;  3MXJ A;  4L8R B;  1IG8 A;  4KTZ A;  3QEX A;  2E6M A;  3PSI A;  4QS7 A;  3E9P A;  3A5L C;  1WAF A;  1IV0 A;  4UQG A;  2OAN A;  1Q9X A;  4M45 A;  3FGU A;  4CGD A;  4LH4 A;  3UKR A;  3VQQ A;  1K8A O;  1NJW A;  3HST B;  1NGC A;  1SS6 A;  2P9N A;  3ZT2 A;  3G0Z A;  4DV3 K;  3WXL A;  3R1X A;  4AHT A;  4A2A A;  3VQD A;  4CEZ A;  3OYB A;  1O1W A;  4CEQ A;  3HSC A;  3K59 A;  1N36 K;  1DLO A;  5JS1 A;  1JLE A;  4I2Q A;  3Q7C A;  1CXU A;  3C95 A;  3BDP A;  1Z05 A;  3I8D A;  2KZM A;  4FJK A;  3HP9 A;  4FWR A;  4RW6 A;  1ATR A;  2YKM A;  3BEX A;  4F3O A;  3RMC A;  1EWQ A;  1BDG A;  4CER A;  5AQG A;  3ZT0 A;  2I7P A;  1BO5 O;  4CF8 A;  1S9E A;  3ZSZ A;  4BC4 A;  3VEW A;  3LZJ A;  3BGR A;  2HW3 A;  5FRM A;  1Q8I A;  2A40 A;  1NGJ A;  1RT5 A;  3VQ9 A;  3KKS A;  5KQD A;  1P8Z A;  2QWP A;  3SPY A;  1SUQ A;  4DTP A;  2D4W A;  4IFV A;  4YOX A;  3QB0 A;  1RTI A;  3AO3 A;  3IG1 A;  5BN8 A;  4IBN A;  3U9D A;  4DTU A;  2YHX A;  2YJF A;  2P9L A;  5AFU A;  2P9P A;  4NXM K;  4LF4 K;  3CCJ N;  3QNO A;  4ELU A;  5GAG P;  4CGF A;  3F5T A;  2O8E B;  1V4T A;  3VEO A;  1QQM A;  3BZC A;  3OHR A;  4OVL A;  4E3S A;  4E7I A;  4CZK A;  2IGI A;  3A2F A;  4C1N K;  4NCA A;  1TK8 A;  4H5W A;  3EY1 A;  3OYD A;  1DKG D;  4FLW A;  5FPE A;  1KLN A;  3WQT A;  4LF7 K;  3HBT A;  3AAR A;  4IDH A;  5SZT A;  2XHB A;  3A5O C;  5E84 A;  3HL8 A;  3SAH A;  1YI2 N;  4F4K A;  5KTQ A;  1H1V A;  3L3U A;  4KHS A;  1F21 A;  5KGX A;  4M3U A;  4BY9 C;  2AA4 A;  2GUP A;  5JVH L;  4KB0 A;  4FJX A;  3BZK A;  1WSJ A;  2G8U A;  5AQO A;  4BE2 A;  1GLC G;  4PA1 A;  3NCI A;  5AQW A;  1VSH A;  3TAN A;  4BRQ A;  4MO5 A;  3I56 N;  4FW2 A;  4M3W A;  2KFN A;  1A5W A;  2HHH K;  3IRX A;  4BDP A;  2ETJ A;  4NLC A;  3A5M C;  4JHD B;  1B9F A;  3WNH A;  3UE5 A;  2YX6 A;  4IOX A;  5EVZ A;  2P9I A;  1NM1 A;  4O55 A;  2DY4 A;  4O5B A;  4BRL A;  4JI4 K;  5AQU A;  3IS9 A;  2E2Q A;  3BF1 A;  3AVC A;  3CJC A;  4B9L A;  1RGI A;  1S6P A;  2QK9 A;  4JKG A;  5BN9 A;  4C8M A;  1O13 A;  3O5B A;  3I8B A;  3AAQ A;  1ZXO A;  4IDK A;  2GUI A;  4CCH A;  2VWJ A;  4XIU A;  3O3F A;  1JLC A;  1C1B A;  2IS3 A;  1YVN A;  4JKC A;  1NGB A;  4BRO A;  4N41 A;  2WOM A;  3TSQ A;  3M5R A;  4CJT A;  4CJ7 A;  2DTU A;  1U47 A;  1K73 O;  1L5U A;  3SPZ A;  4NB4 A;  1TVR A;  1QQC A;  3RRH A;  3ZET A;  2VG6 A;  1HNV A;  3PX0 A;  1RBR A;  3G10 A;  1NK7 A;  2HBK A;  3OYK A;  3L2R A;  1K8K A;  3OYM A;  1KFS A;  3WNG A;  4QS8 A;  1KC8 O;  1IBK K;  1BG3 A;  4DTR A;  3SUN A;  1EKE A;  3RRG A;  3OA9 A;  1XNR K;  2O8C A;  3CI5 A;  3HM8 A;  3QO9 A;  1HYS A;  3C94 A;  2JWK A;  3CHW A;  1CLQ A;  3NH2 A;  1G15 A;  3KWI A;  4EFH A;  4JK8 A;  2IAJ A;  3KLE A;  4MDA A;  5GAH P;  1NJZ A;  4CF9 A;  3N4Q A;  3SQ1 A;  2YHY A;  4AHS A;  4O0J A;  3CCE N;  4QS9 A;  3J81 O;  4IFY A;  4DFM A;  4CJ3 A;  3MEG A;  5GIP A;  4KRE A;  4J2D A;  4OKE A;  4CF1 A;  4G9Z A;  3CYM A;  1BUP A;  5AQZ A;  3GOI A;  3V1R A;  3K5M A;  4F3T A;  2RF2 A;  1LAW A;  2O8B A;  2GBZ A;  1IBM K;  3LDS A;  4CGI A;  2Q3S A;  2YNH A;  3B6O A;  3M6G A;  5AQY A;  4CJP A;  2JGU A;  3U4L A;  3AO2 A;  1NGD A;  1T7P A;  5AZI A;  3K5N A;  4Z4C A;  3ZX2 A;  4RCH A;  3OYA A;  2Z1I A;  1NJX A;  3UKR B;  4JS4 A;  2R7Y A;  4U7B A;  1HKG A;  4HUE A;  3FZK A;  3TAG A;  1BIZ A;  2P9N B;  1NOY A;  4QOZ B;  1BI4 A;  3AA3 A;  3RMB A;  4OGC A;  3DRP A;  4GVM A;  3MN6 A;  2E6L A;  1NU0 A;  3VQA A;  3DXK A;  4I2P A;  5KRS A;  3L4Q A;  3K9K A;  3M8S A;  3NF7 A;  1X9J A;  2YHB A;  3DLB A;  1VRU A;  5M1P A;  4M3T A;  4JI7 K;  5J2M A;  3MXM A;  1S1V A;  5TKW A;  1QHT A;  4QCL A;  3OJU A;  4GW6 A;  5M1K A;  3HM9 A;  2A5X A;  5JMV A;  1VQ6 N;  4KHN A;  4YOW A;  3GL1 A;  1MDU B;  3THV A;  2UXC K;  2E2O A;  3VES A;  4OPJ A;  4CK3 A;  4DV2 K;  3C6U A;  2IDO A;  4PKH A;  3FFK B;  5GIN A;  3PX4 A;  2E8A A;  2DFE A;  3SJH A;  4B3M K;  1VSE A;  4DWI A;  4AM7 A;  3O9S A;  3HPG A;  3ZT1 A;  5KPT A;  5FRO A;  1XMO K;  2HF3 A;  1WSF A;  1SAZ A;  3CPE A;  1IKY A;  3WUH A;  2X6S A;  3TWH A;  1NKB A;  1LCU A;  3OYH A;  3DLR A;  2JWL A;  4DQ8 A;  3TTF A;  2F9W A;  4DLG A;  4IEI A;  3C6A A;  1HPM A;  2P9L B;  4YOY A;  2KQ2 A;  1RBT A;  3CQX A;  4JV5 K;  1WBD A;  2BDP A;  4AM6 A;  1HX1 A;  4E1M A;  2ZM6 K;  1VQ9 N;  1CZ9 A;  4EZ6 A;  4A5A A;  1HKC A;  3CFR A;  3D2F B;  3HO1 A;  2KZZ A;  2AJQ A;  3WT0 A;  3G4S N;  1DTT A;  4BRD A;  4CZF A;  4BR2 A;  2OPS A;  3BY5 A;  1RBS A;  4DUZ K;  3UKU A;  4OKJ A;  4B3T K;  1HNW K;  4ELT A;  2DPN A;  4KHP K;  4Y1D A;  1ASU A;  2W6K A;  3CC2 N;  2D0O A;  4BVO A;  3RMA A;  4IG0 A;  4WCE L;  3R3L A;  2NRH A;  3FZF A;  2ZD1 A;  4CBW A;  3CJB A;  4DTS A;  4KHQ A;  1K6Y A;  4CJV A;  4DR4 K;  4FVM A;  2FSN A;  1SL1 A;  4CHO A;  3SUO A;  3NF6 A;  5ELZ A;  5AQH A;  4KH4 A;  3J7Z O;  5ADX H;  5TKY A;  4JRQ A;  2XY7 A;  5E26 A;  1CZA N;  4FCY A;  1Q7Y O;  1BCO A;  3AV9 A;  1QQO A;  3G25 A;  4MQ3 A;  4W5R A;  4DR2 K;  4FJM A;  1W9H A;  1B9D A;  3SQ2 A;  1Q82 O;  1I39 A;  4KHW A;  4ID5 A;  4H0T B;  1UA0 A;  3JS6 A;  5I42 A;  4CJW A;  3P5J A;  4JKG B;  4JKB A;  1A5V A;  1HYV A;  4KTW A;  1OH5 A;  4PQU A;  2P9S A;  4CW7 B;  2I5J A;  1VQK N;  5C25 A;  4AHU A;  2ZJR L;  3RMD A;  2YI1 A;  4JEP A;  4XH4 A;  4FWM A;  3SI6 A;  1NK9 A;  1EO1 A;  3OBW A;  3CER A;  1JCE A;  3DJC A;  4CGH A;  3QLH A;  4CEB A;  4DSL A;  1C6V A;  4E7K A;  3O3G A;  2X6N A;  2BUP A;  4J8F A;  3L0Q A;  4CES A;  3ZET B;  4CGG A;  4B1Y B;  4EAH D;  3SMS A;  1K8K B;  2UXD K;  3HP6 A;  4DQS A;  4NCG A;  3CCU N;  1WN7 A;  3HPO A;  3ATU A;  1ITG A;  3THX A;  3A5N C;  3ZT3 A;  1GOA A;  4AHV A;  2O8C B;  3OS2 A;  5AQM A;  3CG7 A;  4TSX A;  1J54 A;  4BWJ A;  2IVP A;  1TGO A;  3M8R A;  1NOZ A;  2PZS A;  3VGM A;  2YHW A;  2OYQ A;  4WFB L;  1JJ2 M;  2IC3 A;  3SLC A;  4JS5 A;  4M3R A;  4GV9 A;  4CZL A;  4CED A;  4CJU A;  4OJR A;  1KVB A;  5EOY A;  1ZBI A;  3VA3 A;  1OH6 A;  4LFB K;  4CI6 A;  4C23 A;  5AQF A;  1JL2 A;  5HRR A;  4FJ8 A;  4DQP A;  1NK8 A;  4CHQ A;  3T1H K;  5CE3 A;  4Q0B A;  4FLY A;  3DAW A;  5AQJ A;  4B3O A;  4JAX A;  3VEY A;  4OPK A;  1BOT O;  3TPQ A;  1VSJ A;  3EZ5 A;  1KSP A;  5C0Y A;  1N8R O;  5B8H A;  2O8B B;  2PYJ A;  3VGL A;  4DKW A;  5JLH A;  4M7Y A;  2E2N A;  1N34 K;  1NGG A;  3HPH A;  2OCE A;  4BRH A;  5AQT A;  4DR5 K;  4KV8 A;  3EYZ A;  4IWV A;  4KAZ A;  5AZI B;  2HHX A;  2IOC A;  3O9Q A;  3VEZ A;  3KK3 A;  4FJI A;  3WXM B;  1JXE A;  4BRE A;  2O8F A;  4BC2 A;  4BR9 A;  4O0I A;  3D2E A;  1YTU A;  1VQL N;  4OGE A;  3I55 N;  3DOL A;  3F73 A;  4H5N A;  4FK4 A;  1GLD G;  1M1K O;  4DTM A;  1MA9 B;  4HWI A;  1JLQ A;  4LF9 K;  3SBG A;  2XRI A;  3DXK B;  4B9U A;  2DFF A;  1NJI O;  1ASW A;  3CME N;  3RSE A;  2GEL A;  5AR0 A;  1GLF O;  1TYQ A;  5HP1 A;  4X66 K;  4CJE A;  3AGK A;  4JKF A;  4CJF A;  2VQF K;  4DU4 A;  3S3O A;  1HRH A;  3DLH A;  3K57 A;  5BRF A;  3F2K A;  1T05 A;  1RBV A;  4DR3 K;  4FJN A;  4AIL C;  1V4S A;  2NLX A;  4JNE A;  3VF6 A;  2OA8 A;  4KH6 A;  2F8T A;  4FJ5 A;  2PAV A;  4Z94 A;  4MLH A;  2QKB A;  1RT6 A;  4JI3 K;  5JIC A;  3PLA A;  3W0L A;  4NXN K;  4BR5 A;  3ZEU A;  1E3M A;  3ALY A;  3VF2 A;  4DSJ A;  4FM2 A;  1S5J A;  4DR1 K;  4RG8 A;  1NLV A;  2E5L K;  1U2V A;  2F9T A;  1FJG K;  2HNY A;  2VWK A;  3KK1 A;  4Z4E A;  1BQM A;  3JXU A;  3QFU A;  4B3S K;  4CJL A;  2E4L A;  4BRC A;  4FWL A;  3HOS A;  1JKH A;  1E4F T;  2HBJ A;  4KI4 A;  4CFB A;  3LZI A;  1BQN A;  2GEM A;  3HTV A;  4DUY K;  2OPQ A;  4LFA K;  3LDQ A;  1RT1 A;  1S6Q A;  5LMN K;  2GV9 A;  3M1F A;  3K9J A;  3AVI A;  1QHA A;  3CCV N;  2VCP A;  3CM6 A;  4IJN A;  4E7H A;  1X9M A;  3UKU B;  4CEC A;  1VSM A;  2F96 A;  4KTQ A;  3QBX A;  4CFA A;  3PIP L;  1RDU A;  4W5O A;  1SKR A;  4XEI A;  3GBT A;  2HND A;  5KRT A;  1SL2 A;  3PV8 A;  3VQP A;  1D5A A;  4FOI A;  2OTJ N;  3KK2 A;  2KTQ A;  1T03 A;  1HLU A;  2Q0R A;  1QQN A;  3AO1 A;  4YOU A;  1Y97 A;  1JLG A;  4B1X B;  2RHK A;  1U6Z A;  2Q1N A;  4KHY A;  4O4G A;  3ID6 A;  3QNN A;  4FPB A;  1U04 A;  1JLB A;  1BCM A;  4BE1 A;  3VQB A;  4M42 A;  1J5E K;  5KPR A;  2BGG A;  4FVU A;  4FWK A;  3S41 A;  2W41 A;  4RW8 A;  4KFB A;  5M1Q A;  4QAG A;  3WEE A;  4JI1 K;  3I0S A;  2KHO A;  3V1O A;  2P51 A;  1B92 A;  4N5S A;  1Y64 A;  4B9Q A;  4EZ9 A;  3V9X A;  3L6Q A;  1IKW A;  5AQX A;  1TKZ A;  4YY3 K;  3OYF A;  3FE1 A;  4IOC L;  3LDN A;  4CZH A;  3H45 C;  3MWT A;  1TL1 A;  2H3G X;  4BE0 A;  3TTC A;  5AQQ A;  3KIO A;  3H08 A;  3L3V A;  3THW A;  3ZSW A;  3SQ0 A;  3P39 A;  4K0K K;  4MLE A;  4KKO A;  2G8K A;  1QS4 A;  1W7A A;  1C1A A;  1YIJ N;  3NH1 A;  4BRG A;  3H3O B;  1MWK A;  3C7N A;  1N33 K;  4FWO A;  4CBX A;  4BAC A;  1TKX A;  4DV1 K;  1VSF A;  3THX B;  1XC9 A;  5C42 A;  2PFU A;  4DLE A;  1S22 A;  4CHZ A;  3DLG A;  3JSM A;  3FR0 A;  3MN5 A;  4RWT A;  3QEI A;  4BG9 A;  4HUF A;  2QWO A;  3ID8 A;  4DTX A;  1NK5 A;  2OZS A;  4DS5 A;  4JI6 K;  2D0P A;  1R59 O;  3E9O A;  3EO3 A;  5FRN A;  1LV5 A;  5DMR A;  1HPZ A;  4O44 A;  3ZSO A;  3S3M A;  2A6A A;  1FKP A;  4BDZ A;  4FJL A;  2FBY A;  4H5V A;  3NH0 A;  1Z6R A;  3D0P A;  1BHL A;  4FZY A;  3TAQ A;  3DM2 A;  4PWD A;  4E1J A;  3T3F A;  3E01 A;  5J2N A;  2WBN A;  4CIG A;  2FBX A;  2A3Z A;  2ATQ A;  3CCL N;  3VGK A;  4DMN A;  2QW9 A;  2HHU A;  1LW2 A;  5DK5 A;  4PL8 A;  4WQ5 A;  5K14 A;  3OBY A;  2W6L A;  2CGK A;  4K25 A;  1JXB A;  1RFQ A;  4DG1 A;  3BP8 A;  4FLZ A;  3L8B A;  3EE8 A;  3O9U A;  3LDL A;  4CEO A;  3KD5 E;  3H1V X;  3MDQ A;  4H0Y B;  5FPN A;  1DT9 A;  3OYG A;  5J2Q A;  3ULE A;  3THY A;  5AQS A;  1D4X A;  2Q0U A;  3LP0 A;  3KVG A;  3KZB A;  3CC7 N;  4M7X A;  3LP2 A;  4XH1 A;  2VQE K;  2XY5 A;  4DR6 K;  5M1O A;  1T6C A;  4I9Q A;  5E41 A;  5IT9 O;  3D2E B;  1UAX A;  2HHQ A;  4XH5 A;  3NF9 A;  4DR7 K;  1T44 A;  5JS2 A;  4BRI A;  5M1N A;  3CCS N;  4C1N I;  4E7J A;  2P5G A;  3LM9 A;  1OH7 A;  5HRN A;  4BC3 A;  3TAM A;  2OPP A;  1HNZ K;  1GLE G;  4N47 A;  2X78 A;  5LMU K;  4OO1 J;  1T6D A;  4L3Q A;  3D6R A;  3S3N A; 
#chains in the Genus database with same CATH homology
 3VQE A;  3K58 A;  1HJR A;  3DOK A;  4HCC A;  2ZD1 A;  3FFI A;  4DTN A;  5HRO A;  3MEC A;  1RDD A;  4FJH A;  3CFP A;  1TK0 A;  2EX3 A;  4DTS A;  4KHQ A;  2KFZ A;  1QE1 A;  1C1C A;  1K6Y A;  4CJV A;  1REV A;  3NGI A;  5HLF A;  4C8K A;  4KI6 A;  1U48 A;  4FVM A;  3LWM A;  1TAQ A;  1QSL A;  1SL1 A;  4CHO A;  1HQE A;  3AVG A;  1UOC A;  4DSF A;  3SUO A;  3AA4 A;  3NF6 A;  3VQC A;  3V9U A;  4H4M A;  3OYL A;  1T8E A;  1IG9 A;  3QEW A;  4JRQ A;  4B08 A;  2XY7 A;  4B9V A;  2YNG A;  4FCY A;  2HMI A;  4CHN A;  4DU3 A;  3TI0 A;  2RN2 A;  1BCO A;  3HK2 A;  4FW1 A;  3AV9 A;  3C6T A;  3VQ6 A;  1RT4 A;  3TAP A;  2F8S A;  4MQ3 A;  4W5R A;  1J53 A;  4FJM A;  1W9H A;  2HHT A;  1B9D A;  2VG5 A;  4DFP A;  4DQR A;  3SQ2 A;  5J1E A;  1I39 A;  3AVB A;  4KHW A;  1ZBU A;  4ID5 A;  4CEE A;  4CGJ A;  4CFD A;  3L2W A;  3RMA A;  1U49 A;  3RR7 A;  4N76 A;  1UA0 A;  1C0U A;  2YNF A;  5CYQ A;  5I42 A;  4FJJ A;  2NUB A;  4CJW A;  3SCX A;  4HCB A;  3P5J A;  4B8A B;  3ZSV A;  1Q9Y A;  4HUG A;  4KRF A;  1A5V A;  1HYV A;  4KTW A;  4DS4 A;  4PQU A;  2I5J A;  3LPT A;  5C25 A;  4GMJ B;  4AHU A;  3RMD A;  1BIU A;  3L2V A;  4FM1 A;  3I0R A;  4CEF A;  1ZBH A;  3MXJ A;  1VRT A;  3TAE A;  4L8R B;  3KLI A;  2D0C A;  3ULD A;  4KTZ A;  3QEX A;  3LAM A;  2E6M A;  3T19 A;  2OZM A;  3SI6 A;  3RWU A;  1NK9 A;  3AVH A;  2P5O A;  4FXD A;  1KLM A;  3JYT A;  4CGH A;  3SYZ A;  1WAF A;  3VQ5 A;  3AO4 A;  3QLH A;  4Q5V A;  4CEB A;  4UQG A;  1Q9X A;  4DSL A;  3VQ8 A;  1C6V A;  4M45 A;  3KLF A;  4E7K A;  3O3G A;  2X6N A;  3QIO A;  4E7L A;  3ZSX A;  3DRR A;  3MED A;  4OKK A;  4CGD A;  4R5P A;  4CES A;  3VQ4 A;  4LH4 A;  5HRP A;  4CGG A;  1WNS A;  3VQQ A;  3ZT4 A;  1NJW A;  3HST B;  4RW7 A;  3NE6 A;  4F2R A;  3O4N A;  3ZT2 A;  3G0Z A;  4CJK A;  3PO4 A;  4CEZ A;  4AHT A;  3VQD A;  3OYB A;  3L2Q A;  3HP6 A;  4DQS A;  1O1W A;  4NCG A;  3KLG A;  1BGX T;  1WN7 A;  2O4G A;  1RTJ A;  4CEQ A;  4CIF A;  3HPO A;  4N56 A;  1ITG A;  4W5Q A;  2DFH A;  3K59 A;  3ZT3 A;  4FLX A;  1GOA A;  1DLO A;  3LAN A;  4AHV A;  4AHC A;  3OS2 A;  3OYI A;  5JS1 A;  1JLE A;  2Z1H A;  2A1S A;  4DFK A;  3QER A;  3ITH A;  5HRS A;  2XY6 A;  3CG7 A;  4I2Q A;  1CXU A;  3C95 A;  4TSX A;  3BDP A;  4FM0 A;  1EP4 A;  2A1R A;  1J54 A;  4M41 A;  1TKD A;  3I8D A;  4BWJ A;  2YHA A;  4DSE A;  3V6D A;  4B9M A;  2KZM A;  1RDB A;  1TGO A;  4FJK A;  3HP9 A;  3M8R A;  1NOZ A;  2PZS A;  4RW6 A;  2YKM A;  3PY8 A;  2OYQ A;  3L2U A;  2IC3 A;  4F3O A;  3RMC A;  4CER A;  4JS5 A;  4M3R A;  1RT7 A;  3ZT0 A;  4CED A;  4FZX C;  1GOB A;  1YT3 A;  1HNI A;  1HYZ A;  2G8W A;  4DQI A;  4CJU A;  3NBP A;  1KVB A;  4OJR A;  1S9E A;  4CF8 A;  2QXF A;  3NGY A;  1ZBI A;  3DMJ A;  3NHG A;  3VA3 A;  3CQ8 A;  3ZSZ A;  3AA5 X;  1NKC A;  1LWC A;  1VSK A;  4MFB A;  3U3Y A;  3LZJ A;  3BGR A;  2HW3 A;  1JL2 A;  5HRR A;  4W5T A;  4FJ8 A;  4DQP A;  1Q8I A;  1YTA A;  3ZSY A;  4CJQ A;  3NDK A;  1NK8 A;  4CHQ A;  5FRM A;  4Z4G A;  1RCH A;  1RT5 A;  3VQ9 A;  1NK6 A;  2ITG A;  4Q0B A;  4FLY A;  1TAU A;  2JLE A;  3KKS A;  4B3O A;  4OPK A;  1R0A A;  1Z26 A;  2HVI A;  3SPY A;  3DYA A;  1SUQ A;  4DTP A;  3K5O A;  4IFV A;  4B9S A;  1VSJ A;  3EZ5 A;  1KSP A;  1RTI A;  3AO3 A;  4Z0U A;  1IKV A;  3IG1 A;  3V1Q A;  4YFU A;  3O3H A;  4I9L A;  2Y1J A;  1QSY A;  4BDY A;  2PYJ A;  4IBN A;  3OYC A;  4DTU A;  4ICL A;  1XI1 A;  2EHG A;  3HPH A;  3NFA A;  4RW9 A;  5HBM A;  4KV8 A;  1LW0 A;  1TL3 A;  3K5L A;  3EYZ A;  3QNO A;  1C0M A;  4ELU A;  1KCF A;  4CGF A;  4KAZ A;  4J2A A;  2HHX A;  2KW4 A;  2IOC A;  4JRP A;  1BL3 A;  1S1T A;  3PUF A;  3AVN A;  3KK3 A;  1KFD A;  4OVL A;  4E7I A;  1JXE A;  4E3S A;  3QES A;  4FJI A;  2HHS A;  1CXQ A;  2IGI A;  3AVM A;  3A2F A;  3OYE A;  2QKK A;  4O0I A;  4J2B A;  3LAL A;  1YTU A;  1EET A;  4NCA A;  4RW4 A;  3EY1 A;  1TK8 A;  3OYD A;  4OGE A;  3HXM A;  3DOL A;  4CF2 A;  3F73 A;  4FLW A;  4FK4 A;  4ZTF A;  1KLN A;  4E19 A;  4DTM A;  3P1G A;  4DU1 A;  3V4I A;  1JLQ A;  5SZT A;  3NGZ A;  2XHB A;  4C8N A;  3HL8 A;  4DSI A;  2XRI A;  4F4K A;  2D0B A;  5KTQ A;  3ZCM A;  4B9U A;  2DFF A;  3SJJ A;  1ASW A;  4NCB A;  3L3U A;  1RBU A;  1LWF A;  2P1J A;  1F21 A;  4CIE A;  5KGX A;  4KHS A;  2RPI A;  4M3U A;  2HHW A;  4I7F A;  2BAN A;  1EX4 A;  5HP1 A;  4KB0 A;  2YV0 X;  4KPY A;  3RTV A;  3V81 A;  4FJX A;  2VG7 A;  1WSJ A;  4E1N A;  4CJE A;  1RDA A;  2G8U A;  4BE2 A;  4PA1 A;  1S1U A;  4CJF A;  1A5X A;  3NCI A;  4DU4 A;  3TAF A;  3MXI A;  1XWL A;  1VSH A;  3AVJ A;  3TAN A;  3S3O A;  1IH7 A;  1J5O A;  1HRH A;  4F2S A;  1ZBL A;  3DLH A;  4M3Z A;  3VN5 A;  3K57 A;  4M3W A;  4FW2 A;  1KTQ A;  4H4O A;  2KFN A;  3QET A;  1A5W A;  1L3V A;  3IRX A;  1T05 A;  4BDP A;  1RBV A;  2ETJ A;  2FBT A;  1MU2 A;  2HHV A;  5J2P A;  4FJN A;  4F8R A;  4AIL C;  1B9F A;  3WNH A;  1RT2 A;  3B6P A;  3DLK A;  4O55 A;  3OYJ A;  2DY4 A;  4AHR A;  2OA8 A;  4O5B A;  2F8T A;  2XO7 A;  4FJ5 A;  1RDC A;  3IS9 A;  3KLH A;  3LWL A;  4ZTJ A;  3AVC A;  2QKB A;  2PYL A;  1RT6 A;  2LSN A;  1JLA A;  2Z1G A;  3ASM A;  1WLJ A;  4B9L A;  1S6P A;  2QK9 A;  3AA2 A;  3SV4 A;  3ALY A;  4C8M A;  4K8X A;  4DSJ A;  4FM2 A;  1S5J A;  3T1A A;  3KKR A;  4RG8 A;  2YKN A;  3K2P A;  1W0H A;  4IDK A;  2HNY A;  2GUI A;  2VWK A;  4CE9 A;  4CCH A;  2VWJ A;  3KK1 A;  1NKE A;  4Z4E A;  1BQM A;  4CJL A;  1JL1 A;  2YNI A;  1JLC A;  2E4L A;  1C1B A;  4XIU A;  3O3F A;  2O4I A;  1CZB A;  4NYN A;  5CY4 A;  2G8F A;  2IS3 A;  1JKH A;  3QIP A;  4LSL A;  4HTU A;  4ELV A;  2ZE2 A;  4C8L A;  4IKF A;  3SZ2 A;  4N41 A;  4KI4 A;  2WOM A;  4CJT A;  4CFB A;  4FLT A;  3LZI A;  1BQN A;  1U47 A;  2DTU A;  2OPQ A;  3HYF A;  3SUP A;  4FK2 A;  1L5U A;  1RT1 A;  3M8Q A;  3SPZ A;  1S6Q A;  2Z1J A;  2GV9 A;  1TVR A;  1QQC A;  1IO2 A;  3RRH A;  2PY5 A;  4PUO A;  3AVI A;  4EP4 A;  2VG6 A;  4NYF A;  2W42 A;  1HNV A;  4KHU A;  3PX0 A;  1RBR A;  3G10 A;  1NK7 A;  3CM6 A;  1L3U A;  4CFC A;  3OYK A;  4E7H A;  3QIN A;  1X9M A;  4CF0 A;  3L2R A;  4CEC A;  1VSM A;  3OYM A;  1KFS A;  4KB1 A;  2F96 A;  2OPR A;  3WNG A;  4KTQ A;  1NJY A;  4B9N A;  4DTR A;  2BE2 A;  1SL0 A;  3SUN A;  3M8P A;  4M3X A;  1EKE A;  3RRG A;  3KD1 E;  4FZZ A;  4CFA A;  4Z4H A;  3KTQ A;  4FJ9 A;  3QO9 A;  1HYS A;  3C94 A;  4W5O A;  1CLQ A;  1SKR A;  3NH2 A;  2HVH A;  3ZSR A;  1WSI A;  1G15 A;  4YNQ A;  3OS1 A;  4E0D A;  3OJS A;  1XHZ A;  4DTO A;  5SWM A;  2HND A;  1RTD A;  1X9W A;  2IAJ A;  5KRT A;  1J9A A;  1SL2 A;  3KLE A;  3PV8 A;  3VQP A;  4Z4F A;  3MEE A;  2B4J A;  1D5A A;  4CF9 A;  1KVC A;  1VSD A;  1NK4 A;  3SQ1 A;  1NJZ A;  4CJ5 A;  3KK2 A;  2KTQ A;  4J2E A;  3OS0 A;  1T03 A;  4IG3 A;  3LAK A;  1NK0 A;  1N5Y A;  4AHS A;  1YVU A;  1SKS A;  1L3S A;  1S1W A;  1S9G A;  1DTQ A;  1U4B A;  2G8V A;  1LAV A;  4O0J A;  3AO1 A;  1Y97 A;  1JLG A;  1FKO A;  3CM5 A;  4JLH A;  2D5R A;  4KHY A;  4O4G A;  2G8I A;  3QNN A;  1U04 A;  1JLB A;  1BCM A;  4BE1 A;  3VQB A;  4IFY A;  4M42 A;  3DLE A;  4DFM A;  4CJ3 A;  4M3Y A;  4DFJ A;  2BGG A;  3MEG A;  5CYM A;  4KRE A;  3SUQ A;  4J2D A;  4OKE A;  3U6F A;  4LD0 A;  4RW8 A;  1JLF A;  4CF1 A;  4KFB A;  1FK9 A;  1BI4 B;  4QAG A;  3I0S A;  3CYM A;  3MAQ A;  2FBV A;  4F3T A;  3UIQ A;  3V1R A;  3K5M A;  1GOC A;  4Y1C A;  2RF2 A;  3V1O A;  2P51 A;  1LAW A;  2GBZ A;  4C8O A;  2ZQB A;  3V9Z A;  3KJV A;  3LDS A;  1B92 A;  2Q3S A;  4CGI A;  4N5S A;  2YNH A;  3B6O A;  3TR8 A;  1TKT A;  4FLV A;  4EZ9 A;  4CJP A;  4DTJ A;  3V9X A;  2JGU A;  3O4Q A;  1SV5 A;  1IKW A;  1TKZ A;  3IAY A;  5CZ2 A;  3OYF A;  2Y1I A;  3AO2 A;  4CK1 A;  1EXQ A;  1TV6 A;  4LY7 A;  1T7P A;  2RKI A;  1TL1 A;  3K5N A;  4BE0 A;  1WAJ A;  4Z4C A;  3KIO A;  3H08 A;  3L3V A;  2Z1I A;  1RIL A;  3OY9 A;  3OYN A;  4CJ4 A;  3OYA A;  1NJX A;  4ID1 A;  3OVN A;  3ZSW A;  4KO0 A;  4FK0 A;  3LP3 A;  3SQ0 A;  3PX6 A;  1QTM A;  4JS4 A;  1U45 A;  4KKO A;  2R7Y A;  3TAR A;  3RR8 A;  2G8K A;  3QEP A;  1QS4 A;  4HUE A;  4G1Q A;  1C1A A;  1N6Q A;  3TAG A;  1BIZ A;  3NH1 A;  1NOY A;  4QOZ B;  1BI4 A;  3AA3 A;  3RMB A;  1KRP A;  4OGC A;  3DRP A;  4CHP A;  4GVM A;  4CEA A;  2E6L A;  3S9H A;  3VQA A;  4HVJ A;  2D0A A;  4BAC A;  1TKX A;  4FJ7 A;  4CJR A;  1VSF A;  4I2P A;  3ZSQ A;  5C42 A;  5KRS A;  4DLE A;  2WON A;  4DF8 A;  1XC9 A;  3HJF A;  4CHZ A;  3DLG A;  3JSM A;  1VSL A;  3M8S A;  3QEI A;  3NF7 A;  4B9T A;  2YHB A;  4HUF A;  3DLB A;  1VRU A;  1VSI A;  4DTX A;  1NK5 A;  1UWB A;  3AVL A;  4DS5 A;  2OZS A;  3SV3 A;  3SQ4 A;  1I3A A;  4M3T A;  5J2M A;  4WE1 A;  1ASV A;  4HHT A;  4DQQ A;  1S1V A;  1VK0 A;  1QHT A;  4CHY A;  3MXM A;  5D3G A;  4QCL A;  3AVA A;  4CK2 A;  5FRN A;  3OJU A;  4DF4 A;  4GW6 A;  5CZ1 A;  5DMR A;  3HM9 A;  1L3T A;  1LV5 A;  3CFO A;  1HPZ A;  4H8K A;  4KHN A;  4O44 A;  3ZSO A;  3S3M A;  1ZBF A;  1FKP A;  4BDZ A;  4FJL A;  2FBY A;  2B6A A;  3THV A;  2X74 A;  4OPJ A;  4CK3 A;  3NH0 A;  1HMV A;  3V9S A;  5T7B A;  1BHL A;  3D0P A;  3SNN A;  4FZY A;  1IKX A;  3TAQ A;  3C6U A;  3DM2 A;  1D9D A;  2IDO A;  4PWD A;  3PX4 A;  3T3F A;  3E01 A;  4E89 A;  5J2N A;  1C0T A;  4Z4I A;  3NF8 A;  3AO5 A;  2XY8 A;  2FBX A;  4CIG A;  2DFE A;  2ATQ A;  4OLA A;  3DI6 A;  4FYD A;  1QSS A;  2B5J A;  4DSK A;  1VSE A;  4B8C A;  4DMN A;  4DWI A;  2HHU A;  1RTH A;  1LW2 A;  3U3G A;  4W5N A;  1WSE A;  3VA0 A;  5DK5 A;  3ZT1 A;  3HPG A;  5K14 A;  4PY5 A;  1RT3 A;  2HNZ A;  4LSN A;  5FRO A;  3HVT A;  4CJS A;  1WSF A;  3LPU A;  4FJG A;  1IKY A;  1JXB A;  4DG1 A;  2X6S A;  3TWH A;  1NKB A;  4FLZ A;  1X1P A;  3DRS A;  3OYH A;  2HB5 A;  3DLR A;  3P83 D;  3L8B A;  1FXX A;  4DLG A;  3HT3 A;  4CEO A;  3KD5 E;  3NAE A;  1KVA A;  3TAB A;  3PO5 A;  2G8H A;  1X9S A;  1WSG A;  5FDL A;  1HQU A;  1LWE A;  4AH9 A;  1SKW A;  4EP5 A;  4OLB A;  2KQ2 A;  1RBT A;  5EU7 A;  4ZHR A;  3OYG A;  1D8Y A;  5J2Q A;  2BDP A;  4E1M A;  4BWM A;  3VQ7 A;  4FLU A;  3LP0 A;  3HVR A;  1CZ9 A;  1RNH A;  4EZ6 A;  3CFR A;  3V9W A;  3LP2 A;  3QEV A;  3D45 A;  2XY5 A;  4I9Q A;  3AVF A;  3ISN C;  3F9K A;  5E41 A;  3HO1 A;  2KZZ A;  1ZYQ A;  2AJQ A;  4K8Z A;  4LH5 A;  5I3U A;  1D9F A;  1UAX A;  2HHQ A;  1DTT A;  3NF9 A;  2OPS A;  1Z25 A;  1RBS A;  5JS2 A;  4E7J A;  2P5G A;  1BIS A;  5C24 A;  3WNE A;  5HRN A;  1TK5 A;  4OKJ A;  3TAM A;  5KGW A;  2OPP A;  2FC0 A;  4ELT A;  1UA1 A;  4N47 A;  3LP1 A;  2X78 A;  1XHX A;  4Y1D A;  1ASU A;  1S1X A;  3WNF A;  3AVK A;  4IG0 A;  3S3N A;  5KI6 A;  1WSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...