1RBYA

Human gar tfase complex structure with 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid and substrate beta-gar
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
200
Chain Sequence
ARVAVLISGTGSNLQALIDSTREPNSSAQIDIVISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDSAIDLVLEEFSIDIVCLAGFMRILSGPFVQKWNGKMLNIHPSLLPSFKGSNAHEQALETGVTVTGCTVHFVAEDVDAGQIILQEAVPVKRGDTVATLSERVKLAEHKIFPAALQLVASGTVQLGENGKICWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE
publication title Human GAR Tfase complex structure
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 62
structure length 200
sequence length 200
chains with identical sequence B, C, D
ec nomenclature ec 2.1.2.2: Phosphoribosylglycinamide formyltransferase.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 1rbyA00
3DA8A 1ZLYA 3TQQA 1YRWA 4QPDA 4ZZ2A 5CJJA 1JKXA 4Q12A 4EW1A 5J9FA 3R8XA 1NJSA 1RBMA 3N0VA 3AUFA 1RC1A 3GARA 3Q0IA 4ZYTA 2BW0A 1MEJA 2GARA 4YFYA 4ZYZA 1GARA 3O1LA 3P9XA 4ZYVA 4EW2A 4TT8A 1RBQA 2BLNA 4ZYYA 1GRCA 3LOUA 4ZZ1A 4TS4A 1CDDA 4QPCA 3TQRA 4TTSA 1CDEA 3W7BA 1RC0A 1RBZA 1MENA 3AV3A 4EW3A 4S1NA 1ZGHA 4ZYUA 4ZZ3A 3NRBA 1RBYA 4ZYXA 2YWRA 1FMTA 4PZUA 1C2TA 4ZYWA 5J63A 1C3EA 4ZZ0A 1ZLXA 4YFVA 3DCJA 3OBIA 4IQFA 2FMTA 4NV1A 1S3IA 4DS3A 2CFIA 3KCQA 1MEOA 4R8VA
chains in the Genus database with same CATH superfamily
1FOEB 4RK6A 2O6HA 3L1IA 1NG9A 3VU0A 1CFZA 2HDHA 3DKIA 2WP8J 1RRCA 2GAFA 2XA1A 3MOGA 2NM0A 1C0IA 4QRHA 5HRAA 4MA5A 2A1UA 1AGPA 2C3UA 3DOUA 4J4TA 1N7JA 3EYWA 4EKIA 4JI5B 2CF5A 1UFQA 2ZWMA 4QUEA 1YBMA 1PZXA 2IIBA 3A3PA 2BD0A 1HXHA 2BV3A 3KKOA 4FFNA 2PIDA 5FLKA 1TB4A 4CE6A 1Y6ZA 1CUGA 1D6NA 5EIHA 1HZJA 2D0OB 1Z0FA 1YTLA 4O6VA 3KS9A 1JR2A 1Q91A 2YJZA 4EYOA 2JLVA 3KVNA 4OB8A 4ZOCA 1W36B 1JQJC 1QH1B 3H5LA 4JDPA 1QO0A 1ONSA 1UAGA 3EMDA 1UF9A 3FUUA 1ZX1A 4LE1A 3MM4A 1N6LA 4D9JA 2VQFB 1H8EA 1EESA 5AKYA 4JYCA 1T9AA 5IYZA 1N8KA 1G38A 2WINI 1UBJS 4YMVA 4YDSA 1J20A 2HA7A 4X95A 1IXYA 2EJUA 3SEAA 1HFJA 4MJLA 4XYLA 4BNDB 1NUSA 1PKXA 3MJEA 1BJTA 5LIPA 3VU9B 1L5YA 2E7ZA 4UAGA 3VNQA 3BMOA 3OZXA 3C15C 4BOYA 1F14A 5CFLA 1W5AA 3PUZA 1XXLA 5K0JA 1R8JA 2GN6A 2LKCA 4FYHA 3NHJA 5BQXA 3CF2A 5I7VA 2IL1A 4HP8A 4X1YA 3NG1A 4OU4A 4PRZA 3FCEA 1NBOA 2R1VB 3B3AA 1G5TA 3EXHC 2DLDA 1ZN9A 1RLUA 1HOXA 4LW8A 1V1RA 2FQYA 4YQYA 3T3PB 2WR8A 1EP1B 4ZFNA 3N76A 1X92A 4G56A 4R71A 3A05A 1KQFA 3SLGA 1S9HA 2VJNA 3N9IA 1FTSA 5JHGB 1JE1A 1R6VA 5L3SA 4QQFA 1XEWX 1LTQA 5AW9A 1G7RA 1NW9B 2C29D 4GS5A 3RV3A 1L2TA 4IHQA 1EH5A 1NW5A 1US8B 2BKUA 4MR9B 4KLCA 3IS3A 4HDKB 4MAFA 1V43A 1MVLA 1O54A 2QUKA 4Q82A 2R6JA 4UBOA 2QRQA 4DEVA 2QBYA 4W99A 4NULA 1K6EA 1E1NA 2ADFA 5A06A 2X42A 1HYBA 4YAUA 1MU0A 2ECQA 1HSZA 3A6HA 3R3WA 3GNTA 1EXNA 5DVZA 5EYPB 3SC6A 3THRA 1H1LA 1SC3A 2C2OA 3JQ7B 1T6XA 4LMPA 4OMFG 4HY3A 3B3JA 2COKA 2VATA 5JC1A 3EBLA 3BZUA 3L6DA 3VMMA 3TG2A 4EK9A 3RFTA 4KOEC 3BGVA 4BMSA 1DTWB 2B92A 5TQ0A 2R11A 1UZAA 3V2HA 5M5BA 4PRYA 1PHRA 4HQRA 5AVVA 3NEYA 4IIYA 1JHPA 4IDCA 4CJXA 2H63A 2HNKA 4EJFA 1GTZA 4XR4A 1ABEA 2A1UB 2C0PA 1E3SA 1G20E 1E8DA 1P72A 3OTWA 4DG9A 3QEJA 1E2KA 4OHPA 4JT2A 5CNJA 1NLUA 1EWQA 3C14C 2ODQA 3OLYA 3DFMA 3AYXB 4V0LA 1Z4QA 1QWOA 2RKOA 2PHZA 3IQDB 3SMQA 4EZBA 4DB4A 1Y1QA 4FYIA 3P2KA 3KEFA 3UTDA 3O3OB 3SE7A 2BEKA 2FHSA 5TEVA 5M04A 1R74A 3BJZA 3QI2A 1DC6A 1E6MA 2O50A 4OYLA 2VUUA 1OB5A 3U56A 3LCVB 1TJ4A 4ND2A 5BV1A 5IYZB 4WXMA 2YVKA 5KOYA 4QFCA 2GSWA 1T2NA 2XMZA 5HIKA 1NIPA 1NJ2A 2P2LA 4FEEA 5G0UA 4Y1FA 4ZEWA 4PQRA 4DHEA 1BWQA 4BRSA 3O8CA 1GN8A 5KTOA 4AN1A 5IP5A 4I1PA 5JCPA 1GSHA 3BMOB 3CT6A 1MCZA 1XBTA 2WU1A 3GAZA 4MW6A 5KTPA 4OI1A 2WLTA 4EECA 1KNQA 1GYRA 4OGFA 3SJ7A 4HHEA 2WPDA 3GRCA 5EOVA 3UHFA 3UZUA 3WGMA 3A0RB 1Y6GA 2OZKA 1LDNA 3NYQA 4FE3A 4EELA 3L4KA 1T6ZA 1IWBB 2IXFA 2R4UA 4X1YB 4E0BA 2J85A 2H0AA 4HAVA 4N8SA 4OI4A 3NXSA 1QFYA 4RZXA 4S1WA 4ESVA 1HOTA 1QV7A 1V7CA 2PS9A 5CJPA 2ZWIA 5D7BA 4IDPA 1NHGA 1ZW1A 4DF3A 3EXFA 4C0LA 1KH3A 3LOQA 3M9XA 3P27A 4DQXA 3ZVLA 1IQUA 1V1RB 1XR3A 4OXIA 3TR5A 3QE3A 4B6PA 4F1KA 3U4AA 1KJWA 1PW5A 1Q0PA 2O2ZA 5C18A 1GU0A 1BW9A 1EM6A 2HLDA 1RLTA 1BYUA 1IG3A 1Y3DE 3A27A 4GBMA 3HE3A 2IYOA 1LLCA 1NBWB 2F90A 2OFXA 4XPZA 2I7VA 2LWIA 2G9NA 5C4IA 1P2DA 5L3SB 1LX7A 2WFMA 5I3CA 1YS7A 4RTOA 1IXKA 1K97A 4QU5A 4D6PA 1JHMA 1TF2A 5DOVA 3BOSA 4GGOA 1R9NA 3KLMX 2P62A 3EARA 3EG5A 3K0KA 4XJTA 1Z35A 1F3OA 1ZINA 5ILGA 2BI8A 2QBYB 1ORHA 1FEZA 2ZRFA 4MMYB 1EFPA 5E1DA 4FGWA 3RJ9A 1QF6A 4YHBA 4Z4IA 4EUEA 3BHMA 2P5YA 2PKQP 2X9VA 4MWZA 2FE1A 2OOKA 4L7VA 3UMJA 2I2WA 3B78A 2YC2C 1H1LB 2Z95A 1SY7A 2CL5A 3D0RA 5CIWA 4ENQA 1FFWA 3H5TA 3NBYC 1PBNA 2RONA 3DEAA 2ZJOA 1ZCFA 4L9AA 1BWPA 3B2QA 3O5AA 1UDWA 1MF7A 1JHAA 4O4HA 1QG4A 1TT5A 4EF5A 4LN1A 4KBFA 5TQ0B 4NONA 2H31A 3M2PA 2WIDA 5C1IA 4LAFA 2CEKA 3RKSA 2O8NA 2R9VA 1R1DA 3K15A 3D8NA 4UEQA 3R7LA 4MINA 4BU0A 4D3FA 2PX2A 1N25A 2VYFA 3P9IA 1LW7A 1OX6A 3ABOB 1A5TA 2HU7A 2P9EA 1TA0A 1WZIA 3RB8A 3C4QA 4N82A 3FFWA 3B1JA 2P2CA 4G65A 3VQTA 3W1EA 2KW5A 3EZGA 5COQA 1EK1A 1GPJA 1X9HA 4C89A 2GASA 4S0XA 4DZZA 1OFVA 1GPBA 3B7GA 3PHIA 4I1UA 2VJAA 2X4GA 3HKEA 1UC9A 3OZRA 2OEPA 1OFIA 4Q7EA 4BNLA 5U9CA 1IB0A 1WXHA 1T0JB 4MYTA 3ZH2A 3R7NA 2VH1A 3KZVA 4XCVA 4L4YA 4WFKA 1L7MA 3OIUA 4M9SA 5DNDA 1ODCA 3BN3A 2GAAA 4P33A 5G1PA 1LPMA 1N3LA 2WW8A 3PQ4A 4WNIA 5LVAA 3IKTA 4CQNA 3GY0A 3CSUA 4LBZA 3HWRA 4PZYA 4MQUA 2VUIB 2KLHA 3Q0TA 4C43A 2DR2A 3N53A 4HDQB 2X8JA 3CKLA 3CH6A 2HBQA 3KT3A 1VGQA 3AHCA 4QJ3A 3KJIA 5JJKA 3IEPA 3ROXA 4K6GA 2VJCA 5EFZA 4MAMA 2VJKA 1U9ZA 2FJ0A 2UVDA 4E4YA 2CE2X 5LYYA 1P1IA 1U1CA 2JLBA 3HDTA 3R5TA 1BROA 4KIUA 3KR9A 4LX0A 1JWBB 4QYXA 5B2EA 1OIWA 1GY8A 2YS7A 3V2UA 2JIZD 3CT4A 1R0WA 3TD2A 1U94A 4YK7A 2FEOA 1JQAA 4OG2A 4JI1B 3OG9A 5TC4A 3KQQA 3KOXA 1IAVA 1GQRA 3HCWA 3PDWA 4PZDA 3EXFB 5I9BA 2EC5A 3LO8A 5EHGA 5TSDA 4GVXA 2XMDA 2X6TA 3ZDFA 2V97A 4S2UA 4D7AA 3PYMA 1LRKA 2CCGA 2PCJA 2PGJA 2ZTHA 2OQ2A 4DLUA 1BW9B 1ZMXA 2XCTB 5BV2P 4M1WA 3A26A 2UV8A 3J80A 4LRWA 2Q7DA 1JEQA 4BV2A 5AW6A 3V8NA 1JQ3A 3EGOA 4H3KB 1I5RA 2SBTA 1RCUA 2PGDA 3H87A 4V3CA 1UDRA 3GVHA 3GJQA 3Q11A 3ZY3A 2HO4A 3F96A 2BBTA 4MVJE 3NWBA 1ZXXA 4TROA 5HCIA 3HK2A 3AUJB 1EVKA 3PGMA 4AY3A 3AF6A 1OT3A 2G04A 1FMJA 5K3SA 1EUZA 1QU2A 2G6BA 1EFPB 2LXNA 3SYLA 2ZUBA 4JXJA 1D09A 3NAGA 4BWFB 2VP3A 3INYA 1IPEA 1UOOA 3D1LA 1NN1A 3DMTA 3GIWA 1NMXA 4PIVA 4RYDA 5CDGA 1M2JA 5CJ2A 2EHDA 3KBOA 1M8PA 3G0GA 4QOGA 3T3GA 3LRTA 3OHMA 5HS4A 2QZPA 3DUFA 4H1UA 2HZ7A 3C2QA 2CMFA 3B6MA 2Y4OA 4O4HB 3CB2A 1EUQA 1RC0A 4F5EA 1TT5B 4NESA 2POQX 3OZIA 4HWRA 3EZYA 3PFFA 2WPNA 3NTXA 3WHPA 4A2CA 1L8LA 3KQKA 5K0CA 4C07A 1O7JA 2H4YA 2XYVA 5K01A 1B73A 1FRFS 1XFAA 4I55A 1MKYA 3JSAA 4YMGA 3TL2A 1KHTA 2Q0HA 2XCOA 3DVSX 1K5PA 3BYZA 3G0IA 4I99A 3V5NA 2A0YA 5FJIA 4CMCA 4KQHA 3EQZA 1YULA 2PFGA 3ZJ4A 5ECGC 3FDZA 5EKXA 3RSZA 3HKEB 1E2EA 2JFXA 3JAMA 1Q22A 1K7XB 3AVQA 3D2LA 4IEEA 3VGPA 2BISA 2Z6VA 4H7KA 3SR0A 2QJOA 4M89A 1A27A 3EH1A 3ZZMA 5LQNA 1QCZA 5DLPA 5C8VA 4L27A 1J8YF 1V25A 2ZKIA 2GHRA 3NBZC 2Y0DA 2QGNA 3IKJA 3DVLA 1BQ4A 4OMCA 3QOYA 5CB6A 4JI6B 3IAUA 3RT1A 1WDLA 1Z7WA 1U0HC 2Z8XA 3GH3A 2O59A 2H11A 2O7SA 3OCVA 3VVMA 3QQPA 1XZ8A 4E11A 1TJPB 1YR7A 2X8JB 1QGOA 4QU9A 4Y3UA 3L07A 4RTMA 4MUJA 2FXIA 2PGAA 3MJRA 4X63A 4KQWA 1NP3A 3OQBA 2J5BA 5IBQA 1L5LA 3KZKA 1L4EA 2P69A 4PHGA 4HRAA 2FWIA 3IIJA 2RGXA 3OTQA 4JNCA 1XFDA 3WYCA 1Q0HA 4LWOA 1LDBA 3AL3A 3BAFA 1IULA 1K7FB 2UUOA 4P93A 1WPQA 4RESA 3ZHRA 4C01A 1D07A 3ZR4B 1DIBA 3R44A 1YB1A 5KPJA 2ACWA 4B3IA 1CCWA 1DDOA 4XGNA 4E5PA 3O9ZA 1ZQ9A 5H82A 3QBDA 5TXGA 4CTJA 3CCFA 5LFAA 3DV0A 4HBGA 1CUSA 4FBMA 1C1YA 5F9FA 1ORWA 2RB4A 4NPCA 2F6RA 1R4NA 1SXGA 3JAKA 4KC0A 4TSFA 4RK5A 1I1QB 1JEQB 1C4WA 3Q3VA 4G81A 1BFDA 4HADA 4G4SP 1GYPA 4QATA 3ULKA 1KO1A 3L6EA 1YE5A 1CULC 2JJ1D 1ZNQO 2QVXX 1NUUA 1QGYA 1B2RA 5DK6A 4ECEA 4V0QA 3SQWA 3KXKA 2DUWA 4E32A 2QTWB 3BZBA 5A4AA 1QBGA 3DFUA 4GR5A 4GE0A 1HT3A 2DKFA 5HKKD 2ZUSA 1TUEA 2A78A 4NP6A 1APBA 1ZD2P 3LUJA 3PQ7A 4K7JA 1QK4A 1F2VA 3ZXUB 1ISMA 4HXYA 2ATCA 1O89A 2XMBA 1M0TA 4CMIA 2V7XA 1A8HA 2OOSA 3ND9A 4D4KA 2X41A 2I78A 3BWEA 3DUFB 3KXLA 5LOVF 1Z36A 3TJRA 4YUZA 4UNPA 2YS6A 2BLNA 1I1OA 1R0KA 2QQ5A 4R2XA 2O4UX 5D8DA 3T95A 1RI2A 1GKLA 4IHJA 1VHJA 1U3UA 4RD0A 2GUWA 4B3TB 1HNWB 1GRQA 1BA3A 2JLSA 3EXAA 4WCDA 3TEFA 2P40A 4I55B 3IRUA 2XD9A 1SUPA 3K9GA 5D3KA 5MF6A 3AX6A 3HN7A 3OJ0A 2HPHA 2LDXA 3USCS 2GK4A 4CMEC 2EW1A 3R5KA 3ED1A 3OQPA 4QDKA 3E35A 1HK7A 3FDZB 4QOEA 1FRNA 3VR6D 1G9XA 1WLSA 1JR3D 3K1ZA 3WGHA 2JLUA 2Z04A 3LBFA 2FUG1 2PQ2A 2IXBA 1GQSA 3B5JA 3DL7A 3EJ6A 5FBLB 5IANA 1T4BA 2DYKA 2G4VA 5DASA 4MPTA 3UAOA 2A0UA 2WTXA 4FCVA 3HM9A 2EX0A 2LVBA 1FFBA 4UZSA 4CM4A 3NWJA 4Y6GB 2IBSA 4WRRA 3WI7A 1RXSA 5AVTA 2JATA 1KZYC 2RKWA 3CEHA 3F8TA 4IV8A 1YV9A 3B8HA 1VGVA 3E61A 4GWLA 2H1VA 3NTQA 4F5YA 1XMJA 3RG2A 1UDAA 2PQ0A 5EZQA 1U0TA 1DOZA 1U8XX 4X8MA 4Z1OA 1XRLA 4ZVRA 3F5DA 1W46A 1DOAA 2PH7A 2P1DA 4N0DA 4QWMA 2XB2A 3B6KA 4IJUA 8GPBA 3QF4A 1TJ5A 2FE4A 2G76A 2GBGA 5CT4A 4F6CA 3GAMA 4TMFA 1O77A 2C95A 5IBRA 1XAGA 2DFPA 4KZPA 1VP3A 3TD6A 4RPCA 1GNVA 2JEOA 2MR5A 2P9JA 2QORA 2WU4A 4DSOA 3UB2A 2XXBA 2JZCA 5FUMA 5KNBA 4NU5A 1RM5A 2PXXA 3QE9Y 3DV0B 1WJGA 4X6XA 1DBSA 4B35A 1R4NB 3U4HA 3JAKB 4ZA2A 4PZ0A 1XRQA 1SIWA 3G82C 1UPUA 1ULZA 2QMYA 3GGJA 1K6MA 3P20A 2J09A 1W2HA 2RC5A 4IMRA 4XUGB 5F2EA 3SC3A 1ECPA 2VPIA 1FS5A 4AICA 2C84A 2V7EA 1KI2A 4OGKA 4QPDA 3U7GA 3NVDA 2DSNA 4K9SA 3KJFA 1OA0A 3R7FA 1JLLA 4QQ8A 5JH7A 4JJ8A 1TM7E 1BNCA 4ZVUA 3C3EA 3KL4A 2G0NA 1DU4A 3U5ZB 2ONKA 4DV0B 1ZS9A 4ID9A 4Q05A 1BVHA 3JQPA 2I6TA 3L7CA 1OE0A 1CJKC 2FEXA 4X44A 1DXOA 2R4QA 5EXDA 1RXYA 2ZIZA 4ER5A 1E5DA 4CMIB 1KY5A 3OEED 4OP1A 4NEHB 5BW8A 1KK1A 2FMKA 3DGFC 5JAZA 1DFIA 2GF2A 3ZK7A 3JTEA 2A92A 3IQFA 1EQ2A 2EG5A 1D4ZA 3ZN2A 1DAKA 1AB6A 1E9RA 4MEAA 5JAQA 2OCXA 4IHJB 4L16A 1QQ6A 4GX5A 3SSAA 4HDCA 1Y42X 2X2PA 2H2DA 2BFDA 3TNFA 2QP3A 3AEKA 4YY3B 4KN8A 1CYDA 4J1NA 1N3BA 3SYNA 3G9UA 3ZY4A 2YDYA 1BYIA 3TR0A 5LZ5A 1DEOA 2QM3A 1F06A 3MUFA 4IJWA 4A3SA 2Y67A 3SIXA 4KXFB 3L93A 1UJ4A 4ZREA 3VO9A 3OFJA 1KEPA 4EHLA 3FOZA 3PT9A 2EZ4A 2TYSB 2JJ2A 2QM8A 1P4HA 4EFLA 3PENA 2CUNA 2R85A 2FFHA 4WKBA 2PZKA 5CA0F 1SURA 2QD5A 4Q9LA 3RYHA 5E6UA 1BVYF 2X76A 2P2DA 3OA0A 5CFRA 3LX6A 1ZOSA 4DLZA 4E6PA 3WIVA 3JWEA 4D4GA 1EFRD 2GJ8A 2A1TS 2Z5GA 1VCIA 2Q3EA 1IY9A 1RM3A 2GEUA 3DTVD 3KE9A 3KWMA 2EYUA 4GKJB 5CDTA 1NNLA 4GVLA 4LZAA 3OQMA 1G2QA 5HOEA 1PR0A 3THWA 4ZJZA 5FEUA 1CS0A 3G8YA 2B4AA 5IJ0B 3IMFA 2FW7A 1SK8A 2EEPA 1J99A 4MUXA 4MW7A 3QF4B 5K8LA 3G85A 2CMDA 2IHTA 2FR1A 1XV5A 4JT4A 2H2HA 5HMLA 4WGFA 1HE4A 4EPXA 1N0HA 2ECPA 3FR8A 2CHQA 3CU5A 3ADBA 2LCFA 5LD2C 1G8AA 4NHEA 3D8HA 3K5IA 3KUKA 1WEKA 2NXEA 3TX6A 3ESAA 3IKMB 4YCCA 5L3ZA 1PNTA 2ADMA 1ENZA 2RCNA 2RJNA 4RIGA 3F3SA 1VSBA 3C8UA 5EGSA 3T94A 3V1YA 1XZQA 1G7CA 2ECFA 2RIRA 3C3YA 2QN3A 1ZHHA 1ZWKA 4B7ZA 2BP7A 3CLSC 2P4SA 1Q0LA 3L18A 1MAWA 4CNBA 4D0GA 4LFAB 2GYYA 2UZ0A 3IIIA 4NAHA 3R9IA 3HP7A 2CHEA 2QTTA 1KH1A 3ACCA 3E0QA 1BE1A 4GBGA 1DWPA 2D0DA 3JRXA 4ESOA 4NMHA 4ZD6A 1N1DA 1TQ2A 2XYHA 4ITVA 3VR0A 1JLLB 2QG9A 5JH7B 5I51A 2X5KO 1I0LA 3RAGA 2QP4A 4RQBA 1SC1A 1LVUA 4JIMA 3H7IA 3E5HA 1GRRA 3NH9A 2B3DA 4JEIA 2XDQA 3LSTA 3UXMA 4AURA 1PR2A 3N86A 5FOUA 3AB7A 2FMXA 1NAHA 1T6NA 4OY3A 2H0QA 4M88A 4DR2B 1PI3A 1X7ZA 3QOWA 3I5XA 2UUPA 3OKCA 1XPOA 1T8WA 1A2OA 3H2IA 3ZS9A 1TCAA 3AVUA 4DJ5X 1JQEA 1FUYB 2X5XA 3AR5A 2GPSA 3ZDCA 3KBBA 4K9KA 3VZBA 1M6HA 2CEAA 4LQCA 1G7TA 1K75A 1ZVJA 3U9TA 3WYDA 3R6TA 2OXTA 4QOSA 1XXHE 1IXRC 1NE7A 4F86A 2BFDB 1CY2A 3AZQA 5FPYA 2PWPA 3AEKB 1U28A 2XZDA 3IMGA 4NE2A 4WOJA 2CJPA 4DMLA 1X3LA 3MCZA 2UZ3A 4U0KA 4R1LA 5FO0A 3RRZA 5AHWA 3QLVA 4OQZA 2RH9B 4IKEA 1XRJA 1KOJA 2EKLA 2IPXA 2X23A 3QFRA 1KZGB 3IOEA 1H6AA 4JENA 3FMVA 3DV9A 3MJVA 4WKGA 4XEHA 3EFEA 1R6UA 4RFSA 3ZGVA 4BQRA 3LY5A 4BFTA 4LK3A 4S0ZA 2ZSDA 4ID3A 3SQDA 4EEXA 3T7CA 3AKCA 1I3NA 1NUAA 1B0AA 4YGYA 2FU5C 1AXEA 1OI2A 5J1TB 3G2OA 1YS4A 2GOYA 2PDAA 3IOMA 1MAHA 1YJQA 5E6UB 3RYHB 1JFTA 2IDJA 1OZGA 3VA7A 2O5CA 3WYAA 4LDPA 4PPNA 2EF1A 1WXDA 2LP4Y 3ICWA 4MPPA 4GYJA 4TMZA 2DECA 3PJRA 3DFIA 1QRDA 1QR2A 3N0RA 3OH8A 5CM2Z 3QXXA 1PEYA 3THWB 2R3SA 1CS0B 5ALJA 2VPWA 5DHFA 4GPTA 5F7ZA 4LJLA 3WNVA 1HI9A 1WD5A 4FHZA 2R87A 3ZD9A 4YGXB 3NAZA 4QULA 2ORYA 1F12A 3AINA 3D0QA 5EJMA 4UJ5A 4I81A 3DZKA 2W8ZA 2PH3A 1Z0SA 4ZRNA 2Q8NA 3L4EA 4OGGA 5A7HA 1TQDA 2VWGA 3MJ4A 4ZDWA 3H0KA 3ZK8A 1EA5A 1FP6A 4QFMA 4A82A 1N57A 3BSYA 4NS1A 4Q1AA 1EG2A 3S27A 1ADGA 3HBFA 4JB0A 4NEQA 2O57A 3ASZA 1SVOA 1IZZA 2JHCA 5DHSA 5LB4A 5EMKA 4DUZB 1FDVA 4P3KA 2VDQB 2JRLA 4E5DA 2ALJA 2BP7B 3A36A 1YONA 3DMPA 4BJ1A 3A04A 2VPQA 3L8HA 4J0GA 4QG3A 3KXIA 4O63O 1VLHA 3JRNA 1E9DA 2PY6A 4O1MA 4GWGA 1J21A 1FDUA 4TTTS 2HA3A 4ZZ0A 2F59A 3AERA 1T5OA 2QTLA 3WQHA 4EJ6A 3CEAA 5HXAA 4TXJA 1S2MA 2FSFA 1P8AA 3G6WA 3MQ2A 4WAUA 4A5OA 1IJEA 1EVQA 1N0VC 1N8NA 3GEBA 3L9WA 2XDQB 5IKEA 8AT1A 4HO1X 5HRUA 3AIIA 4MVJH 3ZTYA 4D0LB 1J2EA 3ETDA 3R7BA 2PLFA 3QK7A 2DT8A 4KXUA 4CWAA 3EOZA 2AI3A 2Y0PA 3AF1A 4XRGA 4MGZR 3A6PC 3UHOA 3E9RA 1RT9A 5H4HA 1GSIA 2WNHA 1BVRA 3R6DA 2EDCA 2QAJA 3EDOA 3VU8A 4QRDA 4AY5A 2FW6A 4NIMA 4OU5A 5GJWC 2YMQA 5AKGA 4LHEA 3PJFA 3VDMA 2JJ8A 2VHZA 5LLDA 4I9GA 3VDNB 5MN6A 1AKTA 2H1FA 3NHKA 1AK1A 2IKQA 3AG6A 2H17A 5EI5A 2WKWA 1SCKA 2O07A 4PRKA 2QA5A 2FRDC 1DV1A 3A9SA 1M83A 4AAYA 1AGRA 2VKQA 1NJSA 1K06A 2OCLA 2WB4A 1OWMA 4RFSB 1YB4A 3ZU3A 1OAKA 3OY7A 4G89A 3ZHOA 1FZTA 4CUJA 2VTDA 4H35A 3TGLA 1BKDR 1LI4A 4KO8A 2FN7A 3LOPA 1LZKA 3ZLUA 3KQVA 2C9CA 3OU6A 1HEIA 1VPWA 2EWVA 2F17A 1N8TA 5DYWA 5C0OE 4BGIA 3ORYA 2ZR8A 3DYVA 4GLBA 1UMBA 4UHHA 2M6SA 1ZJWA 1WDMA 3T41A 4EB6A 3HDGA 4I36A 2ZANA 2DBQA 1XWFA 3SAJA 2JL1A 4IDBA 4HNSA 1NKVA 2HMTA 5DN9A 2D4HA 5HKBA 2Z58A 3LBNA 3OOJA 4NYMR 1F0PA 4RV4A 5YASA 1TO2E 4CM1A 1QQ7A 3C3AA 4MR8A 4E03A 5LN1A 4ZHQF 4BJ3A 2IEBA 2Z1NA 2QRZA 1YD7A 1J6UA 3BCUA 1WXGA 4MV7A 3WRYA 2KI5A 5EERA 1PNVA 3OUZA 1Z3IX 3X1YA 4B3CA 1WSBA 1V1JA 1YR8A 1A8UA 2XWJI 2QN9A 4BMCA 1XTJA 3O1IC 4OJTA 2NLOA 3PI7A 3ZCRA 5CNMA 3WGYA 3J81k 2HTFA 1T8PA 2A57A 3S4YA 3ZCXA 1QU3A 3EVTA 5FFNA 3E3LA 1JG3A 4UC0A 1P5JA 4FB4A 1WL8A 3U3JA 2BMFA 2ZS9A 1QTIA 1JUDA 1RSZA 1CSEE 3F2VA 1RRMA 3GQBA 2J9XB 3B3FA 3HA7A 3VH3A 1A69A 4RZIA 2KJQA 2J5KA 1NV8A 2P67A 2XCUA 4XLZA 3OUUA 3LPDA 4GE3A 4BUJA 3IO3A 1OROA 2H85A 2O3RA 3AERB 4JGGA 1Y4UA 1KBOA 5ED0A 3VJRA 1PK9A 1IY2A 1SCUA 2NPFA 3VV2A 4DMCA 1DAPA 1J8MF 4PANA 3B9BA 5AW7A 1QRSA 2OZEA 2PGIA 1W75A 2QKYA 2YW9A 3MBKA 4UEOA 3ZZNA 2VEDA 5G02A 5KVQA 2XTJA 1L5RA 4ZYWA 4MO2A 3IP9A 3SI7A 1L7EA 3ZJ5A 5KQSA 1NUPA 3FB1A 4FJ1A 4J94A 1QJ4A 2FEKA 4OAOA 2VT2A 2QI9F 3MJHA 5EZ5A 2CXTA 2V9PA 1IUKA 4BBAA 3DJYA 2F64A 3BCHA 1FX1A 2IY9A 3KUDA 4DT1A 2DUUA 4L51A 5K0EA 4M0FA 3TD9A 8ATCA 4PHHA 4X3CA 4B4KA 2Z2XA 2W90A 2YIVX 3MQFA 5IM5A 3V4FA 1FMFA 2VWQA 2XEDA 4DMMA 2JIZA 1W7AA 2FPKA 4EL0A 2CXQA 1D1QA 3TKLA 9ATCA 5FI1B 3D3NA 4PHCA 4BNUA 5J2TA 1RP1A 4LA4A 2EJWA 4ARIA 3VYVA 2NV0A 3HDVA 3HEBA 4JJEA 1NBME 1W5BA 1ZJ5A 4OSPA 5D87A 5DWQA 2QN7A 5DIZA 1PLJA 3AW9A 4YUXA 4N1AA 4K3UA 4PLFA 1ZBQA 3IBYA 3T34A 4F4IA 1WBDA 3OWXA 5F2KA 3UXYA 4P7FA 4TPKA 4XWGA 2ABWA 1LFDB 2JC3A 4JSYA 4EUFA 1TYBE 3AR4A 3EBPA 1I9GA 3C8HA 4MA0A 1YAHA 2RH4A 1S2OA 5D84A 1P45A 1H23A 3E9QA 1ZUHA 2F43A 3NVMB 1ISPA 2BGLA 2PSJA 2W6QA 4OQEA 1UMBB 4HGQA 4QHYA 2NXJA 3EBOA 4N18A 3KU1A 3TO5A 3B89A 4EB6B 1DC7A 1PJLA 3BIXA 1USUA 2JF0A 2ZYTX 4WZ6A 1Z2OX 3T5CA 1ODIA 4OUDA 4QGSA 4QYIA 5A1TA 3ORRA 1D8AA 1D6MA 2RGUA 3ICPA 5K6RA 1J2RA 3NHLA 1RE0A 3QEMA 4X93A 3SQNA 3WJAA 4MR8B 5JCOC 1GVHA 1W96A 4CL0A 3IL2A 2WWYA 1FRZA 5I3ZA 1F6DA 1J1IA 3ILHA 4MULA 4FLEA 3RRXA 4HWSA 1IMOA 4MB2A 5HEKA 4PICA 2XT9A 4OX9B 3FPGA 1N4AA 4KWEA 4M1QA 4DL9A 5AJXA 1EWTA 4PO3X 1QSGA 3M6AA 4QT0A 3V7FA 2XKKA 1P8JA 2YXLA 1EZ1A 2RH8A 5JS7A 1HSOA 2IELA 4C2BA 4QSHA 3ZHCA 2VSXA 4WBSA 3LHIA 1SKMA 5KSYA 1P33A 4J9UE 5K3FA 4EMSA 1GPMA 2I4OA 1L8AA 1Y4ZA 2QZ4A 2YXEA 5DP2A 2QRKA 5LQRA 1A1VA 1BD3A 1VCOA 2BZ0A 3GQBB 4OM7A 2Z08A 2DCMA 2WZQA 3CB4A 3W3ZB 4YCAA 6LDHA 1CF4A 2H4ZA 5I8PA 2P0EA 2BSXA 4M1ZA 2ONJA 3WL7A 1AKUA 1U9IA 4BDSA 2G9RA 3ZW9A 2P4HX 3OQ1A 4IHAA 4JD5A 4W5JA 2FX3A 3MPOA 5E4TA 4JX8A 4CRWB 1NTRA 4A15A 2ZRLA 1SCUB 1AHHA 1ZUD1 1M6WA 4CFZA 1AV7A 4JX9A 3EQ6A 1G60A 3SJZA 4A2PA 2VHXA 2N9UA 5K9ZA 5IM4A 3I73A 3DBRA 2PUGA 1QFMA 4GBJA 1IE3A 1TYDE 4IWXA 1GGVA 5T57A 1I4LD 3AIKA 1COZA 4C4ZA 4YRDA 4K6KA 1P1KA 2WVGA 1N3IA 1FLVA 3OM8A 4RLHA 3N75A 2PUVA 1UT6A 1LBTA 1W49A 2IIVA 4YQEA 4DV3B 1XCLA 1V8ZA 4DT1B 3D7RA 4PN3A 3FCSB 1N78A 5E4JA 1NQTA 2FX2A 2CV0A 4NBVA 3PA8A 5FTLA 1DV2A 1C3EA 1TA9A 3OJWA 5I7SA 4U5QA 4X6UA 4TWBA 1ODJA 1IM8A 2PWBA 3TZEA 4E5VA 4GR4A 5J2TB 3LLMA 3ZGXA 1QP0A 2A9OA 3U3DA 1HC7A 1K89A 1UMKA 3EXG2 2MINA 2Q5QA 2HUNA 4WECA 3WL4A 5BWLA 5I6DA 1WKCA 3CX3A 5JQGA 4LVUA 1Q1QA 4D25A 4J29A 1ADYA 1JAXA 2G0TA 1J8FA 2GA8A 2VSYA 3PC3A 2D2XA 1I1NA 2FDRA 2GXQA 2QPLA 4BNZA 4DUYB 2ANBA 5DBIA 2L69A 5CNIA 1A7AA 3OP4A 1MW9X 4GUDA 4M8IA 1P5RA 2J3JA 1L8OA 3V55A 2VQEB 2Q5EA 3EFOA 3ZVNA 2VQ3A 4YMSA 5L51A 1OI3A 2F43B 4DYVA 3N2KA 5WRFA 2OVFA 3NKLA 4ISCA 4KJZA 3B9QA 2YV3A 2V8OA 3I3SR 4F04A 2BKVA 1EM8A 1JL3A 1NC1A 3DR5A 4HMOA 4GZMA 5HKKA 5KOHA 1DSSG 2EGHA 2AG0A 3ZOZA 2PZJA 4OUDB 3GROA 4P54A 4QYIB 5C8XA 4BN0A 2FW0A 3QEMB 5P8WA 5KKAA 2N3ZA 3S81A 3C3MA 1RIFA 2OV1A 5TMEA 5LZ4A 1YDMA 2O1EA 3PF9A 2EKBA 3R6GA 3Q5GA 4I50F 3BL8A 2NU9A 2OHFA 1G17A 4KIJA 4YA6A 2VF8A 2NNWB 4PSUA 1U0JA 3K5WA 1D0IA 4U7HA 4IG4A 1A5SB 3G5TA 2ZJAA 3PL1A 4HLQB 3EIFA 1PGQA 1RKVA 1ZICA 1RRVA 2GPAA 2VLIA 4IMIB 6Q21A 4JV5B 5K3FB 3L4BA 1N5DA 2QX9A 4X45A 3EZXA 3WB2A 1TOAA 2FB9A 2R6HA 4BMDA 1YH3A 2J3MA 3OQIA 5LP1A 4TZTA 2ZRQA 2XV1A 2OZLA 1II0A 3ZZ0A 1VLQA 4A92A 3VR6A 5F52A 2UYOA 1JR3A 2YHUA 3AEYA 1Z74A 4JLWA 4CFSA 5MGBA 3I2JA 3PXCX 5LA6A 4F3RA 5HFNA 4MS3A 2QD2A 4LZPA 1E8NA 4PZAA 4AKSA 2OC9A 3I8XA 3GEPA 3DDUA 2XWBF 2YCBA 4RMNA 5GONA 4B9EA 5BUQA 5JRDS 4L02A 2I66A 5D7NA 3V8RA 2D1QA 4IIBA 3AU8A 2O2CA 1T3SA 3GW8A 4LZZA 3CE6A 1MN6A 1X2EA 2HF2A 2IHKA 1P4JA 2XT0A 4XLTA 3DBRB 5FWXA 4F2HA 4W6ZA 2GNPA 3OPNA 4J7UA 3W3AD 4LXXA 3QOXA 1QGDA 3IFSA 3DOIA 3OT1A 2AQ8A 1FX0A 3H2KA 3I37X 3N0TA 3FWHA 2BZ1A 4FMDF 4KAAA 2BGUA 1OXKB 4G8CA 3SBOA 3FBTA 3H1AA 4PX5A 4QLBA 1UXHA 5EP1A 2X0EA 2J87A 2YWGA 3AR3A 2RJ3A 3PWKA 5IT5A 1GAXA 1T34A 3U39A 3LQQA 5AVUA 3VKWA 2GBCA 3WA6A 3HCFA 2H9IA 4PSAA 2AVDA 4PYJA 1Y5RA 1XQXA 1Y8AA 2P2SA 1XZBA 4RMHA 2I55A 3AY0A 5BRAA 2CMHA 2NT3A 3HSSA 3OM9A 4ZQBA 4A0SA 2DQZA 4L0MA 1I24A 2MINB 3RS3A 1FBTA 1NJ8A 3JAWB 3X1KA 5JQGB 3BDAA 4LHVA 5L4LA 2B83A 2FWJA 3HI6A 3N58A 1AUQA 4B6OA 1HZZA 3EGWA 3LRPA 4W1PA 3NQ41 2EQBA 2O5VA 3ANYB 1R2QA 3E9ZA 3DAPA 5F7XA 1RCFA 1Z5GA 2HF7A 1Y82A 3L0IB 1G8FA 3QLUC 2HN9A 4E5KA 3EPKA 4GNKA 1ZM7A 3EFOB 2ODEA 2P1ZA 3MF4A 5GV7A 4EI8A 3N2KB 5A4MS 4I14A 2QYOA 3UKDA 4BX0A 1R3UA 1R6XA 3F97A 1TIBA 3RW9A 2XQFA 4ZAYA 4FMBB 1EM8B 5KOHB 4LRSB 2Q1XA 1U81A 3TDKA 2XUGA 3QVUA 3HYLA 3ZK9A 1U5AA 3F1KA 3CZ5A 3AZPA 1PR4A 1LQTA 4DB2A 3B1XA 3L9XA 5H16A 1XZHA 4RKYA 4FUQA 1RMQA 4MKRA 1XAJA 4NEGA 3D02A 1KP2A 1JQ5A 2LCIA 1NW7A 3ZV6A 3G68A 1EX1A 3OEEA 4Z6KA 1FDRA 3AUSA 4HCJA 2NU9B 4HEHA 1V8DA 4KPUA 1H6CA 5SZIA 5AW1A 4TTVA 3M2TA 1XWWA 1CF2O 2DE0X 3FCUB 3I42A 4QVIA 4O4LA 5I7OA 5GQSA 3PXAA 2LZ0A 1PJ3A 4OP3A 4JYPA 2VFAA 1DAHA 5JV5A 1YMVA 3NYRA 4HAOA 3DF7A 1PGPA 2HFKA 3TE6A 1Y3CE 1RI1A 2E0IA 3BL5A 3PIDA 3OQIB 5A62A 5JPCA 2OP1A 3MS2A 2OZLB 3PPWA 3M1IA 4IQ0A 3I9JA 4KO2S 3S68A 5E6SA 3AKZA 3GH1A 1E4YA 5IMSA 5FTNA 2XUKA 3V4PB 3UM9A 2NQTA 3EPRA 4Z9BA 5LA6B 4Q1FA 4MS3B 5LU8A 2J3HA 4EAQA 3L6OO 4PTLA 3T7DA 2E48A 4ZYVA 1EP2B 1Z7GA 3BTOA 5GONB 3I53A 1M2HA 3GK3A 3LRXA 3RUCA 1U0NA 4C3OB 5FWXB 3MLEA 2HPZA 4FT4A 1Y7PA 4RK0A 4YECA 5BRNA 2IUYA 2ZETA 1T3LA 2CFRA 2IXAA 2CBGA 1EFRA 3OT1B 5ALRA 1QH8A 2GNAA 4U63A 3DTVA 1FX0B 3RSOA 3O8OA 4DV4B 2YIJA 2J6CA 3N39C 3ZXSA 4NE9A 4EYGA 1CS4C 3K70B 3HM2A 3NIWA 4ZDIA 1ULAA 2GK7A 4QTYA 1CPYA 4JI4B 1OAOC 3CX8A 4KN6A 4JUBA 1T9GR 4QLAA 2ZVPX 5M3BA 2WF7A 2VNJA 3ZLJA 5H8WA 1I51A 1Q1GA 4BHTA 5DYGA 3BFPA 3ZHZA 5HJ5A 4G97A 2EEZA 1JHDA 3NHYA 4OQ4A 4Y2RA 1UBRS 2YCLA 1BGVA 3U2QA 4BQFA 4WCFC 5IWCA 3BD7A 1NBAA 5FHRA 4MVWA 5EXSA 1T2CA 1TK3A 1EGVB 1PWYE 4P81A 4DC0A 4DSTA 3KPWA 2C2KA 4PQEA 2GFHA 1S5PA 4JJIA 4GDFA 2Z83A 3UC5A 1H5UA 1KKUA 1W2WB 3LM8A 3FPKA 2R1TA 3GMDA 1NULA 2J08A 5AXAA 5I7HA 1N9GA 1XA4A 1ZKDA 2BFCA 3FCOA 1GUZA 1JIKA 3B20A 3E9NA 4GXNA 4MIOA 2GYWA 3I1YA 3RVDA 1X7WA 5FOTA 1MAAA 2G07A 4CG0A 5AI9A 1RJDA 2BEUA 4OM8A 1O9GA 2P6MA 1L4LA 2O2EA 4NENA 1Q12A 3GLVA 1PZNA 3HFSA 5HA5A 2BFBA 2GRUA 5IJAA 3PHCA 1VE9A 2VHUA 4RADA 1FNNA 4PXAA 1TEHA 3CCCA 1VMDA 1ZMBA 3IKVA 3L79A 1LRLA 1O1YA 2Q6LA 3TW4A 5GIPE 2JIPA 1JYSA 2JRCA 1ZI9A 1ACJA 2Q3DA 2VDLB 3GWGA 3HACA 4QECA 4KPUB 2CMGA 2O2IA 3BDVA 3DULA 1J8DA 2XGGA 4I5EA 4AECA 2O1SA 3FOWA 4QELA 3WL6A 4LNUA 4O4LB 3HHPA 1K9SA 4IQ4A 1ZGBA 3GDHA 3VDRA 2JIDA 2JFZA 1RYFA 5DRTA 4G0VA 3P9RA 3I0MA 1U0RA 4K2AA 4GP9A 2C7PA 3AF3A 2AV6A 1T8YA 2EFJA 3GT0A 4LZLA 2ZUTA 4P58A 4Z99A 4EY5A 2C3MA 1JIUA 3OE1A 1NNEA 3OHSX 1VE7A 4ZZ2A 3SC4A 3SX0A 4FSDA 4X41A 3TSZA 2I9PA 4AJPA 4R2MA 3GG9A 2FXVA 3AF5A 5ALFA 5E6SB 4ZCMA 4QKQA 4HB0A 4MQBA 2PYDA 4WI1A 3VR5D 4DQDA 5KNCD 4HX5A 3VFDA 4DZTA 5LIRA 1T4DA 4OQMA 2PBZA 4RPKA 4KH0A 3PEWA 3D9QX 4HEA1 1WB9A 1BKYA 1U31A 1G8YA 3I9V6 3NMUF 3JPYA 3LUPA 1VBFA 4TWJA 4RL6A 2TMKA 2WMDA 3FLEA 4V0OA 1J09A 3HWWA 4RE6A 3TZHA 4PYQA 3U3KA 1MOSA 2WFAA 3FD8A 5ECDA 3ZW7A 2K2WA 4TKVA 3IE1A 4Y7CA 5U4QA 1OF1A 3PWZA 3A2MA 1GPUA 3QTBA 4CIBA 3MJDA 1QXSA 1Y3BE 3QU9A 4IINA 1QH8B 4DCOA 1J7KA 3DTVB 5G41A 5JJIA 2NYVA 1LPAB 4DZRA 3EVGA 4ND5A 3DDOA 1QIMA 1RC8A 3Q3EA 1XC7A 2PD3A 4L4UA 2AR9A 4GMDA 3I1JA 3N2LA 2SECE 1QNFA 1YUBA 2QRPA 2Q1YA 3EC7A 3G59A 2F67A 4XTCS 5JALA 3KHKA 3U7IA 2PX8A 3R0IA 1MGOA 4H15A 5DYTA 4D9HA 1YGYA 5M29A 2ZIAA 2X7JA 3OEHD 1SU7A 1GKUB 5CH8A 1Z29A 3QUBA 2R6DA 4BXOA 2VDWA 4JGIA 4BNGA 1AJEA 4LJYA 3W8EA 5JPDA 2JGJA 2VCHA 4WKOA 3OJLA 2EXXA 2WU3A 2JI6A 3DT6A 3OZDA 2DX7A 2HRCA 3MT0A 4P4SA 4XOIA 3ZXXA 2NADA 4CLXA 2QVCA 3GLGE 2GJSA 5TJHA 1T10A 4HXEB 5I48A 1JLMA 2HB6A 1I80A 3PXUA 1QIHA 4L8FA 4K6FA 4P80A 2OQRA 2R1TB 4RL4A 3OIVA 1N9GB 2BFCB 5LKRA 5DHUA 3U31A 1EE1A 1X7WB 4AKTA 3C5VA 5JXIA 4ABTA 2VO1A 4WXHA 1JALA 2BEUB 1R16A 5TF4A 3C0KA 2ZJ4A 3WNBA 4NENB 4Q66C 5ALDA 1RPJA 4E08A 4ZI3A 3C7KA 2BFBB 3H1EA 3QX9A 3QXCA 5F51A 4TLAA 3NRBA 4FSHA 1EP9A 1M6YA 2OXFA 3M5PA 2PS3A 3D43A 2DPXA 2XUZA 2ZB3A 3AUYA 2BFPA 2YFQA 1OVMA 4KNYA 2H1HA 3VHQA 2VRNA 4ML3A 1ECBA 1BU5A 2WD9A 3DM5A 3RVBA 3TL3A 2BKXA 2R7MA 1KAMA 3FDIA 4U02A 1JDJA 3CF4G 3BXHA 4JVLA 5IFLA 2GZHA 4IX1A 2OV6A 2AK3A 1P5FA 3QY0A 2V1XA 4XIGS 1B6GA 1Z0KA 2OLJA 3L46A 4PNPA 4AP6A 2O06A 2C2MA 4JU8A 3HTXA 3EEFA 2VNSA 3NU1A 5IVIA 1XL0A 3JQBA 1IB6A 1VHWA 4G0WA 1TEVA 4YRKA 4M98A 3ESXA 2F4NA 3EHDA 1XJCA 2W2LA 3K2EA 3QE2A 4CCWA 3M0EA 1Y5MA 3BQMB 2ZT5A 2R8PA 1XPJA 2GTHA 3G7UA 1XVAA 2EJTA 4ITUA 4BX3A 1YJ5A 3PDUA 1TC2A 3WBJA 1GCIA 1FNMA 4QFDA 4H7EA 2ACVA 3R8CA 4AYWA 1CUVA 1MRNA 3GUVA 5ENZA 3TQQA 4IRMA 4LXIA 4U1RA 3AL0C 4GNRA 3VZCA 1Z2PX 1Q6ZA 2ZRDA 1WZCA 3IPCA 2FQXA 2WQZA 1TTTA 4XR9A 1JYEA 2VI5A 3S1LA 4TKVB 4IZHA 1T1JA 5JNWA 3AEQA 1JG2A 1N6NA 2D54A 4G4IA 3AFGA 3DL4A 4MB0A 1KQPA 1WF3A 1Y3AA 1DKMA 4UUBA 3CTPA 1WR8A 2V7PA 1EQAA 3EZ9A 3LHKA 1CJSA 1IJFA 4Q15A 4F38A 4IR7A 1POWA 3WDMA 2H5EA 2A58A 4B81A 5IDQA 3BDIA 1DHRA 2QB5A 1JBQA 1I6KA 3MLBA 4RGBA 5DEIA 2PUEA 1NN0A 1ZN2A 1V4VA 1MO6A 1Z22A 4JGBA 2PYZA 4MOWA 4ONEA 5AXCA 4EPRA 4TTJA 2DPHA 1M2EA 2A4MA 3X0DA 1Z0UA 2EZ8A 3NP7A 2BUAA 4BXOB 4L0CA 2VDWB 3PQEA 4F9GA 5MN4A 1ZI8A 4PWYA 1KJ9A 2PH1A 3MYRA 4DCGA 3KB8A 2FPWA 3FWPA 4B6JA 5KYWA 3GJ6A 1YZUA 2RI6A 1B4DA 1PP4A 3MTBA 2EFHB 4N5LA 4R05A 4P4SB 1SVWA 4U2KA 4ME6A 4OFZA 2CJFA 1H65A 1L5WA 4DDKA 3KFXA 4KE7A 1SUCA 1UM9A 2VNHA 5DGHA 3MYYA 3O2JA 1GAQA 2W2MA 3QENA 4BMPB 4QARA 5CB4F 1R9GA 2PCLA 1SWVA 4DTIA 3TB4A 3ZGOA 4B79A 4KCGA 2RHGB 4E2XA 3BA1A 2AMYA 5FF9A 4BQSA 5IJ0A 2DUNA 1BEUB 2Q50A 1VFPA 1S1MA 2O0HA 2OAGA 3QFHA 5AQ1A 1N6KA 4F92B 1ETUA 3GJRA 3JVIA 1WSWA 3FSEA 4UNNA 3KKEA 3VKGA 3R76A 4Q03A 5GINE 3X1DA 1G8PA 3B5IA 2FVXA 5G0SA 1YDGA 2XWPA 2PE5A 2VHVA 4K40A 4YCMA 1ZN7A 2P79A 2R97A 2Y92A 3KJEA 1ZG3A 4IXTA 2RIPA 2ZCUA 3NBFA 2HPVA 3M3HA 4HQFA 3TS1A 5IUNC 3K53A 2GCOA 3G17A 2XCLA 4IDFA 2INGX 2AXQA 3E3NA 2Q5JA 5DM0A 4X8OA 3W4IA 3KAKA 4AMVA 2GN8A 4X85A 4YT5A 1VXRA 4A8JC 4F2DA 3TIXB 4LVOA 1PJBA 2VN8A 4IS2A 1TCVA 2QE6A 4O4IF 1UBTS 3A6DA 1FYWA 3FPEA 3Q72A 2AHRA 2NO7A 3WLKX 5JQWA 1VP9A 2VP4A 4IICA 2I6SA 4O02B 1QB7A 2ZSAA 3GIDA 4AWXA 4GZ3A 2B36A 4L22A 2ZYDA 4M7RA 4CDGA 1QGAA 1J0CA 1Q3TA 2NP7A 2R8YA 2IODA 2CZQA 4G5XA 5JWRA 1DFHA 5DM2A 2GPNA 2C9BA 3AEQB 3HDJA 3M7IA 1U0GA 4EYQA 3AM4A 1A2QA 1HDOA 2G88A 2HIGA 3I6QA 2AVNA 1HDYA 4X94A 2EZTA 5P21A 4L95C 3UMVA 3SWWA 2C97A 3ITEA 1YL7A 3KB1A 3K72B 2ORED 1Y80A 3QPVA 5AM5A 4KXXA 2B0JA 5JI2E 1MFPA 1GTJ1 3FAZA 1DQPA 1QDUA 2O4CA 3N0WA 3T99A 1W0KD 3RD5A 2CUZA 2EJVA 3C97A 5B7PA 1J5EB 1WXEA 1A4XA 3N2YA 1WUTA 2V6JA 4JHXA 4DQKA 5BWMA 2QXTA 4FLMA 4KYTA 2QSUA 5GM2A 1XZCA 3KAQA 2BONA 5B3AA 4ITRC 3I12A 2G9VA 3FDJA 4P4GA 4WA7A 5TEWA 1NSFA 1N2OA 5AM2A 2OBLA 1KKMA 4P5PA 4UVIA 5KYWB 1AF4A 4LJRA 4NCAA 4ZGGA 2YJ3A 4O2AA 4KODA 2RG7A 1OT5A 1C8BA 2WYOA 3F67A 3G0OA 4WDRA 4Z7OB 2H1OA 2AUMA 3PWSA 4FHFA 5IWAB 4K26A 2V4ZA 5EQDA 3FFBA 4MYHA 1S8FA 2QD3A 3DD5A 4BFUA 1UM9B 4Q5IA 5FB3A 4YJKA 1JSRA 1PF7E 2FSVC 1ODSA 3DP7A 1YRYE 1SCQA 1VA5A 4BB6A 1BJRE 2QT0A 2BTQA 4PZEA 1R37A 3PEYA 3R0VA 5FTJA 4KPFC 4BZQA 4AJ9A 2QWXA 3Q41A 5DT9A 1EDEA 1UFKA 3O4RA 4GHWA 2JLAA 2BMWA 4HDMA 1K86A 1Z68A 1IYZA 4IAOA 4FFOA 4X7RA 5FIUA 1EFKA 2Q28A 2EFYA 3AIOA 3LKBA 2QUIA 4Y2GA 3LX5A 2EW2A 2V0NA 3H2YA 4Q4DA 2JBAA 4U6SA 1J07A 1VYVA 4KQCA 4QXRA 1CDEA 1SZPA 3A58B 3A1CA 2P6PA 1H8HA 1JA0A 4J3JA 5EE3A 3ZE0B 2ZCVA 1VDMA 3FW1A 3IERA 3NEJA 2ZI9A 2IF2A 3GQVA 2H7CA 4LKOA 3G9TA 3CNOA 2RBKA 5C9ZA 3L1VA 1ZD8A 2GCOB 1TMYA 3PRKE 3ADCA 3UAYA 1GWNA 2R6FA 1VPTA 4YJDA 4AZ0B 3ZKWA 1XMIA 2E4WA 4KITB 3BRWD 1YNSA 3OCCA 4G5QA 1TM3E 2QX6A 2BFEA 3GCWA 1KFBB 3QPWA 4KLNA 1DAIA 1KAHA 1PR1A 1USWA 2HLNA 3BS4A 4DYHA 3JVUA 4NMLA 3KHUA 1B8OA 1EAMA 3OZ7A 5C31A 5H5JA 3FB4A 3T4XA 4BKMA 4BMVA 1ZCJA 1FS4A 3CLTD 4GEGA 4JI7B 1FNSA 4OFBA 1FMTA 2JHFA 1ZZEA 4IVPA 3ZE1B 3BAZA 2A35A 4IJQA 4UASA 4JQZA 4ZGWA 1OB2A 1VI6A 3KFLA 4YI5A 4QBHA 3T7KA 5IEBA 5CUQA 4AS1A 3VNRA 4QO8A 4EHDA 2UYGA 4Q7MB 5JVDF 5IULC 1SVKA 3D8TA 1FDIA 3DZBA 3LIIA 1JVBA 5CK4A 4OA5A 4RTNA 2OAQ1 1IATA 3WR5A 4M55A 3VTZA 4D46A 1DJQA 3TTXA 4MCAA 3I76A 3OCJA 4ER0A 3KAJA 1RI5A 1SNYA 3TQFA 3SQOA 3ZNPA 2R5NA 2X0FA 3FWNA 4KWIA 1GEEA 1T4MA 2BR4A 2EWWA 3FIUA 4DADA 1NFQA 2ORWA 2JS7A 2ISSD 5DZSA 5TS3A 4YP1A 3WRWA 3F6EX 4BL5A 5IEJA 1A4RA 1GTL1 2O2DA 4I1IA 4OH7A 4GXRA 5BN1A 1HE5A 3AHHA 4MGIR 1UXJA 1YQQA 3D5TA 4MS1A 4P92A 2DQYA 4O2AB 1WY5A 2ZTSA 2YWDA 4FBGA 4FFPA 5EEGA 5CEEA 3QU2A 5E4FA 1XDZA 1T15A 5BQPA 1QX3A 1SKYB 3FY4A 1J2UA 3E05A 4IDHA 2E21A 3MEQA 4UKDA 4U2FA 1RFGE 4NU6A 3C3JA 5NLLA 4URXR 1SG6A 3EGEA 4W82A 4TYQA 5ANRB 4DV6B 1DBPA 3P0FA 2DFDA 2BTQB 1OZAA 3HO6A 3SG0A 1KDOA 1I2AA 1GA6A 4X92A 4Z0PA 4HDMB 4U00A 4U8GA 1KA9H 1LC0A 2EOAA 1ZY2A 2C96A 1HDCA 2WU8A 1TM2A 5CURA 2JBAB 1OGIA 3COWA 5GM1A 1QX4A 3HXOA 2Z2KA 3JY6A 4MZXA 5AT1A 1ESEA 4ZV9A 3G0CA 4HSEA 2V5AA 1ZJYA 3HFRA 4CF6A 1Q84A 5FPQA 2MSLA 4GO1A 3QWBA 3GFQA 4IIJF 1GIAA 1LB1B 1Z15A 4TUYF 2UZ1A 3P9SA 4MUFA 4Y0AA 5JYEA 5ITZA 4DCUA 1UL1X 1J9EA 1R3DA 1FJHA 1E9FA 1TDJA 3E8XA 1JJFA 3ZKWB 3FUXA 2J5RA 1QHXA 3O1JC 4REQA 2P2YA 4MLDA 4C6TA 3IVXA 5JHHB 5M2QA 5BSHA 2W00A 5J4KA 2BFEB 1LDEA 3FZNA 3IDSA 5BNIA 2WDZA 1PHPA 2TRSB 4UREA 4ZQHA 5KJFA 2TSYB 1YU9A 3TYXA 2A0WA 2MOKA 2TMYA 3GEIA 3IVMA 2XCSB 5C8DA 1FYDA 3LNCA 1PKEA 4H16A 5JZSA 2PJZA 5C51B 5T67A 2BF7A 1OZHA 1FP4A 1C29B 1GNQA 2D06A 5FTWA 3UA4A 4FT2A 3STHA 4AKEA 1BAPA 1K92A 2B94A 3GMIA 1E59A 3IAXA 3JV7A 2VRBA 4KFRA 2AOWA 4OHFA 2A30A 5C7LO 5HOQA 4A27A 2W11A 1UBKS 4PWZA 3IAS1 4A73A 3D3WA 1XGKA 5DSZA 2CYBA 3UA3A 3K96A 2VLBA 3OX1A 4ZQCB 4ZU6X 1SCBA 1CLUA 1ZCAA 2DR3A 1MJ5A 2OGWA 3UMCA 3UYLA 2XRFA 1N6OA 3IV7A 2Q6KA 1Y9ZA 2B8EA 5T4HA 4QUAA 1QPBA 2BPOA 2BMVA 1JG1A 3QVJA 4AXXA 4TL9A 3P7MA 1GG2A 1IIRA 1I9CA 2Z2IA 4B43A 1L4GA 5H3HA 3BICA 4XM0A 1LX6A 3B6EA 3E1GA 1EFAA 3UAXA 3AM5A 3HC7A 4WY2A 3OWOA 1VL5A 1ZMRA 3LWBA 3T9FA 1FFXA 4UPEA 1M5RA 3SYKA 5CGZA 2Q9CA 1LQ2A 4FZ3A 4UDXX 1YIDA 4ZU1X 1CT9A 2B30A 2BR3A 2JFVA 3ADPA 4JELA 4MS1B 3A1FA 3F3YA 1P0CA 4A8PA 1NM5C 1B93A 1N2CA 2I67A 4PIMA 4QPNA 4R6WA 4YQZA 1Z62A 2DULA 4KAJA 5B64A 3LLCA 4AJKA 1IU9A 1P31A 1FFHA 1FTYA 3BXOA 3LQFA 4B5LA 3IPLA 2I99A 1O6GA 4QBIA 3O2QB 2RHCA 1VJRA 4LZWA 1JSCA 4U5XA 3U6BA 2ZRBA 1KYWA 4BPBA 3T3DA 3E70C 1EYZA 3D5QA 3KZ1E 2PBLA 1RWPA 1TCUA 1CRLA 1YS2X 2ZBPA 3G13A 3NTOA 3V97A 3VU3A 3T1YB 1W6UA 5IN5A 4AP5A 4FC6A 5A05A 2QEQA 3K9LA 3TQSA 4PY2A 2HV9A 5KEIA 5FXMA 4GG1A 2B1JA 2XAUA 2ZDGA 2V7QA 3HYRA 1JRLA 2A9FA 2ZATA 3KB6A 2QD1A 2L2QA 1LI5A 3ONFA 4BFLA 4MDHA 4UEWA 1M74A 1KRXA 2A0XA 1PR5A 4B76A 3QVVA 2Z2ZA 3B38A 3JPWA 3KDPA 5E2AA 4HAWA 3V9PA 2UZ1B 1HH4A 1NSTA 5ITZB 4MP8A 4J4BA 2V58A 1Z5PA 2JFQA 2Y6VA 4OF4A 1DCTA 1X1AA 4DQVA 5K0TA 4C6TB 1DO0A 4REQB 3D8RA 2AWOA 4D2IA 5FKJA 4J7CA 1D2AA 1GZ6A 2ENWA 4PYMA 4U4AA 1EBFA 1JFSA 5BWCA 3QLJA 3R3JA 1XTBA 4ZOEA 3I8SA 1B8NA 3PCXA 1CDDA 2FZKA 3TKYA 3CPJB 4ZAGA 5L3QA 4NKRA 2FH5B 1UXGA 1FP4B 1V3UA 1DJLA 2HQSA 2X13A 5AK4A 3I0NA 4HMPA 2QM0A 2PUJA 5EHNA 5DGXA 2YV2A 4EITA 3CVWA 4E4TA 4UAJA 2JCVA 3LLVA 4LGCA 4WK4B 3R0JA 3V34A 1IK6A 1VLLA 4LC1A 3CNEA 2R84A 3D3WB 3BGDA 1NJ6A 4JC5A 2GTPA 2Y1GA 1P80A 4S1NA 5E4YA 2D2FA 2P7IA 3FWYA 3S2GA 5ARDA 3VJLA 5FCDA 1A72A 2QTGA 3DE2X 5CCBA 2DTDA 3OWHA 1QK3A 2L18A 2ZULA 1E62A 1RYDA 4JYZA 1T1IA 4KO4S 3UPTA 4XW2A 3R7WA 5AW0A 1MQ9A 4I8DA 3ETNA 4HQLA 4D5GA 4ZYXA 1TTHA 3O94A 1NR7A 2VTKA 4MWOA 2C5AA 3DEIA 1ZUIA 1WNFA 1FFXB 4S1PA 2VJQA 4A6XA 3H1FA 1YQGA 2CHUA 2ORVA 2V54A 5FUBA 3RPEA 2DHQA 1BSVA 3CH4B 2XWSA 3LUGA 1HFEL 1N2CB 2DM6A 3PNKA 4BNVA 5K3AA 5KINB 4Q4AA 2J6IA 1OXBB 5I9MA 4BQNA 2ZUFA 1B7GO 1XA3A 1RWWA 5BV7A 2CKDA 3RIXA 3RFUA 1QYCA 2OBMA 1HFKA 1BS2A 2CE7A 5EJ8A 4UDOA 4KG7A 2NQ2C 3SBEA 3FHJA 4TM7A 3UUGA 2IZ1A 3VR5A 5KNCA 2D2EA 5KJCA 4KIGA 1SN7A 1USKA 4TZ6A 3BIWA 1ZUNA 3OFSA 1TVMA 2O7VA 3FYCA 4NQZA 4WK0B 3OLVA 5G40A 2A9QA 3GUUA 2EX1A 2J7KA 4L75A 1CW2B 2PKXA 2A5LA 4XEUA 2BI4A 2O7RA 3CC8A 2M6KA 2XGJA 3WYGA 3JR7A 4INJA 5C81A 2EJCA 3OX4A 2HY7A 1O0SA 2RB5A 2AJTA 2XTNA 3I64A 3M8KA 4MRSA 3WLSA 4RVSA 2AYZA 2CSUA 4J1TA 1NMQA 3ZJYA 1HT0A 1AQ6A 1EWYA 4CVNA 2WIKA 4LK2A 1QRTA 1MH1A 4OI0A 1OBHA 2RAFA 1OUMA 3PNLA 3QUSA 1SXJA 1X94A 4M1YA 2J4CA 1OKKD 2QQEA 2QVZX 3A1SA 4TTSA 4MVJD 4MWTA 1RWNA 3GJZA 4LTDA 1KK3A 3MW8A 4KQ9A 2XQVA 3OEHA 2VIIA 3KYBA 3TLZA 3QFCA 4H59A 4EBBA 2YYZA 3AO0B 3AR8A 5EJFA 1JMVA 3HVUA 2MMGA 2OMEA 3QITA 3W6OA 4UFPA 2BHSA 4BP8A 1E9BA 5FUXA 5L3QB 1W52X 1ZEJA 1Z34A 3R3VA 4M36A 3GUCA 4N47A 3GVPA 1Z5UA 3IEIA 2Y93A 4HLNA 4XJVA 2XVXA 5FBRB 3SDBA 1Q1AA 5EVCA 3V32A 1ZGCA 2QNRA 4JQOA 5JCZA 4KKVA 1SBZA 4YYZA 3QUQA 5KIAA 2F55A 2EBWA 2JFOA 4ZDJA 1LCIA 3DH0A 3A1UA 3CUEF 3NB0A 1QZZA 3O3NB 4GQAA 4M0LA 4AKHA 1RKQA 3IXQA 3Q87B 5E7IA 4ZVVA 2FDXA 2WJGA 2WT4A 3SZOA 3HJTA 2ECOA 1I2CA 1NDHA 1OIVA 4HGYA 5CCEA 1G55A 5MFZA 1C9YA 4QHTA 2PANA 4YV0A 2IZ6A 1ORIA 1A4UA 2FFJA 4MX8A 4KLAA 1IN5A 3R7WB 3VO8A 4YJFA 5DCYA 4A1FA 4AYXA 2WUGA 4EJMA 1TM5E 5LP6F 4I4TF 4H0CA 5LQJA 2P11A 4LBWA 2QROA 3A1NA 1QZUA 3QKWA 3GRZA 4H3HB 5GVSA 2W42A 2Y71A 2PRYA 2R86A 2D74A 1G2OA 3FG9A 3PD1A 3A1TA 1I33A 1QHIA 3E5MA 3GRYA 3IQWA 4JBIA 4Q1DA 3C6ZA 2AZXA 1IOZA 1DI0A 4MTCA 4JJ6A 3GA0A 4NCKA 1YOVA 5FYDA 1UK7A 1V47A 1YKFA 4Q4AB 2YW2A 3GAAA 2F8LA 1UFRA 4AO8A 3RS2A 4PZUA 2YDXA 4UMDA 1ULSA 3H0EA 3AVXA 4YJHA 5FPKA 2QQFA 5EN4A 1XHFA 4XB6B 2W37A 4BMNA 3BKWA 3AILA 1KO5A 2PGLA 1HT2E 4BO6A 4IQFA 4RHEA 1Q57A 4PC1A 1ZUNB 5DCUA 2QZSA 2CJYA 2YX1A 3PHHA 4FDTA 4MR7A 1W9MA 4OBBA 4WJKB 5DFAA 3UF0A 4CM9D 4O2BF 3NBAA 2SICE 2D8MA 4X1IA 2AUTA 1RWKA 3AUKA 3LL4A 1OH5A 1EK2A 1PCXA 2VYNA 3QWHA 1VYUA 1IAQA 2ZSHA 4Y6OA 1TUGA 1C9EA 1E7YA 1ZOPA 2CLCX 3HRKA 1MJHA 3DS8A 3EGVA 3L0YA 3LQ1A 3HB5X 5AUOB 1Z13A 3T1HB 4CN9A 2QX8A 3UJCA 5FA8A 4BMOB 5A5GA 1C7QA 3ZNOA 5FBQB 1OR8A 1PWEA 3HUFA 2HCBA 1SXJB 5A4KA 1I30A 4Q9DA 1W5TA 1OVGA 5FFFA 5IH3A 4RVNA 3QUCA 2Q7OE 2OENG 3DO8A 3DBHA 3OO1A 4XUDA 5LJIA 3Q8XB 4Z2AA 2ZJ8A 4CV2A 1DC4A 1C3OA 2ID9A 1LLQA 3IEVA 5ES4B 4Z49A 1Y7TA 4OQXA 4JKOA 3H9JA 1FTGA 1P29A 3NT5A 1WS6A 1B23P 3CN9A 4OHWA 1FQOA 2D5AA 5HIMA 3MMZA 1YUMA 5GZ6A 1E7QA 3HBAA 5LBTA 3E9CA 3ZD6A 1KMIY 2O2GA 3VZSA 1S6YA 2PRZA 1CC1S 3BVPA 3H2GA 4L2IA 3D4IA 1AKQA 3LNTA 3M6FA 1W4ZA 3ENWA 5L7TA 3NC1C 1NQOA 1YZ3A 4TSRA 1EEXB 3GGSA 3WVNA 3EGXA 3RVRA 1F2UA 4BFZA 1PT7A 4PFKA 4ZK6A 3RC8A 1Z3CA 1D8TA 2PKQO 4YX9A 2NUAA 2BLLA 3R0QA 1P2SA 4M22A 4Z3KA 1OFHA 1SOVA 4LBYA 3TN7A 3FETA 1ZH4A 3IUEA 5F1YA 3ITDA 1JFVA 3EQ2A 4EA7A 2IYLD 4C7JA 3MRTA 4G5RA 5EGNA 4WLFA 4Z5XA 1NATA 2ZWPA 3PUIA 4QGHA 2BOVA 4RETA 3NORA 4MA4A 4YJFB 3RTEA 2OV2A 3WKDA 1XKXA 1I14A 1RWMA 3GD7A 2OD9A 3FFAA 4HC4A 1C9NA 2QS9A 3CLUD 3DD1A 1YK0A 3IVGA 3PUJA 4UNSA 1NI3A 2VNAA 3R7SA 1PQPA 2F1HA 2FKNA 1ZAKA 2PX0A 3CZPA 4DUPA 5KNBH 1Q44A 5EPOA 4PPFA 3LXUX 1EKXA 4UQLA 1WLYA 1YOVB 2QK4A 1Y4AE 2JFHA 3C98A 4FEYA 4CTKA 2B4TO 4Z86A 5IDXA 1OC4A 5LOVA 3STTA 2XRZA 1ZGHA 5EESA 4CIXA 3QY9A 1GLGA 4JBGA 4IOLA 4YJHB 3H3JA 4ZC1A 3WLOA 2AYXA 1O8CA 2V55B 1ONOA 2PL1A 3M6VA 4KE6A 1F38A 2C2HA 3TR6A 3GZTB 4AU1A 5B1EA 2XTAA 1UP4A 3JW8A 2XECA 2YVLA 4INZA 4O4JF 1CR0A 3MT8A 2WY2D 2ZJ7A 1RTTA 3ES9A 5BWOA 3L06A 4Q9KA 4MR7B 4N8DA 4QL3A 4CM7A 5B1YA 1TK2A 1TVCA 1BDIA 5IABA 1JNXX 4DQUA 2J32A 4KHPB 4JAVC 2Y1LA 4X1IB 4XJSA 4PS1A 2IUEA 3L1UA 3NM5A 1CEXA 3REQA 4JJGA 3TZCA 2GMWA 5F1KA 1Z4PX 4GLOA 4AQDA 5HILA 4B8WA 3T3OA 3RAEC 3WBFA 1FP1D 4Q48A 4A2WA 1BX0A 1PDVA 2NZJA 1J33A 3CA8A 3ZWPA 1JS1X 1S3IA 2GHQA 3A1WA 3HKDA 2H57A 4JP8A 4MW4A 3IR5A 1ZDMA 2IU4A 4B34A 1O58A 1VQ1A 4G6ZA 1MOZA 3RGGA 1H6DA 2DC1A 2I5PO 2O48X 1KQGA 3DBHB 3IDOA 5ALYA 4X8HA 2JK0A 4KVZA 1NLZA 1C3OB 4WLUA 3W0LB 5ELLA 3GVIA 5LQUA 3CEPB 3OY2A 2YJ5A 1WU8A 2XSZD 4L5CA 4IYRA 3OTGA 3PNPA 3RANA 4Q1VA 2AG8A 3H05A 1V8FA 2P4UA 4U6QA 1RWBA 4RF4A 4A0QA 4F3YA 1OBCA 1Q92A 2AZMA 1E2UA 3H65A 1WW2A 2F1OA 4KKXB 5TV2A 5B6IA 3QNUA 1E2BA 4C7KA 4INPA 4L2IB 4TXHA 1XLTA 3GLIE 2GBPA 1XMSA 4G4GA 4FINA 4E13A 1OOEA 4GRIA 3NRCA 1JEYA 5BUCA 2F8TA 3EGXB 4H60A 1F2UB 1C7EA 3HR7A 3BB1A 4ZT6A 3X2FA 1EZ4A 4Y2VA 5BYKA 2JGKA 2ZG6A 1XX6A 1U65A 5EJAA 4O8CA 5AW5A 5CFNA 4FFSA 3NEPX 2RHMA 4KXWA 1C5KA 4R7GA 2NUAB 4UNQA 1W36C 2AK2A 4YXWA 2J9YB 4NK4A 1JI3A 3SR4A 3FFXA 4XARA 2HR1A 3HNPA 4HRYA 5G53C 1JR6A 3R5XA 3GL9A 4L5JA 3VAYA 2V65A 3PSAA 1DB3A 5AIBA 5JS6A 2F8MA 1F4LA 5GIOE 1ZBDA 4BQOA 4IF6A 1OTHA 3LBHA 4DCSA 5DHAA 3S40A 821PA 1NURA 1S9DA 3ZJVA 3RHZA 1DVRA 4Q3DA 1CZOA 2ZBRA 1NOIA 1HR0B 1NVWQ 5D01A 1K4YA 1UBEA 1EA7A 3BSSA 4YIKA 4FMCF 3GLFA 2VF5X 4RKWA 3B82A 3DONA 1JR3E 2B99A 1A77A 5TGDA 4PAGA 1X38A 1YC2A 2SHKA 4HEA6 5LOVB 4X84A 3BRWA 2NUBA 1UPXA 4MGKR 1V95A 4CTNA 4NBWA 2I1QA 1PK8A 4FDAA 5KKNB 5IJZA 2PJDA 2IC5A 4KMMA 4OFXA 4R8LA 2LW7A 3PDJA 4LVNA 2QRLA 4MYDA 1VKHA 2GN0A 3R0ZA 1ZIYA 3T3HA 1DG3A 3W5SA 2C2XA 1XTVA 2N75A 4EFMA 5IBCA 3ZUPA 3I5MA 1MTZA 3CZMA 4LHWA 4XH9B 5EFOA 4PLWA 1KAGA 3NALA 4RH1A 1WBBA 2BGRA 1U1FA 1KJ8A 4OXXA 1H42A 3REQB 4KX5A 5FOQA 3ZDBA 4N6NA 5PGMA 2C0QA 1T26A 3LQRA 3GGOA 1L4HA 2V5VA 1F7VA 2GZ3A 1D2RA 3FMIA 3PE3A 4FNMA 5CT8A 5CT5A 4DR6B 1L5NA 4CDRA 2D1TA 5CA0A 4PU0A 4FEGA 3HKDB 3X1XA 3K9HA 2WWGA 5JS1A 1U02A 2NZXA 2CXXA 4LPKA 2E1RA 3O8DA 5I9LA 4HGZA 3D4OA 3LHFA 4LMRA 3JTMA 3KT0A 4PSVA 2FA9A 3K73O 2PA3A 4PLPA 1IN8A 4QU8A 3E1SA 4TMTA 4JI8B 1KDYA 5ILOA 1HLFA 3I6ZA 1A8IA 1I7PA 4NV1A 5FUQA 2VBIA 4RKQA 1O5TA 2VAXA 3SVZA 1UM8A 1Z0AA 1CR4A 1C1HA 5H70A 4MV3A 1XLVA 2DLNA 1SHKA 3EIHA 3KU4A 3Q85A 4MWGA 4GPZA 4OP2A 2KM1A 4FKMA 5HFAA 1FYXA 1L4KA 2I2BA 3MWLA 3STVA 1B00A 4Q16A 4UCQA 4IJMA 4G4SO 1GPKA 3CF4A 3OPQA 4WBNF 3GBSA 4J0IA 2H9YA 3IPAA 4LTMA 1SRQA 3RSHA 3RG8A 2IE8A 1TD1A 1DRWA 4TRJA 4XD7D 4OHYA 3G79A 4AN4A 2L0XA 1JEYB 5L95A 2VQDA 1NQXA 5KSOA 3ANXA 4HK4A 2YASA 3VSCA 4ER6A 1EX9A 5L6MB 4NBKA 2FZEA 1L4MA 5CEFA 5IT0A 3Q3JB 5CJJA 3M89A 4HQ6A 1OH8A 1R5OA 4UMFA 2XMSA 2BSAA 2NZWA 2AJDA 2WAMA 5H1YA 1ZRHA 2C4TA 3PRJA 5DW3A 1FTQA 3TQIA 2XNCA 1T0PA 4BFSA 1MRZA 2G0AA 3OLXA 1A5BB 3G5MA 3UWMA 4QHSA 5C32A 1U99A 1XDUA 4YT2A 4L1KA 2WZBA 4TXLA 2J0UA 3NAMA 1ZAYA 1R9JA 3UICA 1VHLA 5BURA 3EDQA 3GLFB 3DEZA 1U7DA 3JYLA 3NBQA 4ZYZA 5BN3A 5KQGA 2Q1TA 4RTPA 4FILA 1MABA 4GRAA 4OKIA 7MDHA 3CE9A 3OOWA 3NS7A 4P9NA 3KO8A 5HZHA 1E3TA 3ABRB 5ER6A 1Z26A 2R7KA 3PEVA 4XFJA 2D2VA 3MNFA 2QTCA 3O38A 3NDRA 4LY0A 5DX8A 2MTBA 4DM3A 3GXOA 5L8VA 1OASA 3IP6A 2QENA 1RXEA 2ZZKA 2ODTX 2WJ3A 1N4DA 1UKZA 1XDDA 2IEIA 2O0KA 2F9FA 3FI9A 3NNSA 2PSHA 2VXOA 3ZCSA 4BLQA 5AK0A 5L53A 1O6ZA 5FT9A 5TPWA 1WQ3A 1WP9A 1RHKA 1J00A 2R8OA 3E84A 4IFTA 3AFOA 5SZHB 3IRVA 1PIWA 4FOSA 3BE6A 3AVOA 3W7AA 1DDGA 4AJ2A 5FUYA 4FB5A 3K9WA 4YRBA 5KVSA 3V4OA 3FKJA 2B1GA 3JYHA 2BM9A 1NPDA 1Z6XA 4HV4A 5BW4A 1XZMA 2ZRMA 4MNTA 1P0QA 3HP4A 1PFWA 1YS1X 2Z5FA 3RT7A 3BXEA 2V1UA 3EPLA 4QBKA 1X74A 4PNEA 2HK8A 2ZCJA 5TR9A 5CA0B 2GCIA 2Q99A 3IAM1 4LJ9A 2HCTA 3SJCA 4BLOA 2GM9A 4DY4A 1R0BA 1KDRA 3MN1A 3D3KA 3PB3A 4GPD1 3ZWXA 4N65A 1SBQA 2I1WA 3H19A 3GEGA 2BEWA 1VPLA 1V5IA 1PG5A 3OJFA 1ZJ6A 1ZK4A 4BRWA 1XQYA 2IXEA 1QHYA 2Y66A 5GADl 4V03A 4FFLA 1YBAA 2IHYA 4F2PA 5I7FA 3K9BA 2IK8A 2IWHA 5ITVA 2QRMA 3CPHA 3AWIA 4TTQA 3WS7A 1E0SA 2WF6A 2W6PA 3SZ3A 1HLGA 1V8OA 2PG3A 2ZM6B 1FMCA 1U90A 1O6CA 5DPMA 2PR7A 4ER3A 4UTNA 5JYDA 3HSKA 1P81A 1LDYA 5DM60 3T12A 4AJEA 3OICA 4DUGD 3IUQA 1QAMA 3G5UA 4BU1A 5E1BA 4FD3A 4RLFA 3ZDEA 4JSRA 4J2HA 5HPYB 1QBKC 3QE0A 3R6WA 1D7AA 1GFSA 1FUEA 1RS0A 4H08A 1GT6A 5DMXA 2QP9X 4XWYA 3E0XA 4JR1A 4GKAA 4LY6A 3DT8A 5AM0A 3D54D 1FDWA 5JYCA 1N34B 3P9QA 1I32A 2H59A 3FM9A 4P34A 3L8FA 4U3JA 3ROQA 1UWCA 1GTSA 4JN6B 3P0JA 5IJWA 4KDCA 1Z6GA 4N8EA 2IUUA 4BQQA 1WPGA 1G291 3MBOA 4MMXB 4RIEA 4EVIA 2XMCA 1FQKA 2BEJA 4UQOA 2HA6A 4HX2A 3BILA 5HCNA 3P9KA 3UHAA 2X5NA 1NF2A 3TF5A 4B2LA 2J0UB 3NM4A 5DLDA 1I6WA 2DPLA 1U2GA 3B53X 3QW2A 3PFCA 1VL0A 3TTUA 2FN4A 2ERXA 2ID7A 1QFXA 3URKA 1UP7A 3DOCA 4H27A 5BN3B 1R7RA 2P9QA 3BCRA 3LQ4A 2D3TA 3NC4A 1MABB 1QIJA 2I4IA 1NNI1 1XB2A 2J9RA 2LNDA 3BWYA 4F97A 4RK4A 3K6JA 1HEYA 1UDBA 2CXSA 1BMTA 3BH6A 2WWWA 2ZJ1A 4ON9A 1QAOA 4BFCA 1UC8A 2G77B 1EPUA 2C9MA 1CXZA 4JKYA 3I83A 3RKRA 3VYWA 1GUYA 2D6FA 3LCJA 2NXWA 3QV2A 4HD8A 1C9MA 2Y76A 4MV5A 3WJ1A 1XZJA 2WF9A 4ZAVA 4X91A 3EAQA 5TPWB 5JMPA 3L3BA 3QW4B 4N6GA 4CKEA 4LSZA 2PK3A 2P9YA 1BHO1 2H7VA 5AJYA 4B8YA 5IAAA 1AA9A 1IBLB 2ZWVA 3KLOA 5HM8A 4RQUA 3H04A 4MGHA 4XI9A 3MGGA 2ZE7A 4C4PA 5JCXA 5KJ6A 2QL7A 3O90A 2YUTA 2QIPA 3W5JA 1JLSA 5T3YA 4KBYA 1C0KA 4AFNA 1E92A 1CUAA 2YHIA 1RMYA 3H42B 3K0BA 4QXOA 3JVEA 1I3CA 5K6AA 5FR2A 2DBZA 4YMHA 5IKMA 1NYTA 3L04A 4BKOA 5AVZA 1B1AA 2J48A 4MRAA 5BN5A 2CDBA 4M87A 2BEWB 2WJVA 3GDFA 2I3AA 3CXRA 4BCBA 4UTVA 4IOKA 1LZLA 5J23A 2EWMA 1SOWA 2WWFA 4FFBA 4B3JA 4DLRA 1AA6A 3LK7A 1HLDA 3V8BA 1EFLA 1RXUA 3ZDRA 3BB4A 4Y6RA 1NV9A 2J45A 3LXMA 1H9AA 3KTDA 3WK9A 3GCXA 4ZI2A 2E5WA 4ZHQA 3KVOA 2E87A 3MWEA 2CDRA 3D7KA 4FE7A 1Z6PA 1XHLA 3BEDA 1NC3A 5GJBA 5FOVA 5CLLA 1ZRSA 5JW6A 2IBTA 5CLHA 4RBNA 4IG9A 1ZIDA 1OXTA 3QA3E 1GUFA 2PUHA 3EVNA 3KVVA 3LECA 2P30A 3UB4A 5K7SA 2EGUA 3J7AC 2CY0A 3AQ4A 3GEMA 1L5OA 3LH5A 5BT8A 1COWA 1GZ4A 2IPMA 3H4IA 3UFBA 4GMHA 4ADSG 5IVDA 2NO1A 4YAOA 4JR2A 2QMHA 4O29A 1V1MA 4NCXA 4RXUA 2GDZA 4DWWA 1J42A 3BE4A 3PQFA 4DKJA 3ZV7A 4G09A 1X15A 4R8MA 1EHCA 2PRSA 4DG5A 4UW9A 4G01B 4JZYA 1MB0A 1KEUA 4U3JB 4J03A 2XD4A 1OLOA 3I1IA 3LYLA 4YC7A 4YR9A 2BMJA 1PD1A 2BTOA 4K6HA 2ST1A 1QPGA 3FOAA 1K3TA 3GR6A 4H9GA 4KLRA 1ZJZA 2YYSA 3QHPA 1NW3A 2WM9B 1U5CA 3FTNA 3QNWA 4NPHA 4RABA 2GEBA 5BXYA 3C45A 4MYRA 4DC1A 3O7MA 1ESNA 3F90A 3QBJA 3IE2A 4M86A 5K6TA 3Q3GE 2N42A 3QJ5A 2B5WA 4RTRA 1ZZGA 2ZM5A 3BJEA 2C3PA 1DWQA 3KPVA 1OKKA 3ET4A 4WOKA 2YMMA 1XTQA 2NXCA 3FN4A 4DARA 1RYBA 4QEDA 1I5EA 2MIIA 1J0EA 3D6HA 4AL4A 3PUXA 1ECGA 2V98A 4TYNA 2HSWA 4V0SA 4OH1A 4YRNA 4DV1B 2VP0A 2PWAA 3GUZA 4HVLA 1KY4A 5KSZA 5KUTA 1PS9A 3EWSA 4NV3A 4IDGA 4DV5B 1WPRA 3MJCA 3R9WA 1VGRA 3GZJA 1YWGO 4OFWA 4C7BA 5LMZA 4CKEB 1OX4A 2OO5C 4C2TA 3CPEA 4XVCA 4MSUA 2RHWA 2OG2A 4HZGA 2I4LA 3N28A 3ZVMA 1GJRA 4FE4A 1RHQA 4YNBA 4D82A 2VUHB 2CZGA 3RTCA 3MMPA 5DJ5A 4D3XA 1C7FA 2ZUCA 3BRQA 3SHVA 2FGKA 1N2JA 2FPLA 2O2YA 1H4TA 3AY7A 3DDZX 3QFFA 2YHIB 3K0AA 5L4SA 3HB9A 2HH9A 3PFBA 4LGMA 3OZBA 4LWZA 3UH0A 1SOUA 4JLPA 3V1MA 2P9FA 1LBEA 5LBIA 3ODPA 1BFKA 1H2RS 3FKQA 4CF3A 1FRVA 2IV7A 4C4TA 1WB6A 5BN5B 3U37A 5AXDA 2JGNA 3IBTA 4N5MA 5JWHA 1U3FA 2GAJA 2X3YA 2V7GA 3OSUA 3GHHA 1JJIA 3OD5A 4WFJA 3TSWA 2OHXA 3PKJA 4EG0A 4FFBB 2QAGC 3JCZA 4ZO4A 3OETA 3G8DA 3DO5A 1ZSYA 3GXBA 6ADHA 4QPCA 5FLEX 3I2GA 2O0MA 2IVZA 3ISVA 3O75A 1LTHR 1PFGA 4ZHQB 5EWJA 1U7TA 4I3GA 3MWEB 4CG1A 1GUBA 1H0SA 8OHMA 4QXPA 2AN1A 2FR0A 4NBNA 1A9SA 3W06A 3FYUA 2UZIR 3CTMA 1X80A 4ND6A 3QVWA 2QYSA 2WD8A 1JDTA 121PA 1QONA 3HCEA 3NCTA 3LGXA 3O21A 4GRDA 4I1VA 4RDIA 3T5DA 3ZHVA 5IXYA 1O4VA 1W34A 3E3OA 1RQ2A 4MIEA 3GP3A 2XF2A 3LDHA 4ZO7A 1BGXT 4RTSA 3F6BX 3CNNA 1V1MB 2WWTA 3OIFA 2R79A 3LXRA 4LE0A 3UBMA 4B2IA 3FCAA 4Q7KA 3LSYA 4GICA 4BN4A 4X61A 1KSFX 1SVUA 3MVEA 2UYHA 2Z98A 1CJBA 4Q9HA 3E8SA 1GP2A 4CM9A 2CFOA 1H1DA 3P97A 3FDFA 4B5KA 1PUIA 5LWQA