1RBUA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADNKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 51
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbuA00
3KLEA 2G8WA 3OYBA 2ZD1A 1TV6A 3LP3A 3ZSQA 4AHCA 4OPJA 1EETA 1BIZA 4IFYA 4HTUA 3QESA 1D8YA 1JLFA 4DFKA 3MXJA 1L3SA 3HL8A 4OPKA 4KV8A 2YHBA 3AVKA 3L3UA 4AHTA 4CF9A 4DQQA 2IGIA 3L2UA 1X1PA 4H4OA 4FZZA 4KHYA 4N5SA 1TVRA 1LWFA 2IDOA 1NK7A 2XHBA 1NK6A 4FJ8A 3L2VA 4IDKA 4CGHA 3OYFA 4KAZA 2WONA 3V6DA 1RDDA 3TARA 3S3MA 2YNGA 1VSDA 3SPZA 1X9SA 4OLAA 3VQ4A 1DLOA 2X74A 1GOAA 1L3TA 3ASMA 2DFHA 4W5RA 3AVAA 3HYFA 3D0PA 4CGGA 1HYZA 1UWBA 4N56A 3CQ8A 4E7IA 1B9FA 1WN7A 1LWEA 1KFSA 4F2SA 3DRSA 3SQ1A 5E41A 4DTSA 3OY9A 3IS9A 1WSJA 1HNVA 2QKKA 1SL1A 4KREA 1VSMA 3HP6A 1CXQA 3OVNA 1XI1A 1D9DA 1BIUA 4M42A 1KFDA 2KQ2A 4DTNA 3OYJA 1HMVA 3VQ9A 3LAKA 2PYLA 2YNHA 1TKZA 3HT3A 1J9AA 1I39A 5J2NA 1Q9XA 1QSSA 1KRPA 1TKXA 2A1RA 3VQQA 4DSEA 2HW3A 3EZ5A 3K57A 3TANA 4J2EA 1VSJA 2B5JA 4HVJA 2IS3A 3QETA 4Q0BA 3AO1A 4B9NA 4KHSA 3HPHA 4CF1A 3LP2A 3TWHA 1Z26A 1Y97A 1ZBUA 4FZXC 2HVHA 4CJKA 4KHNA 3DLKA 4WE1A 4KI4A 1C6VA 2RF2A 3M8QA 4ZTFA 1ZBLA 1VRTA 2XY8A 3L8BA 1RT7A 1O1WA 3LZIA 3S3OA 4KB1A 4DTPA 3T1AA 1HPZA 1SV5A 2NUBA 3QINA 2PZSA 3L2RA 4HUEA 1XC9A 1XWLA 5HRRA 4J2BA 1G15A 1XHZA 2JGUA 1NKEA 1Z25A 4CEAA 3AO3A 1SL2A 1L5UA 2HNYA 3EY1A 4DLEA 3KKRA 4E7LA 4FLVA 1HJRA 2X78A 2KTQA 4DSIA 3SUPA 1U49A 1X9MA 1RDBA 1QTMA 1C1BA 4CERA 3OYEA 4DQRA 2G8HA 4CF2A 4DFPA 3TAQA 5T7BA 3KTQA 4ID5A 4BDPA 3RRHA 1X9WA 2OPPA 4EZ6A 4OJRA 3ZSVA 4Z4FA 4CJTA 2HB5A 3DLBA 4IG3A 4CFBA 5J1EA 1NJXA 4DF8A 4PWDA 3DLGA 5SWMA 4M3ZA 1WSFA 3U3GA 4KPYA 1NKCA 4CHQA 4DQPA 2DFFA 3OYCA 3HXMA 3CG7A 3KD5E 1NKBA 2HMIA 3NF7A 4Z4GA 1JLQA 4DTMA 5DK5A 3LZJA 4OGCA 4FXDA 2PY5A 3NFAA 2DTUA 1C1CA 4K8ZA 1LAWA 3ZT0A 1F21A 4FJGA 3ITHA 4KFBA 1VSKA 1WNSA 3MAQA 1JLAA 1JXEA 3T19A 3V9SA 5J2QA 3TAGA 3V9ZA 2KFZA 4I2PA 1IKXA 4I7FA 3KLGA 5J2PA 4EZ9A 3MXIA 5KGWA 4BDYA 4RG8A 4EP5A 2G8VA 1WAFA 3PY8A 3NH0A 3AVFA 3M8PA 4J2DA 1J54A 4B8CA 1NJWA 5FRMA 3VQPA 1BQNA 1JLBA 3DM2A 1BISA 5C25A 1C0MA 3VQEA 3I8DA 3ZT4A 1REVA 3QLHA 4CJPA 3SUNA 1S9EA 2OPSA 4CK1A 4O44A 4CIEA 4R5PA 4B8AB 3OYIA 2XY7A 3S9HA 3QEPA 3KD1E 2XRIA 3S3NA 3O3HA 1U4BA 3OYKA 3VQDA 4CF0A 5I3UA 3PX0A 2HHWA 1B9DA 3O3GA 5FRNA 5C42A 3M8RA 1A5XA 1RCHA 3V4IA 2BGGA 4C8MA 4PUOA 1U47A 1RTIA 4LY7A 3SJJA 3UIQA 4KTQA 3RR8A 2HHUA 3NGIA 4ELUA 1S5JA 3KKSA 4CF8A 3MXMA 4QCLA 3DYAA 2Y1IA 4HHTA 1QSLA 3SPYA 2ATQA 1LW2A 1S1WA 4I9LA 4RW9A 5C24A 3V9WA 1CLQA 3PO4A 4N47A 4DTRA 2D0AA 4KO0A 1BI4B 1KVCA 3P5JA 4B9TA 3OJSA 1NOZA 3AV9A 1RBTA 4FM1A 1QS4A 4OKEA 1L3UA 4M3YA 5JS1A 1W9HA 4HCCA 1S9GA 4DQIA 1BL3A 2OA8A 3B6PA 4YFUA 1RT5A 3SZ2A 4I9QA 1UOCA 4CJEA 4I2QA 4LH4A 3MEEA 4DG1A 3ULDA 3V9XA 4E7JA 3ZT3A 3WNHA 4FM2A 2GBZA 4CFAA 4DTOA 1SKSA 3K5LA 3AVIA 5HP1A 3ZT1A 4FJLA 1EX4A 5CYQA 1BQMA 5HROA 4FJHA 2KZZA 4CCHA 4O5BA 2EX3A 3CM5A 4FJ9A 3QNNA 1BCMA 4FW1A 1RDCA 4B9UA 4DFMA 3OYNA 4DWIA 1RBRA 2BE2A 3SQ0A 1LAVA 1W0HA 4E3SA 2OYQA 3F73A 3LPTA 3QEWA 1EP4A 1S1UA 3OJUA 4FJIA 2XY5A 2X6NA 2HVIA 3NGYA 4E7HA 1ZYQA 2KFNA 4IKFA 1VSLA 3V81A 1JLGA 1TAQA 3AVHA 3AVLA 4GVMA 3ZSXA 4CGIA 2Z1JA 3K5NA 4DU3A 3CFOA 4FLZA 3V1QA 1HYVA 1LW0A 3OYLA 4FJMA 1RDAA 3RTVA 1RBSA 4FM0A 2E6MA 1LV5A 1VRUA 1ASWA 4QAGA 4FVMA 4CJFA 4IG0A 3AVBA 3HM9A 4IBNA 4CECA 4O0IA 1U48A 3OS2A 3OYGA 4OLBA 4CJLA 4AILC 4CJUA 2VWJA 4ELVA 4KTZA 3TAPA 2ZE2A 3OS1A 1T03A 3HJFA 4M3UA 3LP1A 2HHXA 3TAEA 1JXBA 1HQUA 3O4NA 3HVRA 1UAXA 1RBUA 1WSHA 2HNZA 2IAJA 2Q3SA 4DFJA 3QEVA 2R7YA 1KVBA 3QEXA 4CE9A 1S6PA 2VG6A 2Z1GA 2VG7A 4JS5A 4W5NA 3DOLA 3IG1A 5FDLA 3BDPA 4M3XA 4B9MA 5HRPA 2A1SA 3VQAA 4C8LA 4HUGA 1MU2A 4F4KA 4KI6A 1NK5A 4CEDA 4ICLA 3OS0A 4F2RA 4IFVA 4E0DA 4F3OA 3HPGA 3AO5A 4NCGA 3M8SA 1TGOA 3SUQA 3THVA 5KI6A 5K14A 2IOCA 4CHYA 3NF6A 5JS2A 1HNIA 1A5WA 1TL1A 2KW4A 1S6QA 1CXUA 2XY6A 3KK3A 4CJWA 2G8UA 3RR7A 3HPOA 4W5OA 1S1VA 4KRFA 3LALA 2P5GA 3DRPA 2RN2A 4RW4A 3QNOA 4W5TA 2YKNA 2JLEA 3C6UA 3K5OA 4TSXA 1JKHA 2AJQA 1C0TA 2YV0X 4M45A 4OKKA 3CFPA 1JLEA 4AHSA 2P1JA 4L8RB 1SKWA 1FKPA 4PA1A 3HP9A 3WNEA 3ZSWA 4CJ3A 5KTQA 4OVLA 4K8XA 4M3RA 5KRTA 4NCBA 2P51A 2Z1HA 2O4IA 1R0AA 3VQ6A 3PV8A 1I3AA 3G0ZA 4BWJA 4FLUA 4Q5VA 3SQ4A 5D3GA 2BANA 4FK0A 4FK4A 3D45A 2FBXA 1ZBFA 1D5AA 3DI6A 3KLFA 3SYZA 4B3OA 1HYSA 3QERA 3OYDA 4C8NA 3TABA 4QOZB 4CIFA 3CFRA 4DU1A 5HLFA 1RT2A 1KLNA 4FZYA 4H8KA 3IRXA 4CJVA 2D0BA 2ZQBA 3LWMA 1RBVA 2LSNA 4CFCA 5KRSA 4DSJA 4B9SA 2HHVA 1TK5A 1U04A 3ALYA 3PUFA 3LDSA 2EHGA 4DSLA 1VSIA 3V1OA 4NYNA 4RW6A 2ITGA 3P1GA 4ID1A 3SNNA 5FROA 1T05A 2XO7A 2FBYA 4MQ3A 3PO5A 4M41A 4CJRA 1NK8A 1NK4A 4FJXA 3DOKA 4FCYA 3DLRA 3NF8A 3OYAA 3QIOA 4DQSA 1UA0A 1DTTA 1CZ9A 1ASUA 1QQCA 3PX4A 2PYJA 3HK2A 3VN5A 1TK0A 3FFIA 5I42A 1WSEA 3LPUA 1RTJA 2FC0A 1HQEA 3MECA 4DSFA 4DTJA 3TAFA 4CIGA 4CFDA 3LAMA 3LP0A 2DFEA 4RW7A 4Z4HA 3MEGA 3QIPA 3AO2A 2Z1IA 3KK2A 2E4LA 3K2PA 3A2FA 5HBMA 1N6QA 4Y1CA 4KHWA 2FBVA 2E6LA 2YNFA 3SV4A 4B9LA 1JLCA 2FBTA 3RMCA 2KZMA 5DMRA 4FLWA 4AHUA 3VQ8A 1EKEA 2GV9A 3RMBA 1SL0A 2B6AA 3NGZA 3WNGA 4AH9A 4CEEA 3EYZA 1SKRA 4PY5A 1VK0A 3WNFA 4CK3A 4UQGA 1T8EA 1IG9A 3KK1A 2YNIA 4O55A 1IKYA 1ASVA 3KLHA 5HRNA 1VSFA 2HNDA 4KTWA 3SV3A 3SUOA 3E01A 3OYHA 2X6SA 4GW6A 3NE6A 4JLHA 4BE0A 1HRHA 4CJSA 4NCAA 3AVGA 5CYMA 4FYDA 3AO4A 2YKMA 4OKJA 3AA3A 4CEZA 3VA3A 4M3WA 4F3TA 2HHQA 4AHRA 1Q8IA 4OGEA 3DMJA 4B08A 1RNHA 1RILA 3AVCA 3L2WA 4DTUA 1C1AA 1ZBHA 3JSMA 4ZHRA 3O4QA 5CZ1A 3TAMA 4FJKA 4FJNA 2HHTA 1S1TA 1QE1A 1TKTA 1IKWA 3HSTB 2ETJA 2QK9A 4LSLA 2HHSA 3LWLA 1DTQA 3P83D 1NOYA 1N5YA 4MFBA 4DLGA 2G8IA 2BDPA 4BE2A 4LSNA 2B4JA 3ZSOA 3G10A 1NJYA 3DLHA 1RT4A 3TI0A 3RWUA 2O4GA 2IC3A 4J2AA 3F9KA 5EU7A 2F96A 2VWKA 4B9VA 4KHUA 3NDKA 1GOCA 3AVNA 4CJ4A 2D0CA 1FKOA 1IH7A 3DLEA 1KCFA 4KKOA 1XHXA 2OPRA 1TK8A 1IO2A 1RT1A 3C94A 1ITGA 4HUFA 1QSYA 2F8SA 3NCIA 3ZSRA 4E1NA 4DMNA 1LWCA 1L3VA 1J53A 4KHQA 3RMAA 4CHOA 3DRRA 4FJ5A 4LH5A 1GOBA 3VQ7A 2WOMA 5HRSA 1RTHA 4FW2A 4CK2A 3JYTA 1RT3A 4CEQA 3KLIA 3L3VA 1WLJA 3KJVA 4FLYA 4BACA 1JL1A 1Q9YA 1KVAA 4E89A 4BE1A 3ZSZA 3HVTA 1ZBIA 3HO1A 2D5RA 3VA0A 2QKBA 2RPIA 4DU4A 1TAUA 4LD0A 4CEOA 1YTAA 2F8TA 2I5JA 1BHLA 1KTQA 1QHTA 3I0RA 1B92A 3V9UA 1U45A 4N41A 4FK2A 4M3TA 1NK9A 2QXFA 4CESA 3O3FA 1BGXT 2G8KA 4CGJA 1RT6A 3L2QA 4BWMA 4FLXA 2OZMA 3ZCMA 4O4GA 3PX6A 4C8KA 3AVJA 3KIOA 3SQ2A 1A5VA 1TL3A 3U3YA 1RTDA 4Z4EA 1YTUA 4DSKA 4F8RA 1YVUA 1BI4A 3AA2A 1S1XA 4E7KA 4CJQA 3RMDA 5CZ2A 3ZT2A 4CEFA 4W5QA 4JRPA 1VSHA 3B6OA 5CY4A 4ZTJA 3CM6A 4DTXA 3VQBA 4Y1DA 2W42A 3RRGA 1NJZA 4YNQA 3TR8A 2P5OA 4EP4A 4DS5A 4CHPA 4JRQA 4FJJA 5SZTA 3NH1A 3CYMA 3T3FA 1VSEA 4JS4A 1FK9A 1UA1A 4E1MA 4CHNA 1D9FA 2OZSA 4C8OA 1YT3A 2Y1JA 4E19A 3K59A 4Z0UA 1K6YA 1WAJA 1JL2A 2OPQA 4G1QA 4CGFA 4ELTA 3QEIA 4Z4IA 3K58A 3NAEA 1C0UA 4GMJB 3AA5X 2YHAA 3NHGA 3I0SA 1BCOA 1NK0A 3H08A 4AHVA 1FXXA 4CHZA 4HCBA 4Z4CA 4NYFA 4XIUA 1TKDA 1WSIA 1KLMA 1SUQA 2VG5A 3OYMA 4BDZA 5J2MA 4CEBA 3V1RA 4H4MA 4RW8A 1T7PA 3ISNC 3VQCA 3K5MA 4DF4A 3MEDA 4FJ7A 3IAYA 2DY4A 1IKVA 4O0JA 5KGXA 1CZBA 4PQUA 2GUIA 3LANA 3QO9A 3ZSYA 4KB0A 2RKIA 3AA4A 3C95A 3VQ5A 3SI6A 2G8FA 3C6TA 3SCXA 1J5OA 4DS4A 4CJ5A 4N76A 1EXQA 3NBPA 4FLTA 3U6FA 3BGRA 1KSPA 3AVMA 3NF9A 3NH2A 4CGDA 1WSGA
chains in the Genus database with same CATH superfamily
3OYBA 2NNWA 2ZD1A 5AFUH 3VTHA 3I56N 3HTVA 4HTUA 1BIZA 4DFKA 3MXJA 1YF5L 4DQQA 3L3UA 2IGIA 4UY8O 1NMDA 5C12A 2IDOA 5BR9A 3H46O 4WQ5A 5AQLA 2GUPA 1NK6A 4IDKA 3OYFA 2WONA 1VSDA 3SPZA 1X9SA 5M1PA 3C7NA 2X74A 3DXKA 4YDUA 3MX2A 3L0QA 3WXLA 4E7IA 3CQ8A 1KFSA 1LWEA 3DRSA 4DTSA 4MDAA 1HNVA 5ADXA 2QKKA 5LY3A 1CXQA 2KQ2A 4FWPA 3VQ9A 3LAKA 3NVMA 1J9AA 1Q9XA 3E9PA 3GDQA 4JKGB 3TANA 3NMUA 4WQ5C 5A2QO 3AO1A 4B9NA 4FVUA 1HLUA 4JD2B 1Z26A 1H1VA 2HVHA 3DLKA 4WE1A 4YDUC 1C6VA 2XY8A 3L8BA 4V19S 1NGDA 5E84A 2PZSA 5BPLA 4A62A 2JGUA 3CCUN 3AO3A 2J4RA 1YJWN 1L5UA 4DLEA 3B8AX 2UXBK 1YITN 1U49A 4YOWA 3ENHA 3LDOA 1XMOK 3MCPA 1KXPA 2O8BA 3VEZA 4OJRA 3ZSVA 3KWGA 4CFBA 1NJXA 4FPBA 3R8EA 2ZJQL 1KC8O 4M3ZA 1WSFA 4KPYA 1MDUB 2YX6A 1ZC6A 3CG7A 3MMVA 4KH5A 3BZKA 3CC7N 4FXDA 2GX9A 2PY5A 1LAWA 1VSKA 1JLAA 1JXEA 5J2QA 3AAQA 2KFZA 5BN8A 4I7FA 4MO5A 4EZ9A 5KGWA 1WAFA 4A5AA 4B3SK 1BQNA 4PHTX 5C25A 3VQEA 3SUNA 2Q0RA 4CIEA 3CCQN 4IOCL 3BEXA 2WFBA 2XRIA 3S3NA 4CF0A 5I3UA 1B9DA 4FO0A 2E2NA 1A5XA 4K43A 1RCHA 4CZEA 4PUOA 1RTIA 4LY7A 5FLXO 4CF8A 1R59O 3KKSA 3MN9A 4HHTA 4YOVA 3SPYA 1QSLA 1LW2A 4RW9A 3PO4A 3H3NO 3WEEA 4N47A 1BI4B 1T3VA 1BG3A 4B9TA 3OJSA 1NOZA 4BRCA 2NRVA 1NG9A 3QDKA 1W9HA 3VGMA 1VQLN 5JLHA 2OA8A 3SZ2A 3O5BA 4EFHA 4AQYK 4DTOA 1KD1O 4FJLA 5CE3A 1BQMA 3DXMB 3ULEB 4FJHA 2UUCK 4O5BA 5C15A 4WYBA 3WXIA 1QVGM 1NM1A 2I7NA 2BE2A 1W0HA 3HOTA 3QEWA 5LMNK 4WQ4A 3J7AP 4E7HA 5AQSA 4KH4A 2P9KB 3ZSXA 4CGIA 2Z1JA 4FLZA 1RBSA 1ASWA 4CJFA 2Q2RA 4BRFA 3O4WA 1GLCG 3L4QA 2VWJA 4KTZA 1WOQA 2ZE2A 1T03A 3LP1A 2HHXA 2HSTA 3HVRA 1UAXA 2HNZA 2Z1GA 1T44A 2VG7A 4JS5A 2P9UB 3KK7A 3KZBA 3QFPA 3J7ZO 2YHXA 5HRPA 2P9PA 4C8LA 4E1JA 5LMUK 1W2BM 2BUPA 4E0DA 4WQ4C 3HPGA 1TGOA 3THVA 5KI6A 5K14A 4CHYA 3D6RA 1TL1A 3ZX2A 2XY6A 3EZWA 5JICA 2P5GA 2RN2A 4B1XB 3ZYYX 4FPAA 3FE1A 3MWPA 4JYAK 4DR1K 2YV0X 4JI0K 3EEQA 4M7XA 2ZJPL 4GNIA 4ISGA 1R0AA 4FLUA 5D3GA 3SQ4A 2BANA 4FK0A 2Q0UA 2FBXA 3P38A 1NJIO 1P8ZA 4A57A 4C8NA 2P9SA 4WFNL 4B3MK 4CJVA 3LWMA 2ZQBA 3W3DA 1SZ2A 1BA1A 4C1NI 2P9LB 4NYNA 4ID1A 2D4WA 1ZXOA 3EO3A 2FBYA 2F9TA 3PO5A 4LF5K 4GKJK 1NK4A 3DLRA 3OYAA 2ZGZA 4DQSA 1CZ9A 3PX4A 2PYJA 3SMPA 3VN5A 3UKUA 3CJ1A 5I42A 1WSEA 3LPUA 1RTJA 2FC0A 1HQEA 4AM6A 4RW7A 2DFEA 1U2VA 3O8MA 2A3ZA 2H3GX 3K2PA 1SS6A 5LJWA 3D2EB 4Y1CA 4KHWA 5AQFA 4B9LA 2CGKA 2FBTA 3TSPA 4FLWA 4MLEA 1EKEA 1K8KB 1VQ6N 4WF9L 1SL0A 2B6AA 3NGZA 3WNGA 4AH9A 4PY5A 1SKRA 3N4QA 4CK3A 3WNFA 4UQGA 4A61A 2D0PA 3SV3A 1SAZA 2HNDA 4DWIA 3OYHA 5CYMA 4FYDA 3AO4A 3SLCA 2VQEK 4B08A 1RNHA 1TKTA 2P9IB 1LCUA 1DTQA 1VQMN 4LSNA 3TI0A 3RWUA 2HBKA 3I33A 4JKHA 5EX5A 4H0YB 5F0XA 1X9JA 4H5VA 1FKOA 1IH7A 4DUYK 1O13A 4BR9A 1IJJA 2OPRA 1L3VA 4KHQA 1VQON 2QM1A 4CHOA 3DRRA 3ID8A 3O9RA 1VQPN 3CCMN 5HRSA 4A5BA 3CCVN 3JYTA 1EWRA 4CEQA 2GTDA 1WLJA 4BVOA 4B1WB 3HVTA 1ZBIA 1BHLA 4YOTA 3V9UA 4DHYA 3PSFA 3O3FA 1BO5O 3GOIA 1S72N 1RT6A 2NRWA 2Q1NA 3U4LA 1RTDA 1TL3A 1YTUA 4F8RA 4CI6A 1NGGA 4IO8A 3QBWA 3A0IX 4W5QA 3B6OA 2O8DB 2QWOA 4Y1DA 1NU0A 4H5TA 3RRGA 3CD6N 4EP4A 2NRTA 4CHPA 4EHUA 3KVGA 3NH1A 3T3FA 1VSEA 4E1MA 4CHNA 1D9FA 2OZSA 4IJAA 1HR0K 2Y1JA 2HOEA 4JNEA 4IFEA 1K6YA 4JI4K 1WAJA 3NVKA 4X64K 3NAEA 4GMJB 1NK0A 3AA5X 3BF3A 4CHZA 3A5NC 4DV2K 1WSIA 1KLMA 5J2MA 2VG5A 5AQUA 4FWLA 4H4MA 4H5RA 4FJ7A 3MEDA 1IKVA 4JI2K 4CZIA 5KGXA 3LANA 4QS7A 3ZSYA 5BREA 5LL6Z 3SCXA 4H0XB 1EXQA 3WT0A 2F4VK 4B3RK 3CQXA 1Q86O 4CGDA 5AR0A 2OANA 3EE9A 1WSGA 3KLEA 2G8WA 4LF4K 4IFYA 5GADP 5KQ8A 1JLFA 4JKDA 2YHBA 3AVKA 4H4OA 4N5SA 1NK7A 4H5NA 3L2VA 4CGHA 3M3ZA 1Z05A 1OH8A 2YNGA 1VQ8N 4OLAA 2DFHA 4W5RA 3AVAA 1HYZA 1UWBA 4N56A 1B9FA 1WN7A 4F2SA 5E41A 1WSJA 4BR4A 1J6ZA 3HP6A 2UYTA 1KFDA 4DTNA 3OYJA 1HMVA 4BRDA 1S3XA 2O8FA 3G71N 2PYLA 1TKZA 1QSSA 1I39A 2A1RA 4DSEA 4BC3A 3HM8A 3K57A 2F9WA 2IS3A 4Q0BA 4KHSA 3WXMB 3CC4N 3TWHA 1Y97A 4L3QA 4CJKA 3H1QA 4ZTFA 2O8EA 1RT7A 3EN9A 1O1WA 3S3OA 2V7YA 1ILYA 4DTPA 1YVNA 3ZX3A 3T1AA 1KAYA 1HPZA 2NUBA 3QINA 1W97L 3TU5A 3ZLJA 4J2BA 3F9MA 2NZTA 4CEAA 4LC9B 4E7LA 1HJRA 1X9MA 4CERA 4DQRA 4CF2A 4U67L 4ILJA 1K9MO 3KTQA 4ID5A 4BDPA 1NGFA 5AQHA 2QWPA 4EZ6A 4Z4FA 3SBTA 1XQSC 5J1EA 4H0VB 3ZETB 4BRGA 5C2FA 1NKCA 4BGBA 3KD5E 2CH5A 5AZIB 4DTMA 1SQKA 4CVNE 4CD1A 3TTFA 3LZJA 1K73O 1YIJN 4OGCA 2VWBA 4H5WA 4A2AA 1N36K 2DTUA 2QXLA 2UUBK 1F21A 3GE1A 4KFBA 3MAQA 3TAGA 5E26A 2VQFK 3V9SA 1QVFM 1HKGA 3PIPL 3KLGA 4DV3K 1BDGA 2YJEA 4EP5A 3DJCA 2G8VA 5AQXA 5KQDA 3PY8A 3NH0A 1Q18A 1J54A 2F7TA 3A5OC 2VYPA 3HO1A 1S9EA 2XY7A 4B8AB 3OYIA 5EXWA 1NGJA 2BTFA 3KD1E 1U4BA 2WUSA 2HHWA 3C65A 3ZEUA 5C42A 3V4IA 1U47A 4BRAA 3RR8A 1ATNA 3THXA 3CI5A 4ELUA 1S5JA 2Y1IA 4I9LA 1NGCA 3PIOL 5F1XA 5GIPA 3VEWA 1KVCA 2NRHA 4ILGB 1XUPO 4M3YA 1HX1A 4HCCA 3K9JA 4C23A 3V9XA 4I2QA 4LH4A 4M63C 4DG1A 4E7JA 3WNHA 3MX5A 4MO4A 4BRNA 1SKSA 3K5LA 3AVIA 3ZT1A 4O8KA 3AARA 2AP1A 5HROA 3TPQA 4CCHA 3D2FA 4FJ9A 1RDCA 3I55N 1RBRA 4O5FA 2NRRA 3SQ0A 4GVEA 3OJUA 4JHDA 5DM7L 3VF6A 2HVIA 3BUZB 5AQKA 3NGYA 2KFNA 4BRQA 3AGRA 3TSUA 2IVNA 4IJNA 1E4GT 1JLGA 3A5MC 3AVLA 5H1SQ 4JI7K 2ZWHA 4FL9A 3RTVA 4FM0A 2CH6A 2E6MA 3OA9A 4IG0A 4CECA 4O0IA 1U48A 4FWQA 4CJLA 1VQ9N 4JI5K 4FWSA 1YUWA 3TAEA 4DFJA 2VCPA 1RBUA 1WSHA 2R7YA 1KVBA 1RDUA 2ZM6K 3O1WA 3DOLA 4IZ9A 3QFUA 3BDPA 4M3XA 1Q81O 1VAZA 4CJ7A 1NBWA 5AQGA 2QI2A 1MU2A 3O9SA 1NK5A 4F2RA 4F3OA 2GEMA 3M8SA 3SAHA 2IOCA 3NF6A 1HNIA 3C7NB 1A5WA 3DXKB 2ITMA 3CJCA 5AQRA 4DKWA 1NWKA 2HBMA 3HPOA 1BU6O 2YCHA 3QNOA 2YKNA 2AJQA 4TSXA 2UUAK 3CFPA 4L8RB 1FKPA 5KTQA 3HP9A 3WNEA 3ZSWA 3GG4A 5DM6L 4M3RA 4CBWA 2O4IA 1QQNA 3VEVA 2ASOA 4Z94A 4B1VA 4DB3A 5AQVA 3D45A 1XMQK 1ZBFA 1D5AA 3DI6A 3SYZA 4B3OA 1HYSA 4BGAA 3QERA 3TABA 4QOZB 4DU1A 5HLFA 1KLNA 2OTJN 1RGIA 2VGNA 1YJ9N 2LSNA 5KRSA 4B9SA 1C0GA 1YJNN 1TK5A 5HOOA 1U04A 3ALYA 3P1GA 3VETA 4EIAA 1T05A 2XO7A 4M41A 3BY5A 1NK8A 4FJXA 3ENOA 3QIOA 2FLOA 2E8AA 4QS9A 1HPMA 1DTTA 1QQCA 1TK0A 1GLLO 3CC2N 3WXKA 4DTJA 4DSFA 3TAFA 3THYA 4CIGA 4Z4HA 2ASMA 3LP0A 3L4IA 5JLFA 4JAXA 3QIPA 1MWKA 3O9TA 2Z1IA 3KK2A 2O8BB 5HBMA 3VPZA 1N6QA 5BN9A 4DQ8A 1N33K 1VQ7N 2GWJA 1JLCA 1NGEA 2KKZA 4NLCA 5ADXH 5JVHL 2KZMA 3VQ8A 1QZ5A 3OHRA 3EYZA 4CEEA 1IG9A 1T6DA 4O55A 4BG8A 5HRNA 4WCEL 3NE6A 2X6SA 4NCAA 2V7ZA 4DR6K 4OKJA 3VA3A 2HHQA 4AHRA 1Q8IA 3DMJA 4LF8K 3L2WA 3O4QA 1TYQA 1S1TA 5M1FA 3IMXA 2QK9A 2ETJA 4LSLA 1HKCA 3MDQA 1BUPA 1YI2N 1N5YA 4MFBA 2BDPA 4BE2A 2HBJA 2W6LA 3ZSOA 2GWKA 3DLHA 5M1NA 3IUCA 1D4XA 3F5TA 1HJOA 5EU7A 4B9VA 3NDKA 4FSVA 1GOCA 1J5EK 2D0CA 4BRPA 4BQZA 1KCFA 3C94A 2E20A 3RMAA 4FJ5A 4HTLA 1GOBA 4LH5A 3WEEB 2WOMA 1EWQA 4CK2A 5LJVA 4A2BA 3KJVA 4KH6A 4PKHA 1Q9YA 3CHWA 5BPNA 1KVAA 3CJAA 1VQKN 4HWIA 3VA0A 3QICA 2RPIA 4H03B 4DU4A 1TAUA 2PFUA 2F8TA 2E5LK 1NK9A 2QXFA 3R9PA 4CGJA 4DR3K 3CERA 3L2QA 4BWMA 2OZMA 2RE2A 3KIOA 3U3YA 1YVUA 1S1XA 3BF1A 1E3MA 1I94K 4CJQA 3RMDA 1OH7A 5CY4A 3CCJN 3U9DA 1NNEA 3CM6A 4DTXA 4YNQA 4OPHA 3O08A 2P5OA 2V52B 4DS5A 4O8UA 5FPEA 2HHHK 1V4SA 4PKIA 3LM2A 1GLBG 1P90A 2W40A 4G1QA 5CR4A 3LL3A 2VGMA 3A8YA 2P9PB 4BC4A 1C0UA 3H08A 1FXXA 2WC9A 1TKDA 1SUQA 4I6MA 3FR0A 4BDZA 1YHQN 1T7PA 1ESVA 2Q31A 3K5MA 4DF4A 2DY4A 4O0JA 1CZBA 2PBDA 2FSJA 2RKIA 2G8FA 3C6TA 4DS4A 3U6FA 4CZHA 4BC2A 3CF5L 1N32K 3LP3A 3ZSQA 4AHCA 1EETA 4H0OA 3N4PA 3HL8A 4OPKA 4KV8A 3L2UA 1X1PA 4FZZA 2BH1A 4BRHA 5AQYA 5KPZA 2P9SB 1RDDA 3S3MA 1OVYA 1TUYA 2QWLA 4A59A 1DLOA 3AAPA 1L3TA 3HYFA 3D0PA 4CZKA 3P39A 4CGGA 4OO1J 2QEXN 4DV4K 3SQ1A 3ZX0A 4JI6K 3PSIA 1GLDG 4R79A 5M1KA 3LDQA 3FFKB 3OVNA 1BIUA 4M42A 3UB5A 4JV5K 2P9NA 5J2NA 3HT3A 3UKUB 3VQQA 2HW3A 3EZ5A 2I7PA 1VHXA 4J2EA 2B5JA 3CPEA 3THWA 4B9QA 1U2VB 4CF1A 1ATSA 2FSNA 1ZBUA 4FZXC 3ATUA 3M8QA 3R6MA 4BR7A 3SAFA 3DAWA 5GAGP 1FJGK 3C0BA 3CJBA 1SV5A 3L2RA 4G9ZA 1XC9A 4FWRA 3C6AA 1G15A 3O9QA 2QA4N 1XHZA 1NKEA 1Z25A 4KHPK 2X78A 2KTQA 4DSIA 3SUPA 2FF6A 1RDBA 1C1BA 2G8HA 2E2PA 4DFPA 4RCHA 5T7BA 5F2RA 3RRHA 1X9WA 1JJ2M 1XC3A 2UXCK 3O9UA 4NXMK 1JCGA 4EAHD 4RWTA 5AQQA 3U3GA 4DQPA 2DFFA 3HXMA 2HMIA 1QZ6A 5DK5A 4FWMA 1BWFO 1QHAA 3NFAA 4MDBA 3ZT0A 4K41A 5C2DA 2OTLN 4ILHA 3V9ZA 1NGAA 5J2PA 4BDYA 4RG8A 2KHOA 4J2DA 3SJHA 1NJWA 4GKKK 3VQPA 1JLBA 1BISA 1C0MA 3I8DA 3ZT4A 4CK1A 3H6EA 2O8CA 3CIPA 1IBKK 3O3HA 3OYKA 5AZJA 3VQDA 4XEIA 3O3GA 3KHYA 3E9OA 4B3TK 4ISEA 5FRNA 5GIOA 3M8RA 4J8FA 2BGGA 1NMNA 2IIRA 4C8MA 3FZMA 3UE5A 4KTQA 3SJJA 3UIQA 3P4IA 4BC5A 1EO1A 3MXMA 3DYAA 1S1WA 1CLQA 1RBTA 4FM1A 1HNXK 4BROA 3CMAN 5JS1A 3E9LA 1S9GA 3HI0A 1JCFA 4IDHA 2ASPA 2A6AA 3B6PA 4YFUA 1FW6A 1UOCA 3MEEA 5AQNA 3ZT3A 4CFAA 5HP1A 1T6CA 3MWTA 5ELZA 5CYQA 4LFBK 4BRLA 3CM5A 3QNNA 1BCMA 4FW1A 5C10A 4B9UA 4DFMA 4CBUA 3OYNA 4DUZK 3SBGA 5AFUA 4E3SA 2UU9K 4NXNK 2XY5A 1ZYQA 4IKFA 1VSLA 3J8AA 2FF3B 3AVHA 4GVMA 4DU3A 2DPNA 4C1NK 3V1QA 4CZFA 1HYVA 5IWAK 3OYLA 4FJMA 1NGBA 4DR7K 3RSEA 2CGLA 1LOTB 3HM9A 5GINA 3OS2A 4ELVA 3OS1A 3HJFA 4M3UA 5MLCQ 3O4NA 4BVPA 2Q3SA 3UKRA 3QEXA 3QEVA 3G6EN 2VG6A 3LDNA 4W5NA 5FDLA 2A1SA 3VQAA 4HUGA 4LF7K 4F4KA 5AQZA 3HZ6A 3O1BA 4ICLA 3AO5A 3SUQA 2QWNA 2KW4A 4CZMA 4BR5A 3FGUA 3KK3A 2OCEA 4YORA 2G8UA 3RR7A 1S1VA 3LALA 3G25A 3DRPA 5M1OA 4RW4A 2JLEA 3IKMA 3K5OA 1JKHA 3CCRN 4OKKA 4AHSA 2P1JA 1X3NA 4PA1A 2O8FB 2P51A 2Z1HA 1I3AA 3G0ZA 4BWJA 1OH5A 1X3MA 4Q5VA 3PLAA 1E4FT 3TSQA 3CFRA 4FZYA 4CFCA 3LDLA 4DSJA 1XNQK 3VERA 2O8EB 3PUFA 3LDSA 2EHGA 2E1ZA 4OX9K 3V1OA 2ITGA 5FROA 3AVMA 3QBXA 4DV1K 3DOKA 3D7EO 3P31A 5KPTA 4IO9L 1ASUA 3VEYA 3HK2A 1W7AA 3OBWA 4CBXA 3FFIA 4XH1A 1CZAN 3F2KA 4JKGA 1TUUA 3LAMA 3CCEN 1Q7YO 4MLHA 3AO2A 3E66A 2E4LA 3A2FA 4JD2A 4DR5K 2FBVA 2E6LA 3RMCA 1WUAA 2D1KA 3EE8A 5DMRA 4H0TB 4AHUA 5AQOA 5I9EB 3Q7CA 5AQIA 2A42A 1VK0A 1OVQA 1T8EA 3KK1A 2YNIA 1IBMK 5C0YA 1IKYA 1ASVA 3KLHA 1VSFA 4KTWA 3E01A 4GW6A 5FPDA 4JLHA 4BE0A 2YKMA 3AA3A 4M3WA 4F3TA 4B1UB 3VGKA 3MCAB 4DTUA 1RILA 1ZBHA 1C1AA 3JSMA 4ZHRA 5CZ1A 3TAMA 4FJKA 4FJNA 4IOAL 3QMLA 1IKWA 3HSTB 4FWKA 3P83D 4DLGA 5BR8K 2B4JA 1NJYA 4YOUA 2O4GA 2IC3A 4J2AA 3F9KA 5M1QA 2F96A 2VWKA 4KHUA 3ZEUB 3AVNA 5KPRA 2FSKA 2E88A 3ATVA 4KKOA 1XHXA 1TK8A 1RT1A 1QSYA 2F8SA 3THXB 3R3LA 4E1NA 5BPMA 1LWCA 2QW9A 1KAXA 3VQ7A 4NB4A 4RTFD 1RTHA 4FW2A 4WFBL 3L3VA 4FLYA 1JL1A 2AA4A 3EKSA 3CPWM 4PL7A 4BE1A 3ZSZA 3U8XA 4LD0A 3ENBA 2I5JA 3A5LC 4DCHA 4N41A 1KTQA 1QHTA 4FK2A 1U45A 2EWSA 4M3TA 3VOVA 2Q97A 4CESA 2ZGYA 4IEEA 3D2FB 5GAHP 1HNZK 1DGKN 4O4GA 1Y64A 3PX6A 4C8KA 2KLAA 3CCLN 1WBBA 1A5VA 4JHDB 4Z4EA 3T1YK 3ID6A 1OH6A 4X65K 1BI4A 4E7KA 5CZ2A 3ZT2A 4CEFA 1VSHA 2Q36A 1RFQA 4FJJA 5SZTA 3CYMA 2PAVA 1UA1A 5JVGL 2FXUA 4JI3K 4C8OA 4DR2K 1YT3A 3DXMA 2YHWA 3ULEA 4E19A 3DWLA 1JL2A 2JWKA 2OPQA 4ELTA 4K0KK 3CJ7A 3QEIA 4FOEA 5AQWA 1BCOA 2NLXA 4AHVA 3TTCA 4Z4CA 4XIUA 4CEBA 5BRDA 5EVZA 5AQJA 2P9KA 3VQCA 3IAYA 3FZLA 3CXCM 3C95A 3SI6A 1J5OA 4CJ5A 4FWOA 1Z6RA 4NO7A 3NBPA 4FLTA 3R1XA 3BGRA 1KSPA 3NF9A 3NH2A 3P5JA 1TV6A 4OPJA 1D8YA 3QESA 4BRKA 2P9UA 1L3SA 2QWRA 4CF9A 4AHTA 2UXDK 4XH5A 3M1FA 1G99A 4KHYA 1TVRA 1LWFA 1VQ5N 2XHBA 4H0PA 3FZKA 2YHYA 3MN5A 4FJ8A 4KAZA 4LFAK 3V6DA 3TARA 1XNRK 4AF1A 3O80A 3VQ4A 1GOAA 3ASMA 4GV9A 3OY9A 3IS9A 3H3OB 3SAGA 1SL1A 4KREA 1VSMA 3J80O 1XI1A 1D9DA 1C0FA 4BREA 2YNHA 1KRPA 4GV3A 2QWQA 3T7ZA 1TKXA 3THYB 1VSJA 4HVJA 5CHIA 3QETA 3HPHA 4JK7A 3J81O 3LP2A 4JN4A 4JI1K 4KHNA 4KI4A 2RF2A 5EY4A 1ZBLA 1VRTA 4DV7K 4KB1A 3LZIA 1MWMA 4IXCA 2P9LA 1GLJO 1IBLK 4HUEA 1XWLA 5HRRA 3SMSA 1SL2A 2HNYA 3EY1A 3KKRA 4FLVA 4YHHK 4DR4K 3J7YP 1QTMA 3OYEA 4BR0A 3TAQA 1TYQB 2OPPA 2W41A 4CJTA 2HB5A 3DLBA 3D2EA 4IG3A 4PWDA 3AGKA 4DF8A 3DLGA 5SWMA 4NLBA 1YXQA 3IFRA 4CHQA 5IT9O 1K8KA 4JKEA 4BG9A 3OYCA 1YAGA 3H1VX 1NKBA 2IVPA 3NF7A 1WBDA 3DLLL 1JLQA 4Z4GA 2E2QA 1C1CA 4K8ZA 4AM7A 4YOXA 4FJGA 3ITHA 1V4TA 1WNSA 1QQOA 4X62K 1KAZA 3T19A 3HSCA 4I2PA 1IKXA 3MXIA 4IWVA 3AVFA 2P9IA 1IG8A 3M8PA 4B8CA 5FRMA 3DM2A 3SQ2A 4IEIA 1REVA 3QLHA 4CJPA 1M90O 2OPSA 4R5PA 4O44A 3OTOK 3QEPA 3PX0A 3HBTA 3GL1A 1NLVA 2YI1A 4DV6K 3FZHA 2V51B 2HHUA 3NGIA 4QCLA 2ATQA 3V9WA 5C24A 5FPNA 3OBYA 2D0AA 4KO0A 4DTRA 4WFAL 3AV9A 3FZFA 1QS4A 4OKEA 1L3UA 1M1KO 4DQIA 1BL3A 3K0SA 1RT5A 4I9QA 3RVCA 3OW2M 4CJEA 3ULDA 4JK9A 4FM2A 2GBZA 4JI8K 4EHTA 2WTUA 1EX4A 3VF2A 2KZZA 1HKBA 3QB0A 3I8BA 2EX3A 1DEJA 4BY9C 3SK3A 3VEXA 1LAVA 2RHKA 2OYQA 3F73A 3LPTA 1EP4A 1S1UA 4FJIA 2X6NA 4I6MB 3V81A 1JCEA 1TAQA 3K5NA 3O6WA 4CZGA 3CFOA 3CQYA 1LW0A 1RDAA 2O8DA 1LV5A 2E1YA 1VRUA 4B1YB 4QAGA 4FVMA 3AVBA 4IBNA 4FOIA 3OYGA 3CCSN 4OLBA 4AILC 4CJUA 3TAPA 2ZJRL 4U7BA 1K8AO 1JXBA 1HQUA 3VMFB 3S9HA 2IAJA 4CE9A 1S6PA 2D0OA 3IG1A 4FWNA 4B9MA 3MN7A 3VESA 4PKGA 3WQUA 3BZCA 4KI6A 4CEDA 3OS0A 4IFVA 3T69A 4NCGA 3LM9A 3HOSA 5JS2A 1S6QA 1CXUA 3CJ9A 3IDHA 4CJWA 1NGHA 4W5OA 4KRFA 3Q7BA 4K42A 4W5TA 4GV6A 3C6UA 1C0TA 2E2OA 4M45A 1JLEA 1SKWA 4K8XA 4CJ3A 1MA9B 4OVLA 2P9NB 3H45C 3G4SN 5KRTA 2ZF5O 4NCBA 3AY9A 1ZBSA 3VQ6A 3PV8A 3MK6A 3THWB 4FK4A 1HUXA 3KLFA 1VQ4N 3OYDA 3VGLA 4CIFA 1KQSM 4QS8A 1RT2A 4H8KA 3IRXA 2D0BA 1RBVA 4KBOA 2HHVA 4ISFA 5HL7L 4DSLA 1VSIA 2YJFA 5AQMA 3T1HK 4RW6A 2IVOA 3L6QA 3JAMO 3SNNA 5TKYA 1BA0A 4MQ3A 5JMVA 4CJRA 1RDWX 3JS6A 4FCYA 3NF8A 1UA0A 4OPAA 3WXJA 3CETA 4F9OA 3VF4A 1QQMA 3U9ZA 5TKWA 3MECA 3WUHA 2A41A 2JWLA 3BP8A 4CFDA 1S22A 4BR2A 3LDPA 3MEGA 3VTIA 3K9KA 1VQNN 4JKCA 5AQPA 5BRFA 2YNFA 3SV4A 5FPMA 2HF3A 2GV9A 3RMBA 4LFCK 4LF6K 1U6ZA 3KWIA 1EQYA 3SUOA 1HRHA 4CJSA 3AVGA 4CZLA 4CEZA 4OGEA 4IOXA 3AVCA 3EKUA 2HHTA 1QE1A 2A5XA 3VENA 2HHSA 3LWLA 2HMPA 1NOYA 4YY3K 2G8IA 4PL8A 2O8CB 4M7YA 3ZETA 3G10A 4CD3A 1RT4A 4JKAA 5EOYA 5AZJB 4B1ZA 4DV0K 5AZIA 2CGJA 4CJ4A 3CMEN 4JEPA 3MN6A 3DLEA 4X66K 1Q82O 4JKFA 3S41A 1IO2A 1GLAG 1OKJA 1ITGA 3E1YA 5BRHA 4DV5K 3M5RA 4HUFA 3NCIA 3ZSRA 4DMNA 1J53A 4BRIA 4LF9K 3C6HA 1BOTO 2NRXA 4BRMA 1DT9A 1RT3A 3KLIA 2QTDA 4BACA 3FLCO 4JKBA 4E89A 2D5RA 2QKBA 4CEOA 4JK8A 3WQTA 1YTAA 3I0RA 1B92A 3W0LA 5GAEP 1BGXT 5B8HA 2G8KA 1NGIA 4YOYA 5AJ3K 4FLXA 4K25A 3ZCMA 3AVJA 3JXUA 2QWMA 4Y0WA 1GLEG 2GELA 2WBNA 4DSKA 3AA2A 2HF4A 3HRGA 4JRPA 4ZTJA 3RSEB 3VQBA 1ATRA 2W42A 3M6GA 2A40A 1NJZA 3TR8A 3TTDA 4JRQA 1DKGD 4JS4A 1FK9A 2W6KA 3GBTA 3UKRB 1HNWK 3K59A 4Z0UA 4BQLA 2NRZA 4CGFA 1N8RO 4Z4IA 3K58A 3NHGA 2YHAA 3I0SA 1IV0A 4HCBA 4GY2B 4NYFA 3OYMA 3V1RA 3EL2A 4RW8A 1WB9A 3ISNC 4CZJA 1N34K 4CW7B 4PQUA 2GUIA 3QO9A 4KB0A 1GLFO 3AA4A 3VQ5A 4XH4A 5AQTA 4N76A 3VEOA 2HBLA
chains in the Genus database with same CATH topology
3KLEA 2G8WA 3OYBA 2ZD1A 1TV6A 3LP3A 3ZSQA 4AHCA 4OPJA 1EETA 1BIZA 4IFYA 4HTUA 3QESA 1D8YA 1JLFA 4DFKA 3MXJA 1L3SA 3HL8A 4OPKA 4KV8A 2YHBA 3AVKA 3L3UA 4AHTA 4CF9A 4DQQA 2IGIA 3L2UA 1X1PA 4H4OA 4FZZA 4KHYA 4N5SA 1TVRA 1LWFA 2IDOA 1NK7A 2XHBA 1NK6A 4FJ8A 3L2VA 4IDKA 4CGHA 3OYFA 4KAZA 2WONA 3V6DA 1RDDA 3TARA 3S3MA 2YNGA 1VSDA 3SPZA 1X9SA 4OLAA 3VQ4A 1DLOA 2X74A 1GOAA 1L3TA 3ASMA 2DFHA 4W5RA 3AVAA 3HYFA 3D0PA 4CGGA 1HYZA 1UWBA 4N56A 3CQ8A 4E7IA 1B9FA 1WN7A 1LWEA 1KFSA 4F2SA 3DRSA 3SQ1A 5E41A 4DTSA 3OY9A 3IS9A 1WSJA 1HNVA 2QKKA 1SL1A 4KREA 1VSMA 3HP6A 1CXQA 3OVNA 1XI1A 1D9DA 1BIUA 4M42A 1KFDA 2KQ2A 4DTNA 3OYJA 1HMVA 3VQ9A 3LAKA 2PYLA 2YNHA 1TKZA 3HT3A 1J9AA 1I39A 5J2NA 1Q9XA 1QSSA 1KRPA 1TKXA 2A1RA 3VQQA 4DSEA 2HW3A 3EZ5A 3K57A 3TANA 4J2EA 1VSJA 2B5JA 4HVJA 2IS3A 3QETA 4Q0BA 3AO1A 4B9NA 4KHSA 3HPHA 4CF1A 3LP2A 3TWHA 1Z26A 1Y97A 1ZBUA 4FZXC 2HVHA 4CJKA 4KHNA 3DLKA 4WE1A 4KI4A 1C6VA 2RF2A 3M8QA 4ZTFA 1ZBLA 1VRTA 2XY8A 3L8BA 1RT7A 1O1WA 3LZIA 3S3OA 4KB1A 4DTPA 3T1AA 1HPZA 1SV5A 2NUBA 3QINA 2PZSA 3L2RA 4HUEA 1XC9A 1XWLA 5HRRA 4J2BA 1G15A 1XHZA 2JGUA 1NKEA 1Z25A 4CEAA 3AO3A 1SL2A 1L5UA 2HNYA 3EY1A 4DLEA 3KKRA 4E7LA 4FLVA 1HJRA 2X78A 2KTQA 4DSIA 3SUPA 1U49A 1X9MA 1RDBA 1QTMA 1C1BA 4CERA 3OYEA 4DQRA 2G8HA 4CF2A 4DFPA 3TAQA 5T7BA 3KTQA 4ID5A 4BDPA 3RRHA 1X9WA 2OPPA 4EZ6A 4OJRA 3ZSVA 4Z4FA 4CJTA 2HB5A 3DLBA 4IG3A 4CFBA 5J1EA 1NJXA 4DF8A 4PWDA 3DLGA 5SWMA 4M3ZA 1WSFA 3U3GA 4KPYA 1NKCA 4CHQA 4DQPA 2DFFA 3OYCA 3HXMA 3CG7A 3KD5E 1NKBA 2HMIA 3NF7A 4Z4GA 1JLQA 4DTMA 5DK5A 3LZJA 4OGCA 4FXDA 2PY5A 3NFAA 2DTUA 1C1CA 4K8ZA 1LAWA 3ZT0A 1F21A 4FJGA 3ITHA 4KFBA 1VSKA 1WNSA 3MAQA 1JLAA 1JXEA 3T19A 3V9SA 5J2QA 3TAGA 3V9ZA 2KFZA 4I2PA 1IKXA 4I7FA 3KLGA 5J2PA 4EZ9A 3MXIA 5KGWA 4BDYA 4RG8A 4EP5A 2G8VA 1WAFA 3PY8A 3NH0A 3AVFA 3M8PA 4J2DA 1J54A 4B8CA 1NJWA 5FRMA 3VQPA 1BQNA 1JLBA 3DM2A 1BISA 5C25A 1C0MA 3VQEA 3I8DA 3ZT4A 1REVA 3QLHA 4CJPA 3SUNA 1S9EA 2OPSA 4CK1A 4O44A 4CIEA 4R5PA 4B8AB 3OYIA 2XY7A 3S9HA 3QEPA 3KD1E 2XRIA 3S3NA 3O3HA 1U4BA 3OYKA 3VQDA 4CF0A 5I3UA 3PX0A 2HHWA 1B9DA 3O3GA 5FRNA 5C42A 3M8RA 1A5XA 1RCHA 3V4IA 2BGGA 4C8MA 4PUOA 1U47A 1RTIA 4LY7A 3SJJA 3UIQA 4KTQA 3RR8A 2HHUA 3NGIA 4ELUA 1S5JA 3KKSA 4CF8A 3MXMA 4QCLA 3DYAA 2Y1IA 4HHTA 1QSLA 3SPYA 2ATQA 1LW2A 1S1WA 4I9LA 4RW9A 5C24A 3V9WA 1CLQA 3PO4A 4N47A 4DTRA 2D0AA 4KO0A 1BI4B 1KVCA 3P5JA 4B9TA 3OJSA 1NOZA 3AV9A 1RBTA 4FM1A 1QS4A 4OKEA 1L3UA 4M3YA 5JS1A 1W9HA 4HCCA 1S9GA 4DQIA 1BL3A 2OA8A 3B6PA 4YFUA 1RT5A 3SZ2A 4I9QA 1UOCA 4CJEA 4I2QA 4LH4A 3MEEA 4DG1A 3ULDA 3V9XA 4E7JA 3ZT3A 3WNHA 4FM2A 2GBZA 4CFAA 4DTOA 1SKSA 3K5LA 3AVIA 5HP1A 3ZT1A 4FJLA 1EX4A 5CYQA 1BQMA 5HROA 4FJHA 2KZZA 4CCHA 4O5BA 2EX3A 3CM5A 4FJ9A 3QNNA 1BCMA 4FW1A 1RDCA 4B9UA 4DFMA 3OYNA 4DWIA 1RBRA 2BE2A 3SQ0A 1LAVA 1W0HA 4E3SA 2OYQA 3F73A 3LPTA 3QEWA 1EP4A 1S1UA 3OJUA 4FJIA 2XY5A 2X6NA 2HVIA 3NGYA 4E7HA 1ZYQA 2KFNA 4IKFA 1VSLA 3V81A 1JLGA 1TAQA 3AVHA 3AVLA 4GVMA 3ZSXA 4CGIA 2Z1JA 3K5NA 4DU3A 3CFOA 4FLZA 3V1QA 1HYVA 1LW0A 3OYLA 4FJMA 1RDAA 3RTVA 1RBSA 4FM0A 2E6MA 1LV5A 1VRUA 1ASWA 4QAGA 4FVMA 4CJFA 4IG0A 3AVBA 3HM9A 4IBNA 4CECA 4O0IA 1U48A 3OS2A 3OYGA 4OLBA 4CJLA 4AILC 4CJUA 2VWJA 4ELVA 4KTZA 3TAPA 2ZE2A 3OS1A 1T03A 3HJFA 4M3UA 3LP1A 2HHXA 3TAEA 1JXBA 1HQUA 3O4NA 3HVRA 1UAXA 1RBUA 1WSHA 2HNZA 2IAJA 2Q3SA 4DFJA 3QEVA 2R7YA 1KVBA 3QEXA 4CE9A 1S6PA 2VG6A 2Z1GA 2VG7A 4JS5A 4W5NA 3DOLA 3IG1A 5FDLA 3BDPA 4M3XA 4B9MA 5HRPA 2A1SA 3VQAA 4C8LA 4HUGA 1MU2A 4F4KA 4KI6A 1NK5A 4CEDA 4ICLA 3OS0A 4F2RA 4IFVA 4E0DA 4F3OA 3HPGA 3AO5A 4NCGA 3M8SA 1TGOA 3SUQA 3THVA 5KI6A 5K14A 2IOCA 4CHYA 3NF6A 5JS2A 1HNIA 1A5WA 1TL1A 2KW4A 1S6QA 1CXUA 2XY6A 3KK3A 4CJWA 2G8UA 3RR7A 3HPOA 4W5OA 1S1VA 4KRFA 3LALA 2P5GA 3DRPA 2RN2A 4RW4A 3QNOA 4W5TA 2YKNA 2JLEA 3C6UA 3K5OA 4TSXA 1JKHA 2AJQA 1C0TA 2YV0X 4M45A 4OKKA 3CFPA 1JLEA 4AHSA 2P1JA 4L8RB 1SKWA 1FKPA 4PA1A 3HP9A 3WNEA 3ZSWA 4CJ3A 5KTQA 4OVLA 4K8XA 4M3RA 5KRTA 4NCBA 2P51A 2Z1HA 2O4IA 1R0AA 3VQ6A 3PV8A 1I3AA 3G0ZA 4BWJA 4FLUA 4Q5VA 3SQ4A 5D3GA 2BANA 4FK0A 4FK4A 3D45A 2FBXA 1ZBFA 1D5AA 3DI6A 3KLFA 3SYZA 4B3OA 1HYSA 3QERA 3OYDA 4C8NA 3TABA 4QOZB 4CIFA 3CFRA 4DU1A 5HLFA 1RT2A 1KLNA 4FZYA 4H8KA 3IRXA 4CJVA 2D0BA 2ZQBA 3LWMA 1RBVA 2LSNA 4CFCA 5KRSA 4DSJA 4B9SA 2HHVA 1TK5A 1U04A 3ALYA 3PUFA 3LDSA 2EHGA 4DSLA 1VSIA 3V1OA 4NYNA 4RW6A 2ITGA 3P1GA 4ID1A 3SNNA 5FROA 1T05A 2XO7A 2FBYA 4MQ3A 3PO5A 4M41A 4CJRA 1NK8A 1NK4A 4FJXA 3DOKA 4FCYA 3DLRA 3NF8A 3OYAA 3QIOA 4DQSA 1UA0A 1DTTA 1CZ9A 1ASUA 1QQCA 3PX4A 2PYJA 3HK2A 3VN5A 1TK0A 3FFIA 5I42A 1WSEA 3LPUA 1RTJA 2FC0A 1HQEA 3MECA 4DSFA 4DTJA 3TAFA 4CIGA 4CFDA 3LAMA 3LP0A 2DFEA 4RW7A 4Z4HA 3MEGA 3QIPA 3AO2A 2Z1IA 3KK2A 2E4LA 3K2PA 3A2FA 5HBMA 1N6QA 4Y1CA 4KHWA 2FBVA 2E6LA 2YNFA 3SV4A 4B9LA 1JLCA 2FBTA 3RMCA 2KZMA 5DMRA 4FLWA 4AHUA 3VQ8A 1EKEA 2GV9A 3RMBA 1SL0A 2B6AA 3NGZA 3WNGA 4AH9A 4CEEA 3EYZA 1SKRA 4PY5A 1VK0A 3WNFA 4CK3A 4UQGA 1T8EA 1IG9A 3KK1A 2YNIA 4O55A 1IKYA 1ASVA 3KLHA 5HRNA 1VSFA 2HNDA 4KTWA 3SV3A 3SUOA 3E01A 3OYHA 2X6SA 4GW6A 3NE6A 4JLHA 4BE0A 1HRHA 4CJSA 4NCAA 3AVGA 5CYMA 4FYDA 3AO4A 2YKMA 4OKJA 3AA3A 4CEZA 3VA3A 4M3WA 4F3TA 2HHQA 4AHRA 1Q8IA 4OGEA 3DMJA 4B08A 1RNHA 1RILA 3AVCA 3L2WA 4DTUA 1C1AA 1ZBHA 3JSMA 4ZHRA 3O4QA 5CZ1A 3TAMA 4FJKA 4FJNA 2HHTA 1S1TA 1QE1A 1TKTA 1IKWA 3HSTB 2ETJA 2QK9A 4LSLA 2HHSA 3LWLA 1DTQA 3P83D 1NOYA 1N5YA 4MFBA 4DLGA 2G8IA 2BDPA 4BE2A 4LSNA 2B4JA 3ZSOA 3G10A 1NJYA 3DLHA 1RT4A 3TI0A 3RWUA 2O4GA 2IC3A 4J2AA 3F9KA 5EU7A 2F96A 2VWKA 4B9VA 4KHUA 3NDKA 1GOCA 3AVNA 4CJ4A 2D0CA 1FKOA 1IH7A 3DLEA 1KCFA 4KKOA 1XHXA 2OPRA 1TK8A 1IO2A 1RT1A 3C94A 1ITGA 4HUFA 1QSYA 2F8SA 3NCIA 3ZSRA 4E1NA 4DMNA 1LWCA 1L3VA 1J53A 4KHQA 3RMAA 4CHOA 3DRRA 4FJ5A 4LH5A 1GOBA 3VQ7A 2WOMA 5HRSA 1RTHA 4FW2A 4CK2A 3JYTA 1RT3A 4CEQA 3KLIA 3L3VA 1WLJA 3KJVA 4FLYA 4BACA 1JL1A 1Q9YA 1KVAA 4E89A 4BE1A 3ZSZA 3HVTA 1ZBIA 3HO1A 2D5RA 3VA0A 2QKBA 2RPIA 4DU4A 1TAUA 4LD0A 4CEOA 1YTAA 2F8TA 2I5JA 1BHLA 1KTQA 1QHTA 3I0RA 1B92A 3V9UA 1U45A 4N41A 4FK2A 4M3TA 1NK9A 2QXFA 4CESA 3O3FA 1BGXT 2G8KA 4CGJA 1RT6A 3L2QA 4BWMA 4FLXA 2OZMA 3ZCMA 4O4GA 3PX6A 4C8KA 3AVJA 3KIOA 3SQ2A 1A5VA 1TL3A 3U3YA 1RTDA 4Z4EA 1YTUA 4DSKA 4F8RA 1YVUA 1BI4A 3AA2A 1S1XA 4E7KA 4CJQA 3RMDA 5CZ2A 3ZT2A 4CEFA 4W5QA 4JRPA 1VSHA 3B6OA 5CY4A 4ZTJA 3CM6A 4DTXA 3VQBA 4Y1DA 2W42A 3RRGA 1NJZA 4YNQA 3TR8A 2P5OA 4EP4A 4DS5A 4CHPA 4JRQA 4FJJA 5SZTA 3NH1A 3CYMA 3T3FA 1VSEA 4JS4A 1FK9A 1UA1A 4E1MA 4CHNA 1D9FA 2OZSA 4C8OA 1YT3A 2Y1JA 4E19A 3K59A 4Z0UA 1K6YA 1WAJA 1JL2A 2OPQA 4G1QA 4CGFA 4ELTA 3QEIA 4Z4IA 3K58A 3NAEA 1C0UA 4GMJB 3AA5X 2YHAA 3NHGA 3I0SA 1BCOA 1NK0A 3H08A 4AHVA 1FXXA 4CHZA 4HCBA 4Z4CA 4NYFA 4XIUA 1TKDA 1WSIA 1KLMA 1SUQA 2VG5A 3OYMA 4BDZA 5J2MA 4CEBA 3V1RA 4H4MA 4RW8A 1T7PA 3ISNC 3VQCA 3K5MA 4DF4A 3MEDA 4FJ7A 3IAYA 2DY4A 1IKVA 4O0JA 5KGXA 1CZBA 4PQUA 2GUIA 3LANA 3QO9A 3ZSYA 4KB0A 2RKIA 3AA4A 3C95A 3VQ5A 3SI6A 2G8FA 3C6TA 3SCXA 1J5OA 4DS4A 4CJ5A 4N76A 1EXQA 3NBPA 4FLTA 3U6FA 3BGRA 1KSPA 3AVMA 3NF9A 3NH2A 4CGDA 1WSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KLE A;  2G8W A;  3OYB A;  2ZD1 A;  1TV6 A;  3LP3 A;  3ZSQ A;  4AHC A;  4OPJ A;  1EET A;  1BIZ A;  4IFY A;  4HTU A;  3QES A;  1D8Y A;  1JLF A;  4DFK A;  3MXJ A;  1L3S A;  3HL8 A;  4OPK A;  4KV8 A;  2YHB A;  3AVK A;  3L3U A;  4AHT A;  4CF9 A;  4DQQ A;  2IGI A;  3L2U A;  1X1P A;  4H4O A;  4FZZ A;  4KHY A;  4N5S A;  1TVR A;  1LWF A;  2IDO A;  1NK7 A;  2XHB A;  1NK6 A;  4FJ8 A;  3L2V A;  4IDK A;  4CGH A;  3OYF A;  4KAZ A;  2WON A;  3V6D A;  1RDD A;  3TAR A;  3S3M A;  2YNG A;  1VSD A;  3SPZ A;  1X9S A;  4OLA A;  3VQ4 A;  1DLO A;  2X74 A;  1GOA A;  1L3T A;  3ASM A;  2DFH A;  4W5R A;  3AVA A;  3HYF A;  3D0P A;  4CGG A;  1HYZ A;  1UWB A;  4N56 A;  3CQ8 A;  4E7I A;  1B9F A;  1WN7 A;  1LWE A;  1KFS A;  4F2S A;  3DRS A;  3SQ1 A;  5E41 A;  4DTS A;  3OY9 A;  3IS9 A;  1WSJ A;  1HNV A;  2QKK A;  1SL1 A;  4KRE A;  1VSM A;  3HP6 A;  1CXQ A;  3OVN A;  1XI1 A;  1D9D A;  1BIU A;  4M42 A;  1KFD A;  2KQ2 A;  4DTN A;  3OYJ A;  1HMV A;  3VQ9 A;  3LAK A;  2PYL A;  2YNH A;  1TKZ A;  3HT3 A;  1J9A A;  1I39 A;  5J2N A;  1Q9X A;  1QSS A;  1KRP A;  1TKX A;  2A1R A;  3VQQ A;  4DSE A;  2HW3 A;  3EZ5 A;  3K57 A;  3TAN A;  4J2E A;  1VSJ A;  2B5J A;  4HVJ A;  2IS3 A;  3QET A;  4Q0B A;  3AO1 A;  4B9N A;  4KHS A;  3HPH A;  4CF1 A;  3LP2 A;  3TWH A;  1Z26 A;  1Y97 A;  1ZBU A;  4FZX C;  2HVH A;  4CJK A;  4KHN A;  3DLK A;  4WE1 A;  4KI4 A;  1C6V A;  2RF2 A;  3M8Q A;  4ZTF A;  1ZBL A;  1VRT A;  2XY8 A;  3L8B A;  1RT7 A;  1O1W A;  3LZI A;  3S3O A;  4KB1 A;  4DTP A;  3T1A A;  1HPZ A;  1SV5 A;  2NUB A;  3QIN A;  2PZS A;  3L2R A;  4HUE A;  1XC9 A;  1XWL A;  5HRR A;  4J2B A;  1G15 A;  1XHZ A;  2JGU A;  1NKE A;  1Z25 A;  4CEA A;  3AO3 A;  1SL2 A;  1L5U A;  2HNY A;  3EY1 A;  4DLE A;  3KKR A;  4E7L A;  4FLV A;  1HJR A;  2X78 A;  2KTQ A;  4DSI A;  3SUP A;  1U49 A;  1X9M A;  1RDB A;  1QTM A;  1C1B A;  4CER A;  3OYE A;  4DQR A;  2G8H A;  4CF2 A;  4DFP A;  3TAQ A;  5T7B A;  3KTQ A;  4ID5 A;  4BDP A;  3RRH A;  1X9W A;  2OPP A;  4EZ6 A;  4OJR A;  3ZSV A;  4Z4F A;  4CJT A;  2HB5 A;  3DLB A;  4IG3 A;  4CFB A;  5J1E A;  1NJX A;  4DF8 A;  4PWD A;  3DLG A;  5SWM A;  4M3Z A;  1WSF A;  3U3G A;  4KPY A;  1NKC A;  4CHQ A;  4DQP A;  2DFF A;  3OYC A;  3HXM A;  3CG7 A;  3KD5 E;  1NKB A;  2HMI A;  3NF7 A;  4Z4G A;  1JLQ A;  4DTM A;  5DK5 A;  3LZJ A;  4OGC A;  4FXD A;  2PY5 A;  3NFA A;  2DTU A;  1C1C A;  4K8Z A;  1LAW A;  3ZT0 A;  1F21 A;  4FJG A;  3ITH A;  4KFB A;  1VSK A;  1WNS A;  3MAQ A;  1JLA A;  1JXE A;  3T19 A;  3V9S A;  5J2Q A;  3TAG A;  3V9Z A;  2KFZ A;  4I2P A;  1IKX A;  4I7F A;  3KLG A;  5J2P A;  4EZ9 A;  3MXI A;  5KGW A;  4BDY A;  4RG8 A;  4EP5 A;  2G8V A;  1WAF A;  3PY8 A;  3NH0 A;  3AVF A;  3M8P A;  4J2D A;  1J54 A;  4B8C A;  1NJW A;  5FRM A;  3VQP A;  1BQN A;  1JLB A;  3DM2 A;  1BIS A;  5C25 A;  1C0M A;  3VQE A;  3I8D A;  3ZT4 A;  1REV A;  3QLH A;  4CJP A;  3SUN A;  1S9E A;  2OPS A;  4CK1 A;  4O44 A;  4CIE A;  4R5P A;  4B8A B;  3OYI A;  2XY7 A;  3S9H A;  3QEP A;  3KD1 E;  2XRI A;  3S3N A;  3O3H A;  1U4B A;  3OYK A;  3VQD A;  4CF0 A;  5I3U A;  3PX0 A;  2HHW A;  1B9D A;  3O3G A;  5FRN A;  5C42 A;  3M8R A;  1A5X A;  1RCH A;  3V4I A;  2BGG A;  4C8M A;  4PUO A;  1U47 A;  1RTI A;  4LY7 A;  3SJJ A;  3UIQ A;  4KTQ A;  3RR8 A;  2HHU A;  3NGI A;  4ELU A;  1S5J A;  3KKS A;  4CF8 A;  3MXM A;  4QCL A;  3DYA A;  2Y1I A;  4HHT A;  1QSL A;  3SPY A;  2ATQ A;  1LW2 A;  1S1W A;  4I9L A;  4RW9 A;  5C24 A;  3V9W A;  1CLQ A;  3PO4 A;  4N47 A;  4DTR A;  2D0A A;  4KO0 A;  1BI4 B;  1KVC A;  3P5J A;  4B9T A;  3OJS A;  1NOZ A;  3AV9 A;  1RBT A;  4FM1 A;  1QS4 A;  4OKE A;  1L3U A;  4M3Y A;  5JS1 A;  1W9H A;  4HCC A;  1S9G A;  4DQI A;  1BL3 A;  2OA8 A;  3B6P A;  4YFU A;  1RT5 A;  3SZ2 A;  4I9Q A;  1UOC A;  4CJE A;  4I2Q A;  4LH4 A;  3MEE A;  4DG1 A;  3ULD A;  3V9X A;  4E7J A;  3ZT3 A;  3WNH A;  4FM2 A;  2GBZ A;  4CFA A;  4DTO A;  1SKS A;  3K5L A;  3AVI A;  5HP1 A;  3ZT1 A;  4FJL A;  1EX4 A;  5CYQ A;  1BQM A;  5HRO A;  4FJH A;  2KZZ A;  4CCH A;  4O5B A;  2EX3 A;  3CM5 A;  4FJ9 A;  3QNN A;  1BCM A;  4FW1 A;  1RDC A;  4B9U A;  4DFM A;  3OYN A;  4DWI A;  1RBR A;  2BE2 A;  3SQ0 A;  1LAV A;  1W0H A;  4E3S A;  2OYQ A;  3F73 A;  3LPT A;  3QEW A;  1EP4 A;  1S1U A;  3OJU A;  4FJI A;  2XY5 A;  2X6N A;  2HVI A;  3NGY A;  4E7H A;  1ZYQ A;  2KFN A;  4IKF A;  1VSL A;  3V81 A;  1JLG A;  1TAQ A;  3AVH A;  3AVL A;  4GVM A;  3ZSX A;  4CGI A;  2Z1J A;  3K5N A;  4DU3 A;  3CFO A;  4FLZ A;  3V1Q A;  1HYV A;  1LW0 A;  3OYL A;  4FJM A;  1RDA A;  3RTV A;  1RBS A;  4FM0 A;  2E6M A;  1LV5 A;  1VRU A;  1ASW A;  4QAG A;  4FVM A;  4CJF A;  4IG0 A;  3AVB A;  3HM9 A;  4IBN A;  4CEC A;  4O0I A;  1U48 A;  3OS2 A;  3OYG A;  4OLB A;  4CJL A;  4AIL C;  4CJU A;  2VWJ A;  4ELV A;  4KTZ A;  3TAP A;  2ZE2 A;  3OS1 A;  1T03 A;  3HJF A;  4M3U A;  3LP1 A;  2HHX A;  3TAE A;  1JXB A;  1HQU A;  3O4N A;  3HVR A;  1UAX A;  1RBU A;  1WSH A;  2HNZ A;  2IAJ A;  2Q3S A;  4DFJ A;  3QEV A;  2R7Y A;  1KVB A;  3QEX A;  4CE9 A;  1S6P A;  2VG6 A;  2Z1G A;  2VG7 A;  4JS5 A;  4W5N A;  3DOL A;  3IG1 A;  5FDL A;  3BDP A;  4M3X A;  4B9M A;  5HRP A;  2A1S A;  3VQA A;  4C8L A;  4HUG A;  1MU2 A;  4F4K A;  4KI6 A;  1NK5 A;  4CED A;  4ICL A;  3OS0 A;  4F2R A;  4IFV A;  4E0D A;  4F3O A;  3HPG A;  3AO5 A;  4NCG A;  3M8S A;  1TGO A;  3SUQ A;  3THV A;  5KI6 A;  5K14 A;  2IOC A;  4CHY A;  3NF6 A;  5JS2 A;  1HNI A;  1A5W A;  1TL1 A;  2KW4 A;  1S6Q A;  1CXU A;  2XY6 A;  3KK3 A;  4CJW A;  2G8U A;  3RR7 A;  3HPO A;  4W5O A;  1S1V A;  4KRF A;  3LAL A;  2P5G A;  3DRP A;  2RN2 A;  4RW4 A;  3QNO A;  4W5T A;  2YKN A;  2JLE A;  3C6U A;  3K5O A;  4TSX A;  1JKH A;  2AJQ A;  1C0T A;  2YV0 X;  4M45 A;  4OKK A;  3CFP A;  1JLE A;  4AHS A;  2P1J A;  4L8R B;  1SKW A;  1FKP A;  4PA1 A;  3HP9 A;  3WNE A;  3ZSW A;  4CJ3 A;  5KTQ A;  4OVL A;  4K8X A;  4M3R A;  5KRT A;  4NCB A;  2P51 A;  2Z1H A;  2O4I A;  1R0A A;  3VQ6 A;  3PV8 A;  1I3A A;  3G0Z A;  4BWJ A;  4FLU A;  4Q5V A;  3SQ4 A;  5D3G A;  2BAN A;  4FK0 A;  4FK4 A;  3D45 A;  2FBX A;  1ZBF A;  1D5A A;  3DI6 A;  3KLF A;  3SYZ A;  4B3O A;  1HYS A;  3QER A;  3OYD A;  4C8N A;  3TAB A;  4QOZ B;  4CIF A;  3CFR A;  4DU1 A;  5HLF A;  1RT2 A;  1KLN A;  4FZY A;  4H8K A;  3IRX A;  4CJV A;  2D0B A;  2ZQB A;  3LWM A;  1RBV A;  2LSN A;  4CFC A;  5KRS A;  4DSJ A;  4B9S A;  2HHV A;  1TK5 A;  1U04 A;  3ALY A;  3PUF A;  3LDS A;  2EHG A;  4DSL A;  1VSI A;  3V1O A;  4NYN A;  4RW6 A;  2ITG A;  3P1G A;  4ID1 A;  3SNN A;  5FRO A;  1T05 A;  2XO7 A;  2FBY A;  4MQ3 A;  3PO5 A;  4M41 A;  4CJR A;  1NK8 A;  1NK4 A;  4FJX A;  3DOK A;  4FCY A;  3DLR A;  3NF8 A;  3OYA A;  3QIO A;  4DQS A;  1UA0 A;  1DTT A;  1CZ9 A;  1ASU A;  1QQC A;  3PX4 A;  2PYJ A;  3HK2 A;  3VN5 A;  1TK0 A;  3FFI A;  5I42 A;  1WSE A;  3LPU A;  1RTJ A;  2FC0 A;  1HQE A;  3MEC A;  4DSF A;  4DTJ A;  3TAF A;  4CIG A;  4CFD A;  3LAM A;  3LP0 A;  2DFE A;  4RW7 A;  4Z4H A;  3MEG A;  3QIP A;  3AO2 A;  2Z1I A;  3KK2 A;  2E4L A;  3K2P A;  3A2F A;  5HBM A;  1N6Q A;  4Y1C A;  4KHW A;  2FBV A;  2E6L A;  2YNF A;  3SV4 A;  4B9L A;  1JLC A;  2FBT A;  3RMC A;  2KZM A;  5DMR A;  4FLW A;  4AHU A;  3VQ8 A;  1EKE A;  2GV9 A;  3RMB A;  1SL0 A;  2B6A A;  3NGZ A;  3WNG A;  4AH9 A;  4CEE A;  3EYZ A;  1SKR A;  4PY5 A;  1VK0 A;  3WNF A;  4CK3 A;  4UQG A;  1T8E A;  1IG9 A;  3KK1 A;  2YNI A;  4O55 A;  1IKY A;  1ASV A;  3KLH A;  5HRN A;  1VSF A;  2HND A;  4KTW A;  3SV3 A;  3SUO A;  3E01 A;  3OYH A;  2X6S A;  4GW6 A;  3NE6 A;  4JLH A;  4BE0 A;  1HRH A;  4CJS A;  4NCA A;  3AVG A;  5CYM A;  4FYD A;  3AO4 A;  2YKM A;  4OKJ A;  3AA3 A;  4CEZ A;  3VA3 A;  4M3W A;  4F3T A;  2HHQ A;  4AHR A;  1Q8I A;  4OGE A;  3DMJ A;  4B08 A;  1RNH A;  1RIL A;  3AVC A;  3L2W A;  4DTU A;  1C1A A;  1ZBH A;  3JSM A;  4ZHR A;  3O4Q A;  5CZ1 A;  3TAM A;  4FJK A;  4FJN A;  2HHT A;  1S1T A;  1QE1 A;  1TKT A;  1IKW A;  3HST B;  2ETJ A;  2QK9 A;  4LSL A;  2HHS A;  3LWL A;  1DTQ A;  3P83 D;  1NOY A;  1N5Y A;  4MFB A;  4DLG A;  2G8I A;  2BDP A;  4BE2 A;  4LSN A;  2B4J A;  3ZSO A;  3G10 A;  1NJY A;  3DLH A;  1RT4 A;  3TI0 A;  3RWU A;  2O4G A;  2IC3 A;  4J2A A;  3F9K A;  5EU7 A;  2F96 A;  2VWK A;  4B9V A;  4KHU A;  3NDK A;  1GOC A;  3AVN A;  4CJ4 A;  2D0C A;  1FKO A;  1IH7 A;  3DLE A;  1KCF A;  4KKO A;  1XHX A;  2OPR A;  1TK8 A;  1IO2 A;  1RT1 A;  3C94 A;  1ITG A;  4HUF A;  1QSY A;  2F8S A;  3NCI A;  3ZSR A;  4E1N A;  4DMN A;  1LWC A;  1L3V A;  1J53 A;  4KHQ A;  3RMA A;  4CHO A;  3DRR A;  4FJ5 A;  4LH5 A;  1GOB A;  3VQ7 A;  2WOM A;  5HRS A;  1RTH A;  4FW2 A;  4CK2 A;  3JYT A;  1RT3 A;  4CEQ A;  3KLI A;  3L3V A;  1WLJ A;  3KJV A;  4FLY A;  4BAC A;  1JL1 A;  1Q9Y A;  1KVA A;  4E89 A;  4BE1 A;  3ZSZ A;  3HVT A;  1ZBI A;  3HO1 A;  2D5R A;  3VA0 A;  2QKB A;  2RPI A;  4DU4 A;  1TAU A;  4LD0 A;  4CEO A;  1YTA A;  2F8T A;  2I5J A;  1BHL A;  1KTQ A;  1QHT A;  3I0R A;  1B92 A;  3V9U A;  1U45 A;  4N41 A;  4FK2 A;  4M3T A;  1NK9 A;  2QXF A;  4CES A;  3O3F A;  1BGX T;  2G8K A;  4CGJ A;  1RT6 A;  3L2Q A;  4BWM A;  4FLX A;  2OZM A;  3ZCM A;  4O4G A;  3PX6 A;  4C8K A;  3AVJ A;  3KIO A;  3SQ2 A;  1A5V A;  1TL3 A;  3U3Y A;  1RTD A;  4Z4E A;  1YTU A;  4DSK A;  4F8R A;  1YVU A;  1BI4 A;  3AA2 A;  1S1X A;  4E7K A;  4CJQ A;  3RMD A;  5CZ2 A;  3ZT2 A;  4CEF A;  4W5Q A;  4JRP A;  1VSH A;  3B6O A;  5CY4 A;  4ZTJ A;  3CM6 A;  4DTX A;  3VQB A;  4Y1D A;  2W42 A;  3RRG A;  1NJZ A;  4YNQ A;  3TR8 A;  2P5O A;  4EP4 A;  4DS5 A;  4CHP A;  4JRQ A;  4FJJ A;  5SZT A;  3NH1 A;  3CYM A;  3T3F A;  1VSE A;  4JS4 A;  1FK9 A;  1UA1 A;  4E1M A;  4CHN A;  1D9F A;  2OZS A;  4C8O A;  1YT3 A;  2Y1J A;  4E19 A;  3K59 A;  4Z0U A;  1K6Y A;  1WAJ A;  1JL2 A;  2OPQ A;  4G1Q A;  4CGF A;  4ELT A;  3QEI A;  4Z4I A;  3K58 A;  3NAE A;  1C0U A;  4GMJ B;  3AA5 X;  2YHA A;  3NHG A;  3I0S A;  1BCO A;  1NK0 A;  3H08 A;  4AHV A;  1FXX A;  4CHZ A;  4HCB A;  4Z4C A;  4NYF A;  4XIU A;  1TKD A;  1WSI A;  1KLM A;  1SUQ A;  2VG5 A;  3OYM A;  4BDZ A;  5J2M A;  4CEB A;  3V1R A;  4H4M A;  4RW8 A;  1T7P A;  3ISN C;  3VQC A;  3K5M A;  4DF4 A;  3MED A;  4FJ7 A;  3IAY A;  2DY4 A;  1IKV A;  4O0J A;  5KGX A;  1CZB A;  4PQU A;  2GUI A;  3LAN A;  3QO9 A;  3ZSY A;  4KB0 A;  2RKI A;  3AA4 A;  3C95 A;  3VQ5 A;  3SI6 A;  2G8F A;  3C6T A;  3SCX A;  1J5O A;  4DS4 A;  4CJ5 A;  4N76 A;  1EXQ A;  3NBP A;  4FLT A;  3U6F A;  3BGR A;  1KSP A;  3AVM A;  3NF9 A;  3NH2 A;  4CGD A;  1WSG A; 
#chains in the Genus database with same CATH topology
 3OYB A;  2NNW A;  2ZD1 A;  5AFU H;  3VTH A;  3I56 N;  3HTV A;  4HTU A;  1BIZ A;  4DFK A;  3MXJ A;  1YF5 L;  4DQQ A;  3L3U A;  2IGI A;  4UY8 O;  1NMD A;  5C12 A;  2IDO A;  5BR9 A;  3H46 O;  4WQ5 A;  5AQL A;  2GUP A;  1NK6 A;  4IDK A;  3OYF A;  2WON A;  1VSD A;  3SPZ A;  1X9S A;  5M1P A;  3C7N A;  2X74 A;  3DXK A;  4YDU A;  3MX2 A;  3L0Q A;  3WXL A;  4E7I A;  3CQ8 A;  1KFS A;  1LWE A;  3DRS A;  4DTS A;  4MDA A;  1HNV A;  5ADX A;  2QKK A;  5LY3 A;  1CXQ A;  2KQ2 A;  4FWP A;  3VQ9 A;  3LAK A;  3NVM A;  1J9A A;  1Q9X A;  3E9P A;  3GDQ A;  4JKG B;  3TAN A;  3NMU A;  4WQ5 C;  5A2Q O;  3AO1 A;  4B9N A;  4FVU A;  1HLU A;  4JD2 B;  1Z26 A;  1H1V A;  2HVH A;  3DLK A;  4WE1 A;  4YDU C;  1C6V A;  2XY8 A;  3L8B A;  4V19 S;  1NGD A;  5E84 A;  2PZS A;  5BPL A;  4A62 A;  2JGU A;  3CCU N;  3AO3 A;  2J4R A;  1YJW N;  1L5U A;  4DLE A;  3B8A X;  2UXB K;  1YIT N;  1U49 A;  4YOW A;  3ENH A;  3LDO A;  1XMO K;  3MCP A;  1KXP A;  2O8B A;  3VEZ A;  4OJR A;  3ZSV A;  3KWG A;  4CFB A;  1NJX A;  4FPB A;  3R8E A;  2ZJQ L;  1KC8 O;  4M3Z A;  1WSF A;  4KPY A;  1MDU B;  2YX6 A;  1ZC6 A;  3CG7 A;  3MMV A;  4KH5 A;  3BZK A;  3CC7 N;  4FXD A;  2GX9 A;  2PY5 A;  1LAW A;  1VSK A;  1JLA A;  1JXE A;  5J2Q A;  3AAQ A;  2KFZ A;  5BN8 A;  4I7F A;  4MO5 A;  4EZ9 A;  5KGW A;  1WAF A;  4A5A A;  4B3S K;  1BQN A;  4PHT X;  5C25 A;  3VQE A;  3SUN A;  2Q0R A;  4CIE A;  3CCQ N;  4IOC L;  3BEX A;  2WFB A;  2XRI A;  3S3N A;  4CF0 A;  5I3U A;  1B9D A;  4FO0 A;  2E2N A;  1A5X A;  4K43 A;  1RCH A;  4CZE A;  4PUO A;  1RTI A;  4LY7 A;  5FLX O;  4CF8 A;  1R59 O;  3KKS A;  3MN9 A;  4HHT A;  4YOV A;  3SPY A;  1QSL A;  1LW2 A;  4RW9 A;  3PO4 A;  3H3N O;  3WEE A;  4N47 A;  1BI4 B;  1T3V A;  1BG3 A;  4B9T A;  3OJS A;  1NOZ A;  4BRC A;  2NRV A;  1NG9 A;  3QDK A;  1W9H A;  3VGM A;  1VQL N;  5JLH A;  2OA8 A;  3SZ2 A;  3O5B A;  4EFH A;  4AQY K;  4DTO A;  1KD1 O;  4FJL A;  5CE3 A;  1BQM A;  3DXM B;  3ULE B;  4FJH A;  2UUC K;  4O5B A;  5C15 A;  4WYB A;  3WXI A;  1QVG M;  1NM1 A;  2I7N A;  2BE2 A;  1W0H A;  3HOT A;  3QEW A;  5LMN K;  4WQ4 A;  3J7A P;  4E7H A;  5AQS A;  4KH4 A;  2P9K B;  3ZSX A;  4CGI A;  2Z1J A;  4FLZ A;  1RBS A;  1ASW A;  4CJF A;  2Q2R A;  4BRF A;  3O4W A;  1GLC G;  3L4Q A;  2VWJ A;  4KTZ A;  1WOQ A;  2ZE2 A;  1T03 A;  3LP1 A;  2HHX A;  2HST A;  3HVR A;  1UAX A;  2HNZ A;  2Z1G A;  1T44 A;  2VG7 A;  4JS5 A;  2P9U B;  3KK7 A;  3KZB A;  3QFP A;  3J7Z O;  2YHX A;  5HRP A;  2P9P A;  4C8L A;  4E1J A;  5LMU K;  1W2B M;  2BUP A;  4E0D A;  4WQ4 C;  3HPG A;  1TGO A;  3THV A;  5KI6 A;  5K14 A;  4CHY A;  3D6R A;  1TL1 A;  3ZX2 A;  2XY6 A;  3EZW A;  5JIC A;  2P5G A;  2RN2 A;  4B1X B;  3ZYY X;  4FPA A;  3FE1 A;  3MWP A;  4JYA K;  4DR1 K;  2YV0 X;  4JI0 K;  3EEQ A;  4M7X A;  2ZJP L;  4GNI A;  4ISG A;  1R0A A;  4FLU A;  5D3G A;  3SQ4 A;  2BAN A;  4FK0 A;  2Q0U A;  2FBX A;  3P38 A;  1NJI O;  1P8Z A;  4A57 A;  4C8N A;  2P9S A;  4WFN L;  4B3M K;  4CJV A;  3LWM A;  2ZQB A;  3W3D A;  1SZ2 A;  1BA1 A;  4C1N I;  2P9L B;  4NYN A;  4ID1 A;  2D4W A;  1ZXO A;  3EO3 A;  2FBY A;  2F9T A;  3PO5 A;  4LF5 K;  4GKJ K;  1NK4 A;  3DLR A;  3OYA A;  2ZGZ A;  4DQS A;  1CZ9 A;  3PX4 A;  2PYJ A;  3SMP A;  3VN5 A;  3UKU A;  3CJ1 A;  5I42 A;  1WSE A;  3LPU A;  1RTJ A;  2FC0 A;  1HQE A;  4AM6 A;  4RW7 A;  2DFE A;  1U2V A;  3O8M A;  2A3Z A;  2H3G X;  3K2P A;  1SS6 A;  5LJW A;  3D2E B;  4Y1C A;  4KHW A;  5AQF A;  4B9L A;  2CGK A;  2FBT A;  3TSP A;  4FLW A;  4MLE A;  1EKE A;  1K8K B;  1VQ6 N;  4WF9 L;  1SL0 A;  2B6A A;  3NGZ A;  3WNG A;  4AH9 A;  4PY5 A;  1SKR A;  3N4Q A;  4CK3 A;  3WNF A;  4UQG A;  4A61 A;  2D0P A;  3SV3 A;  1SAZ A;  2HND A;  4DWI A;  3OYH A;  5CYM A;  4FYD A;  3AO4 A;  3SLC A;  2VQE K;  4B08 A;  1RNH A;  1TKT A;  2P9I B;  1LCU A;  1DTQ A;  1VQM N;  4LSN A;  3TI0 A;  3RWU A;  2HBK A;  3I33 A;  4JKH A;  5EX5 A;  4H0Y B;  5F0X A;  1X9J A;  4H5V A;  1FKO A;  1IH7 A;  4DUY K;  1O13 A;  4BR9 A;  1IJJ A;  2OPR A;  1L3V A;  4KHQ A;  1VQO N;  2QM1 A;  4CHO A;  3DRR A;  3ID8 A;  3O9R A;  1VQP N;  3CCM N;  5HRS A;  4A5B A;  3CCV N;  3JYT A;  1EWR A;  4CEQ A;  2GTD A;  1WLJ A;  4BVO A;  4B1W B;  3HVT A;  1ZBI A;  1BHL A;  4YOT A;  3V9U A;  4DHY A;  3PSF A;  3O3F A;  1BO5 O;  3GOI A;  1S72 N;  1RT6 A;  2NRW A;  2Q1N A;  3U4L A;  1RTD A;  1TL3 A;  1YTU A;  4F8R A;  4CI6 A;  1NGG A;  4IO8 A;  3QBW A;  3A0I X;  4W5Q A;  3B6O A;  2O8D B;  2QWO A;  4Y1D A;  1NU0 A;  4H5T A;  3RRG A;  3CD6 N;  4EP4 A;  2NRT A;  4CHP A;  4EHU A;  3KVG A;  3NH1 A;  3T3F A;  1VSE A;  4E1M A;  4CHN A;  1D9F A;  2OZS A;  4IJA A;  1HR0 K;  2Y1J A;  2HOE A;  4JNE A;  4IFE A;  1K6Y A;  4JI4 K;  1WAJ A;  3NVK A;  4X64 K;  3NAE A;  4GMJ B;  1NK0 A;  3AA5 X;  3BF3 A;  4CHZ A;  3A5N C;  4DV2 K;  1WSI A;  1KLM A;  5J2M A;  2VG5 A;  5AQU A;  4FWL A;  4H4M A;  4H5R A;  4FJ7 A;  3MED A;  1IKV A;  4JI2 K;  4CZI A;  5KGX A;  3LAN A;  4QS7 A;  3ZSY A;  5BRE A;  5LL6 Z;  3SCX A;  4H0X B;  1EXQ A;  3WT0 A;  2F4V K;  4B3R K;  3CQX A;  1Q86 O;  4CGD A;  5AR0 A;  2OAN A;  3EE9 A;  1WSG A;  3KLE A;  2G8W A;  4LF4 K;  4IFY A;  5GAD P;  5KQ8 A;  1JLF A;  4JKD A;  2YHB A;  3AVK A;  4H4O A;  4N5S A;  1NK7 A;  4H5N A;  3L2V A;  4CGH A;  3M3Z A;  1Z05 A;  1OH8 A;  2YNG A;  1VQ8 N;  4OLA A;  2DFH A;  4W5R A;  3AVA A;  1HYZ A;  1UWB A;  4N56 A;  1B9F A;  1WN7 A;  4F2S A;  5E41 A;  1WSJ A;  4BR4 A;  1J6Z A;  3HP6 A;  2UYT A;  1KFD A;  4DTN A;  3OYJ A;  1HMV A;  4BRD A;  1S3X A;  2O8F A;  3G71 N;  2PYL A;  1TKZ A;  1QSS A;  1I39 A;  2A1R A;  4DSE A;  4BC3 A;  3HM8 A;  3K57 A;  2F9W A;  2IS3 A;  4Q0B A;  4KHS A;  3WXM B;  3CC4 N;  3TWH A;  1Y97 A;  4L3Q A;  4CJK A;  3H1Q A;  4ZTF A;  2O8E A;  1RT7 A;  3EN9 A;  1O1W A;  3S3O A;  2V7Y A;  1ILY A;  4DTP A;  1YVN A;  3ZX3 A;  3T1A A;  1KAY A;  1HPZ A;  2NUB A;  3QIN A;  1W97 L;  3TU5 A;  3ZLJ A;  4J2B A;  3F9M A;  2NZT A;  4CEA A;  4LC9 B;  4E7L A;  1HJR A;  1X9M A;  4CER A;  4DQR A;  4CF2 A;  4U67 L;  4ILJ A;  1K9M O;  3KTQ A;  4ID5 A;  4BDP A;  1NGF A;  5AQH A;  2QWP A;  4EZ6 A;  4Z4F A;  3SBT A;  1XQS C;  5J1E A;  4H0V B;  3ZET B;  4BRG A;  5C2F A;  1NKC A;  4BGB A;  3KD5 E;  2CH5 A;  5AZI B;  4DTM A;  1SQK A;  4CVN E;  4CD1 A;  3TTF A;  3LZJ A;  1K73 O;  1YIJ N;  4OGC A;  2VWB A;  4H5W A;  4A2A A;  1N36 K;  2DTU A;  2QXL A;  2UUB K;  1F21 A;  3GE1 A;  4KFB A;  3MAQ A;  3TAG A;  5E26 A;  2VQF K;  3V9S A;  1QVF M;  1HKG A;  3PIP L;  3KLG A;  4DV3 K;  1BDG A;  2YJE A;  4EP5 A;  3DJC A;  2G8V A;  5AQX A;  5KQD A;  3PY8 A;  3NH0 A;  1Q18 A;  1J54 A;  2F7T A;  3A5O C;  2VYP A;  3HO1 A;  1S9E A;  2XY7 A;  4B8A B;  3OYI A;  5EXW A;  1NGJ A;  2BTF A;  3KD1 E;  1U4B A;  2WUS A;  2HHW A;  3C65 A;  3ZEU A;  5C42 A;  3V4I A;  1U47 A;  4BRA A;  3RR8 A;  1ATN A;  3THX A;  3CI5 A;  4ELU A;  1S5J A;  2Y1I A;  4I9L A;  1NGC A;  3PIO L;  5F1X A;  5GIP A;  3VEW A;  1KVC A;  2NRH A;  4ILG B;  1XUP O;  4M3Y A;  1HX1 A;  4HCC A;  3K9J A;  4C23 A;  3V9X A;  4I2Q A;  4LH4 A;  4M63 C;  4DG1 A;  4E7J A;  3WNH A;  3MX5 A;  4MO4 A;  4BRN A;  1SKS A;  3K5L A;  3AVI A;  3ZT1 A;  4O8K A;  3AAR A;  2AP1 A;  5HRO A;  3TPQ A;  4CCH A;  3D2F A;  4FJ9 A;  1RDC A;  3I55 N;  1RBR A;  4O5F A;  2NRR A;  3SQ0 A;  4GVE A;  3OJU A;  4JHD A;  5DM7 L;  3VF6 A;  2HVI A;  3BUZ B;  5AQK A;  3NGY A;  2KFN A;  4BRQ A;  3AGR A;  3TSU A;  2IVN A;  4IJN A;  1E4G T;  1JLG A;  3A5M C;  3AVL A;  5H1S Q;  4JI7 K;  2ZWH A;  4FL9 A;  3RTV A;  4FM0 A;  2CH6 A;  2E6M A;  3OA9 A;  4IG0 A;  4CEC A;  4O0I A;  1U48 A;  4FWQ A;  4CJL A;  1VQ9 N;  4JI5 K;  4FWS A;  1YUW A;  3TAE A;  4DFJ A;  2VCP A;  1RBU A;  1WSH A;  2R7Y A;  1KVB A;  1RDU A;  2ZM6 K;  3O1W A;  3DOL A;  4IZ9 A;  3QFU A;  3BDP A;  4M3X A;  1Q81 O;  1VAZ A;  4CJ7 A;  1NBW A;  5AQG A;  2QI2 A;  1MU2 A;  3O9S A;  1NK5 A;  4F2R A;  4F3O A;  2GEM A;  3M8S A;  3SAH A;  2IOC A;  3NF6 A;  1HNI A;  3C7N B;  1A5W A;  3DXK B;  2ITM A;  3CJC A;  5AQR A;  4DKW A;  1NWK A;  2HBM A;  3HPO A;  1BU6 O;  2YCH A;  3QNO A;  2YKN A;  2AJQ A;  4TSX A;  2UUA K;  3CFP A;  4L8R B;  1FKP A;  5KTQ A;  3HP9 A;  3WNE A;  3ZSW A;  3GG4 A;  5DM6 L;  4M3R A;  4CBW A;  2O4I A;  1QQN A;  3VEV A;  2ASO A;  4Z94 A;  4B1V A;  4DB3 A;  5AQV A;  3D45 A;  1XMQ K;  1ZBF A;  1D5A A;  3DI6 A;  3SYZ A;  4B3O A;  1HYS A;  4BGA A;  3QER A;  3TAB A;  4QOZ B;  4DU1 A;  5HLF A;  1KLN A;  2OTJ N;  1RGI A;  2VGN A;  1YJ9 N;  2LSN A;  5KRS A;  4B9S A;  1C0G A;  1YJN N;  1TK5 A;  5HOO A;  1U04 A;  3ALY A;  3P1G A;  3VET A;  4EIA A;  1T05 A;  2XO7 A;  4M41 A;  3BY5 A;  1NK8 A;  4FJX A;  3ENO A;  3QIO A;  2FLO A;  2E8A A;  4QS9 A;  1HPM A;  1DTT A;  1QQC A;  1TK0 A;  1GLL O;  3CC2 N;  3WXK A;  4DTJ A;  4DSF A;  3TAF A;  3THY A;  4CIG A;  4Z4H A;  2ASM A;  3LP0 A;  3L4I A;  5JLF A;  4JAX A;  3QIP A;  1MWK A;  3O9T A;  2Z1I A;  3KK2 A;  2O8B B;  5HBM A;  3VPZ A;  1N6Q A;  5BN9 A;  4DQ8 A;  1N33 K;  1VQ7 N;  2GWJ A;  1JLC A;  1NGE A;  2KKZ A;  4NLC A;  5ADX H;  5JVH L;  2KZM A;  3VQ8 A;  1QZ5 A;  3OHR A;  3EYZ A;  4CEE A;  1IG9 A;  1T6D A;  4O55 A;  4BG8 A;  5HRN A;  4WCE L;  3NE6 A;  2X6S A;  4NCA A;  2V7Z A;  4DR6 K;  4OKJ A;  3VA3 A;  2HHQ A;  4AHR A;  1Q8I A;  3DMJ A;  4LF8 K;  3L2W A;  3O4Q A;  1TYQ A;  1S1T A;  5M1F A;  3IMX A;  2QK9 A;  2ETJ A;  4LSL A;  1HKC A;  3MDQ A;  1BUP A;  1YI2 N;  1N5Y A;  4MFB A;  2BDP A;  4BE2 A;  2HBJ A;  2W6L A;  3ZSO A;  2GWK A;  3DLH A;  5M1N A;  3IUC A;  1D4X A;  3F5T A;  1HJO A;  5EU7 A;  4B9V A;  3NDK A;  4FSV A;  1GOC A;  1J5E K;  2D0C A;  4BRP A;  4BQZ A;  1KCF A;  3C94 A;  2E20 A;  3RMA A;  4FJ5 A;  4HTL A;  1GOB A;  4LH5 A;  3WEE B;  2WOM A;  1EWQ A;  4CK2 A;  5LJV A;  4A2B A;  3KJV A;  4KH6 A;  4PKH A;  1Q9Y A;  3CHW A;  5BPN A;  1KVA A;  3CJA A;  1VQK N;  4HWI A;  3VA0 A;  3QIC A;  2RPI A;  4H03 B;  4DU4 A;  1TAU A;  2PFU A;  2F8T A;  2E5L K;  1NK9 A;  2QXF A;  3R9P A;  4CGJ A;  4DR3 K;  3CER A;  3L2Q A;  4BWM A;  2OZM A;  2RE2 A;  3KIO A;  3U3Y A;  1YVU A;  1S1X A;  3BF1 A;  1E3M A;  1I94 K;  4CJQ A;  3RMD A;  1OH7 A;  5CY4 A;  3CCJ N;  3U9D A;  1NNE A;  3CM6 A;  4DTX A;  4YNQ A;  4OPH A;  3O08 A;  2P5O A;  2V52 B;  4DS5 A;  4O8U A;  5FPE A;  2HHH K;  1V4S A;  4PKI A;  3LM2 A;  1GLB G;  1P90 A;  2W40 A;  4G1Q A;  5CR4 A;  3LL3 A;  2VGM A;  3A8Y A;  2P9P B;  4BC4 A;  1C0U A;  3H08 A;  1FXX A;  2WC9 A;  1TKD A;  1SUQ A;  4I6M A;  3FR0 A;  4BDZ A;  1YHQ N;  1T7P A;  1ESV A;  2Q31 A;  3K5M A;  4DF4 A;  2DY4 A;  4O0J A;  1CZB A;  2PBD A;  2FSJ A;  2RKI A;  2G8F A;  3C6T A;  4DS4 A;  3U6F A;  4CZH A;  4BC2 A;  3CF5 L;  1N32 K;  3LP3 A;  3ZSQ A;  4AHC A;  1EET A;  4H0O A;  3N4P A;  3HL8 A;  4OPK A;  4KV8 A;  3L2U A;  1X1P A;  4FZZ A;  2BH1 A;  4BRH A;  5AQY A;  5KPZ A;  2P9S B;  1RDD A;  3S3M A;  1OVY A;  1TUY A;  2QWL A;  4A59 A;  1DLO A;  3AAP A;  1L3T A;  3HYF A;  3D0P A;  4CZK A;  3P39 A;  4CGG A;  4OO1 J;  2QEX N;  4DV4 K;  3SQ1 A;  3ZX0 A;  4JI6 K;  3PSI A;  1GLD G;  4R79 A;  5M1K A;  3LDQ A;  3FFK B;  3OVN A;  1BIU A;  4M42 A;  3UB5 A;  4JV5 K;  2P9N A;  5J2N A;  3HT3 A;  3UKU B;  3VQQ A;  2HW3 A;  3EZ5 A;  2I7P A;  1VHX A;  4J2E A;  2B5J A;  3CPE A;  3THW A;  4B9Q A;  1U2V B;  4CF1 A;  1ATS A;  2FSN A;  1ZBU A;  4FZX C;  3ATU A;  3M8Q A;  3R6M A;  4BR7 A;  3SAF A;  3DAW A;  5GAG P;  1FJG K;  3C0B A;  3CJB A;  1SV5 A;  3L2R A;  4G9Z A;  1XC9 A;  4FWR A;  3C6A A;  1G15 A;  3O9Q A;  2QA4 N;  1XHZ A;  1NKE A;  1Z25 A;  4KHP K;  2X78 A;  2KTQ A;  4DSI A;  3SUP A;  2FF6 A;  1RDB A;  1C1B A;  2G8H A;  2E2P A;  4DFP A;  4RCH A;  5T7B A;  5F2R A;  3RRH A;  1X9W A;  1JJ2 M;  1XC3 A;  2UXC K;  3O9U A;  4NXM K;  1JCG A;  4EAH D;  4RWT A;  5AQQ A;  3U3G A;  4DQP A;  2DFF A;  3HXM A;  2HMI A;  1QZ6 A;  5DK5 A;  4FWM A;  1BWF O;  1QHA A;  3NFA A;  4MDB A;  3ZT0 A;  4K41 A;  5C2D A;  2OTL N;  4ILH A;  3V9Z A;  1NGA A;  5J2P A;  4BDY A;  4RG8 A;  2KHO A;  4J2D A;  3SJH A;  1NJW A;  4GKK K;  3VQP A;  1JLB A;  1BIS A;  1C0M A;  3I8D A;  3ZT4 A;  4CK1 A;  3H6E A;  2O8C A;  3CIP A;  1IBK K;  3O3H A;  3OYK A;  5AZJ A;  3VQD A;  4XEI A;  3O3G A;  3KHY A;  3E9O A;  4B3T K;  4ISE A;  5FRN A;  5GIO A;  3M8R A;  4J8F A;  2BGG A;  1NMN A;  2IIR A;  4C8M A;  3FZM A;  3UE5 A;  4KTQ A;  3SJJ A;  3UIQ A;  3P4I A;  4BC5 A;  1EO1 A;  3MXM A;  3DYA A;  1S1W A;  1CLQ A;  1RBT A;  4FM1 A;  1HNX K;  4BRO A;  3CMA N;  5JS1 A;  3E9L A;  1S9G A;  3HI0 A;  1JCF A;  4IDH A;  2ASP A;  2A6A A;  3B6P A;  4YFU A;  1FW6 A;  1UOC A;  3MEE A;  5AQN A;  3ZT3 A;  4CFA A;  5HP1 A;  1T6C A;  3MWT A;  5ELZ A;  5CYQ A;  4LFB K;  4BRL A;  3CM5 A;  3QNN A;  1BCM A;  4FW1 A;  5C10 A;  4B9U A;  4DFM A;  4CBU A;  3OYN A;  4DUZ K;  3SBG A;  5AFU A;  4E3S A;  2UU9 K;  4NXN K;  2XY5 A;  1ZYQ A;  4IKF A;  1VSL A;  3J8A A;  2FF3 B;  3AVH A;  4GVM A;  4DU3 A;  2DPN A;  4C1N K;  3V1Q A;  4CZF A;  1HYV A;  5IWA K;  3OYL A;  4FJM A;  1NGB A;  4DR7 K;  3RSE A;  2CGL A;  1LOT B;  3HM9 A;  5GIN A;  3OS2 A;  4ELV A;  3OS1 A;  3HJF A;  4M3U A;  5MLC Q;  3O4N A;  4BVP A;  2Q3S A;  3UKR A;  3QEX A;  3QEV A;  3G6E N;  2VG6 A;  3LDN A;  4W5N A;  5FDL A;  2A1S A;  3VQA A;  4HUG A;  4LF7 K;  4F4K A;  5AQZ A;  3HZ6 A;  3O1B A;  4ICL A;  3AO5 A;  3SUQ A;  2QWN A;  2KW4 A;  4CZM A;  4BR5 A;  3FGU A;  3KK3 A;  2OCE A;  4YOR A;  2G8U A;  3RR7 A;  1S1V A;  3LAL A;  3G25 A;  3DRP A;  5M1O A;  4RW4 A;  2JLE A;  3IKM A;  3K5O A;  1JKH A;  3CCR N;  4OKK A;  4AHS A;  2P1J A;  1X3N A;  4PA1 A;  2O8F B;  2P51 A;  2Z1H A;  1I3A A;  3G0Z A;  4BWJ A;  1OH5 A;  1X3M A;  4Q5V A;  3PLA A;  1E4F T;  3TSQ A;  3CFR A;  4FZY A;  4CFC A;  3LDL A;  4DSJ A;  1XNQ K;  3VER A;  2O8E B;  3PUF A;  3LDS A;  2EHG A;  2E1Z A;  4OX9 K;  3V1O A;  2ITG A;  5FRO A;  3AVM A;  3QBX A;  4DV1 K;  3DOK A;  3D7E O;  3P31 A;  5KPT A;  4IO9 L;  1ASU A;  3VEY A;  3HK2 A;  1W7A A;  3OBW A;  4CBX A;  3FFI A;  4XH1 A;  1CZA N;  3F2K A;  4JKG A;  1TUU A;  3LAM A;  3CCE N;  1Q7Y O;  4MLH A;  3AO2 A;  3E66 A;  2E4L A;  3A2F A;  4JD2 A;  4DR5 K;  2FBV A;  2E6L A;  3RMC A;  1WUA A;  2D1K A;  3EE8 A;  5DMR A;  4H0T B;  4AHU A;  5AQO A;  5I9E B;  3Q7C A;  5AQI A;  2A42 A;  1VK0 A;  1OVQ A;  1T8E A;  3KK1 A;  2YNI A;  1IBM K;  5C0Y A;  1IKY A;  1ASV A;  3KLH A;  1VSF A;  4KTW A;  3E01 A;  4GW6 A;  5FPD A;  4JLH A;  4BE0 A;  2YKM A;  3AA3 A;  4M3W A;  4F3T A;  4B1U B;  3VGK A;  3MCA B;  4DTU A;  1RIL A;  1ZBH A;  1C1A A;  3JSM A;  4ZHR A;  5CZ1 A;  3TAM A;  4FJK A;  4FJN A;  4IOA L;  3QML A;  1IKW A;  3HST B;  4FWK A;  3P83 D;  4DLG A;  5BR8 K;  2B4J A;  1NJY A;  4YOU A;  2O4G A;  2IC3 A;  4J2A A;  3F9K A;  5M1Q A;  2F96 A;  2VWK A;  4KHU A;  3ZEU B;  3AVN A;  5KPR A;  2FSK A;  2E88 A;  3ATV A;  4KKO A;  1XHX A;  1TK8 A;  1RT1 A;  1QSY A;  2F8S A;  3THX B;  3R3L A;  4E1N A;  5BPM A;  1LWC A;  2QW9 A;  1KAX A;  3VQ7 A;  4NB4 A;  4RTF D;  1RTH A;  4FW2 A;  4WFB L;  3L3V A;  4FLY A;  1JL1 A;  2AA4 A;  3EKS A;  3CPW M;  4PL7 A;  4BE1 A;  3ZSZ A;  3U8X A;  4LD0 A;  3ENB A;  2I5J A;  3A5L C;  4DCH A;  4N41 A;  1KTQ A;  1QHT A;  4FK2 A;  1U45 A;  2EWS A;  4M3T A;  3VOV A;  2Q97 A;  4CES A;  2ZGY A;  4IEE A;  3D2F B;  5GAH P;  1HNZ K;  1DGK N;  4O4G A;  1Y64 A;  3PX6 A;  4C8K A;  2KLA A;  3CCL N;  1WBB A;  1A5V A;  4JHD B;  4Z4E A;  3T1Y K;  3ID6 A;  1OH6 A;  4X65 K;  1BI4 A;  4E7K A;  5CZ2 A;  3ZT2 A;  4CEF A;  1VSH A;  2Q36 A;  1RFQ A;  4FJJ A;  5SZT A;  3CYM A;  2PAV A;  1UA1 A;  5JVG L;  2FXU A;  4JI3 K;  4C8O A;  4DR2 K;  1YT3 A;  3DXM A;  2YHW A;  3ULE A;  4E19 A;  3DWL A;  1JL2 A;  2JWK A;  2OPQ A;  4ELT A;  4K0K K;  3CJ7 A;  3QEI A;  4FOE A;  5AQW A;  1BCO A;  2NLX A;  4AHV A;  3TTC A;  4Z4C A;  4XIU A;  4CEB A;  5BRD A;  5EVZ A;  5AQJ A;  2P9K A;  3VQC A;  3IAY A;  3FZL A;  3CXC M;  3C95 A;  3SI6 A;  1J5O A;  4CJ5 A;  4FWO A;  1Z6R A;  4NO7 A;  3NBP A;  4FLT A;  3R1X A;  3BGR A;  1KSP A;  3NF9 A;  3NH2 A;  3P5J A;  1TV6 A;  4OPJ A;  1D8Y A;  3QES A;  4BRK A;  2P9U A;  1L3S A;  2QWR A;  4CF9 A;  4AHT A;  2UXD K;  4XH5 A;  3M1F A;  1G99 A;  4KHY A;  1TVR A;  1LWF A;  1VQ5 N;  2XHB A;  4H0P A;  3FZK A;  2YHY A;  3MN5 A;  4FJ8 A;  4KAZ A;  4LFA K;  3V6D A;  3TAR A;  1XNR K;  4AF1 A;  3O80 A;  3VQ4 A;  1GOA A;  3ASM A;  4GV9 A;  3OY9 A;  3IS9 A;  3H3O B;  3SAG A;  1SL1 A;  4KRE A;  1VSM A;  3J80 O;  1XI1 A;  1D9D A;  1C0F A;  4BRE A;  2YNH A;  1KRP A;  4GV3 A;  2QWQ A;  3T7Z A;  1TKX A;  3THY B;  1VSJ A;  4HVJ A;  5CHI A;  3QET A;  3HPH A;  4JK7 A;  3J81 O;  3LP2 A;  4JN4 A;  4JI1 K;  4KHN A;  4KI4 A;  2RF2 A;  5EY4 A;  1ZBL A;  1VRT A;  4DV7 K;  4KB1 A;  3LZI A;  1MWM A;  4IXC A;  2P9L A;  1GLJ O;  1IBL K;  4HUE A;  1XWL A;  5HRR A;  3SMS A;  1SL2 A;  2HNY A;  3EY1 A;  3KKR A;  4FLV A;  4YHH K;  4DR4 K;  3J7Y P;  1QTM A;  3OYE A;  4BR0 A;  3TAQ A;  1TYQ B;  2OPP A;  2W41 A;  4CJT A;  2HB5 A;  3DLB A;  3D2E A;  4IG3 A;  4PWD A;  3AGK A;  4DF8 A;  3DLG A;  5SWM A;  4NLB A;  1YXQ A;  3IFR A;  4CHQ A;  5IT9 O;  1K8K A;  4JKE A;  4BG9 A;  3OYC A;  1YAG A;  3H1V X;  1NKB A;  2IVP A;  3NF7 A;  1WBD A;  3DLL L;  1JLQ A;  4Z4G A;  2E2Q A;  1C1C A;  4K8Z A;  4AM7 A;  4YOX A;  4FJG A;  3ITH A;  1V4T A;  1WNS A;  1QQO A;  4X62 K;  1KAZ A;  3T19 A;  3HSC A;  4I2P A;  1IKX A;  3MXI A;  4IWV A;  3AVF A;  2P9I A;  1IG8 A;  3M8P A;  4B8C A;  5FRM A;  3DM2 A;  3SQ2 A;  4IEI A;  1REV A;  3QLH A;  4CJP A;  1M90 O;  2OPS A;  4R5P A;  4O44 A;  3OTO K;  3QEP A;  3PX0 A;  3HBT A;  3GL1 A;  1NLV A;  2YI1 A;  4DV6 K;  3FZH A;  2V51 B;  2HHU A;  3NGI A;  4QCL A;  2ATQ A;  3V9W A;  5C24 A;  5FPN A;  3OBY A;  2D0A A;  4KO0 A;  4DTR A;  4WFA L;  3AV9 A;  3FZF A;  1QS4 A;  4OKE A;  1L3U A;  1M1K O;  4DQI A;  1BL3 A;  3K0S A;  1RT5 A;  4I9Q A;  3RVC A;  3OW2 M;  4CJE A;  3ULD A;  4JK9 A;  4FM2 A;  2GBZ A;  4JI8 K;  4EHT A;  2WTU A;  1EX4 A;  3VF2 A;  2KZZ A;  1HKB A;  3QB0 A;  3I8B A;  2EX3 A;  1DEJ A;  4BY9 C;  3SK3 A;  3VEX A;  1LAV A;  2RHK A;  2OYQ A;  3F73 A;  3LPT A;  1EP4 A;  1S1U A;  4FJI A;  2X6N A;  4I6M B;  3V81 A;  1JCE A;  1TAQ A;  3K5N A;  3O6W A;  4CZG A;  3CFO A;  3CQY A;  1LW0 A;  1RDA A;  2O8D A;  1LV5 A;  2E1Y A;  1VRU A;  4B1Y B;  4QAG A;  4FVM A;  3AVB A;  4IBN A;  4FOI A;  3OYG A;  3CCS N;  4OLB A;  4AIL C;  4CJU A;  3TAP A;  2ZJR L;  4U7B A;  1K8A O;  1JXB A;  1HQU A;  3VMF B;  3S9H A;  2IAJ A;  4CE9 A;  1S6P A;  2D0O A;  3IG1 A;  4FWN A;  4B9M A;  3MN7 A;  3VES A;  4PKG A;  3WQU A;  3BZC A;  4KI6 A;  4CED A;  3OS0 A;  4IFV A;  3T69 A;  4NCG A;  3LM9 A;  3HOS A;  5JS2 A;  1S6Q A;  1CXU A;  3CJ9 A;  3IDH A;  4CJW A;  1NGH A;  4W5O A;  4KRF A;  3Q7B A;  4K42 A;  4W5T A;  4GV6 A;  3C6U A;  1C0T A;  2E2O A;  4M45 A;  1JLE A;  1SKW A;  4K8X A;  4CJ3 A;  1MA9 B;  4OVL A;  2P9N B;  3H45 C;  3G4S N;  5KRT A;  2ZF5 O;  4NCB A;  3AY9 A;  1ZBS A;  3VQ6 A;  3PV8 A;  3MK6 A;  3THW B;  4FK4 A;  1HUX A;  3KLF A;  1VQ4 N;  3OYD A;  3VGL A;  4CIF A;  1KQS M;  4QS8 A;  1RT2 A;  4H8K A;  3IRX A;  2D0B A;  1RBV A;  4KBO A;  2HHV A;  4ISF A;  5HL7 L;  4DSL A;  1VSI A;  2YJF A;  5AQM A;  3T1H K;  4RW6 A;  2IVO A;  3L6Q A;  3JAM O;  3SNN A;  5TKY A;  1BA0 A;  4MQ3 A;  5JMV A;  4CJR A;  1RDW X;  3JS6 A;  4FCY A;  3NF8 A;  1UA0 A;  4OPA A;  3WXJ A;  3CET A;  4F9O A;  3VF4 A;  1QQM A;  3U9Z A;  5TKW A;  3MEC A;  3WUH A;  2A41 A;  2JWL A;  3BP8 A;  4CFD A;  1S22 A;  4BR2 A;  3LDP A;  3MEG A;  3VTI A;  3K9K A;  1VQN N;  4JKC A;  5AQP A;  5BRF A;  2YNF A;  3SV4 A;  5FPM A;  2HF3 A;  2GV9 A;  3RMB A;  4LFC K;  4LF6 K;  1U6Z A;  3KWI A;  1EQY A;  3SUO A;  1HRH A;  4CJS A;  3AVG A;  4CZL A;  4CEZ A;  4OGE A;  4IOX A;  3AVC A;  3EKU A;  2HHT A;  1QE1 A;  2A5X A;  3VEN A;  2HHS A;  3LWL A;  2HMP A;  1NOY A;  4YY3 K;  2G8I A;  4PL8 A;  2O8C B;  4M7Y A;  3ZET A;  3G10 A;  4CD3 A;  1RT4 A;  4JKA A;  5EOY A;  5AZJ B;  4B1Z A;  4DV0 K;  5AZI A;  2CGJ A;  4CJ4 A;  3CME N;  4JEP A;  3MN6 A;  3DLE A;  4X66 K;  1Q82 O;  4JKF A;  3S41 A;  1IO2 A;  1GLA G;  1OKJ A;  1ITG A;  3E1Y A;  5BRH A;  4DV5 K;  3M5R A;  4HUF A;  3NCI A;  3ZSR A;  4DMN A;  1J53 A;  4BRI A;  4LF9 K;  3C6H A;  1BOT O;  2NRX A;  4BRM A;  1DT9 A;  1RT3 A;  3KLI A;  2QTD A;  4BAC A;  3FLC O;  4JKB A;  4E89 A;  2D5R A;  2QKB A;  4CEO A;  4JK8 A;  3WQT A;  1YTA A;  3I0R A;  1B92 A;  3W0L A;  5GAE P;  1BGX T;  5B8H A;  2G8K A;  1NGI A;  4YOY A;  5AJ3 K;  4FLX A;  4K25 A;  3ZCM A;  3AVJ A;  3JXU A;  2QWM A;  4Y0W A;  1GLE G;  2GEL A;  2WBN A;  4DSK A;  3AA2 A;  2HF4 A;  3HRG A;  4JRP A;  4ZTJ A;  3RSE B;  3VQB A;  1ATR A;  2W42 A;  3M6G A;  2A40 A;  1NJZ A;  3TR8 A;  3TTD A;  4JRQ A;  1DKG D;  4JS4 A;  1FK9 A;  2W6K A;  3GBT A;  3UKR B;  1HNW K;  3K59 A;  4Z0U A;  4BQL A;  2NRZ A;  4CGF A;  1N8R O;  4Z4I A;  3K58 A;  3NHG A;  2YHA A;  3I0S A;  1IV0 A;  4HCB A;  4GY2 B;  4NYF A;  3OYM A;  3V1R A;  3EL2 A;  4RW8 A;  1WB9 A;  3ISN C;  4CZJ A;  1N34 K;  4CW7 B;  4PQU A;  2GUI A;  3QO9 A;  4KB0 A;  1GLF O;  3AA4 A;  3VQ5 A;  4XH4 A;  5AQT A;  4N76 A;  3VEO A;  2HBL A; 
#chains in the Genus database with same CATH homology
 3KLE A;  2G8W A;  3OYB A;  2ZD1 A;  1TV6 A;  3LP3 A;  3ZSQ A;  4AHC A;  4OPJ A;  1EET A;  1BIZ A;  4IFY A;  4HTU A;  3QES A;  1D8Y A;  1JLF A;  4DFK A;  3MXJ A;  1L3S A;  3HL8 A;  4OPK A;  4KV8 A;  2YHB A;  3AVK A;  3L3U A;  4AHT A;  4CF9 A;  4DQQ A;  2IGI A;  3L2U A;  1X1P A;  4H4O A;  4FZZ A;  4KHY A;  4N5S A;  1TVR A;  1LWF A;  2IDO A;  1NK7 A;  2XHB A;  1NK6 A;  4FJ8 A;  3L2V A;  4IDK A;  4CGH A;  3OYF A;  4KAZ A;  2WON A;  3V6D A;  1RDD A;  3TAR A;  3S3M A;  2YNG A;  1VSD A;  3SPZ A;  1X9S A;  4OLA A;  3VQ4 A;  1DLO A;  2X74 A;  1GOA A;  1L3T A;  3ASM A;  2DFH A;  4W5R A;  3AVA A;  3HYF A;  3D0P A;  4CGG A;  1HYZ A;  1UWB A;  4N56 A;  3CQ8 A;  4E7I A;  1B9F A;  1WN7 A;  1LWE A;  1KFS A;  4F2S A;  3DRS A;  3SQ1 A;  5E41 A;  4DTS A;  3OY9 A;  3IS9 A;  1WSJ A;  1HNV A;  2QKK A;  1SL1 A;  4KRE A;  1VSM A;  3HP6 A;  1CXQ A;  3OVN A;  1XI1 A;  1D9D A;  1BIU A;  4M42 A;  1KFD A;  2KQ2 A;  4DTN A;  3OYJ A;  1HMV A;  3VQ9 A;  3LAK A;  2PYL A;  2YNH A;  1TKZ A;  3HT3 A;  1J9A A;  1I39 A;  5J2N A;  1Q9X A;  1QSS A;  1KRP A;  1TKX A;  2A1R A;  3VQQ A;  4DSE A;  2HW3 A;  3EZ5 A;  3K57 A;  3TAN A;  4J2E A;  1VSJ A;  2B5J A;  4HVJ A;  2IS3 A;  3QET A;  4Q0B A;  3AO1 A;  4B9N A;  4KHS A;  3HPH A;  4CF1 A;  3LP2 A;  3TWH A;  1Z26 A;  1Y97 A;  1ZBU A;  4FZX C;  2HVH A;  4CJK A;  4KHN A;  3DLK A;  4WE1 A;  4KI4 A;  1C6V A;  2RF2 A;  3M8Q A;  4ZTF A;  1ZBL A;  1VRT A;  2XY8 A;  3L8B A;  1RT7 A;  1O1W A;  3LZI A;  3S3O A;  4KB1 A;  4DTP A;  3T1A A;  1HPZ A;  1SV5 A;  2NUB A;  3QIN A;  2PZS A;  3L2R A;  4HUE A;  1XC9 A;  1XWL A;  5HRR A;  4J2B A;  1G15 A;  1XHZ A;  2JGU A;  1NKE A;  1Z25 A;  4CEA A;  3AO3 A;  1SL2 A;  1L5U A;  2HNY A;  3EY1 A;  4DLE A;  3KKR A;  4E7L A;  4FLV A;  1HJR A;  2X78 A;  2KTQ A;  4DSI A;  3SUP A;  1U49 A;  1X9M A;  1RDB A;  1QTM A;  1C1B A;  4CER A;  3OYE A;  4DQR A;  2G8H A;  4CF2 A;  4DFP A;  3TAQ A;  5T7B A;  3KTQ A;  4ID5 A;  4BDP A;  3RRH A;  1X9W A;  2OPP A;  4EZ6 A;  4OJR A;  3ZSV A;  4Z4F A;  4CJT A;  2HB5 A;  3DLB A;  4IG3 A;  4CFB A;  5J1E A;  1NJX A;  4DF8 A;  4PWD A;  3DLG A;  5SWM A;  4M3Z A;  1WSF A;  3U3G A;  4KPY A;  1NKC A;  4CHQ A;  4DQP A;  2DFF A;  3OYC A;  3HXM A;  3CG7 A;  3KD5 E;  1NKB A;  2HMI A;  3NF7 A;  4Z4G A;  1JLQ A;  4DTM A;  5DK5 A;  3LZJ A;  4OGC A;  4FXD A;  2PY5 A;  3NFA A;  2DTU A;  1C1C A;  4K8Z A;  1LAW A;  3ZT0 A;  1F21 A;  4FJG A;  3ITH A;  4KFB A;  1VSK A;  1WNS A;  3MAQ A;  1JLA A;  1JXE A;  3T19 A;  3V9S A;  5J2Q A;  3TAG A;  3V9Z A;  2KFZ A;  4I2P A;  1IKX A;  4I7F A;  3KLG A;  5J2P A;  4EZ9 A;  3MXI A;  5KGW A;  4BDY A;  4RG8 A;  4EP5 A;  2G8V A;  1WAF A;  3PY8 A;  3NH0 A;  3AVF A;  3M8P A;  4J2D A;  1J54 A;  4B8C A;  1NJW A;  5FRM A;  3VQP A;  1BQN A;  1JLB A;  3DM2 A;  1BIS A;  5C25 A;  1C0M A;  3VQE A;  3I8D A;  3ZT4 A;  1REV A;  3QLH A;  4CJP A;  3SUN A;  1S9E A;  2OPS A;  4CK1 A;  4O44 A;  4CIE A;  4R5P A;  4B8A B;  3OYI A;  2XY7 A;  3S9H A;  3QEP A;  3KD1 E;  2XRI A;  3S3N A;  3O3H A;  1U4B A;  3OYK A;  3VQD A;  4CF0 A;  5I3U A;  3PX0 A;  2HHW A;  1B9D A;  3O3G A;  5FRN A;  5C42 A;  3M8R A;  1A5X A;  1RCH A;  3V4I A;  2BGG A;  4C8M A;  4PUO A;  1U47 A;  1RTI A;  4LY7 A;  3SJJ A;  3UIQ A;  4KTQ A;  3RR8 A;  2HHU A;  3NGI A;  4ELU A;  1S5J A;  3KKS A;  4CF8 A;  3MXM A;  4QCL A;  3DYA A;  2Y1I A;  4HHT A;  1QSL A;  3SPY A;  2ATQ A;  1LW2 A;  1S1W A;  4I9L A;  4RW9 A;  5C24 A;  3V9W A;  1CLQ A;  3PO4 A;  4N47 A;  4DTR A;  2D0A A;  4KO0 A;  1BI4 B;  1KVC A;  3P5J A;  4B9T A;  3OJS A;  1NOZ A;  3AV9 A;  1RBT A;  4FM1 A;  1QS4 A;  4OKE A;  1L3U A;  4M3Y A;  5JS1 A;  1W9H A;  4HCC A;  1S9G A;  4DQI A;  1BL3 A;  2OA8 A;  3B6P A;  4YFU A;  1RT5 A;  3SZ2 A;  4I9Q A;  1UOC A;  4CJE A;  4I2Q A;  4LH4 A;  3MEE A;  4DG1 A;  3ULD A;  3V9X A;  4E7J A;  3ZT3 A;  3WNH A;  4FM2 A;  2GBZ A;  4CFA A;  4DTO A;  1SKS A;  3K5L A;  3AVI A;  5HP1 A;  3ZT1 A;  4FJL A;  1EX4 A;  5CYQ A;  1BQM A;  5HRO A;  4FJH A;  2KZZ A;  4CCH A;  4O5B A;  2EX3 A;  3CM5 A;  4FJ9 A;  3QNN A;  1BCM A;  4FW1 A;  1RDC A;  4B9U A;  4DFM A;  3OYN A;  4DWI A;  1RBR A;  2BE2 A;  3SQ0 A;  1LAV A;  1W0H A;  4E3S A;  2OYQ A;  3F73 A;  3LPT A;  3QEW A;  1EP4 A;  1S1U A;  3OJU A;  4FJI A;  2XY5 A;  2X6N A;  2HVI A;  3NGY A;  4E7H A;  1ZYQ A;  2KFN A;  4IKF A;  1VSL A;  3V81 A;  1JLG A;  1TAQ A;  3AVH A;  3AVL A;  4GVM A;  3ZSX A;  4CGI A;  2Z1J A;  3K5N A;  4DU3 A;  3CFO A;  4FLZ A;  3V1Q A;  1HYV A;  1LW0 A;  3OYL A;  4FJM A;  1RDA A;  3RTV A;  1RBS A;  4FM0 A;  2E6M A;  1LV5 A;  1VRU A;  1ASW A;  4QAG A;  4FVM A;  4CJF A;  4IG0 A;  3AVB A;  3HM9 A;  4IBN A;  4CEC A;  4O0I A;  1U48 A;  3OS2 A;  3OYG A;  4OLB A;  4CJL A;  4AIL C;  4CJU A;  2VWJ A;  4ELV A;  4KTZ A;  3TAP A;  2ZE2 A;  3OS1 A;  1T03 A;  3HJF A;  4M3U A;  3LP1 A;  2HHX A;  3TAE A;  1JXB A;  1HQU A;  3O4N A;  3HVR A;  1UAX A;  1RBU A;  1WSH A;  2HNZ A;  2IAJ A;  2Q3S A;  4DFJ A;  3QEV A;  2R7Y A;  1KVB A;  3QEX A;  4CE9 A;  1S6P A;  2VG6 A;  2Z1G A;  2VG7 A;  4JS5 A;  4W5N A;  3DOL A;  3IG1 A;  5FDL A;  3BDP A;  4M3X A;  4B9M A;  5HRP A;  2A1S A;  3VQA A;  4C8L A;  4HUG A;  1MU2 A;  4F4K A;  4KI6 A;  1NK5 A;  4CED A;  4ICL A;  3OS0 A;  4F2R A;  4IFV A;  4E0D A;  4F3O A;  3HPG A;  3AO5 A;  4NCG A;  3M8S A;  1TGO A;  3SUQ A;  3THV A;  5KI6 A;  5K14 A;  2IOC A;  4CHY A;  3NF6 A;  5JS2 A;  1HNI A;  1A5W A;  1TL1 A;  2KW4 A;  1S6Q A;  1CXU A;  2XY6 A;  3KK3 A;  4CJW A;  2G8U A;  3RR7 A;  3HPO A;  4W5O A;  1S1V A;  4KRF A;  3LAL A;  2P5G A;  3DRP A;  2RN2 A;  4RW4 A;  3QNO A;  4W5T A;  2YKN A;  2JLE A;  3C6U A;  3K5O A;  4TSX A;  1JKH A;  2AJQ A;  1C0T A;  2YV0 X;  4M45 A;  4OKK A;  3CFP A;  1JLE A;  4AHS A;  2P1J A;  4L8R B;  1SKW A;  1FKP A;  4PA1 A;  3HP9 A;  3WNE A;  3ZSW A;  4CJ3 A;  5KTQ A;  4OVL A;  4K8X A;  4M3R A;  5KRT A;  4NCB A;  2P51 A;  2Z1H A;  2O4I A;  1R0A A;  3VQ6 A;  3PV8 A;  1I3A A;  3G0Z A;  4BWJ A;  4FLU A;  4Q5V A;  3SQ4 A;  5D3G A;  2BAN A;  4FK0 A;  4FK4 A;  3D45 A;  2FBX A;  1ZBF A;  1D5A A;  3DI6 A;  3KLF A;  3SYZ A;  4B3O A;  1HYS A;  3QER A;  3OYD A;  4C8N A;  3TAB A;  4QOZ B;  4CIF A;  3CFR A;  4DU1 A;  5HLF A;  1RT2 A;  1KLN A;  4FZY A;  4H8K A;  3IRX A;  4CJV A;  2D0B A;  2ZQB A;  3LWM A;  1RBV A;  2LSN A;  4CFC A;  5KRS A;  4DSJ A;  4B9S A;  2HHV A;  1TK5 A;  1U04 A;  3ALY A;  3PUF A;  3LDS A;  2EHG A;  4DSL A;  1VSI A;  3V1O A;  4NYN A;  4RW6 A;  2ITG A;  3P1G A;  4ID1 A;  3SNN A;  5FRO A;  1T05 A;  2XO7 A;  2FBY A;  4MQ3 A;  3PO5 A;  4M41 A;  4CJR A;  1NK8 A;  1NK4 A;  4FJX A;  3DOK A;  4FCY A;  3DLR A;  3NF8 A;  3OYA A;  3QIO A;  4DQS A;  1UA0 A;  1DTT A;  1CZ9 A;  1ASU A;  1QQC A;  3PX4 A;  2PYJ A;  3HK2 A;  3VN5 A;  1TK0 A;  3FFI A;  5I42 A;  1WSE A;  3LPU A;  1RTJ A;  2FC0 A;  1HQE A;  3MEC A;  4DSF A;  4DTJ A;  3TAF A;  4CIG A;  4CFD A;  3LAM A;  3LP0 A;  2DFE A;  4RW7 A;  4Z4H A;  3MEG A;  3QIP A;  3AO2 A;  2Z1I A;  3KK2 A;  2E4L A;  3K2P A;  3A2F A;  5HBM A;  1N6Q A;  4Y1C A;  4KHW A;  2FBV A;  2E6L A;  2YNF A;  3SV4 A;  4B9L A;  1JLC A;  2FBT A;  3RMC A;  2KZM A;  5DMR A;  4FLW A;  4AHU A;  3VQ8 A;  1EKE A;  2GV9 A;  3RMB A;  1SL0 A;  2B6A A;  3NGZ A;  3WNG A;  4AH9 A;  4CEE A;  3EYZ A;  1SKR A;  4PY5 A;  1VK0 A;  3WNF A;  4CK3 A;  4UQG A;  1T8E A;  1IG9 A;  3KK1 A;  2YNI A;  4O55 A;  1IKY A;  1ASV A;  3KLH A;  5HRN A;  1VSF A;  2HND A;  4KTW A;  3SV3 A;  3SUO A;  3E01 A;  3OYH A;  2X6S A;  4GW6 A;  3NE6 A;  4JLH A;  4BE0 A;  1HRH A;  4CJS A;  4NCA A;  3AVG A;  5CYM A;  4FYD A;  3AO4 A;  2YKM A;  4OKJ A;  3AA3 A;  4CEZ A;  3VA3 A;  4M3W A;  4F3T A;  2HHQ A;  4AHR A;  1Q8I A;  4OGE A;  3DMJ A;  4B08 A;  1RNH A;  1RIL A;  3AVC A;  3L2W A;  4DTU A;  1C1A A;  1ZBH A;  3JSM A;  4ZHR A;  3O4Q A;  5CZ1 A;  3TAM A;  4FJK A;  4FJN A;  2HHT A;  1S1T A;  1QE1 A;  1TKT A;  1IKW A;  3HST B;  2ETJ A;  2QK9 A;  4LSL A;  2HHS A;  3LWL A;  1DTQ A;  3P83 D;  1NOY A;  1N5Y A;  4MFB A;  4DLG A;  2G8I A;  2BDP A;  4BE2 A;  4LSN A;  2B4J A;  3ZSO A;  3G10 A;  1NJY A;  3DLH A;  1RT4 A;  3TI0 A;  3RWU A;  2O4G A;  2IC3 A;  4J2A A;  3F9K A;  5EU7 A;  2F96 A;  2VWK A;  4B9V A;  4KHU A;  3NDK A;  1GOC A;  3AVN A;  4CJ4 A;  2D0C A;  1FKO A;  1IH7 A;  3DLE A;  1KCF A;  4KKO A;  1XHX A;  2OPR A;  1TK8 A;  1IO2 A;  1RT1 A;  3C94 A;  1ITG A;  4HUF A;  1QSY A;  2F8S A;  3NCI A;  3ZSR A;  4E1N A;  4DMN A;  1LWC A;  1L3V A;  1J53 A;  4KHQ A;  3RMA A;  4CHO A;  3DRR A;  4FJ5 A;  4LH5 A;  1GOB A;  3VQ7 A;  2WOM A;  5HRS A;  1RTH A;  4FW2 A;  4CK2 A;  3JYT A;  1RT3 A;  4CEQ A;  3KLI A;  3L3V A;  1WLJ A;  3KJV A;  4FLY A;  4BAC A;  1JL1 A;  1Q9Y A;  1KVA A;  4E89 A;  4BE1 A;  3ZSZ A;  3HVT A;  1ZBI A;  3HO1 A;  2D5R A;  3VA0 A;  2QKB A;  2RPI A;  4DU4 A;  1TAU A;  4LD0 A;  4CEO A;  1YTA A;  2F8T A;  2I5J A;  1BHL A;  1KTQ A;  1QHT A;  3I0R A;  1B92 A;  3V9U A;  1U45 A;  4N41 A;  4FK2 A;  4M3T A;  1NK9 A;  2QXF A;  4CES A;  3O3F A;  1BGX T;  2G8K A;  4CGJ A;  1RT6 A;  3L2Q A;  4BWM A;  4FLX A;  2OZM A;  3ZCM A;  4O4G A;  3PX6 A;  4C8K A;  3AVJ A;  3KIO A;  3SQ2 A;  1A5V A;  1TL3 A;  3U3Y A;  1RTD A;  4Z4E A;  1YTU A;  4DSK A;  4F8R A;  1YVU A;  1BI4 A;  3AA2 A;  1S1X A;  4E7K A;  4CJQ A;  3RMD A;  5CZ2 A;  3ZT2 A;  4CEF A;  4W5Q A;  4JRP A;  1VSH A;  3B6O A;  5CY4 A;  4ZTJ A;  3CM6 A;  4DTX A;  3VQB A;  4Y1D A;  2W42 A;  3RRG A;  1NJZ A;  4YNQ A;  3TR8 A;  2P5O A;  4EP4 A;  4DS5 A;  4CHP A;  4JRQ A;  4FJJ A;  5SZT A;  3NH1 A;  3CYM A;  3T3F A;  1VSE A;  4JS4 A;  1FK9 A;  1UA1 A;  4E1M A;  4CHN A;  1D9F A;  2OZS A;  4C8O A;  1YT3 A;  2Y1J A;  4E19 A;  3K59 A;  4Z0U A;  1K6Y A;  1WAJ A;  1JL2 A;  2OPQ A;  4G1Q A;  4CGF A;  4ELT A;  3QEI A;  4Z4I A;  3K58 A;  3NAE A;  1C0U A;  4GMJ B;  3AA5 X;  2YHA A;  3NHG A;  3I0S A;  1BCO A;  1NK0 A;  3H08 A;  4AHV A;  1FXX A;  4CHZ A;  4HCB A;  4Z4C A;  4NYF A;  4XIU A;  1TKD A;  1WSI A;  1KLM A;  1SUQ A;  2VG5 A;  3OYM A;  4BDZ A;  5J2M A;  4CEB A;  3V1R A;  4H4M A;  4RW8 A;  1T7P A;  3ISN C;  3VQC A;  3K5M A;  4DF4 A;  3MED A;  4FJ7 A;  3IAY A;  2DY4 A;  1IKV A;  4O0J A;  5KGX A;  1CZB A;  4PQU A;  2GUI A;  3LAN A;  3QO9 A;  3ZSY A;  4KB0 A;  2RKI A;  3AA4 A;  3C95 A;  3VQ5 A;  3SI6 A;  2G8F A;  3C6T A;  3SCX A;  1J5O A;  4DS4 A;  4CJ5 A;  4N76 A;  1EXQ A;  3NBP A;  4FLT A;  3U6F A;  3BGR A;  1KSP A;  3AVM A;  3NF9 A;  3NH2 A;  4CGD A;  1WSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...