1RC5A

Crystal structure of mg(ii)-complex of rnase iii endonuclease domain from aquifex aeolicus at 2.30 angstrom resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
148
structure length
148
Chain Sequence
b'GMKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease III
publication title Noncatalytic Assembly of Ribonuclease III with Double-Stranded RNA.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase
total genus 53
structure length 148
sequence length 148
chains with identical sequence B, C, D
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2003-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1rc5A00
2QVWA 4M30A 3C4TA 1O0WA 3O2RB 3O2RA 1RC5A 1I4SA 2A11A 1YZ9A 1YYWA 3C4BA 4OUNA 2FFLA 3RV0A 1YYOA 4M2ZA 2GSLA 2NUEA 2EZ6A 1RC7A 1U61A 3N3WA 2EB1A 2NUFA 4OOGC 1JFZA 2NUGA 3RV1A 1YYKA
chains in the Genus database with same CATH superfamily
2QVWA 4M30A 3C4TA 1O0WA 3O2RB 3O2RA 1RC5A 1I4SA 2A11A 1YZ9A 1ZTDA 1YYWA 3C4BA 4OUNA 2FFLA 3RV0A 1YYOA 4M2ZA 2GSLA 2NUEA 2EZ6A 1RC7A 1U61A 3N3WA 2EB1A 2NUFA 4OOGC 1JFZA 2NUGA 3RV1A 1YYKA
chains in the Genus database with same CATH topology
2QVWA 4M30A 3C4TA 1O0WA 3O2RB 3O2RA 1RC5A 1I4SA 2A11A 1YZ9A 1YYWA 3C4BA 4OUNA 2FFLA 3RV0A 1YYOA 4M2ZA 2GSLA 2NUEA 2EZ6A 1RC7A 1U61A 3N3WA 2EB1A 2NUFA 4OOGC 1JFZA 2NUGA 3RV1A 1YYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QVW A;  4M30 A;  3C4T A;  1O0W A;  3O2R B;  3O2R A;  1RC5 A;  1I4S A;  2A11 A;  1YZ9 A;  1YYW A;  3C4B A;  4OUN A;  2FFL A;  3RV0 A;  1YYO A;  4M2Z A;  2GSL A;  2NUE A;  2EZ6 A;  1RC7 A;  1U61 A;  3N3W A;  2EB1 A;  2NUF A;  4OOG C;  1JFZ A;  2NUG A;  3RV1 A;  1YYK A; 
#chains in the Genus database with same CATH topology
 2QVW A;  4M30 A;  3C4T A;  1O0W A;  3O2R B;  3O2R A;  1RC5 A;  1I4S A;  2A11 A;  1YZ9 A;  1ZTD A;  1YYW A;  3C4B A;  4OUN A;  2FFL A;  3RV0 A;  1YYO A;  4M2Z A;  2GSL A;  2NUE A;  2EZ6 A;  1RC7 A;  1U61 A;  3N3W A;  2EB1 A;  2NUF A;  4OOG C;  1JFZ A;  2NUG A;  3RV1 A;  1YYK A; 
#chains in the Genus database with same CATH homology
 2QVW A;  4M30 A;  3C4T A;  1O0W A;  3O2R B;  3O2R A;  1RC5 A;  1I4S A;  2A11 A;  1YZ9 A;  1YYW A;  3C4B A;  4OUN A;  2FFL A;  3RV0 A;  1YYO A;  4M2Z A;  2GSL A;  2NUE A;  2EZ6 A;  1RC7 A;  1U61 A;  3N3W A;  2EB1 A;  2NUF A;  4OOG C;  1JFZ A;  2NUG A;  3RV1 A;  1YYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...