1RBUA

Structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADNKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural study of mutants of Escherichia coli ribonuclease HI with enhanced thermostability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
total genus 51
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rbuA00
4FM2A 1F21A 1G15A 4OVLA 1SL2A 4DTOA 1LV5A 3AVFA 2YNIA 4M3TA 3DI6A 1C0TA 1DLOA 3QIPA 4IG0A 2DFHA 4TSXA 3DLRA 3MEEA 4CJLA 4F3TA 1CXUA 2DY4A 2XY5A 3AVAA 1I3AA 2X78A 3AVNA 1JKHA 4PA1A 3SUQA 3SV3A 3K59A 3ZT1A 1W0HA 1L3SA 3CG7A 4F8RA 2EHGA 4Z4HA 3SUNA 1ASVA 4RW6A 1BI4A 4KHQA 1EETA 1T05A 2O4GA 3VQCA 2OYQA 4ICLA 4LH4A 1QQCA 4Q5VA 1UOCA 2RF2A 3G0ZA 2G8FA 1TK5A 1B9FA 1T7PA 4YNQA 2ATQA 1RT4A 2HW3A 3V1RA 1XWLA 2Z1GA 2XY8A 1WAJA 1X9WA 3NH1A 2PZSA 2OZMA 3DLKA 4CJFA 1BISA 4NCBA 4KB1A 4C8NA 2OPRA 3MECA 4O5BA 1SKSA 5JS2A 2YHAA 4DS5A 3SPZA 3RRGA 1HMVA 3L2WA 3K5LA 1WNSA 3H08A 5CY4A 1RT1A 4CF8A 4CF9A 1REVA 4CGFA 2IC3A 4CJKA 4L8RB 2XY6A 2XY7A 3QLHA 2BE2A 4RG8A 3L8BA 4KV8A 3VQAA 3HVTA 3KKSA 1ZBIA 2QKKA 4B3OA 3I0RA 4FZYA 1QS4A 1EKEA 3OYCA 1FXXA 4CJSA 1VRTA 1J54A 1KSPA 1SV5A 4MFBA 4DSJA 3SPYA 5I3UA 1RTHA 1ASUA 1RDCA 3M8PA 3LWLA 1U45A 4B9NA 4CEDA 1ZBFA 3CM6A 4B8CA 3OYFA 1S1WA 1UAXA 3PO4A 4FJ7A 4E7JA 5CYMA 5J1EA 1NJWA 4FJXA 4QOZB 1LWFA 1Z26A 4DQQA 3EYZA 3LZIA 5J2PA 4J2EA 3EZ5A 4CGHA 3S3MA 2ZE2A 4B8AB 3DLGA 4HCBA 2OA8A 3SYZA 4O44A 4RW7A 1L5UA 1C1BA 1Q9XA 2B5JA 4Y1DA 1NJZA 4KHWA 4CECA 1XI1A 4N76A 3UIQA 1KLNA 2G8UA 3KLGA 4FK4A 4LSNA 1HNVA 3HPHA 1HNIA 4CE9A 4FM0A 3SI6A 4DWIA 3OS1A 1QSLA 1EP4A 3M8SA 1L3UA 3SQ0A 4KHNA 4O55A 3V9SA 3QO9A 4H4MA 4B9TA 4BDPA 3HJFA 4AHCA 1VSKA 1RTJA 1KVCA 2VWKA 4KFBA 3VQQA 5KTQA 3KK1A 4FLZA 2G8KA 3TANA 5FROA 4O0IA 2D0AA 3AVHA 1RT5A 3HM9A 4DQRA 4FXDA 4CEBA 4BDZA 2P5OA 3QEXA 2KZMA 1YTUA 2YV0X 2EX3A 2YNHA 4CEQA 1GOCA 3D45A 3HXMA 5FRNA 4R5PA 1HPZA 3AVMA 3C94A 1C6VA 1S5JA 2KW4A 3DLEA 3U3GA 5SWMA 4OKEA 3L2QA 1JL2A 3PX6A 1RTIA 4E1MA 4E7IA 5HROA 1ZBLA 2FBTA 2PYLA 1CLQA 1WSGA 3S3NA 1K6YA 2HHWA 1TKDA 2BGGA 3LP2A 4Q0BA 3WNHA 4B08A 3JYTA 3MAQA 4CHPA 2IS3A 5CZ2A 3L2RA 3CYMA 4BE0A 3QIOA 4JRQA 3VN5A 4CHNA 3LWMA 2G8HA 3AO4A 1WLJA 3AA4A 1BQMA 4FJJA 4M3XA 3QEIA 4B9LA 4DMNA 2VG7A 4NYFA 1JLCA 3ZT3A 2DFFA 3F73A 4FLWA 4IBNA 2I5JA 4KHUA 3AO3A 4E0DA 4CF0A 4CEEA 3HP9A 3AA2A 4FW2A 1BIZA 4FJNA 4RW4A 3HYFA 4HHTA 5KGXA 1KRPA 3O3HA 4B9SA 3DRPA 1U04A 1J9AA 1C0MA 2KZZA 3OYJA 1TL1A 4N41A 5DMRA 1IKVA 1GOAA 3SQ4A 3V81A 3AO5A 3E01A 1S1XA 3MXJA 1QHTA 3ASMA 1S1TA 4OGEA 3OJUA 1LAWA 1S1UA 2WOMA 1QSSA 4FJ9A 1RILA 3OYMA 1S9EA 3LPUA 4PY5A 3VQPA 4C8OA 3OYAA 1EX4A 4IDKA 3CFPA 2G8VA 1VSDA 3RMCA 1SKWA 1JLEA 4IG3A 3VQBA 4J2AA 1TAQA 4E7HA 1B92A 4KTWA 2P5GA 1YVUA 2IDOA 5CYQA 2YKNA 2X74A 2OPQA 4DSFA 2ZQBA 1L3VA 1WSIA 3AVKA 3TAGA 1KLMA 1JLGA 4YFUA 1DTQA 5C42A 5FDLA 3T19A 3VA0A 1ASWA 3U3YA 2HVIA 2BANA 4H4OA 2D5RA 4AH9A 1QSYA 4ELUA 4BWMA 3V9UA 3DLHA 3PO5A 3AVCA 3LZJA 1UWBA 5D3GA 5HRRA 1UA1A 4OLBA 3PX4A 4KHYA 4LH5A 3CFRA 1HYSA 5HP1A 3S3OA 2F8TA 2DFEA 4FJHA 1RBUA 1JLAA 3LP1A 3LALA 4CJEA 1JL1A 3M8RA 1S6QA 2XHBA 3K5MA 1Q8IA 2X6SA 3V1OA 4O4GA 4CGDA 1NK8A 3AVBA 3WNEA 3D0PA 3SNNA 4DSIA 5E41A 4Z4FA 4E3SA 4CIGA 1FK9A 4PQUA 4FW1A 4FM1A 4DTNA 2D0CA 1IKXA 1RDBA 3HT3A 3TAEA 1T8EA 4DU3A 4W5TA 3RMAA 3ZSYA 3HK2A 2QK9A 2DTUA 4W5OA 4DU4A 4OGCA 4BWJA 4N5SA 2YHBA 1IO2A 3OJSA 4KKOA 3OYGA 1RBSA 1XHXA 4CK2A 3KLFA 1J5OA 4CHZA 4OJRA 3ULDA 5EU7A 4ZTFA 3PY8A 3K5OA 3RTVA 2VG6A 1RT6A 2R7YA 4DS4A 3ZT4A 4E1NA 4FLTA 1WSJA 1MU2A 2GUIA 4WE1A 3HPOA 4F4KA 4DF4A 1RBVA 1TKZA 3IS9A 4CJPA 3IAYA 2HHXA 3OYBA 4LD0A 1JLQA 2HB5A 2B4JA 1HYZA 4AHSA 4Z4GA 3NCIA 4FJMA 4M45A 1A5VA 4FK2A 1RBRA 1NKCA 3IG1A 4BACA 3AVGA 4M41A 3MEGA 4FJ5A 4BDYA 3LAMA 4H8KA 1TK8A 1KFSA 2G8IA 1C1CA 4UQGA 2OZSA 4W5NA 3NE6A 3B6PA 1VSIA 3KLEA 1N5YA 3C95A 4OKKA 4CGGA 4FK0A 4CIEA 1KVAA 4AHUA 1B9DA 1S6PA 4B9VA 3JSMA 4I7FA 4EP4A 4DSKA 3RWUA 3P1GA 3ZCMA 1IKYA 1NJXA 1C1AA 4K8ZA 4DSLA 3NGIA 3KD1E 1YTAA 3AO1A 3HPGA 4CERA 4CEOA 4CJQA 4Z4CA 1XHZA 3O3GA 3VA3A 1NK6A 3KLIA 1RBTA 1FKPA 1JLFA 3KIOA 3I8DA 1U48A 4OPKA 1S9GA 3QEWA 1W9HA 1VSMA 3QERA 4GMJB 3SJJA 3RR7A 2Q3SA 3RMDA 2O4IA 3VQ6A 2HNDA 1NK4A 1T03A 5KI6A 4DU1A 4NCAA 2HVHA 4W5QA 1RCHA 2KQ2A 4G1QA 3MXMA 4FYDA 5HRSA 3VQ8A 4J2BA 5C24A 3M8QA 3TAQA 4KI6A 4BE2A 4FLVA 3QINA 4DLEA 4EP5A 3WNGA 4KHSA 3V4IA 3DM2A 5I42A 1NK9A 3ZT2A 3HO1A 4FJGA 2GV9A 2E4LA 4CHYA 2Z1HA 3NH2A 3BGRA 4ID5A 3ZT0A 5CZ1A 1TKTA 2AJQA 1LAVA 4F2RA 1CXQA 3CM5A 1KCFA 3DYAA 3ZSWA 3THVA 3OY9A 3AA5X 4AHRA 4B9MA 1KVBA 3L3UA 2X6NA 1ZYQA 1BGXT 1HYVA 4HTUA 4FLXA 4CJ4A 1BL3A 3I0SA 3VQ9A 4CJRA 1R0AA 5JS1A 5SZTA 4QCLA 4DFPA 3CFOA 4AHVA 1VSHA 3NHGA 1GOBA 4KTZA 3OYDA 3MEDA 3AA3A 4CK3A 1N6QA 2W42A 1BIUA 4HCCA 1ITGA 3F9KA 3PUFA 4CF2A 3TABA 1NKBA 3IRXA 1NK0A 4CGIA 3RRHA 2YKMA 4I9QA 1D9DA 3KLHA 3AVJA 3TAMA 2Z1IA 3QEPA 1XC9A 1SL0A 1NKEA 3AO2A 4DQPA 4DFJA 4OKJA 5HBMA 4CHQA 4DF8A 2HHSA 1RDAA 4DLGA 4CCHA 2D0BA 4RW8A 3ISNC 4ZTJA 4DQIA 4FVMA 2HHTA 3AVLA 4DTXA 4AHTA 3SUPA 1IG9A 2B6AA 1NOYA 1LWCA 3NAEA 2YNFA 4HVJA 1UA0A 1U47A 3LP0A 3V6DA 4EZ9A 1ZBHA 1BQNA 3KJVA 4JS5A 5J2QA 4Z4EA 4DTUA 1U4BA 3LPTA 4CJTA 4M3ZA 1VSLA 2GBZA 1TV6A 2YNGA 4CJ5A 3G10A 4LY7A 2XO7A 3HVRA 3OYHA 1J53A 2FBYA 4K8XA 3OS0A 4M3WA 1BHLA 1D8YA 4JLHA 3ZSQA 2VWJA 3KKRA 2KFZA 2KFNA 1TAUA 1L3TA 4CJUA 1O1WA 2ETJA 2IAJA 3ALYA 5C25A 1RTDA 3L2VA 4C8LA 4FJIA 1HQUA 4JS4A 3SV4A 3QNOA 5KGWA 4KB0A 2PY5A 2G8WA 1JXEA 1JXBA 3O4NA 1SKRA 1BCMA 2HHUA 1LWEA 4BE1A 3QEVA 3K5NA 4CFDA 2Y1JA 2FBVA 2OPPA 1ZBUA 4KREA 1LW2A 3O3FA 3QETA 4PUOA 2HHQA 3BDPA 1WSHA 1WSFA 3AVIA 4E7KA 3NF9A 3SCXA 4JRPA 1TK0A 3OYNA 3DRRA 4HUEA 4CESA 2E6LA 1SL1A 4W5RA 3EY1A 3RMBA 4RW9A 3ZSVA 4O0JA 4HUFA 3ZSXA 4IFVA 3L3VA 5K14A 1S1VA 4FLUA 4F2SA 1A5XA 1VSFA 3NF8A 3O4QA 4AILC 1TGOA 4OPJA 1NK7A 4CIFA 3VQ5A 1HQEA 4QAGA 4CHOA 3P5JA 1U49A 3KK2A 4CGJA 2HNYA 3VQ7A 2E6MA 4M3YA 3SUOA 4I2QA 3SZ2A 2HHVA 5T7BA 3NF7A 3NFAA 4I2PA 1BI4B 2OPSA 4DTJA 3QESA 4KTQA 1X9MA 3T3FA 2FBXA 1Z25A 1WAFA 3DRSA 4ID1A 5HRNA 3OYEA 2QKBA 4DTSA 1Y97A 1TL3A 4C8KA 1VRUA 3LANA 4FZXC 1YT3A 3NBPA 4Z0UA 1C0UA 5HRPA 3NGZA 2ITGA 4DTPA 1D9FA 2IOCA 5FRMA 3ZSZA 3LDSA 1WSEA 3SQ1A 3NDKA 3MXIA 1VSJA 4F3OA 4CJVA 2JGUA 3V9XA 2QXFA 4E19A 3V9WA 3KTQA 2JLEA 3HL8A 2HNZA 2HMIA 3NH0A 3HSTB 4N47A 4N56A 1SUQA 1JLBA 4CFBA 3S9HA 4CJ3A 4KAZA 4KO0A 5KRSA 3TWHA 4FJLA 3DOLA 2PYJA 1RNHA 4C8MA 3PX0A 1IKWA 2NUBA 5HLFA 4DTRA 2Z1JA 3ZSRA 3DLBA 4CFCA 1HRHA 3KD5E 4EZ6A 4FLYA 1TKXA 1BCOA 3C6UA 4GVMA 4HUGA 4DG1A 2Y1IA 3P83D 3A2FA 4NCGA 2P51A 2F96A 2XRIA 4NYNA 3CQ8A 5J2NA 3PV8A 4M42A 1A5WA 1RDDA 2P1JA 5KRTA 3FFIA 2LSNA 4FZZA 2KTQA 3TARA 1LW0A 4B9UA 4LSLA 3HP6A 3OYIA 4Y1CA 4E89A 1EXQA 3WNFA 3VQEA 3L2UA 1VK0A 2RKIA 3OVNA 1DTTA 3K58A 3ITHA 1NOZA 1RT3A 2ZD1A 4ELTA 2F8SA 3SQ2A 3C6TA 3QNNA 4IKFA 1QE1A 4PWDA 4CEFA 2RPIA 2BDPA 3ZSOA 1WN7A 1QTMA 3U6FA 1FKOA 3T1AA 5J2MA 4FJ8A 1CZ9A 4ZHRA 1IH7A 1D5AA 2A1RA 3K2PA 4GW6A 1NJYA 1I39A 3OYLA 1VSEA 1NK5A 1TVRA 3TR8A 1Q9YA 3RR8A 4DQSA 4Z4IA 4MQ3A 4I9LA 1RT2A 4IFYA 2WONA 3OS2A 3TI0A 4CFAA 4CK1A 3TAPA 4DSEA 4ELVA 3VQDA 4KI4A 2VG5A 4CJWA 3DOKA 3B6OA 3NF6A 1X1PA 1KFDA 5DK5A 4E7LA 2FC0A 3LAKA 3AV9A 3V1QA 4CEZA 3OYKA 3TAFA 3LP3A 2A1SA 1X9SA 4M3UA 4OLAA 2RN2A 3KK3A 3V9ZA 4M3RA 4CF1A 4DTMA 4DFMA 3NGYA 1RT7A 3VQ4A 1KTQA 1CZBA 4XIUA 1HJRA 4J2DA 4FJKA 4FCYA 2IGIA 4CEAA 4KPYA 4KRFA 3DMJA 3K57A 4DFKA
chains in the Genus database with same CATH superfamily
1IBLK 4FM2A 4OVLA 1SL2A 1LV5A 2YNIA 3QIPA 1DLOA 5AR0A 3MEEA 2XY5A 3AVAA 2X78A 3FLCO 1JKHA 3EEQA 2ASMA 3JAMO 4LC9B 4KHQA 3IMXA 1UOCA 1T7PA 1QQNA 2Z1GA 2V7YA 2XY8A 3A5NC 3CJCA 1MDUB 2D4WA 2P9NA 2OPRA 3MECA 4O5BA 4U7BA 4FVUA 5LMUK 4DS5A 3K5LA 4B1WB 4JI0K 1WNSA 1RT1A 2GWKA 4L8RB 1KAXA 4BRAA 2IVOA 4KV8A 3KKSA 3HI0A 4B3TK 3HBTA 2P9PB 4B1VA 3U4LA 1VRTA 3SPYA 1RTHA 1RDCA 3ULEA 3LM9A 3OYFA 4JNEA 2CH6A 5J1EA 3VEVA 3EYZA 4CGHA 4KBOA 4O44A 3O1BA 2E5LK 4KHWA 4Y1DA 4DHYA 1XI1A 3EZWA 1VQNN 2FLOA 3ZEUB 3WXIA 3KLGA 2F4VK 4IOCL 4DWIA 3OS1A 2O8BB 1EP4A 3QO9A 2VWBA 5DM7L 2E2OA 2UYTA 3KK1A 3CMAN 3THWB 3TANA 5FROA 1RT5A 4CZFA 2KZMA 2YNHA 4JKAA 3D45A 5FRNA 2Q2RA 3KHYA 1U49A 3AVMA 3C94A 1C6VA 1NM1A 4MDAA 1BO5O 2GELA 3SUNA 2P9IB 1JL2A 3PSIA 4YDUA 4E1MA 2PYLA 3S3NA 3U9DA 3SAHA 2KKZA 2BGGA 3JYTA 3MAQA 4CHPA 3OTOK 3AGRA 4CHNA 1WLJA 4BG9A 2VG7A 3ZT3A 2DFFA 2E2QA 2I5JA 3AO3A 3L4IA 4H0TB 2O8EB 3HOTA 4HHTA 3CC7N 1NMNA 3O3HA 3VGMA 3C65A 3P31A 3D2EB 3F2KA 1K8KA 5DMRA 3SQ4A 3AO5A 4JAXA 1S1XA 3THXA 1QHTA 2ZGYA 4OGEA 3MN7A 4FJ9A 1S9EA 4LFAK 3VQPA 1EX4A 4B1ZA 3H1VX 1HLUA 4E7HA 1K8KB 2ZWHA 4FL9A 1D4XA 2E8AA 3AAQA 3TAGA 1KLMA 1JLGA 5C42A 3VA0A 1ASWA 2O8EA 4H4OA 2D5RA 3HM8A 1NJIO 1QSYA 3WXKA 3AVCA 3LZJA 1UWBA 4CZMA 1IJJA 4OLBA 3C7NB 4KHYA 1HYSA 4YOYA 2F8TA 4FJHA 1RBUA 4JKGB 3LALA 4CJEA 4K0KK 3M8RA 2XHBA 1VQ8N 1NK8A 3AVBA 3WNEA 2P9IA 5JVGL 4E3SA 1FK9A 4K25A 4DTNA 3TAEA 1T8EA 1N36K 3ZSYA 2DTUA 2YJFA 4DU4A 1YUWA 2YHBA 1HJOA 3MDQA 1U2VA 1XHXA 4A5BA 1J5OA 4OJRA 3AAPA 2OANA 3FZFA 4XH4A 1QVFM 4FWRA 1LCUA 4E1NA 4WE1A 3HK2A 1RBVA 3VEWA 3OYBA 2O8BA 5B8HA 4FJMA 1I94K 4M45A 4BVOA 2UUCK 1ILYA 4FK2A 4HWIA 4M41A 3GOIA 1C1CA 4UQGA 4W5NA 5AQMA 4ISEA 3NE6A 3B6PA 5ADXA 3C95A 2NRTA 2VCPA 3WXLA 2QWRA 4B9VA 3JSMA 3ZCMA 3ATUA 1BU6O 4YOTA 4DSLA 3NGIA 3KD1E 4Z4EA 3HPGA 4CEOA 3O3GA 3EO3A 1FW6A 3KLIA 2A3ZA 4OPKA 1Q18A 3J8AA 3QERA 4NCAA 4KH6A 4DU1A 1NBWA 2KQ2A 3ID6A 4JKDA 4FYDA 4DV1K 5C24A 3M8QA 4BE2A 4FLVA 3QINA 4JHDA 4DLEA 1EO1A 4KHSA 4BGBA 3ULEB 3DM2A 2P9NB 3ZT2A 2IVNA 4FJGA 3WUHA 1HPMA 3BGRA 4ID5A 4F2RA 1CXQA 3CM5A 1KCFA 3THVA 4AHRA 1ZYQA 1T44A 1QHAA 4BRLA 3I0SA 5SZTA 1HNZK 3CFOA 4AHVA 1GLAG 4KTZA 3OYDA 3AA3A 3BP8A 2W42A 1BIUA 1ITGA 3TABA 1GLDG 3IRXA 3H46O 1NK0A 3ENHA 4BRPA 1NKEA 4DFJA 5HBMA 4CHQA 2HHSA 1RDAA 4CCHA 2W6KA 4NB4A 4DTXA 4AHTA 1ATRA 3SUPA 5EOYA 2YNFA 3CCJN 1ZBHA 3V6DA 1BQNA 5J2QA 4EHTA 4YOXA 4JI7K 2XO7A 3VETA 3HVRA 3G10A 2WBNA 3ATVA 3CQYA 2EWSA 1J53A 3I33A 4K8XA 3KKRA 1L3TA 4CJUA 5AQJA 1RTDA 3SBTA 3L2VA 5AQKA 2QXLA 4JS4A 5KGWA 5C12A 2FF3B 1LWEA 3DXKB 2Q31A 4BRGA 3EE9A 4DCHA 1X3NA 1LW2A 3O3FA 3N4PA 3BDPA 4E7KA 3A5OC 3DRRA 3OYNA 4CESA 2E6LA 2O8DB 3T1HK 4RW9A 3ZSXA 3CMEN 3L3VA 5K14A 5GAHP 4FLUA 1A5XA 1FJGK 3HOSA 3O4QA 4AILC 1TGOA 3VQ5A 4QAGA 4DV7K 2HBMA 2QWPA 4XEIA 4CGJA 4H5TA 5GIPA 2HHVA 1BI4B 1YHQN 1X9MA 4LF7K 3DRSA 1WAFA 1Q7YO 1YT3A 2D1KA 3NGZA 3LDSA 1VSJA 4I6MB 3V9XA 3O9QA 2QXFA 3V9WA 2JLEA 4YOVA 3HL8A 2HNZA 4BRHA 5C2DA 4CFBA 3VF6A 1QVGM 3S9HA 3LDNA 4CJ3A 4KAZA 4KO0A 3TWHA 3LDLA 2PYJA 3DLBA 2CGLA 3VESA 1HRHA 1TKXA 2O8DA 1XQSC 3LL3A 3VTHA 3ZETB 3F9MA 4WYBA 1QQOA 2F96A 4NYNA 3E9PA 4BRCA 1RDDA 5KRTA 3QMLA 2LSNA 3D2FA 5HOOA 3IUCA 2E2PA 4LSLA 3HP6A 3OYIA 4B3SK 1T6DA 2P9LB 5BR8K 4RWTA 4IDHA 3O9SA 2P9KA 2ZD1A 4JN4A 3SQ2A 3QNNA 4IKFA 5EXWA 4G9ZA 2FSKA 5J2MA 3H3NO 1D5AA 2A1RA 3Q7BA 3K2PA 3CCMN 1I39A 3K9KA 4CZEA 4IZ9A 1NK5A 1TVRA 3TR8A 3RR8A 4MQ3A 4I9LA 4H0PA 2WONA 3TI0A 4ELVA 4CFAA 4CK1A 5M1NA 1NGBA 1KQSM 3VQDA 4KI4A 4CJWA 2A6AA 3NF6A 3AV9A 4M3UA 2RN2A 4M3RA 3NGYA 3MCAB 2VQFK 3NVKA 3TSUA 1M1KO 1JLAA 2ZJRL 4DTOA 3AVFA 3DI6A 2DFHA 2WTUA 3O6WA 4JKFA 4CJLA 5GAEP 3SMSA 4F3TA 2DY4A 2KHOA 2W40A 3SUQA 1CZAN 2GX9A 5C10A 1HNWK 4H5RA 1ASVA 1E4FT 4A2AA 3D2FB 3VQCA 4LH4A 2D0PA 2G8FA 1B9FA 4YNQA 2ATQA 2UU9K 1XWLA 1WAJA 3KWIA 1X9WA 3NH1A 2PZSA 3DLKA 4CJFA 4KB1A 3VPZA 4B3MK 4FWKA 3M3ZA 5JS2A 3VTIA 2YHAA 4B1YB 5KPZA 1Y64A 3RRGA 4WFBL 2QA4N 2V7ZA 1REVA 4FPBA 4CJKA 2XY6A 1NGHA 3QLHA 2BE2A 4RG8A 3L8BA 5KQ8A 4MLHA 2QKKA 3W3DA 1YI2N 4BR9A 3C0BA 4U67L 3M8PA 3LWLA 4B8CA 3PO4A 4DR1K 4BRQA 1LWFA 5AQYA 3HSCA 3S3MA 2ZE2A 2OA8A 3SYZA 1L5UA 4CECA 1KLNA 4LSNA 1HNVA 1MWMA 4CE9A 3SQ0A 2NNWA 4O55A 3G71N 4GKKK 3I56N 4BDPA 3HJFA 4JYAK 1RTJA 1KVCA 4KFBA 1RGIA 4BRFA 2ZGZA 4O0IA 4AQYK 4PL8A 1ATSA 3QDKA 1YTUA 4CBUA 3C7NA 4M3WA 1HPZA 3U3GA 2OZMA 2ASOA 3L2QA 5HROA 1RTIA 4BQLA 3VGKA 4DR4K 1CLQA 1K6YA 1P8ZA 4Q0BA 4B08A 1BWFO 3FGUA 2IS3A 4BE0A 1EWQA 4JRQA 2G8HA 3AA4A 4FJJA 4M3XA 4NYFA 3M6GA 3M1FA 1NGCA 2YHXA 1GLEG 5KGXA 1YIJN 4H0YB 4PL7A 3DRPA 4B9SA 1U04A 1J9AA 2KZZA 4GV3A 3OYJA 4RTFD 3GG4A 4N41A 1GOAA 3V81A 3E01A 5LMNK 2PFUA 3EKSA 3OYMA 3LPUA 3CFPA 2F7TA 2HOEA 2Q1NA 3VQBA 2P5GA 2IDOA 2X74A 2NRZA 3CCEN 2RE2A 2YX6A 3CJBA 5AJ3K 4YFUA 1DTQA 2HVIA 4AH9A 1BA1A 4ELUA 3V9UA 3DLHA 3PO5A 2GTDA 4YORA 5HRRA 1UA1A 4IO8A 2V52B 3NMUA 2E2NA 3SLCA 4CZJA 1IV0A 3V1OA 3H3OB 5E41A 2P9UB 4CIGA 3F5TA 5CR4A 4BC3A 4OGCA 3P38A 1IO2A 2QWNA 1S72N 4JD2B 4KKOA 3W0LA 3OYGA 3CF5L 4CK2A 3KLFA 1NGFA 4GY2B 5EU7A 3PY8A 3K5OA 3RTVA 1NU0A 3L6QA 3S41A 4NLBA 4AM7A 2AJQA 5CHIA 4DF4A 4CJPA 2UXBK 4IWVA 1TUYA 2HB5A 3ZLJA 5AQNA 4BREA 3R6MA 1RBRA 1NKCA 3CCSN 4MO5A 4MLEA 4FJ5A 4JKBA 1KFSA 1LOTB 2OZSA 2GWJA 3J81O 1VSIA 3O9UA 4CGGA 4AHUA 4EIAA 3CC2N 3O8MA 4BG8A 4K8ZA 2NRHA 3CPEA 2BH1A 1O13A 1NK6A 4Z4CA 3CCUN 2Q97A 1FKPA 3RVCA 3I8DA 1U48A 1S9GA 3SAGA 3O1WA 2RHKA 4GMJB 2Q3SA 3RMDA 3K0SA 2HNDA 1T03A 1MA9B 3P4IA 4G1QA 3GL1A 5HRSA 2WUSA 3VQ8A 3SK3A 4EP5A 4R79A 3I55N 2GV9A 4JI3K 1TKTA 5FPNA 3AA5X 2D0OA 2X6NA 4CJ4A 4LF5K 4JEPA 1HR0K 1VSHA 1GOBA 1GLCG 4C23A 1TUUA 1N6QA 5GIOA 4HCCA 3F9KA 2P9LA 4JKEA 4CGIA 4I9QA 2YKMA 3NVMA 3D2EA 2ZJQL 3TSPA 3AVJA 3TAMA 4BROA 3CQXA 4DV5K 5BN8A 1XC9A 1N32K 5BREA 2QTDA 3CI5A 4ISGA 5LL6Z 4IXCA 3ISNC 3J7YP 4FVMA 1GLJO 2YCHA 3AVLA 5M1OA 1IG9A 1NOYA 3VF4A 3NAEA 1U47A 4JS5A 3KJVA 4DTUA 2QWMA 2PBDA 1U4BA 3LPTA 5AQTA 4BGAA 2YNGA 1XNQK 4CJ5A 4LY7A 3OYHA 1BHLA 4JLHA 2VWJA 2KFZA 4CZHA 4LF6K 4C8LA 1EWRA 1V4SA 4FJIA 3QNOA 4KB0A 1JXEA 4CZGA 3MWPA 2HHUA 1KXPA 4BE1A 3QEVA 2FBVA 3MMVA 4DV4K 4KREA 4FWQA 5AQFA 1YF5L 4DB3A 3NF9A 2A40A 4BR7A 4PHTX 1YXQA 3MN6A 4FWMA 4W5RA 5KQDA 4K41A 5JICA 3ZEUA 1GLFO 4KH5A 3VMFB 1RDUA 1SZ2A 2E6MA 5FPEA 4IO9L 2I7NA 2OPSA 4DTJA 2FBXA 1Z25A 3O08A 5HRNA 1VHXA 3LANA 4Z0UA 3NBPA 1C0UA 5HRPA 4IOAL 4DV3K 1D9FA 1T6CA 2P9PA 3ZSZA 5BRDA 3MXIA 3J7ZO 2W41A 4DR5K 2JGUA 3RSEA 4E19A 3Q7CA 3KTQA 4BR2A 2HMIA 3NH0A 4N47A 5FLXO 3G6EN 1RNHA 4C8MA 5AQHA 5HLFA 4DTRA 3ZSRA 4FLYA 3VENA 3C6UA 4HUGA 3A2FA 4FOEA 3CQ8A 5J2NA 3LDPA 4IOXA 3HRGA 4X64K 4HTLA 4IFEA 4Y1CA 3VF2A 3WNFA 1VK0A 2RKIA 2HF3A 3ID8A 4ELTA 1XMQK 4YY3K 3C6TA 4YDUC 3RSEB 4CEFA 2BDPA 1SQKA 4GNIA 2ZJPL 1ESVA 3U6FA 1FKOA 2QWQA 1IH7A 1Z6RA 1NJYA 4B1UB 3OYLA 2JWLA 3TU5A 1VAZA 2IVPA 5AQXA 1VSEA 1QZ6A 4BR4A 3CERA 4JHDB 1Q9YA 4DQSA 1RT2A 3MN9A 2NLXA 4ILJA 1KFDA 4M3TA 2FC0A 3LAKA 3V1QA 4CEZA 3OYKA 4OLAA 4B3RK 4EFHA 3KK3A 4DTMA 3ENOA 3SJHA 1KTQA 3MCPA 2P9SA 1HJRA 4J2DA 4KHPK 5BR9A 4FJKA 4FCYA 4KPYA 3OBWA 2Q0UA 1YITN 3FZKA 3K57A 3QBWA 1ZXOA 1F21A 2HMPA 3AY9A 3BY5A 3DLRA 4Z94A 4QS7A 4AF1A 1W0HA 4F8RA 1HKGA 3H45C 4Z4HA 1BI4A 1QZ5A 1EETA 1T05A 4FWLA 2RF2A 4NCBA 1BISA 3CPWM 3DXMB 1NG9A 2WC9A 1HMVA 3L2WA 5CY4A 4B9QA 4CF9A 4E1JA 3TPQA 1H1VA 3CJ7A 4IEEA 2XY7A 3UB5A 4LFCK 4J8FA 3VQAA 4WCEL 2IIRA 4B3OA 3I0RA 1QS4A 1EKEA 3OYCA 4CJSA 4AM6A 4EHUA 1SV5A 4DSJA 5I3UA 2QM1A 5E84A 4B9NA 4CEDA 1ZBFA 3CM6A 1UAXA 4FJ7A 2PAVA 3WT0A 3OHRA 1E3MA 4DQQA 2AA4A 4JI6K 4B8AB 3DLGA 4BVPA 4H0VB 1NGEA 2FXUA 1C1BA 3O9RA 2B5JA 4FSVA 4BR0A 1NJZA 1WBBA 4DR7K 3BF3A 4N76A 2G8UA 2HBLA 4FK4A 3HPHA 4FM0A 3SI6A 5ELZA 5JVHL 1DT9A 4KHNA 3VEZA 4JK7A 3ZX2A 4B9TA 4AHCA 1VSKA 3THXB 2VWKA 5KTQA 3CJAA 4FLZA 2G8KA 3EL2A 3HM9A 4FXDA 4BDZA 3O9TA 1ZC6A 3QEXA 5AQRA 2YV0X 2EX3A 4CEQA 1GOCA 3HXMA 3UKUB 1S5JA 2KW4A 3DLEA 5SWMA 1ZBLA 3CC4N 2FBTA 1SS6A 2HHWA 1TKDA 3WNHA 2QW9A 2HF4A 3WQUA 1OH8A 3J80O 3L2RA 4M7XA 4XH1A 3VN5A 3LWMA 1BQMA 1E4GT 3JXUA 4CD1A 3BEXA 4DMNA 1JLCA 1HKBA 3F73A 4IBNA 4KHUA 4E0DA 3VGLA 2E88A 4CEEA 3AA2A 1VQON 3A5LC 2J4RA 2DPNA 1Q82O 1C0MA 2A41A 5BPMA 5GINA 1TL1A 1C0FA 3MXJA 5AQGA 1S1TA 3OJUA 2NRWA 2WOMA 4PY5A 1RILA 4C8OA 4H5NA 4IDKA 2G8VA 1YAGA 1SKWA 4BC5A 1U6ZA 1HUXA 1B92A 1YVUA 5CYQA 2OPQA 1WSIA 3EN9A 3U3YA 5FDLA 3T19A 4H5WA 2BANA 2E1YA 4F9OA 3CJ9A 3OA9A 4BWMA 3CCLN 5D3GA 1OH6A 3PX4A 3C6AA 4WQ5A 4CW7B 5HP1A 3G25A 1JL1A 1NMDA 2YJEA 3E1YA 1S6QA 3E9LA 3K5MA 1Q8IA 4O4GA 1OKJA 1KAYA 3OBYA 4H0XB 3D0PA 4DSIA 3EE8A 2UUAK 4PQUA 1JJ2M 4FW1A 1W2BM 2D0CA 1RDBA 5FPDA 3HT3A 5KPTA 1K73O 1N33K 4W5TA 4MDBA 4BY9C 3FR0A 3HTVA 2QK9A 2VYPA 4N5SA 5TKWA 3OJSA 2KLAA 4JKGA 4JI1K 4CHZA 4WQ5C 1OVYA 3CCQN 5AZIA 2VG6A 4CJ7A 4DS4A 4FLTA 5C2FA 5AFUH 1MU2A 1BA0A 2GUIA 3HPOA 4F4KA 4BRIA 4ILGB 4A62A 3IAYA 1HNXK 1JLQA 4BQZA 2B4JA 4CD3A 4Z4GA 5TKYA 4PKGA 1YVNA 1A5VA 3AVGA 1HX1A 4BDYA 3LAMA 4H8KA 5H1SQ 1VQKN 4FOIA 1N5YA 4OKKA 2NRRA 1KVAA 1W97L 3R8EA 1B9DA 4EP4A 5DM6L 4DSKA 4BC2A 4CZKA 3PIOL 4DV6K 4NXNK 5LJVA 4DV0K 1NJXA 3CHWA 4PKHA 1BOTO 1BG3A 1YTAA 3AO1A 2E20A 3DJCA 4CERA 4CJQA 3H1QA 1NGJA 1JLFA 3WXMB 2O8CB 4GVEA 3SJJA 3RR7A 5AQWA 3VQ6A 1NK4A 5KI6A 4L3QA 1RCHA 3QICA 4J2BA 3ZETA 4KI6A 5FPMA 3EKUA 5EVZA 4MO4A 3DXMA 1NK9A 3NH2A 3ZT0A 5CZ1A 1N8RO 4K43A 3OY9A 4B9MA 1KVBA 4Z4FA 1HYVA 4HTUA 4FLXA 3K9JA 3VQ9A 4CJRA 4JI8K 5JS1A 4QCLA 4DFPA 3NHGA 3MEDA 3DWLA 4CF2A 1NKBA 3RRHA 3VEXA 1D9DA 1IG8A 3KLHA 2Z1IA 4QS9A 3QEPA 1SL0A 4WFNL 3AO2A 4DQPA 4OKJA 4DF8A 4DLGA 2A42A 2D0BA 4RW8A 4DKWA 4DQIA 2VGNA 4ISFA 1YJNN 4O8KA 4CBXA 1LWCA 5LY3A 4HVJA 4LF4K 3TTCA 4M3ZA 1VSLA 5AQOA 4M7YA 4FWPA 4LF9K 3ZSQA 1TAUA 2KFNA 1VQ5N 2ETJA 3ALYA 3KK7A 5M1QA 3T7ZA 1HQUA 1OH5A 1WB9A 2G8WA 1M90O 1ZBSA 1BCMA 3TSQA 5HL7L 5JMVA 3K5NA 2Y1JA 2HHQA 2ZF5O 4JKHA 3SCXA 1TK0A 3WEEB 4HUEA 5F0XA 3L0QA 1Z05A 1WUAA 3ZSVA 4HUFA 1GLLO 2HBKA 4IFVA 4F2SA 1JCGA 4O8UA 1JCFA 2F9WA 4CIFA 4OX9K 3VQ7A 3GBTA 3SZ2A 5T7BA 3NFAA 4I2PA 1R59O 4KTQA 1RDWX 3OYEA 1Y97A 4C8KA 1VRUA 3VOVA 3ZYYX 2ITGA 4NO7A 5FRMA 1WSEA 1WOQA 4F3OA 2GEMA 4CJVA 3BF1A 1RFQA 4N56A 1SUQA 1JLBA 1TYQB 2P9KB 4FJLA 1ATNA 3PX0A 1IKWA 1XMOK 4CFCA 1VQ7N 1BCOA 3CETA 1QQMA 4A2BA 4Y0WA 3GDQA 2Y1IA 5F1XA 5AQSA 2P51A 3PV8A 4M42A 3TTFA 1LW0A 4B9UA 2CGJA 1EXQA 3L2UA 1DTTA 1J5EK 3ITHA 1MWKA 4JK8A 1NOZA 2F8SA 4FWNA 2BTFA 1QE1A 1VQPN 4PWDA 4I6MA 4FWSA 5M1KA 3ZSOA 3OW2M 3DLLL 1OVQA 1NGDA 3FE1A 4DR6K 4M63C 2GUPA 1NWKA 4EAHD 4Z4IA 4IFYA 3GE1A 3MX2A 3OS2A 3I8BA 3DOKA 1X1PA 4E7LA 3TAFA 1DGKN 4CZIA 3LP3A 4JI2K 1U2VB 4CF1A 1VQLN 3QBXA 2FSNA 3BUZB 3VQ4A 1CZBA 3O80A 1XNRK 3D6RA 2IGIA 4DV2K 4DFKA 1G15A 1G99A 4BRKA 1HKCA 1C0TA 4IG0A 4TSXA 4A61A 2HBJA 3DXKA 1CXUA 3SBGA 1I3AA 3AVNA 4PA1A 3IKMA 3SV3A 3K59A 3ZT1A 4OO1J 1L3SA 3CG7A 2EHGA 4RW6A 2OTLN 2H3GX 2O4GA 2OYQA 3E9OA 4ICLA 1QQCA 4Q5VA 4IJNA 4GKJK 3G0ZA 2HW3A 1TK5A 1RT4A 3V1RA 2O8CA 2HHHK 5MLCQ 5IWAK 4C8NA 3DAWA 1SKSA 3N4QA 2QWOA 1NGIA 3SPZA 2YI1A 2CH5A 3H08A 4CF8A 4CGFA 2IC3A 1TYQA 3TTDA 3HVTA 3U8XA 1ZBIA 1X3MA 4FZYA 2O8FA 1FXXA 2HSTA 1J54A 1KSPA 4MFBA 2JWKA 3T1YK 5BRFA 4OPAA 3E66A 1ASUA 5AZJA 1U45A 1S1WA 4YOUA 4E7JA 5CYMA 1NJWA 4FJXA 4QOZB 3JS6A 1Z26A 5M1FA 5J2PA 3LZIA 4J2EA 3EZ5A 4C1NI 4HCBA 4IJAA 4RW7A 3G4SN 1Q9XA 1K9MO 2OCEA 3UIQA 5M1PA 4DR3K 1HNIA 3MN5A 1QSLA 1W7AA 4RCHA 3M8SA 1T3VA 1L3UA 3MWTA 3J7AP 3V9SA 3O4WA 4H4MA 2QI2A 3VQQA 3SAFA 5LJWA 5GAGP 4JD2A 3CCVN 3T69A 2D0AA 3AVHA 4LFBK 4DQRA 4CEBA 2P5OA 1XUPO 4WQ4A 3FFKB 3D7EO 5BN9A 3U9ZA 4H0OA 4R5PA 3RWUA 4OKEA 3PX6A 2AP1A 3ZX3A 4E7IA 4LF8K 1WSGA 2Q36A 3LP2A 4YOWA 5CZ2A 1YJWN 3CYMA 3QIOA 4KH4A 4JI5K 2FSJA 3AO4A 4JK9A 2ZM6K 4XH5A 3QEIA 4B9LA 3M5RA 5AQLA 4FLWA 2VQEK 4CF0A 3KWGA 4CI6A 3HP9A 1VQ6N 4FW2A 1BIZA 4JKCA 4FJNA 4IEIA 1S22A 2P9UA 3HYFA 4RW4A 1KRPA 4BRNA 5BRHA 3A8YA 1IKVA 2V51B 1BUPA 3ASMA 1LAWA 4DUZK 1S1UA 2UUBK 5EY4A 1QSSA 3OYAA 3HZ6A 1VSDA 3BZKA 3RMCA 1JLEA 4IG3A 4J2AA 3R9PA 1TAQA 1VQ4N 4KTWA 2YKNA 4DSFA 2ZQBA 4WQ4C 1L3VA 3AVKA 4GV9A 3VERA 3LDOA 3UKUA 4CVNE 5AZJB 1P90A 4LH5A 5JLHA 3CFRA 1S3XA 4V19S 3A5MC 2ASPA 3S3OA 2DFEA 3LP1A 5AQPA 2X6SA 4BRDA 4CGDA 3SMPA 3SNNA 3R1XA 4FM1A 4ILHA 1IKXA 4DU3A 3RMAA 4W5OA 2UXCK 5GADP 3CCRN 4BWJA 3A0IX 2QWLA 1RBSA 4NLCA 3QB0A 3ULDA 1GLBG 4ZTFA 1RT6A 2R7YA 3ZT4A 1WSJA 1TKZA 3IS9A 2HHXA 1DKGD 2A5XA 4LD0A 2UXDK 1HYZA 4AHSA 3NCIA 1Q81O 4OPHA 5AZIB 3IG1A 4BACA 3MEGA 2G8IA 1TK8A 2NRXA 3ZX0A 3KLEA 2WFBA 4FK0A 4CIEA 1S6PA 2E1ZA 4FPAA 4I7FA 2F9TA 3P1GA 1IKYA 3CXCM 1C1AA 1XC3A 4A57A 4BC4A 3THWA 1XHZA 3VA3A 2ITMA 1RBTA 3KIOA 3THYB 3CD6N 3QEWA 1W9HA 1VSMA 1K8AO 3PLAA 2O4IA 2HVHA 1IBKK 4CBWA 4W5QA 1WBDA 3MXMA 5BPLA 3TAQA 5CE3A 3WNGA 2FF6A 3V4IA 1SAZA 1X9JA 5I42A 3HO1A 5E26A 2E4LA 5AFUA 2Z1HA 4CHYA 5IT9O 1LAVA 1KD1O 3DYAA 3ZSWA 3VEOA 3L3UA 1BGXT 5AQUA 1BL3A 3FZMA 1N34K 1R0AA 3KVGA 5A2QO 1V4TA 4CK3A 4A5AA 3PUFA 4GV6A 1NGAA 3LM2A 3VEYA 4BR5A 4CZLA 3IDHA 5AQZA 1NGGA 2NZTA 4DQ8A 4ZTJA 4BRMA 2HHTA 2B6AA 1UA0A 4EZ9A 5KPRA 3LP0A 3IFRA 5AQVA 1OH7A 4CJTA 2W6LA 2GBZA 1TV6A 2I7PA 2FBYA 3OS0A 3PSFA 1Q86O 1D8YA 4WFAL 1NLVA 1O1WA 2IAJA 5C25A 4UY8O 3WXJA 3QFPA 3SV4A 2PY5A 3O4NA 1JXBA 2Q0RA 1SKRA 2O8FB 4WF9L 4CFDA 2OPPA 1ZBUA 5F2RA 3QETA 4PUOA 1WSHA 1WSFA 3AARA 3AVIA 1KAZA 3B8AX 4JRPA 1SL1A 3RMBA 3EY1A 5C15A 4X66K 4O0JA 1EQYA 1S1VA 4O5FA 2BUPA 1C0GA 1VSFA 3NF8A 4H03B 3WEEA 4OPJA 1NK7A 4A59A 3CJ1A 1HQEA 1JCEA 4CHOA 5AQQA 3FZLA 3P5JA 4X62K 3PIPL 3KK2A 2HNYA 1J6ZA 4FWOA 4M3YA 3SUOA 4I2QA 2QEXN 3L4QA 3NF7A 3UKRA 3R3LA 3QESA 3MK6A 3T3FA 4ID1A 4PKIA 2QKBA 4DTSA 1TL3A 4FZXC 5JLFA 4DTPA 2IOCA 4QS8A 3C6HA 4C1NK 3NDKA 3SQ1A 1IBMK 3HSTB 2OTJN 4DR2K 3WQTA 5ADXH 5KRSA 4NXMK 3DOLA 2NUBA 3P39A 2Z1JA 5AQIA 3KD5E 3CIPA 2YHYA 1YJ9N 4EZ6A 4GVMA 2YHWA 3UE5A 4DG1A 3P83D 1KC8O 1VQMN 4NCGA 2XRIA 5C0YA 4DUYK 5EX5A 1A5WA 2P1JA 3O5BA 3FFIA 3QFUA 3H6EA 3THYA 3TARA 4FZZA 4YHHK 2KTQA 3FZHA 2NRVA 4E89A 3VQEA 3OVNA 3K58A 4JV5K 1RT3A 3KZBA 4FO0A 2RPIA 2CGKA 1WN7A 5I9EB 1QTMA 3LDQA 3T1AA 4FJ8A 1CZ9A 4ZHRA 4H5VA 4JI4K 4GW6A 2P9SB 3MX5A 3AGKA 3UKRB 1NNEA 2VGMA 3ENBA 3TAPA 4DSEA 1BDGA 2VG5A 1DEJA 3B6OA 4X65K 5DK5A 5BPNA 1X9SA 2A1SA 3V9ZA 4DFMA 1RT7A 4K42A 4XIUA 3BZCA 4B1XB 4CEAA 4KRFA 1VQ9N 3DMJA
chains in the Genus database with same CATH topology
4FM2A 1F21A 1G15A 4OVLA 1SL2A 4DTOA 1LV5A 3AVFA 2YNIA 4M3TA 3DI6A 1C0TA 1DLOA 3QIPA 4IG0A 2DFHA 4TSXA 3DLRA 3MEEA 4CJLA 4F3TA 1CXUA 2DY4A 2XY5A 3AVAA 1I3AA 2X78A 3AVNA 1JKHA 4PA1A 3SUQA 3SV3A 3K59A 3ZT1A 1W0HA 1L3SA 3CG7A 4F8RA 2EHGA 4Z4HA 3SUNA 1ASVA 4RW6A 1BI4A 4KHQA 1EETA 1T05A 2O4GA 3VQCA 2OYQA 4ICLA 4LH4A 1QQCA 4Q5VA 1UOCA 2RF2A 3G0ZA 2G8FA 1TK5A 1B9FA 1T7PA 4YNQA 2ATQA 1RT4A 2HW3A 3V1RA 1XWLA 2Z1GA 2XY8A 1WAJA 1X9WA 3NH1A 2PZSA 2OZMA 3DLKA 4CJFA 1BISA 4NCBA 4KB1A 4C8NA 2OPRA 3MECA 4O5BA 1SKSA 5JS2A 2YHAA 4DS5A 3SPZA 3RRGA 1HMVA 3L2WA 3K5LA 1WNSA 3H08A 5CY4A 1RT1A 4CF8A 4CF9A 1REVA 4CGFA 2IC3A 4CJKA 4L8RB 2XY6A 2XY7A 3QLHA 2BE2A 4RG8A 3L8BA 4KV8A 3VQAA 3HVTA 3KKSA 1ZBIA 2QKKA 4B3OA 3I0RA 4FZYA 1QS4A 1EKEA 3OYCA 1FXXA 4CJSA 1VRTA 1J54A 1KSPA 1SV5A 4MFBA 4DSJA 3SPYA 5I3UA 1RTHA 1ASUA 1RDCA 3M8PA 3LWLA 1U45A 4B9NA 4CEDA 1ZBFA 3CM6A 4B8CA 3OYFA 1S1WA 1UAXA 3PO4A 4FJ7A 4E7JA 5CYMA 5J1EA 1NJWA 4FJXA 4QOZB 1LWFA 1Z26A 4DQQA 3EYZA 3LZIA 5J2PA 4J2EA 3EZ5A 4CGHA 3S3MA 2ZE2A 4B8AB 3DLGA 4HCBA 2OA8A 3SYZA 4O44A 4RW7A 1L5UA 1C1BA 1Q9XA 2B5JA 4Y1DA 1NJZA 4KHWA 4CECA 1XI1A 4N76A 3UIQA 1KLNA 2G8UA 3KLGA 4FK4A 4LSNA 1HNVA 3HPHA 1HNIA 4CE9A 4FM0A 3SI6A 4DWIA 3OS1A 1QSLA 1EP4A 3M8SA 1L3UA 3SQ0A 4KHNA 4O55A 3V9SA 3QO9A 4H4MA 4B9TA 4BDPA 3HJFA 4AHCA 1VSKA 1RTJA 1KVCA 2VWKA 4KFBA 3VQQA 5KTQA 3KK1A 4FLZA 2G8KA 3TANA 5FROA 4O0IA 2D0AA 3AVHA 1RT5A 3HM9A 4DQRA 4FXDA 4CEBA 4BDZA 2P5OA 3QEXA 2KZMA 1YTUA 2YV0X 2EX3A 2YNHA 4CEQA 1GOCA 3D45A 3HXMA 5FRNA 4R5PA 1HPZA 3AVMA 3C94A 1C6VA 1S5JA 2KW4A 3DLEA 3U3GA 5SWMA 4OKEA 3L2QA 1JL2A 3PX6A 1RTIA 4E1MA 4E7IA 5HROA 1ZBLA 2FBTA 2PYLA 1CLQA 1WSGA 3S3NA 1K6YA 2HHWA 1TKDA 2BGGA 3LP2A 4Q0BA 3WNHA 4B08A 3JYTA 3MAQA 4CHPA 2IS3A 5CZ2A 3L2RA 3CYMA 4BE0A 3QIOA 4JRQA 3VN5A 4CHNA 3LWMA 2G8HA 3AO4A 1WLJA 3AA4A 1BQMA 4FJJA 4M3XA 3QEIA 4B9LA 4DMNA 2VG7A 4NYFA 1JLCA 3ZT3A 2DFFA 3F73A 4FLWA 4IBNA 2I5JA 4KHUA 3AO3A 4E0DA 4CF0A 4CEEA 3HP9A 3AA2A 4FW2A 1BIZA 4FJNA 4RW4A 3HYFA 4HHTA 5KGXA 1KRPA 3O3HA 4B9SA 3DRPA 1U04A 1J9AA 1C0MA 2KZZA 3OYJA 1TL1A 4N41A 5DMRA 1IKVA 1GOAA 3SQ4A 3V81A 3AO5A 3E01A 1S1XA 3MXJA 1QHTA 3ASMA 1S1TA 4OGEA 3OJUA 1LAWA 1S1UA 2WOMA 1QSSA 4FJ9A 1RILA 3OYMA 1S9EA 3LPUA 4PY5A 3VQPA 4C8OA 3OYAA 1EX4A 4IDKA 3CFPA 2G8VA 1VSDA 3RMCA 1SKWA 1JLEA 4IG3A 3VQBA 4J2AA 1TAQA 4E7HA 1B92A 4KTWA 2P5GA 1YVUA 2IDOA 5CYQA 2YKNA 2X74A 2OPQA 4DSFA 2ZQBA 1L3VA 1WSIA 3AVKA 3TAGA 1KLMA 1JLGA 4YFUA 1DTQA 5C42A 5FDLA 3T19A 3VA0A 1ASWA 3U3YA 2HVIA 2BANA 4H4OA 2D5RA 4AH9A 1QSYA 4ELUA 4BWMA 3V9UA 3DLHA 3PO5A 3AVCA 3LZJA 1UWBA 5D3GA 5HRRA 1UA1A 4OLBA 3PX4A 4KHYA 4LH5A 3CFRA 1HYSA 5HP1A 3S3OA 2F8TA 2DFEA 4FJHA 1RBUA 1JLAA 3LP1A 3LALA 4CJEA 1JL1A 3M8RA 1S6QA 2XHBA 3K5MA 1Q8IA 2X6SA 3V1OA 4O4GA 4CGDA 1NK8A 3AVBA 3WNEA 3D0PA 3SNNA 4DSIA 5E41A 4Z4FA 4E3SA 4CIGA 1FK9A 4PQUA 4FW1A 4FM1A 4DTNA 2D0CA 1IKXA 1RDBA 3HT3A 3TAEA 1T8EA 4DU3A 4W5TA 3RMAA 3ZSYA 3HK2A 2QK9A 2DTUA 4W5OA 4DU4A 4OGCA 4BWJA 4N5SA 2YHBA 1IO2A 3OJSA 4KKOA 3OYGA 1RBSA 1XHXA 4CK2A 3KLFA 1J5OA 4CHZA 4OJRA 3ULDA 5EU7A 4ZTFA 3PY8A 3K5OA 3RTVA 2VG6A 1RT6A 2R7YA 4DS4A 3ZT4A 4E1NA 4FLTA 1WSJA 1MU2A 2GUIA 4WE1A 3HPOA 4F4KA 4DF4A 1RBVA 1TKZA 3IS9A 4CJPA 3IAYA 2HHXA 3OYBA 4LD0A 1JLQA 2HB5A 2B4JA 1HYZA 4AHSA 4Z4GA 3NCIA 4FJMA 4M45A 1A5VA 4FK2A 1RBRA 1NKCA 3IG1A 4BACA 3AVGA 4M41A 3MEGA 4FJ5A 4BDYA 3LAMA 4H8KA 1TK8A 1KFSA 2G8IA 1C1CA 4UQGA 2OZSA 4W5NA 3NE6A 3B6PA 1VSIA 3KLEA 1N5YA 3C95A 4OKKA 4CGGA 4FK0A 4CIEA 1KVAA 4AHUA 1B9DA 1S6PA 4B9VA 3JSMA 4I7FA 4EP4A 4DSKA 3RWUA 3P1GA 3ZCMA 1IKYA 1NJXA 1C1AA 4K8ZA 4DSLA 3NGIA 3KD1E 1YTAA 3AO1A 3HPGA 4CERA 4CEOA 4CJQA 4Z4CA 1XHZA 3O3GA 3VA3A 1NK6A 3KLIA 1RBTA 1FKPA 1JLFA 3KIOA 3I8DA 1U48A 4OPKA 1S9GA 3QEWA 1W9HA 1VSMA 3QERA 4GMJB 3SJJA 3RR7A 2Q3SA 3RMDA 2O4IA 3VQ6A 2HNDA 1NK4A 1T03A 5KI6A 4DU1A 4NCAA 2HVHA 4W5QA 1RCHA 2KQ2A 4G1QA 3MXMA 4FYDA 5HRSA 3VQ8A 4J2BA 5C24A 3M8QA 3TAQA 4KI6A 4BE2A 4FLVA 3QINA 4DLEA 4EP5A 3WNGA 4KHSA 3V4IA 3DM2A 5I42A 1NK9A 3ZT2A 3HO1A 4FJGA 2GV9A 2E4LA 4CHYA 2Z1HA 3NH2A 3BGRA 4ID5A 3ZT0A 5CZ1A 1TKTA 2AJQA 1LAVA 4F2RA 1CXQA 3CM5A 1KCFA 3DYAA 3ZSWA 3THVA 3OY9A 3AA5X 4AHRA 4B9MA 1KVBA 3L3UA 2X6NA 1ZYQA 1BGXT 1HYVA 4HTUA 4FLXA 4CJ4A 1BL3A 3I0SA 3VQ9A 4CJRA 1R0AA 5JS1A 5SZTA 4QCLA 4DFPA 3CFOA 4AHVA 1VSHA 3NHGA 1GOBA 4KTZA 3OYDA 3MEDA 3AA3A 4CK3A 1N6QA 2W42A 1BIUA 4HCCA 1ITGA 3F9KA 3PUFA 4CF2A 3TABA 1NKBA 3IRXA 1NK0A 4CGIA 3RRHA 2YKMA 4I9QA 1D9DA 3KLHA 3AVJA 3TAMA 2Z1IA 3QEPA 1XC9A 1SL0A 1NKEA 3AO2A 4DQPA 4DFJA 4OKJA 5HBMA 4CHQA 4DF8A 2HHSA 1RDAA 4DLGA 4CCHA 2D0BA 4RW8A 3ISNC 4ZTJA 4DQIA 4FVMA 2HHTA 3AVLA 4DTXA 4AHTA 3SUPA 1IG9A 2B6AA 1NOYA 1LWCA 3NAEA 2YNFA 4HVJA 1UA0A 1U47A 3LP0A 3V6DA 4EZ9A 1ZBHA 1BQNA 3KJVA 4JS5A 5J2QA 4Z4EA 4DTUA 1U4BA 3LPTA 4CJTA 4M3ZA 1VSLA 2GBZA 1TV6A 2YNGA 4CJ5A 3G10A 4LY7A 2XO7A 3HVRA 3OYHA 1J53A 2FBYA 4K8XA 3OS0A 4M3WA 1BHLA 1D8YA 4JLHA 3ZSQA 2VWJA 3KKRA 2KFZA 2KFNA 1TAUA 1L3TA 4CJUA 1O1WA 2ETJA 2IAJA 3ALYA 5C25A 1RTDA 3L2VA 4C8LA 4FJIA 1HQUA 4JS4A 3SV4A 3QNOA 5KGWA 4KB0A 2PY5A 2G8WA 1JXEA 1JXBA 3O4NA 1SKRA 1BCMA 2HHUA 1LWEA 4BE1A 3QEVA 3K5NA 4CFDA 2Y1JA 2FBVA 2OPPA 1ZBUA 4KREA 1LW2A 3O3FA 3QETA 4PUOA 2HHQA 3BDPA 1WSHA 1WSFA 3AVIA 4E7KA 3NF9A 3SCXA 4JRPA 1TK0A 3OYNA 3DRRA 4HUEA 4CESA 2E6LA 1SL1A 4W5RA 3EY1A 3RMBA 4RW9A 3ZSVA 4O0JA 4HUFA 3ZSXA 4IFVA 3L3VA 5K14A 1S1VA 4FLUA 4F2SA 1A5XA 1VSFA 3NF8A 3O4QA 4AILC 1TGOA 4OPJA 1NK7A 4CIFA 3VQ5A 1HQEA 4QAGA 4CHOA 3P5JA 1U49A 3KK2A 4CGJA 2HNYA 3VQ7A 2E6MA 4M3YA 3SUOA 4I2QA 3SZ2A 2HHVA 5T7BA 3NF7A 3NFAA 4I2PA 1BI4B 2OPSA 4DTJA 3QESA 4KTQA 1X9MA 3T3FA 2FBXA 1Z25A 1WAFA 3DRSA 4ID1A 5HRNA 3OYEA 2QKBA 4DTSA 1Y97A 1TL3A 4C8KA 1VRUA 3LANA 4FZXC 1YT3A 3NBPA 4Z0UA 1C0UA 5HRPA 3NGZA 2ITGA 4DTPA 1D9FA 2IOCA 5FRMA 3ZSZA 3LDSA 1WSEA 3SQ1A 3NDKA 3MXIA 1VSJA 4F3OA 4CJVA 2JGUA 3V9XA 2QXFA 4E19A 3V9WA 3KTQA 2JLEA 3HL8A 2HNZA 2HMIA 3NH0A 3HSTB 4N47A 4N56A 1SUQA 1JLBA 4CFBA 3S9HA 4CJ3A 4KAZA 4KO0A 5KRSA 3TWHA 4FJLA 3DOLA 2PYJA 1RNHA 4C8MA 3PX0A 1IKWA 2NUBA 5HLFA 4DTRA 2Z1JA 3ZSRA 3DLBA 4CFCA 1HRHA 3KD5E 4EZ6A 4FLYA 1TKXA 1BCOA 3C6UA 4GVMA 4HUGA 4DG1A 2Y1IA 3P83D 3A2FA 4NCGA 2P51A 2F96A 2XRIA 4NYNA 3CQ8A 5J2NA 3PV8A 4M42A 1A5WA 1RDDA 2P1JA 5KRTA 3FFIA 2LSNA 4FZZA 2KTQA 3TARA 1LW0A 4B9UA 4LSLA 3HP6A 3OYIA 4Y1CA 4E89A 1EXQA 3WNFA 3VQEA 3L2UA 1VK0A 2RKIA 3OVNA 1DTTA 3K58A 3ITHA 1NOZA 1RT3A 2ZD1A 4ELTA 2F8SA 3SQ2A 3C6TA 3QNNA 4IKFA 1QE1A 4PWDA 4CEFA 2RPIA 2BDPA 3ZSOA 1WN7A 1QTMA 3U6FA 1FKOA 3T1AA 5J2MA 4FJ8A 1CZ9A 4ZHRA 1IH7A 1D5AA 2A1RA 3K2PA 4GW6A 1NJYA 1I39A 3OYLA 1VSEA 1NK5A 1TVRA 3TR8A 1Q9YA 3RR8A 4DQSA 4Z4IA 4MQ3A 4I9LA 1RT2A 4IFYA 2WONA 3OS2A 3TI0A 4CFAA 4CK1A 3TAPA 4DSEA 4ELVA 3VQDA 4KI4A 2VG5A 4CJWA 3DOKA 3B6OA 3NF6A 1X1PA 1KFDA 5DK5A 4E7LA 2FC0A 3LAKA 3AV9A 3V1QA 4CEZA 3OYKA 3TAFA 3LP3A 2A1SA 1X9SA 4M3UA 4OLAA 2RN2A 3KK3A 3V9ZA 4M3RA 4CF1A 4DTMA 4DFMA 3NGYA 1RT7A 3VQ4A 1KTQA 1CZBA 4XIUA 1HJRA 4J2DA 4FJKA 4FCYA 2IGIA 4CEAA 4KPYA 4KRFA 3DMJA 3K57A 4DFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FM2 A;  1F21 A;  1G15 A;  4OVL A;  1SL2 A;  4DTO A;  1LV5 A;  3AVF A;  2YNI A;  4M3T A;  3DI6 A;  1C0T A;  1DLO A;  3QIP A;  4IG0 A;  2DFH A;  4TSX A;  3DLR A;  3MEE A;  4CJL A;  4F3T A;  1CXU A;  2DY4 A;  2XY5 A;  3AVA A;  1I3A A;  2X78 A;  3AVN A;  1JKH A;  4PA1 A;  3SUQ A;  3SV3 A;  3K59 A;  3ZT1 A;  1W0H A;  1L3S A;  3CG7 A;  4F8R A;  2EHG A;  4Z4H A;  3SUN A;  1ASV A;  4RW6 A;  1BI4 A;  4KHQ A;  1EET A;  1T05 A;  2O4G A;  3VQC A;  2OYQ A;  4ICL A;  4LH4 A;  1QQC A;  4Q5V A;  1UOC A;  2RF2 A;  3G0Z A;  2G8F A;  1TK5 A;  1B9F A;  1T7P A;  4YNQ A;  2ATQ A;  1RT4 A;  2HW3 A;  3V1R A;  1XWL A;  2Z1G A;  2XY8 A;  1WAJ A;  1X9W A;  3NH1 A;  2PZS A;  2OZM A;  3DLK A;  4CJF A;  1BIS A;  4NCB A;  4KB1 A;  4C8N A;  2OPR A;  3MEC A;  4O5B A;  1SKS A;  5JS2 A;  2YHA A;  4DS5 A;  3SPZ A;  3RRG A;  1HMV A;  3L2W A;  3K5L A;  1WNS A;  3H08 A;  5CY4 A;  1RT1 A;  4CF8 A;  4CF9 A;  1REV A;  4CGF A;  2IC3 A;  4CJK A;  4L8R B;  2XY6 A;  2XY7 A;  3QLH A;  2BE2 A;  4RG8 A;  3L8B A;  4KV8 A;  3VQA A;  3HVT A;  3KKS A;  1ZBI A;  2QKK A;  4B3O A;  3I0R A;  4FZY A;  1QS4 A;  1EKE A;  3OYC A;  1FXX A;  4CJS A;  1VRT A;  1J54 A;  1KSP A;  1SV5 A;  4MFB A;  4DSJ A;  3SPY A;  5I3U A;  1RTH A;  1ASU A;  1RDC A;  3M8P A;  3LWL A;  1U45 A;  4B9N A;  4CED A;  1ZBF A;  3CM6 A;  4B8C A;  3OYF A;  1S1W A;  1UAX A;  3PO4 A;  4FJ7 A;  4E7J A;  5CYM A;  5J1E A;  1NJW A;  4FJX A;  4QOZ B;  1LWF A;  1Z26 A;  4DQQ A;  3EYZ A;  3LZI A;  5J2P A;  4J2E A;  3EZ5 A;  4CGH A;  3S3M A;  2ZE2 A;  4B8A B;  3DLG A;  4HCB A;  2OA8 A;  3SYZ A;  4O44 A;  4RW7 A;  1L5U A;  1C1B A;  1Q9X A;  2B5J A;  4Y1D A;  1NJZ A;  4KHW A;  4CEC A;  1XI1 A;  4N76 A;  3UIQ A;  1KLN A;  2G8U A;  3KLG A;  4FK4 A;  4LSN A;  1HNV A;  3HPH A;  1HNI A;  4CE9 A;  4FM0 A;  3SI6 A;  4DWI A;  3OS1 A;  1QSL A;  1EP4 A;  3M8S A;  1L3U A;  3SQ0 A;  4KHN A;  4O55 A;  3V9S A;  3QO9 A;  4H4M A;  4B9T A;  4BDP A;  3HJF A;  4AHC A;  1VSK A;  1RTJ A;  1KVC A;  2VWK A;  4KFB A;  3VQQ A;  5KTQ A;  3KK1 A;  4FLZ A;  2G8K A;  3TAN A;  5FRO A;  4O0I A;  2D0A A;  3AVH A;  1RT5 A;  3HM9 A;  4DQR A;  4FXD A;  4CEB A;  4BDZ A;  2P5O A;  3QEX A;  2KZM A;  1YTU A;  2YV0 X;  2EX3 A;  2YNH A;  4CEQ A;  1GOC A;  3D45 A;  3HXM A;  5FRN A;  4R5P A;  1HPZ A;  3AVM A;  3C94 A;  1C6V A;  1S5J A;  2KW4 A;  3DLE A;  3U3G A;  5SWM A;  4OKE A;  3L2Q A;  1JL2 A;  3PX6 A;  1RTI A;  4E1M A;  4E7I A;  5HRO A;  1ZBL A;  2FBT A;  2PYL A;  1CLQ A;  1WSG A;  3S3N A;  1K6Y A;  2HHW A;  1TKD A;  2BGG A;  3LP2 A;  4Q0B A;  3WNH A;  4B08 A;  3JYT A;  3MAQ A;  4CHP A;  2IS3 A;  5CZ2 A;  3L2R A;  3CYM A;  4BE0 A;  3QIO A;  4JRQ A;  3VN5 A;  4CHN A;  3LWM A;  2G8H A;  3AO4 A;  1WLJ A;  3AA4 A;  1BQM A;  4FJJ A;  4M3X A;  3QEI A;  4B9L A;  4DMN A;  2VG7 A;  4NYF A;  1JLC A;  3ZT3 A;  2DFF A;  3F73 A;  4FLW A;  4IBN A;  2I5J A;  4KHU A;  3AO3 A;  4E0D A;  4CF0 A;  4CEE A;  3HP9 A;  3AA2 A;  4FW2 A;  1BIZ A;  4FJN A;  4RW4 A;  3HYF A;  4HHT A;  5KGX A;  1KRP A;  3O3H A;  4B9S A;  3DRP A;  1U04 A;  1J9A A;  1C0M A;  2KZZ A;  3OYJ A;  1TL1 A;  4N41 A;  5DMR A;  1IKV A;  1GOA A;  3SQ4 A;  3V81 A;  3AO5 A;  3E01 A;  1S1X A;  3MXJ A;  1QHT A;  3ASM A;  1S1T A;  4OGE A;  3OJU A;  1LAW A;  1S1U A;  2WOM A;  1QSS A;  4FJ9 A;  1RIL A;  3OYM A;  1S9E A;  3LPU A;  4PY5 A;  3VQP A;  4C8O A;  3OYA A;  1EX4 A;  4IDK A;  3CFP A;  2G8V A;  1VSD A;  3RMC A;  1SKW A;  1JLE A;  4IG3 A;  3VQB A;  4J2A A;  1TAQ A;  4E7H A;  1B92 A;  4KTW A;  2P5G A;  1YVU A;  2IDO A;  5CYQ A;  2YKN A;  2X74 A;  2OPQ A;  4DSF A;  2ZQB A;  1L3V A;  1WSI A;  3AVK A;  3TAG A;  1KLM A;  1JLG A;  4YFU A;  1DTQ A;  5C42 A;  5FDL A;  3T19 A;  3VA0 A;  1ASW A;  3U3Y A;  2HVI A;  2BAN A;  4H4O A;  2D5R A;  4AH9 A;  1QSY A;  4ELU A;  4BWM A;  3V9U A;  3DLH A;  3PO5 A;  3AVC A;  3LZJ A;  1UWB A;  5D3G A;  5HRR A;  1UA1 A;  4OLB A;  3PX4 A;  4KHY A;  4LH5 A;  3CFR A;  1HYS A;  5HP1 A;  3S3O A;  2F8T A;  2DFE A;  4FJH A;  1RBU A;  1JLA A;  3LP1 A;  3LAL A;  4CJE A;  1JL1 A;  3M8R A;  1S6Q A;  2XHB A;  3K5M A;  1Q8I A;  2X6S A;  3V1O A;  4O4G A;  4CGD A;  1NK8 A;  3AVB A;  3WNE A;  3D0P A;  3SNN A;  4DSI A;  5E41 A;  4Z4F A;  4E3S A;  4CIG A;  1FK9 A;  4PQU A;  4FW1 A;  4FM1 A;  4DTN A;  2D0C A;  1IKX A;  1RDB A;  3HT3 A;  3TAE A;  1T8E A;  4DU3 A;  4W5T A;  3RMA A;  3ZSY A;  3HK2 A;  2QK9 A;  2DTU A;  4W5O A;  4DU4 A;  4OGC A;  4BWJ A;  4N5S A;  2YHB A;  1IO2 A;  3OJS A;  4KKO A;  3OYG A;  1RBS A;  1XHX A;  4CK2 A;  3KLF A;  1J5O A;  4CHZ A;  4OJR A;  3ULD A;  5EU7 A;  4ZTF A;  3PY8 A;  3K5O A;  3RTV A;  2VG6 A;  1RT6 A;  2R7Y A;  4DS4 A;  3ZT4 A;  4E1N A;  4FLT A;  1WSJ A;  1MU2 A;  2GUI A;  4WE1 A;  3HPO A;  4F4K A;  4DF4 A;  1RBV A;  1TKZ A;  3IS9 A;  4CJP A;  3IAY A;  2HHX A;  3OYB A;  4LD0 A;  1JLQ A;  2HB5 A;  2B4J A;  1HYZ A;  4AHS A;  4Z4G A;  3NCI A;  4FJM A;  4M45 A;  1A5V A;  4FK2 A;  1RBR A;  1NKC A;  3IG1 A;  4BAC A;  3AVG A;  4M41 A;  3MEG A;  4FJ5 A;  4BDY A;  3LAM A;  4H8K A;  1TK8 A;  1KFS A;  2G8I A;  1C1C A;  4UQG A;  2OZS A;  4W5N A;  3NE6 A;  3B6P A;  1VSI A;  3KLE A;  1N5Y A;  3C95 A;  4OKK A;  4CGG A;  4FK0 A;  4CIE A;  1KVA A;  4AHU A;  1B9D A;  1S6P A;  4B9V A;  3JSM A;  4I7F A;  4EP4 A;  4DSK A;  3RWU A;  3P1G A;  3ZCM A;  1IKY A;  1NJX A;  1C1A A;  4K8Z A;  4DSL A;  3NGI A;  3KD1 E;  1YTA A;  3AO1 A;  3HPG A;  4CER A;  4CEO A;  4CJQ A;  4Z4C A;  1XHZ A;  3O3G A;  3VA3 A;  1NK6 A;  3KLI A;  1RBT A;  1FKP A;  1JLF A;  3KIO A;  3I8D A;  1U48 A;  4OPK A;  1S9G A;  3QEW A;  1W9H A;  1VSM A;  3QER A;  4GMJ B;  3SJJ A;  3RR7 A;  2Q3S A;  3RMD A;  2O4I A;  3VQ6 A;  2HND A;  1NK4 A;  1T03 A;  5KI6 A;  4DU1 A;  4NCA A;  2HVH A;  4W5Q A;  1RCH A;  2KQ2 A;  4G1Q A;  3MXM A;  4FYD A;  5HRS A;  3VQ8 A;  4J2B A;  5C24 A;  3M8Q A;  3TAQ A;  4KI6 A;  4BE2 A;  4FLV A;  3QIN A;  4DLE A;  4EP5 A;  3WNG A;  4KHS A;  3V4I A;  3DM2 A;  5I42 A;  1NK9 A;  3ZT2 A;  3HO1 A;  4FJG A;  2GV9 A;  2E4L A;  4CHY A;  2Z1H A;  3NH2 A;  3BGR A;  4ID5 A;  3ZT0 A;  5CZ1 A;  1TKT A;  2AJQ A;  1LAV A;  4F2R A;  1CXQ A;  3CM5 A;  1KCF A;  3DYA A;  3ZSW A;  3THV A;  3OY9 A;  3AA5 X;  4AHR A;  4B9M A;  1KVB A;  3L3U A;  2X6N A;  1ZYQ A;  1BGX T;  1HYV A;  4HTU A;  4FLX A;  4CJ4 A;  1BL3 A;  3I0S A;  3VQ9 A;  4CJR A;  1R0A A;  5JS1 A;  5SZT A;  4QCL A;  4DFP A;  3CFO A;  4AHV A;  1VSH A;  3NHG A;  1GOB A;  4KTZ A;  3OYD A;  3MED A;  3AA3 A;  4CK3 A;  1N6Q A;  2W42 A;  1BIU A;  4HCC A;  1ITG A;  3F9K A;  3PUF A;  4CF2 A;  3TAB A;  1NKB A;  3IRX A;  1NK0 A;  4CGI A;  3RRH A;  2YKM A;  4I9Q A;  1D9D A;  3KLH A;  3AVJ A;  3TAM A;  2Z1I A;  3QEP A;  1XC9 A;  1SL0 A;  1NKE A;  3AO2 A;  4DQP A;  4DFJ A;  4OKJ A;  5HBM A;  4CHQ A;  4DF8 A;  2HHS A;  1RDA A;  4DLG A;  4CCH A;  2D0B A;  4RW8 A;  3ISN C;  4ZTJ A;  4DQI A;  4FVM A;  2HHT A;  3AVL A;  4DTX A;  4AHT A;  3SUP A;  1IG9 A;  2B6A A;  1NOY A;  1LWC A;  3NAE A;  2YNF A;  4HVJ A;  1UA0 A;  1U47 A;  3LP0 A;  3V6D A;  4EZ9 A;  1ZBH A;  1BQN A;  3KJV A;  4JS5 A;  5J2Q A;  4Z4E A;  4DTU A;  1U4B A;  3LPT A;  4CJT A;  4M3Z A;  1VSL A;  2GBZ A;  1TV6 A;  2YNG A;  4CJ5 A;  3G10 A;  4LY7 A;  2XO7 A;  3HVR A;  3OYH A;  1J53 A;  2FBY A;  4K8X A;  3OS0 A;  4M3W A;  1BHL A;  1D8Y A;  4JLH A;  3ZSQ A;  2VWJ A;  3KKR A;  2KFZ A;  2KFN A;  1TAU A;  1L3T A;  4CJU A;  1O1W A;  2ETJ A;  2IAJ A;  3ALY A;  5C25 A;  1RTD A;  3L2V A;  4C8L A;  4FJI A;  1HQU A;  4JS4 A;  3SV4 A;  3QNO A;  5KGW A;  4KB0 A;  2PY5 A;  2G8W A;  1JXE A;  1JXB A;  3O4N A;  1SKR A;  1BCM A;  2HHU A;  1LWE A;  4BE1 A;  3QEV A;  3K5N A;  4CFD A;  2Y1J A;  2FBV A;  2OPP A;  1ZBU A;  4KRE A;  1LW2 A;  3O3F A;  3QET A;  4PUO A;  2HHQ A;  3BDP A;  1WSH A;  1WSF A;  3AVI A;  4E7K A;  3NF9 A;  3SCX A;  4JRP A;  1TK0 A;  3OYN A;  3DRR A;  4HUE A;  4CES A;  2E6L A;  1SL1 A;  4W5R A;  3EY1 A;  3RMB A;  4RW9 A;  3ZSV A;  4O0J A;  4HUF A;  3ZSX A;  4IFV A;  3L3V A;  5K14 A;  1S1V A;  4FLU A;  4F2S A;  1A5X A;  1VSF A;  3NF8 A;  3O4Q A;  4AIL C;  1TGO A;  4OPJ A;  1NK7 A;  4CIF A;  3VQ5 A;  1HQE A;  4QAG A;  4CHO A;  3P5J A;  1U49 A;  3KK2 A;  4CGJ A;  2HNY A;  3VQ7 A;  2E6M A;  4M3Y A;  3SUO A;  4I2Q A;  3SZ2 A;  2HHV A;  5T7B A;  3NF7 A;  3NFA A;  4I2P A;  1BI4 B;  2OPS A;  4DTJ A;  3QES A;  4KTQ A;  1X9M A;  3T3F A;  2FBX A;  1Z25 A;  1WAF A;  3DRS A;  4ID1 A;  5HRN A;  3OYE A;  2QKB A;  4DTS A;  1Y97 A;  1TL3 A;  4C8K A;  1VRU A;  3LAN A;  4FZX C;  1YT3 A;  3NBP A;  4Z0U A;  1C0U A;  5HRP A;  3NGZ A;  2ITG A;  4DTP A;  1D9F A;  2IOC A;  5FRM A;  3ZSZ A;  3LDS A;  1WSE A;  3SQ1 A;  3NDK A;  3MXI A;  1VSJ A;  4F3O A;  4CJV A;  2JGU A;  3V9X A;  2QXF A;  4E19 A;  3V9W A;  3KTQ A;  2JLE A;  3HL8 A;  2HNZ A;  2HMI A;  3NH0 A;  3HST B;  4N47 A;  4N56 A;  1SUQ A;  1JLB A;  4CFB A;  3S9H A;  4CJ3 A;  4KAZ A;  4KO0 A;  5KRS A;  3TWH A;  4FJL A;  3DOL A;  2PYJ A;  1RNH A;  4C8M A;  3PX0 A;  1IKW A;  2NUB A;  5HLF A;  4DTR A;  2Z1J A;  3ZSR A;  3DLB A;  4CFC A;  1HRH A;  3KD5 E;  4EZ6 A;  4FLY A;  1TKX A;  1BCO A;  3C6U A;  4GVM A;  4HUG A;  4DG1 A;  2Y1I A;  3P83 D;  3A2F A;  4NCG A;  2P51 A;  2F96 A;  2XRI A;  4NYN A;  3CQ8 A;  5J2N A;  3PV8 A;  4M42 A;  1A5W A;  1RDD A;  2P1J A;  5KRT A;  3FFI A;  2LSN A;  4FZZ A;  2KTQ A;  3TAR A;  1LW0 A;  4B9U A;  4LSL A;  3HP6 A;  3OYI A;  4Y1C A;  4E89 A;  1EXQ A;  3WNF A;  3VQE A;  3L2U A;  1VK0 A;  2RKI A;  3OVN A;  1DTT A;  3K58 A;  3ITH A;  1NOZ A;  1RT3 A;  2ZD1 A;  4ELT A;  2F8S A;  3SQ2 A;  3C6T A;  3QNN A;  4IKF A;  1QE1 A;  4PWD A;  4CEF A;  2RPI A;  2BDP A;  3ZSO A;  1WN7 A;  1QTM A;  3U6F A;  1FKO A;  3T1A A;  5J2M A;  4FJ8 A;  1CZ9 A;  4ZHR A;  1IH7 A;  1D5A A;  2A1R A;  3K2P A;  4GW6 A;  1NJY A;  1I39 A;  3OYL A;  1VSE A;  1NK5 A;  1TVR A;  3TR8 A;  1Q9Y A;  3RR8 A;  4DQS A;  4Z4I A;  4MQ3 A;  4I9L A;  1RT2 A;  4IFY A;  2WON A;  3OS2 A;  3TI0 A;  4CFA A;  4CK1 A;  3TAP A;  4DSE A;  4ELV A;  3VQD A;  4KI4 A;  2VG5 A;  4CJW A;  3DOK A;  3B6O A;  3NF6 A;  1X1P A;  1KFD A;  5DK5 A;  4E7L A;  2FC0 A;  3LAK A;  3AV9 A;  3V1Q A;  4CEZ A;  3OYK A;  3TAF A;  3LP3 A;  2A1S A;  1X9S A;  4M3U A;  4OLA A;  2RN2 A;  3KK3 A;  3V9Z A;  4M3R A;  4CF1 A;  4DTM A;  4DFM A;  3NGY A;  1RT7 A;  3VQ4 A;  1KTQ A;  1CZB A;  4XIU A;  1HJR A;  4J2D A;  4FJK A;  4FCY A;  2IGI A;  4CEA A;  4KPY A;  4KRF A;  3DMJ A;  3K57 A;  4DFK A; 
#chains in the Genus database with same CATH topology
 1IBL K;  4FM2 A;  4OVL A;  1SL2 A;  1LV5 A;  2YNI A;  3QIP A;  1DLO A;  5AR0 A;  3MEE A;  2XY5 A;  3AVA A;  2X78 A;  3FLC O;  1JKH A;  3EEQ A;  2ASM A;  3JAM O;  4LC9 B;  4KHQ A;  3IMX A;  1UOC A;  1T7P A;  1QQN A;  2Z1G A;  2V7Y A;  2XY8 A;  3A5N C;  3CJC A;  1MDU B;  2D4W A;  2P9N A;  2OPR A;  3MEC A;  4O5B A;  4U7B A;  4FVU A;  5LMU K;  4DS5 A;  3K5L A;  4B1W B;  4JI0 K;  1WNS A;  1RT1 A;  2GWK A;  4L8R B;  1KAX A;  4BRA A;  2IVO A;  4KV8 A;  3KKS A;  3HI0 A;  4B3T K;  3HBT A;  2P9P B;  4B1V A;  3U4L A;  1VRT A;  3SPY A;  1RTH A;  1RDC A;  3ULE A;  3LM9 A;  3OYF A;  4JNE A;  2CH6 A;  5J1E A;  3VEV A;  3EYZ A;  4CGH A;  4KBO A;  4O44 A;  3O1B A;  2E5L K;  4KHW A;  4Y1D A;  4DHY A;  1XI1 A;  3EZW A;  1VQN N;  2FLO A;  3ZEU B;  3WXI A;  3KLG A;  2F4V K;  4IOC L;  4DWI A;  3OS1 A;  2O8B B;  1EP4 A;  3QO9 A;  2VWB A;  5DM7 L;  2E2O A;  2UYT A;  3KK1 A;  3CMA N;  3THW B;  3TAN A;  5FRO A;  1RT5 A;  4CZF A;  2KZM A;  2YNH A;  4JKA A;  3D45 A;  5FRN A;  2Q2R A;  3KHY A;  1U49 A;  3AVM A;  3C94 A;  1C6V A;  1NM1 A;  4MDA A;  1BO5 O;  2GEL A;  3SUN A;  2P9I B;  1JL2 A;  3PSI A;  4YDU A;  4E1M A;  2PYL A;  3S3N A;  3U9D A;  3SAH A;  2KKZ A;  2BGG A;  3JYT A;  3MAQ A;  4CHP A;  3OTO K;  3AGR A;  4CHN A;  1WLJ A;  4BG9 A;  2VG7 A;  3ZT3 A;  2DFF A;  2E2Q A;  2I5J A;  3AO3 A;  3L4I A;  4H0T B;  2O8E B;  3HOT A;  4HHT A;  3CC7 N;  1NMN A;  3O3H A;  3VGM A;  3C65 A;  3P31 A;  3D2E B;  3F2K A;  1K8K A;  5DMR A;  3SQ4 A;  3AO5 A;  4JAX A;  1S1X A;  3THX A;  1QHT A;  2ZGY A;  4OGE A;  3MN7 A;  4FJ9 A;  1S9E A;  4LFA K;  3VQP A;  1EX4 A;  4B1Z A;  3H1V X;  1HLU A;  4E7H A;  1K8K B;  2ZWH A;  4FL9 A;  1D4X A;  2E8A A;  3AAQ A;  3TAG A;  1KLM A;  1JLG A;  5C42 A;  3VA0 A;  1ASW A;  2O8E A;  4H4O A;  2D5R A;  3HM8 A;  1NJI O;  1QSY A;  3WXK A;  3AVC A;  3LZJ A;  1UWB A;  4CZM A;  1IJJ A;  4OLB A;  3C7N B;  4KHY A;  1HYS A;  4YOY A;  2F8T A;  4FJH A;  1RBU A;  4JKG B;  3LAL A;  4CJE A;  4K0K K;  3M8R A;  2XHB A;  1VQ8 N;  1NK8 A;  3AVB A;  3WNE A;  2P9I A;  5JVG L;  4E3S A;  1FK9 A;  4K25 A;  4DTN A;  3TAE A;  1T8E A;  1N36 K;  3ZSY A;  2DTU A;  2YJF A;  4DU4 A;  1YUW A;  2YHB A;  1HJO A;  3MDQ A;  1U2V A;  1XHX A;  4A5B A;  1J5O A;  4OJR A;  3AAP A;  2OAN A;  3FZF A;  4XH4 A;  1QVF M;  4FWR A;  1LCU A;  4E1N A;  4WE1 A;  3HK2 A;  1RBV A;  3VEW A;  3OYB A;  2O8B A;  5B8H A;  4FJM A;  1I94 K;  4M45 A;  4BVO A;  2UUC K;  1ILY A;  4FK2 A;  4HWI A;  4M41 A;  3GOI A;  1C1C A;  4UQG A;  4W5N A;  5AQM A;  4ISE A;  3NE6 A;  3B6P A;  5ADX A;  3C95 A;  2NRT A;  2VCP A;  3WXL A;  2QWR A;  4B9V A;  3JSM A;  3ZCM A;  3ATU A;  1BU6 O;  4YOT A;  4DSL A;  3NGI A;  3KD1 E;  4Z4E A;  3HPG A;  4CEO A;  3O3G A;  3EO3 A;  1FW6 A;  3KLI A;  2A3Z A;  4OPK A;  1Q18 A;  3J8A A;  3QER A;  4NCA A;  4KH6 A;  4DU1 A;  1NBW A;  2KQ2 A;  3ID6 A;  4JKD A;  4FYD A;  4DV1 K;  5C24 A;  3M8Q A;  4BE2 A;  4FLV A;  3QIN A;  4JHD A;  4DLE A;  1EO1 A;  4KHS A;  4BGB A;  3ULE B;  3DM2 A;  2P9N B;  3ZT2 A;  2IVN A;  4FJG A;  3WUH A;  1HPM A;  3BGR A;  4ID5 A;  4F2R A;  1CXQ A;  3CM5 A;  1KCF A;  3THV A;  4AHR A;  1ZYQ A;  1T44 A;  1QHA A;  4BRL A;  3I0S A;  5SZT A;  1HNZ K;  3CFO A;  4AHV A;  1GLA G;  4KTZ A;  3OYD A;  3AA3 A;  3BP8 A;  2W42 A;  1BIU A;  1ITG A;  3TAB A;  1GLD G;  3IRX A;  3H46 O;  1NK0 A;  3ENH A;  4BRP A;  1NKE A;  4DFJ A;  5HBM A;  4CHQ A;  2HHS A;  1RDA A;  4CCH A;  2W6K A;  4NB4 A;  4DTX A;  4AHT A;  1ATR A;  3SUP A;  5EOY A;  2YNF A;  3CCJ N;  1ZBH A;  3V6D A;  1BQN A;  5J2Q A;  4EHT A;  4YOX A;  4JI7 K;  2XO7 A;  3VET A;  3HVR A;  3G10 A;  2WBN A;  3ATV A;  3CQY A;  2EWS A;  1J53 A;  3I33 A;  4K8X A;  3KKR A;  1L3T A;  4CJU A;  5AQJ A;  1RTD A;  3SBT A;  3L2V A;  5AQK A;  2QXL A;  4JS4 A;  5KGW A;  5C12 A;  2FF3 B;  1LWE A;  3DXK B;  2Q31 A;  4BRG A;  3EE9 A;  4DCH A;  1X3N A;  1LW2 A;  3O3F A;  3N4P A;  3BDP A;  4E7K A;  3A5O C;  3DRR A;  3OYN A;  4CES A;  2E6L A;  2O8D B;  3T1H K;  4RW9 A;  3ZSX A;  3CME N;  3L3V A;  5K14 A;  5GAH P;  4FLU A;  1A5X A;  1FJG K;  3HOS A;  3O4Q A;  4AIL C;  1TGO A;  3VQ5 A;  4QAG A;  4DV7 K;  2HBM A;  2QWP A;  4XEI A;  4CGJ A;  4H5T A;  5GIP A;  2HHV A;  1BI4 B;  1YHQ N;  1X9M A;  4LF7 K;  3DRS A;  1WAF A;  1Q7Y O;  1YT3 A;  2D1K A;  3NGZ A;  3LDS A;  1VSJ A;  4I6M B;  3V9X A;  3O9Q A;  2QXF A;  3V9W A;  2JLE A;  4YOV A;  3HL8 A;  2HNZ A;  4BRH A;  5C2D A;  4CFB A;  3VF6 A;  1QVG M;  3S9H A;  3LDN A;  4CJ3 A;  4KAZ A;  4KO0 A;  3TWH A;  3LDL A;  2PYJ A;  3DLB A;  2CGL A;  3VES A;  1HRH A;  1TKX A;  2O8D A;  1XQS C;  3LL3 A;  3VTH A;  3ZET B;  3F9M A;  4WYB A;  1QQO A;  2F96 A;  4NYN A;  3E9P A;  4BRC A;  1RDD A;  5KRT A;  3QML A;  2LSN A;  3D2F A;  5HOO A;  3IUC A;  2E2P A;  4LSL A;  3HP6 A;  3OYI A;  4B3S K;  1T6D A;  2P9L B;  5BR8 K;  4RWT A;  4IDH A;  3O9S A;  2P9K A;  2ZD1 A;  4JN4 A;  3SQ2 A;  3QNN A;  4IKF A;  5EXW A;  4G9Z A;  2FSK A;  5J2M A;  3H3N O;  1D5A A;  2A1R A;  3Q7B A;  3K2P A;  3CCM N;  1I39 A;  3K9K A;  4CZE A;  4IZ9 A;  1NK5 A;  1TVR A;  3TR8 A;  3RR8 A;  4MQ3 A;  4I9L A;  4H0P A;  2WON A;  3TI0 A;  4ELV A;  4CFA A;  4CK1 A;  5M1N A;  1NGB A;  1KQS M;  3VQD A;  4KI4 A;  4CJW A;  2A6A A;  3NF6 A;  3AV9 A;  4M3U A;  2RN2 A;  4M3R A;  3NGY A;  3MCA B;  2VQF K;  3NVK A;  3TSU A;  1M1K O;  1JLA A;  2ZJR L;  4DTO A;  3AVF A;  3DI6 A;  2DFH A;  2WTU A;  3O6W A;  4JKF A;  4CJL A;  5GAE P;  3SMS A;  4F3T A;  2DY4 A;  2KHO A;  2W40 A;  3SUQ A;  1CZA N;  2GX9 A;  5C10 A;  1HNW K;  4H5R A;  1ASV A;  1E4F T;  4A2A A;  3D2F B;  3VQC A;  4LH4 A;  2D0P A;  2G8F A;  1B9F A;  4YNQ A;  2ATQ A;  2UU9 K;  1XWL A;  1WAJ A;  3KWI A;  1X9W A;  3NH1 A;  2PZS A;  3DLK A;  4CJF A;  4KB1 A;  3VPZ A;  4B3M K;  4FWK A;  3M3Z A;  5JS2 A;  3VTI A;  2YHA A;  4B1Y B;  5KPZ A;  1Y64 A;  3RRG A;  4WFB L;  2QA4 N;  2V7Z A;  1REV A;  4FPB A;  4CJK A;  2XY6 A;  1NGH A;  3QLH A;  2BE2 A;  4RG8 A;  3L8B A;  5KQ8 A;  4MLH A;  2QKK A;  3W3D A;  1YI2 N;  4BR9 A;  3C0B A;  4U67 L;  3M8P A;  3LWL A;  4B8C A;  3PO4 A;  4DR1 K;  4BRQ A;  1LWF A;  5AQY A;  3HSC A;  3S3M A;  2ZE2 A;  2OA8 A;  3SYZ A;  1L5U A;  4CEC A;  1KLN A;  4LSN A;  1HNV A;  1MWM A;  4CE9 A;  3SQ0 A;  2NNW A;  4O55 A;  3G71 N;  4GKK K;  3I56 N;  4BDP A;  3HJF A;  4JYA K;  1RTJ A;  1KVC A;  4KFB A;  1RGI A;  4BRF A;  2ZGZ A;  4O0I A;  4AQY K;  4PL8 A;  1ATS A;  3QDK A;  1YTU A;  4CBU A;  3C7N A;  4M3W A;  1HPZ A;  3U3G A;  2OZM A;  2ASO A;  3L2Q A;  5HRO A;  1RTI A;  4BQL A;  3VGK A;  4DR4 K;  1CLQ A;  1K6Y A;  1P8Z A;  4Q0B A;  4B08 A;  1BWF O;  3FGU A;  2IS3 A;  4BE0 A;  1EWQ A;  4JRQ A;  2G8H A;  3AA4 A;  4FJJ A;  4M3X A;  4NYF A;  3M6G A;  3M1F A;  1NGC A;  2YHX A;  1GLE G;  5KGX A;  1YIJ N;  4H0Y B;  4PL7 A;  3DRP A;  4B9S A;  1U04 A;  1J9A A;  2KZZ A;  4GV3 A;  3OYJ A;  4RTF D;  3GG4 A;  4N41 A;  1GOA A;  3V81 A;  3E01 A;  5LMN K;  2PFU A;  3EKS A;  3OYM A;  3LPU A;  3CFP A;  2F7T A;  2HOE A;  2Q1N A;  3VQB A;  2P5G A;  2IDO A;  2X74 A;  2NRZ A;  3CCE N;  2RE2 A;  2YX6 A;  3CJB A;  5AJ3 K;  4YFU A;  1DTQ A;  2HVI A;  4AH9 A;  1BA1 A;  4ELU A;  3V9U A;  3DLH A;  3PO5 A;  2GTD A;  4YOR A;  5HRR A;  1UA1 A;  4IO8 A;  2V52 B;  3NMU A;  2E2N A;  3SLC A;  4CZJ A;  1IV0 A;  3V1O A;  3H3O B;  5E41 A;  2P9U B;  4CIG A;  3F5T A;  5CR4 A;  4BC3 A;  4OGC A;  3P38 A;  1IO2 A;  2QWN A;  1S72 N;  4JD2 B;  4KKO A;  3W0L A;  3OYG A;  3CF5 L;  4CK2 A;  3KLF A;  1NGF A;  4GY2 B;  5EU7 A;  3PY8 A;  3K5O A;  3RTV A;  1NU0 A;  3L6Q A;  3S41 A;  4NLB A;  4AM7 A;  2AJQ A;  5CHI A;  4DF4 A;  4CJP A;  2UXB K;  4IWV A;  1TUY A;  2HB5 A;  3ZLJ A;  5AQN A;  4BRE A;  3R6M A;  1RBR A;  1NKC A;  3CCS N;  4MO5 A;  4MLE A;  4FJ5 A;  4JKB A;  1KFS A;  1LOT B;  2OZS A;  2GWJ A;  3J81 O;  1VSI A;  3O9U A;  4CGG A;  4AHU A;  4EIA A;  3CC2 N;  3O8M A;  4BG8 A;  4K8Z A;  2NRH A;  3CPE A;  2BH1 A;  1O13 A;  1NK6 A;  4Z4C A;  3CCU N;  2Q97 A;  1FKP A;  3RVC A;  3I8D A;  1U48 A;  1S9G A;  3SAG A;  3O1W A;  2RHK A;  4GMJ B;  2Q3S A;  3RMD A;  3K0S A;  2HND A;  1T03 A;  1MA9 B;  3P4I A;  4G1Q A;  3GL1 A;  5HRS A;  2WUS A;  3VQ8 A;  3SK3 A;  4EP5 A;  4R79 A;  3I55 N;  2GV9 A;  4JI3 K;  1TKT A;  5FPN A;  3AA5 X;  2D0O A;  2X6N A;  4CJ4 A;  4LF5 K;  4JEP A;  1HR0 K;  1VSH A;  1GOB A;  1GLC G;  4C23 A;  1TUU A;  1N6Q A;  5GIO A;  4HCC A;  3F9K A;  2P9L A;  4JKE A;  4CGI A;  4I9Q A;  2YKM A;  3NVM A;  3D2E A;  2ZJQ L;  3TSP A;  3AVJ A;  3TAM A;  4BRO A;  3CQX A;  4DV5 K;  5BN8 A;  1XC9 A;  1N32 K;  5BRE A;  2QTD A;  3CI5 A;  4ISG A;  5LL6 Z;  4IXC A;  3ISN C;  3J7Y P;  4FVM A;  1GLJ O;  2YCH A;  3AVL A;  5M1O A;  1IG9 A;  1NOY A;  3VF4 A;  3NAE A;  1U47 A;  4JS5 A;  3KJV A;  4DTU A;  2QWM A;  2PBD A;  1U4B A;  3LPT A;  5AQT A;  4BGA A;  2YNG A;  1XNQ K;  4CJ5 A;  4LY7 A;  3OYH A;  1BHL A;  4JLH A;  2VWJ A;  2KFZ A;  4CZH A;  4LF6 K;  4C8L A;  1EWR A;  1V4S A;  4FJI A;  3QNO A;  4KB0 A;  1JXE A;  4CZG A;  3MWP A;  2HHU A;  1KXP A;  4BE1 A;  3QEV A;  2FBV A;  3MMV A;  4DV4 K;  4KRE A;  4FWQ A;  5AQF A;  1YF5 L;  4DB3 A;  3NF9 A;  2A40 A;  4BR7 A;  4PHT X;  1YXQ A;  3MN6 A;  4FWM A;  4W5R A;  5KQD A;  4K41 A;  5JIC A;  3ZEU A;  1GLF O;  4KH5 A;  3VMF B;  1RDU A;  1SZ2 A;  2E6M A;  5FPE A;  4IO9 L;  2I7N A;  2OPS A;  4DTJ A;  2FBX A;  1Z25 A;  3O08 A;  5HRN A;  1VHX A;  3LAN A;  4Z0U A;  3NBP A;  1C0U A;  5HRP A;  4IOA L;  4DV3 K;  1D9F A;  1T6C A;  2P9P A;  3ZSZ A;  5BRD A;  3MXI A;  3J7Z O;  2W41 A;  4DR5 K;  2JGU A;  3RSE A;  4E19 A;  3Q7C A;  3KTQ A;  4BR2 A;  2HMI A;  3NH0 A;  4N47 A;  5FLX O;  3G6E N;  1RNH A;  4C8M A;  5AQH A;  5HLF A;  4DTR A;  3ZSR A;  4FLY A;  3VEN A;  3C6U A;  4HUG A;  3A2F A;  4FOE A;  3CQ8 A;  5J2N A;  3LDP A;  4IOX A;  3HRG A;  4X64 K;  4HTL A;  4IFE A;  4Y1C A;  3VF2 A;  3WNF A;  1VK0 A;  2RKI A;  2HF3 A;  3ID8 A;  4ELT A;  1XMQ K;  4YY3 K;  3C6T A;  4YDU C;  3RSE B;  4CEF A;  2BDP A;  1SQK A;  4GNI A;  2ZJP L;  1ESV A;  3U6F A;  1FKO A;  2QWQ A;  1IH7 A;  1Z6R A;  1NJY A;  4B1U B;  3OYL A;  2JWL A;  3TU5 A;  1VAZ A;  2IVP A;  5AQX A;  1VSE A;  1QZ6 A;  4BR4 A;  3CER A;  4JHD B;  1Q9Y A;  4DQS A;  1RT2 A;  3MN9 A;  2NLX A;  4ILJ A;  1KFD A;  4M3T A;  2FC0 A;  3LAK A;  3V1Q A;  4CEZ A;  3OYK A;  4OLA A;  4B3R K;  4EFH A;  3KK3 A;  4DTM A;  3ENO A;  3SJH A;  1KTQ A;  3MCP A;  2P9S A;  1HJR A;  4J2D A;  4KHP K;  5BR9 A;  4FJK A;  4FCY A;  4KPY A;  3OBW A;  2Q0U A;  1YIT N;  3FZK A;  3K57 A;  3QBW A;  1ZXO A;  1F21 A;  2HMP A;  3AY9 A;  3BY5 A;  3DLR A;  4Z94 A;  4QS7 A;  4AF1 A;  1W0H A;  4F8R A;  1HKG A;  3H45 C;  4Z4H A;  1BI4 A;  1QZ5 A;  1EET A;  1T05 A;  4FWL A;  2RF2 A;  4NCB A;  1BIS A;  3CPW M;  3DXM B;  1NG9 A;  2WC9 A;  1HMV A;  3L2W A;  5CY4 A;  4B9Q A;  4CF9 A;  4E1J A;  3TPQ A;  1H1V A;  3CJ7 A;  4IEE A;  2XY7 A;  3UB5 A;  4LFC K;  4J8F A;  3VQA A;  4WCE L;  2IIR A;  4B3O A;  3I0R A;  1QS4 A;  1EKE A;  3OYC A;  4CJS A;  4AM6 A;  4EHU A;  1SV5 A;  4DSJ A;  5I3U A;  2QM1 A;  5E84 A;  4B9N A;  4CED A;  1ZBF A;  3CM6 A;  1UAX A;  4FJ7 A;  2PAV A;  3WT0 A;  3OHR A;  1E3M A;  4DQQ A;  2AA4 A;  4JI6 K;  4B8A B;  3DLG A;  4BVP A;  4H0V B;  1NGE A;  2FXU A;  1C1B A;  3O9R A;  2B5J A;  4FSV A;  4BR0 A;  1NJZ A;  1WBB A;  4DR7 K;  3BF3 A;  4N76 A;  2G8U A;  2HBL A;  4FK4 A;  3HPH A;  4FM0 A;  3SI6 A;  5ELZ A;  5JVH L;  1DT9 A;  4KHN A;  3VEZ A;  4JK7 A;  3ZX2 A;  4B9T A;  4AHC A;  1VSK A;  3THX B;  2VWK A;  5KTQ A;  3CJA A;  4FLZ A;  2G8K A;  3EL2 A;  3HM9 A;  4FXD A;  4BDZ A;  3O9T A;  1ZC6 A;  3QEX A;  5AQR A;  2YV0 X;  2EX3 A;  4CEQ A;  1GOC A;  3HXM A;  3UKU B;  1S5J A;  2KW4 A;  3DLE A;  5SWM A;  1ZBL A;  3CC4 N;  2FBT A;  1SS6 A;  2HHW A;  1TKD A;  3WNH A;  2QW9 A;  2HF4 A;  3WQU A;  1OH8 A;  3J80 O;  3L2R A;  4M7X A;  4XH1 A;  3VN5 A;  3LWM A;  1BQM A;  1E4G T;  3JXU A;  4CD1 A;  3BEX A;  4DMN A;  1JLC A;  1HKB A;  3F73 A;  4IBN A;  4KHU A;  4E0D A;  3VGL A;  2E88 A;  4CEE A;  3AA2 A;  1VQO N;  3A5L C;  2J4R A;  2DPN A;  1Q82 O;  1C0M A;  2A41 A;  5BPM A;  5GIN A;  1TL1 A;  1C0F A;  3MXJ A;  5AQG A;  1S1T A;  3OJU A;  2NRW A;  2WOM A;  4PY5 A;  1RIL A;  4C8O A;  4H5N A;  4IDK A;  2G8V A;  1YAG A;  1SKW A;  4BC5 A;  1U6Z A;  1HUX A;  1B92 A;  1YVU A;  5CYQ A;  2OPQ A;  1WSI A;  3EN9 A;  3U3Y A;  5FDL A;  3T19 A;  4H5W A;  2BAN A;  2E1Y A;  4F9O A;  3CJ9 A;  3OA9 A;  4BWM A;  3CCL N;  5D3G A;  1OH6 A;  3PX4 A;  3C6A A;  4WQ5 A;  4CW7 B;  5HP1 A;  3G25 A;  1JL1 A;  1NMD A;  2YJE A;  3E1Y A;  1S6Q A;  3E9L A;  3K5M A;  1Q8I A;  4O4G A;  1OKJ A;  1KAY A;  3OBY A;  4H0X B;  3D0P A;  4DSI A;  3EE8 A;  2UUA K;  4PQU A;  1JJ2 M;  4FW1 A;  1W2B M;  2D0C A;  1RDB A;  5FPD A;  3HT3 A;  5KPT A;  1K73 O;  1N33 K;  4W5T A;  4MDB A;  4BY9 C;  3FR0 A;  3HTV A;  2QK9 A;  2VYP A;  4N5S A;  5TKW A;  3OJS A;  2KLA A;  4JKG A;  4JI1 K;  4CHZ A;  4WQ5 C;  1OVY A;  3CCQ N;  5AZI A;  2VG6 A;  4CJ7 A;  4DS4 A;  4FLT A;  5C2F A;  5AFU H;  1MU2 A;  1BA0 A;  2GUI A;  3HPO A;  4F4K A;  4BRI A;  4ILG B;  4A62 A;  3IAY A;  1HNX K;  1JLQ A;  4BQZ A;  2B4J A;  4CD3 A;  4Z4G A;  5TKY A;  4PKG A;  1YVN A;  1A5V A;  3AVG A;  1HX1 A;  4BDY A;  3LAM A;  4H8K A;  5H1S Q;  1VQK N;  4FOI A;  1N5Y A;  4OKK A;  2NRR A;  1KVA A;  1W97 L;  3R8E A;  1B9D A;  4EP4 A;  5DM6 L;  4DSK A;  4BC2 A;  4CZK A;  3PIO L;  4DV6 K;  4NXN K;  5LJV A;  4DV0 K;  1NJX A;  3CHW A;  4PKH A;  1BOT O;  1BG3 A;  1YTA A;  3AO1 A;  2E20 A;  3DJC A;  4CER A;  4CJQ A;  3H1Q A;  1NGJ A;  1JLF A;  3WXM B;  2O8C B;  4GVE A;  3SJJ A;  3RR7 A;  5AQW A;  3VQ6 A;  1NK4 A;  5KI6 A;  4L3Q A;  1RCH A;  3QIC A;  4J2B A;  3ZET A;  4KI6 A;  5FPM A;  3EKU A;  5EVZ A;  4MO4 A;  3DXM A;  1NK9 A;  3NH2 A;  3ZT0 A;  5CZ1 A;  1N8R O;  4K43 A;  3OY9 A;  4B9M A;  1KVB A;  4Z4F A;  1HYV A;  4HTU A;  4FLX A;  3K9J A;  3VQ9 A;  4CJR A;  4JI8 K;  5JS1 A;  4QCL A;  4DFP A;  3NHG A;  3MED A;  3DWL A;  4CF2 A;  1NKB A;  3RRH A;  3VEX A;  1D9D A;  1IG8 A;  3KLH A;  2Z1I A;  4QS9 A;  3QEP A;  1SL0 A;  4WFN L;  3AO2 A;  4DQP A;  4OKJ A;  4DF8 A;  4DLG A;  2A42 A;  2D0B A;  4RW8 A;  4DKW A;  4DQI A;  2VGN A;  4ISF A;  1YJN N;  4O8K A;  4CBX A;  1LWC A;  5LY3 A;  4HVJ A;  4LF4 K;  3TTC A;  4M3Z A;  1VSL A;  5AQO A;  4M7Y A;  4FWP A;  4LF9 K;  3ZSQ A;  1TAU A;  2KFN A;  1VQ5 N;  2ETJ A;  3ALY A;  3KK7 A;  5M1Q A;  3T7Z A;  1HQU A;  1OH5 A;  1WB9 A;  2G8W A;  1M90 O;  1ZBS A;  1BCM A;  3TSQ A;  5HL7 L;  5JMV A;  3K5N A;  2Y1J A;  2HHQ A;  2ZF5 O;  4JKH A;  3SCX A;  1TK0 A;  3WEE B;  4HUE A;  5F0X A;  3L0Q A;  1Z05 A;  1WUA A;  3ZSV A;  4HUF A;  1GLL O;  2HBK A;  4IFV A;  4F2S A;  1JCG A;  4O8U A;  1JCF A;  2F9W A;  4CIF A;  4OX9 K;  3VQ7 A;  3GBT A;  3SZ2 A;  5T7B A;  3NFA A;  4I2P A;  1R59 O;  4KTQ A;  1RDW X;  3OYE A;  1Y97 A;  4C8K A;  1VRU A;  3VOV A;  3ZYY X;  2ITG A;  4NO7 A;  5FRM A;  1WSE A;  1WOQ A;  4F3O A;  2GEM A;  4CJV A;  3BF1 A;  1RFQ A;  4N56 A;  1SUQ A;  1JLB A;  1TYQ B;  2P9K B;  4FJL A;  1ATN A;  3PX0 A;  1IKW A;  1XMO K;  4CFC A;  1VQ7 N;  1BCO A;  3CET A;  1QQM A;  4A2B A;  4Y0W A;  3GDQ A;  2Y1I A;  5F1X A;  5AQS A;  2P51 A;  3PV8 A;  4M42 A;  3TTF A;  1LW0 A;  4B9U A;  2CGJ A;  1EXQ A;  3L2U A;  1DTT A;  1J5E K;  3ITH A;  1MWK A;  4JK8 A;  1NOZ A;  2F8S A;  4FWN A;  2BTF A;  1QE1 A;  1VQP N;  4PWD A;  4I6M A;  4FWS A;  5M1K A;  3ZSO A;  3OW2 M;  3DLL L;  1OVQ A;  1NGD A;  3FE1 A;  4DR6 K;  4M63 C;  2GUP A;  1NWK A;  4EAH D;  4Z4I A;  4IFY A;  3GE1 A;  3MX2 A;  3OS2 A;  3I8B A;  3DOK A;  1X1P A;  4E7L A;  3TAF A;  1DGK N;  4CZI A;  3LP3 A;  4JI2 K;  1U2V B;  4CF1 A;  1VQL N;  3QBX A;  2FSN A;  3BUZ B;  3VQ4 A;  1CZB A;  3O80 A;  1XNR K;  3D6R A;  2IGI A;  4DV2 K;  4DFK A;  1G15 A;  1G99 A;  4BRK A;  1HKC A;  1C0T A;  4IG0 A;  4TSX A;  4A61 A;  2HBJ A;  3DXK A;  1CXU A;  3SBG A;  1I3A A;  3AVN A;  4PA1 A;  3IKM A;  3SV3 A;  3K59 A;  3ZT1 A;  4OO1 J;  1L3S A;  3CG7 A;  2EHG A;  4RW6 A;  2OTL N;  2H3G X;  2O4G A;  2OYQ A;  3E9O A;  4ICL A;  1QQC A;  4Q5V A;  4IJN A;  4GKJ K;  3G0Z A;  2HW3 A;  1TK5 A;  1RT4 A;  3V1R A;  2O8C A;  2HHH K;  5MLC Q;  5IWA K;  4C8N A;  3DAW A;  1SKS A;  3N4Q A;  2QWO A;  1NGI A;  3SPZ A;  2YI1 A;  2CH5 A;  3H08 A;  4CF8 A;  4CGF A;  2IC3 A;  1TYQ A;  3TTD A;  3HVT A;  3U8X A;  1ZBI A;  1X3M A;  4FZY A;  2O8F A;  1FXX A;  2HST A;  1J54 A;  1KSP A;  4MFB A;  2JWK A;  3T1Y K;  5BRF A;  4OPA A;  3E66 A;  1ASU A;  5AZJ A;  1U45 A;  1S1W A;  4YOU A;  4E7J A;  5CYM A;  1NJW A;  4FJX A;  4QOZ B;  3JS6 A;  1Z26 A;  5M1F A;  5J2P A;  3LZI A;  4J2E A;  3EZ5 A;  4C1N I;  4HCB A;  4IJA A;  4RW7 A;  3G4S N;  1Q9X A;  1K9M O;  2OCE A;  3UIQ A;  5M1P A;  4DR3 K;  1HNI A;  3MN5 A;  1QSL A;  1W7A A;  4RCH A;  3M8S A;  1T3V A;  1L3U A;  3MWT A;  3J7A P;  3V9S A;  3O4W A;  4H4M A;  2QI2 A;  3VQQ A;  3SAF A;  5LJW A;  5GAG P;  4JD2 A;  3CCV N;  3T69 A;  2D0A A;  3AVH A;  4LFB K;  4DQR A;  4CEB A;  2P5O A;  1XUP O;  4WQ4 A;  3FFK B;  3D7E O;  5BN9 A;  3U9Z A;  4H0O A;  4R5P A;  3RWU A;  4OKE A;  3PX6 A;  2AP1 A;  3ZX3 A;  4E7I A;  4LF8 K;  1WSG A;  2Q36 A;  3LP2 A;  4YOW A;  5CZ2 A;  1YJW N;  3CYM A;  3QIO A;  4KH4 A;  4JI5 K;  2FSJ A;  3AO4 A;  4JK9 A;  2ZM6 K;  4XH5 A;  3QEI A;  4B9L A;  3M5R A;  5AQL A;  4FLW A;  2VQE K;  4CF0 A;  3KWG A;  4CI6 A;  3HP9 A;  1VQ6 N;  4FW2 A;  1BIZ A;  4JKC A;  4FJN A;  4IEI A;  1S22 A;  2P9U A;  3HYF A;  4RW4 A;  1KRP A;  4BRN A;  5BRH A;  3A8Y A;  1IKV A;  2V51 B;  1BUP A;  3ASM A;  1LAW A;  4DUZ K;  1S1U A;  2UUB K;  5EY4 A;  1QSS A;  3OYA A;  3HZ6 A;  1VSD A;  3BZK A;  3RMC A;  1JLE A;  4IG3 A;  4J2A A;  3R9P A;  1TAQ A;  1VQ4 N;  4KTW A;  2YKN A;  4DSF A;  2ZQB A;  4WQ4 C;  1L3V A;  3AVK A;  4GV9 A;  3VER A;  3LDO A;  3UKU A;  4CVN E;  5AZJ B;  1P90 A;  4LH5 A;  5JLH A;  3CFR A;  1S3X A;  4V19 S;  3A5M C;  2ASP A;  3S3O A;  2DFE A;  3LP1 A;  5AQP A;  2X6S A;  4BRD A;  4CGD A;  3SMP A;  3SNN A;  3R1X A;  4FM1 A;  4ILH A;  1IKX A;  4DU3 A;  3RMA A;  4W5O A;  2UXC K;  5GAD P;  3CCR N;  4BWJ A;  3A0I X;  2QWL A;  1RBS A;  4NLC A;  3QB0 A;  3ULD A;  1GLB G;  4ZTF A;  1RT6 A;  2R7Y A;  3ZT4 A;  1WSJ A;  1TKZ A;  3IS9 A;  2HHX A;  1DKG D;  2A5X A;  4LD0 A;  2UXD K;  1HYZ A;  4AHS A;  3NCI A;  1Q81 O;  4OPH A;  5AZI B;  3IG1 A;  4BAC A;  3MEG A;  2G8I A;  1TK8 A;  2NRX A;  3ZX0 A;  3KLE A;  2WFB A;  4FK0 A;  4CIE A;  1S6P A;  2E1Z A;  4FPA A;  4I7F A;  2F9T A;  3P1G A;  1IKY A;  3CXC M;  1C1A A;  1XC3 A;  4A57 A;  4BC4 A;  3THW A;  1XHZ A;  3VA3 A;  2ITM A;  1RBT A;  3KIO A;  3THY B;  3CD6 N;  3QEW A;  1W9H A;  1VSM A;  1K8A O;  3PLA A;  2O4I A;  2HVH A;  1IBK K;  4CBW A;  4W5Q A;  1WBD A;  3MXM A;  5BPL A;  3TAQ A;  5CE3 A;  3WNG A;  2FF6 A;  3V4I A;  1SAZ A;  1X9J A;  5I42 A;  3HO1 A;  5E26 A;  2E4L A;  5AFU A;  2Z1H A;  4CHY A;  5IT9 O;  1LAV A;  1KD1 O;  3DYA A;  3ZSW A;  3VEO A;  3L3U A;  1BGX T;  5AQU A;  1BL3 A;  3FZM A;  1N34 K;  1R0A A;  3KVG A;  5A2Q O;  1V4T A;  4CK3 A;  4A5A A;  3PUF A;  4GV6 A;  1NGA A;  3LM2 A;  3VEY A;  4BR5 A;  4CZL A;  3IDH A;  5AQZ A;  1NGG A;  2NZT A;  4DQ8 A;  4ZTJ A;  4BRM A;  2HHT A;  2B6A A;  1UA0 A;  4EZ9 A;  5KPR A;  3LP0 A;  3IFR A;  5AQV A;  1OH7 A;  4CJT A;  2W6L A;  2GBZ A;  1TV6 A;  2I7P A;  2FBY A;  3OS0 A;  3PSF A;  1Q86 O;  1D8Y A;  4WFA L;  1NLV A;  1O1W A;  2IAJ A;  5C25 A;  4UY8 O;  3WXJ A;  3QFP A;  3SV4 A;  2PY5 A;  3O4N A;  1JXB A;  2Q0R A;  1SKR A;  2O8F B;  4WF9 L;  4CFD A;  2OPP A;  1ZBU A;  5F2R A;  3QET A;  4PUO A;  1WSH A;  1WSF A;  3AAR A;  3AVI A;  1KAZ A;  3B8A X;  4JRP A;  1SL1 A;  3RMB A;  3EY1 A;  5C15 A;  4X66 K;  4O0J A;  1EQY A;  1S1V A;  4O5F A;  2BUP A;  1C0G A;  1VSF A;  3NF8 A;  4H03 B;  3WEE A;  4OPJ A;  1NK7 A;  4A59 A;  3CJ1 A;  1HQE A;  1JCE A;  4CHO A;  5AQQ A;  3FZL A;  3P5J A;  4X62 K;  3PIP L;  3KK2 A;  2HNY A;  1J6Z A;  4FWO A;  4M3Y A;  3SUO A;  4I2Q A;  2QEX N;  3L4Q A;  3NF7 A;  3UKR A;  3R3L A;  3QES A;  3MK6 A;  3T3F A;  4ID1 A;  4PKI A;  2QKB A;  4DTS A;  1TL3 A;  4FZX C;  5JLF A;  4DTP A;  2IOC A;  4QS8 A;  3C6H A;  4C1N K;  3NDK A;  3SQ1 A;  1IBM K;  3HST B;  2OTJ N;  4DR2 K;  3WQT A;  5ADX H;  5KRS A;  4NXM K;  3DOL A;  2NUB A;  3P39 A;  2Z1J A;  5AQI A;  3KD5 E;  3CIP A;  2YHY A;  1YJ9 N;  4EZ6 A;  4GVM A;  2YHW A;  3UE5 A;  4DG1 A;  3P83 D;  1KC8 O;  1VQM N;  4NCG A;  2XRI A;  5C0Y A;  4DUY K;  5EX5 A;  1A5W A;  2P1J A;  3O5B A;  3FFI A;  3QFU A;  3H6E A;  3THY A;  3TAR A;  4FZZ A;  4YHH K;  2KTQ A;  3FZH A;  2NRV A;  4E89 A;  3VQE A;  3OVN A;  3K58 A;  4JV5 K;  1RT3 A;  3KZB A;  4FO0 A;  2RPI A;  2CGK A;  1WN7 A;  5I9E B;  1QTM A;  3LDQ A;  3T1A A;  4FJ8 A;  1CZ9 A;  4ZHR A;  4H5V A;  4JI4 K;  4GW6 A;  2P9S B;  3MX5 A;  3AGK A;  3UKR B;  1NNE A;  2VGM A;  3ENB A;  3TAP A;  4DSE A;  1BDG A;  2VG5 A;  1DEJ A;  3B6O A;  4X65 K;  5DK5 A;  5BPN A;  1X9S A;  2A1S A;  3V9Z A;  4DFM A;  1RT7 A;  4K42 A;  4XIU A;  3BZC A;  4B1X B;  4CEA A;  4KRF A;  1VQ9 N;  3DMJ A; 
#chains in the Genus database with same CATH homology
 4FM2 A;  1F21 A;  1G15 A;  4OVL A;  1SL2 A;  4DTO A;  1LV5 A;  3AVF A;  2YNI A;  4M3T A;  3DI6 A;  1C0T A;  1DLO A;  3QIP A;  4IG0 A;  2DFH A;  4TSX A;  3DLR A;  3MEE A;  4CJL A;  4F3T A;  1CXU A;  2DY4 A;  2XY5 A;  3AVA A;  1I3A A;  2X78 A;  3AVN A;  1JKH A;  4PA1 A;  3SUQ A;  3SV3 A;  3K59 A;  3ZT1 A;  1W0H A;  1L3S A;  3CG7 A;  4F8R A;  2EHG A;  4Z4H A;  3SUN A;  1ASV A;  4RW6 A;  1BI4 A;  4KHQ A;  1EET A;  1T05 A;  2O4G A;  3VQC A;  2OYQ A;  4ICL A;  4LH4 A;  1QQC A;  4Q5V A;  1UOC A;  2RF2 A;  3G0Z A;  2G8F A;  1TK5 A;  1B9F A;  1T7P A;  4YNQ A;  2ATQ A;  1RT4 A;  2HW3 A;  3V1R A;  1XWL A;  2Z1G A;  2XY8 A;  1WAJ A;  1X9W A;  3NH1 A;  2PZS A;  2OZM A;  3DLK A;  4CJF A;  1BIS A;  4NCB A;  4KB1 A;  4C8N A;  2OPR A;  3MEC A;  4O5B A;  1SKS A;  5JS2 A;  2YHA A;  4DS5 A;  3SPZ A;  3RRG A;  1HMV A;  3L2W A;  3K5L A;  1WNS A;  3H08 A;  5CY4 A;  1RT1 A;  4CF8 A;  4CF9 A;  1REV A;  4CGF A;  2IC3 A;  4CJK A;  4L8R B;  2XY6 A;  2XY7 A;  3QLH A;  2BE2 A;  4RG8 A;  3L8B A;  4KV8 A;  3VQA A;  3HVT A;  3KKS A;  1ZBI A;  2QKK A;  4B3O A;  3I0R A;  4FZY A;  1QS4 A;  1EKE A;  3OYC A;  1FXX A;  4CJS A;  1VRT A;  1J54 A;  1KSP A;  1SV5 A;  4MFB A;  4DSJ A;  3SPY A;  5I3U A;  1RTH A;  1ASU A;  1RDC A;  3M8P A;  3LWL A;  1U45 A;  4B9N A;  4CED A;  1ZBF A;  3CM6 A;  4B8C A;  3OYF A;  1S1W A;  1UAX A;  3PO4 A;  4FJ7 A;  4E7J A;  5CYM A;  5J1E A;  1NJW A;  4FJX A;  4QOZ B;  1LWF A;  1Z26 A;  4DQQ A;  3EYZ A;  3LZI A;  5J2P A;  4J2E A;  3EZ5 A;  4CGH A;  3S3M A;  2ZE2 A;  4B8A B;  3DLG A;  4HCB A;  2OA8 A;  3SYZ A;  4O44 A;  4RW7 A;  1L5U A;  1C1B A;  1Q9X A;  2B5J A;  4Y1D A;  1NJZ A;  4KHW A;  4CEC A;  1XI1 A;  4N76 A;  3UIQ A;  1KLN A;  2G8U A;  3KLG A;  4FK4 A;  4LSN A;  1HNV A;  3HPH A;  1HNI A;  4CE9 A;  4FM0 A;  3SI6 A;  4DWI A;  3OS1 A;  1QSL A;  1EP4 A;  3M8S A;  1L3U A;  3SQ0 A;  4KHN A;  4O55 A;  3V9S A;  3QO9 A;  4H4M A;  4B9T A;  4BDP A;  3HJF A;  4AHC A;  1VSK A;  1RTJ A;  1KVC A;  2VWK A;  4KFB A;  3VQQ A;  5KTQ A;  3KK1 A;  4FLZ A;  2G8K A;  3TAN A;  5FRO A;  4O0I A;  2D0A A;  3AVH A;  1RT5 A;  3HM9 A;  4DQR A;  4FXD A;  4CEB A;  4BDZ A;  2P5O A;  3QEX A;  2KZM A;  1YTU A;  2YV0 X;  2EX3 A;  2YNH A;  4CEQ A;  1GOC A;  3D45 A;  3HXM A;  5FRN A;  4R5P A;  1HPZ A;  3AVM A;  3C94 A;  1C6V A;  1S5J A;  2KW4 A;  3DLE A;  3U3G A;  5SWM A;  4OKE A;  3L2Q A;  1JL2 A;  3PX6 A;  1RTI A;  4E1M A;  4E7I A;  5HRO A;  1ZBL A;  2FBT A;  2PYL A;  1CLQ A;  1WSG A;  3S3N A;  1K6Y A;  2HHW A;  1TKD A;  2BGG A;  3LP2 A;  4Q0B A;  3WNH A;  4B08 A;  3JYT A;  3MAQ A;  4CHP A;  2IS3 A;  5CZ2 A;  3L2R A;  3CYM A;  4BE0 A;  3QIO A;  4JRQ A;  3VN5 A;  4CHN A;  3LWM A;  2G8H A;  3AO4 A;  1WLJ A;  3AA4 A;  1BQM A;  4FJJ A;  4M3X A;  3QEI A;  4B9L A;  4DMN A;  2VG7 A;  4NYF A;  1JLC A;  3ZT3 A;  2DFF A;  3F73 A;  4FLW A;  4IBN A;  2I5J A;  4KHU A;  3AO3 A;  4E0D A;  4CF0 A;  4CEE A;  3HP9 A;  3AA2 A;  4FW2 A;  1BIZ A;  4FJN A;  4RW4 A;  3HYF A;  4HHT A;  5KGX A;  1KRP A;  3O3H A;  4B9S A;  3DRP A;  1U04 A;  1J9A A;  1C0M A;  2KZZ A;  3OYJ A;  1TL1 A;  4N41 A;  5DMR A;  1IKV A;  1GOA A;  3SQ4 A;  3V81 A;  3AO5 A;  3E01 A;  1S1X A;  3MXJ A;  1QHT A;  3ASM A;  1S1T A;  4OGE A;  3OJU A;  1LAW A;  1S1U A;  2WOM A;  1QSS A;  4FJ9 A;  1RIL A;  3OYM A;  1S9E A;  3LPU A;  4PY5 A;  3VQP A;  4C8O A;  3OYA A;  1EX4 A;  4IDK A;  3CFP A;  2G8V A;  1VSD A;  3RMC A;  1SKW A;  1JLE A;  4IG3 A;  3VQB A;  4J2A A;  1TAQ A;  4E7H A;  1B92 A;  4KTW A;  2P5G A;  1YVU A;  2IDO A;  5CYQ A;  2YKN A;  2X74 A;  2OPQ A;  4DSF A;  2ZQB A;  1L3V A;  1WSI A;  3AVK A;  3TAG A;  1KLM A;  1JLG A;  4YFU A;  1DTQ A;  5C42 A;  5FDL A;  3T19 A;  3VA0 A;  1ASW A;  3U3Y A;  2HVI A;  2BAN A;  4H4O A;  2D5R A;  4AH9 A;  1QSY A;  4ELU A;  4BWM A;  3V9U A;  3DLH A;  3PO5 A;  3AVC A;  3LZJ A;  1UWB A;  5D3G A;  5HRR A;  1UA1 A;  4OLB A;  3PX4 A;  4KHY A;  4LH5 A;  3CFR A;  1HYS A;  5HP1 A;  3S3O A;  2F8T A;  2DFE A;  4FJH A;  1RBU A;  1JLA A;  3LP1 A;  3LAL A;  4CJE A;  1JL1 A;  3M8R A;  1S6Q A;  2XHB A;  3K5M A;  1Q8I A;  2X6S A;  3V1O A;  4O4G A;  4CGD A;  1NK8 A;  3AVB A;  3WNE A;  3D0P A;  3SNN A;  4DSI A;  5E41 A;  4Z4F A;  4E3S A;  4CIG A;  1FK9 A;  4PQU A;  4FW1 A;  4FM1 A;  4DTN A;  2D0C A;  1IKX A;  1RDB A;  3HT3 A;  3TAE A;  1T8E A;  4DU3 A;  4W5T A;  3RMA A;  3ZSY A;  3HK2 A;  2QK9 A;  2DTU A;  4W5O A;  4DU4 A;  4OGC A;  4BWJ A;  4N5S A;  2YHB A;  1IO2 A;  3OJS A;  4KKO A;  3OYG A;  1RBS A;  1XHX A;  4CK2 A;  3KLF A;  1J5O A;  4CHZ A;  4OJR A;  3ULD A;  5EU7 A;  4ZTF A;  3PY8 A;  3K5O A;  3RTV A;  2VG6 A;  1RT6 A;  2R7Y A;  4DS4 A;  3ZT4 A;  4E1N A;  4FLT A;  1WSJ A;  1MU2 A;  2GUI A;  4WE1 A;  3HPO A;  4F4K A;  4DF4 A;  1RBV A;  1TKZ A;  3IS9 A;  4CJP A;  3IAY A;  2HHX A;  3OYB A;  4LD0 A;  1JLQ A;  2HB5 A;  2B4J A;  1HYZ A;  4AHS A;  4Z4G A;  3NCI A;  4FJM A;  4M45 A;  1A5V A;  4FK2 A;  1RBR A;  1NKC A;  3IG1 A;  4BAC A;  3AVG A;  4M41 A;  3MEG A;  4FJ5 A;  4BDY A;  3LAM A;  4H8K A;  1TK8 A;  1KFS A;  2G8I A;  1C1C A;  4UQG A;  2OZS A;  4W5N A;  3NE6 A;  3B6P A;  1VSI A;  3KLE A;  1N5Y A;  3C95 A;  4OKK A;  4CGG A;  4FK0 A;  4CIE A;  1KVA A;  4AHU A;  1B9D A;  1S6P A;  4B9V A;  3JSM A;  4I7F A;  4EP4 A;  4DSK A;  3RWU A;  3P1G A;  3ZCM A;  1IKY A;  1NJX A;  1C1A A;  4K8Z A;  4DSL A;  3NGI A;  3KD1 E;  1YTA A;  3AO1 A;  3HPG A;  4CER A;  4CEO A;  4CJQ A;  4Z4C A;  1XHZ A;  3O3G A;  3VA3 A;  1NK6 A;  3KLI A;  1RBT A;  1FKP A;  1JLF A;  3KIO A;  3I8D A;  1U48 A;  4OPK A;  1S9G A;  3QEW A;  1W9H A;  1VSM A;  3QER A;  4GMJ B;  3SJJ A;  3RR7 A;  2Q3S A;  3RMD A;  2O4I A;  3VQ6 A;  2HND A;  1NK4 A;  1T03 A;  5KI6 A;  4DU1 A;  4NCA A;  2HVH A;  4W5Q A;  1RCH A;  2KQ2 A;  4G1Q A;  3MXM A;  4FYD A;  5HRS A;  3VQ8 A;  4J2B A;  5C24 A;  3M8Q A;  3TAQ A;  4KI6 A;  4BE2 A;  4FLV A;  3QIN A;  4DLE A;  4EP5 A;  3WNG A;  4KHS A;  3V4I A;  3DM2 A;  5I42 A;  1NK9 A;  3ZT2 A;  3HO1 A;  4FJG A;  2GV9 A;  2E4L A;  4CHY A;  2Z1H A;  3NH2 A;  3BGR A;  4ID5 A;  3ZT0 A;  5CZ1 A;  1TKT A;  2AJQ A;  1LAV A;  4F2R A;  1CXQ A;  3CM5 A;  1KCF A;  3DYA A;  3ZSW A;  3THV A;  3OY9 A;  3AA5 X;  4AHR A;  4B9M A;  1KVB A;  3L3U A;  2X6N A;  1ZYQ A;  1BGX T;  1HYV A;  4HTU A;  4FLX A;  4CJ4 A;  1BL3 A;  3I0S A;  3VQ9 A;  4CJR A;  1R0A A;  5JS1 A;  5SZT A;  4QCL A;  4DFP A;  3CFO A;  4AHV A;  1VSH A;  3NHG A;  1GOB A;  4KTZ A;  3OYD A;  3MED A;  3AA3 A;  4CK3 A;  1N6Q A;  2W42 A;  1BIU A;  4HCC A;  1ITG A;  3F9K A;  3PUF A;  4CF2 A;  3TAB A;  1NKB A;  3IRX A;  1NK0 A;  4CGI A;  3RRH A;  2YKM A;  4I9Q A;  1D9D A;  3KLH A;  3AVJ A;  3TAM A;  2Z1I A;  3QEP A;  1XC9 A;  1SL0 A;  1NKE A;  3AO2 A;  4DQP A;  4DFJ A;  4OKJ A;  5HBM A;  4CHQ A;  4DF8 A;  2HHS A;  1RDA A;  4DLG A;  4CCH A;  2D0B A;  4RW8 A;  3ISN C;  4ZTJ A;  4DQI A;  4FVM A;  2HHT A;  3AVL A;  4DTX A;  4AHT A;  3SUP A;  1IG9 A;  2B6A A;  1NOY A;  1LWC A;  3NAE A;  2YNF A;  4HVJ A;  1UA0 A;  1U47 A;  3LP0 A;  3V6D A;  4EZ9 A;  1ZBH A;  1BQN A;  3KJV A;  4JS5 A;  5J2Q A;  4Z4E A;  4DTU A;  1U4B A;  3LPT A;  4CJT A;  4M3Z A;  1VSL A;  2GBZ A;  1TV6 A;  2YNG A;  4CJ5 A;  3G10 A;  4LY7 A;  2XO7 A;  3HVR A;  3OYH A;  1J53 A;  2FBY A;  4K8X A;  3OS0 A;  4M3W A;  1BHL A;  1D8Y A;  4JLH A;  3ZSQ A;  2VWJ A;  3KKR A;  2KFZ A;  2KFN A;  1TAU A;  1L3T A;  4CJU A;  1O1W A;  2ETJ A;  2IAJ A;  3ALY A;  5C25 A;  1RTD A;  3L2V A;  4C8L A;  4FJI A;  1HQU A;  4JS4 A;  3SV4 A;  3QNO A;  5KGW A;  4KB0 A;  2PY5 A;  2G8W A;  1JXE A;  1JXB A;  3O4N A;  1SKR A;  1BCM A;  2HHU A;  1LWE A;  4BE1 A;  3QEV A;  3K5N A;  4CFD A;  2Y1J A;  2FBV A;  2OPP A;  1ZBU A;  4KRE A;  1LW2 A;  3O3F A;  3QET A;  4PUO A;  2HHQ A;  3BDP A;  1WSH A;  1WSF A;  3AVI A;  4E7K A;  3NF9 A;  3SCX A;  4JRP A;  1TK0 A;  3OYN A;  3DRR A;  4HUE A;  4CES A;  2E6L A;  1SL1 A;  4W5R A;  3EY1 A;  3RMB A;  4RW9 A;  3ZSV A;  4O0J A;  4HUF A;  3ZSX A;  4IFV A;  3L3V A;  5K14 A;  1S1V A;  4FLU A;  4F2S A;  1A5X A;  1VSF A;  3NF8 A;  3O4Q A;  4AIL C;  1TGO A;  4OPJ A;  1NK7 A;  4CIF A;  3VQ5 A;  1HQE A;  4QAG A;  4CHO A;  3P5J A;  1U49 A;  3KK2 A;  4CGJ A;  2HNY A;  3VQ7 A;  2E6M A;  4M3Y A;  3SUO A;  4I2Q A;  3SZ2 A;  2HHV A;  5T7B A;  3NF7 A;  3NFA A;  4I2P A;  1BI4 B;  2OPS A;  4DTJ A;  3QES A;  4KTQ A;  1X9M A;  3T3F A;  2FBX A;  1Z25 A;  1WAF A;  3DRS A;  4ID1 A;  5HRN A;  3OYE A;  2QKB A;  4DTS A;  1Y97 A;  1TL3 A;  4C8K A;  1VRU A;  3LAN A;  4FZX C;  1YT3 A;  3NBP A;  4Z0U A;  1C0U A;  5HRP A;  3NGZ A;  2ITG A;  4DTP A;  1D9F A;  2IOC A;  5FRM A;  3ZSZ A;  3LDS A;  1WSE A;  3SQ1 A;  3NDK A;  3MXI A;  1VSJ A;  4F3O A;  4CJV A;  2JGU A;  3V9X A;  2QXF A;  4E19 A;  3V9W A;  3KTQ A;  2JLE A;  3HL8 A;  2HNZ A;  2HMI A;  3NH0 A;  3HST B;  4N47 A;  4N56 A;  1SUQ A;  1JLB A;  4CFB A;  3S9H A;  4CJ3 A;  4KAZ A;  4KO0 A;  5KRS A;  3TWH A;  4FJL A;  3DOL A;  2PYJ A;  1RNH A;  4C8M A;  3PX0 A;  1IKW A;  2NUB A;  5HLF A;  4DTR A;  2Z1J A;  3ZSR A;  3DLB A;  4CFC A;  1HRH A;  3KD5 E;  4EZ6 A;  4FLY A;  1TKX A;  1BCO A;  3C6U A;  4GVM A;  4HUG A;  4DG1 A;  2Y1I A;  3P83 D;  3A2F A;  4NCG A;  2P51 A;  2F96 A;  2XRI A;  4NYN A;  3CQ8 A;  5J2N A;  3PV8 A;  4M42 A;  1A5W A;  1RDD A;  2P1J A;  5KRT A;  3FFI A;  2LSN A;  4FZZ A;  2KTQ A;  3TAR A;  1LW0 A;  4B9U A;  4LSL A;  3HP6 A;  3OYI A;  4Y1C A;  4E89 A;  1EXQ A;  3WNF A;  3VQE A;  3L2U A;  1VK0 A;  2RKI A;  3OVN A;  1DTT A;  3K58 A;  3ITH A;  1NOZ A;  1RT3 A;  2ZD1 A;  4ELT A;  2F8S A;  3SQ2 A;  3C6T A;  3QNN A;  4IKF A;  1QE1 A;  4PWD A;  4CEF A;  2RPI A;  2BDP A;  3ZSO A;  1WN7 A;  1QTM A;  3U6F A;  1FKO A;  3T1A A;  5J2M A;  4FJ8 A;  1CZ9 A;  4ZHR A;  1IH7 A;  1D5A A;  2A1R A;  3K2P A;  4GW6 A;  1NJY A;  1I39 A;  3OYL A;  1VSE A;  1NK5 A;  1TVR A;  3TR8 A;  1Q9Y A;  3RR8 A;  4DQS A;  4Z4I A;  4MQ3 A;  4I9L A;  1RT2 A;  4IFY A;  2WON A;  3OS2 A;  3TI0 A;  4CFA A;  4CK1 A;  3TAP A;  4DSE A;  4ELV A;  3VQD A;  4KI4 A;  2VG5 A;  4CJW A;  3DOK A;  3B6O A;  3NF6 A;  1X1P A;  1KFD A;  5DK5 A;  4E7L A;  2FC0 A;  3LAK A;  3AV9 A;  3V1Q A;  4CEZ A;  3OYK A;  3TAF A;  3LP3 A;  2A1S A;  1X9S A;  4M3U A;  4OLA A;  2RN2 A;  3KK3 A;  3V9Z A;  4M3R A;  4CF1 A;  4DTM A;  4DFM A;  3NGY A;  1RT7 A;  3VQ4 A;  1KTQ A;  1CZB A;  4XIU A;  1HJR A;  4J2D A;  4FJK A;  4FCY A;  2IGI A;  4CEA A;  4KPY A;  4KRF A;  3DMJ A;  3K57 A;  4DFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...