1RCVD

Cholera toxin b-pentamer complexed with bivalent nitrophenol-galactoside ligand bv1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonspanning bivalent ligands as improved surface receptor binding inhibitors of the cholera toxin B pentamer.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
molecule keywords cholera toxin B protein (CTB)
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rcvD00
2RDHA 3GP7A 1G8ZD 4DXFA 1ET6A 3DWAA 1I4XA 1KLUD 1LT5D 1CQVA 4Z9CB 1I4GA 4RFBA 1AN8A 3BVMA 1DYQA 3W2DA 3SEBA 1HXYD 3EA6A 1KTKA 1TS5A 5D3IB 1CK1A 1FNWA 1L0XB 4RHSA 2R61A 1TS2A 1SBBB 1SXTA 1PRTC 3EFXD 1ENFA 1HTLD 4OHJA 1S5FD 1BCPD 1JCKB 1KLGD 1PRTF 5FKAC 3TSSA 1PZJD 4BWGB 2XRSD 4L63B 3MFGA 1JWMD 1V1PA 1STEA 1XXGA 5ELFA 1GOZA 1PRTD 1LO5D 1PTOH 1BXTA 1EFID 5TSSA 1D5MC 1SE3A 1BCPC 2ICIA 2Z8LA 2AQ2B 1EU3A 1TS3A 3R8BA 1F77A 1PTOB 3O13A 2XN9C 1B1ZA 4RGMA 1LTGD 2IPKD 2QEJC 1SE2A 2RDGA 1QILA 1JR0D 1D5XC 3V05A 1PZID 1LT3D 1AW7A 1V1OA 1UUPA 2WV6D 3BVGA 2SEBD 1LTAD 3BVZA 1LT6D 1PZKD 4RHRA 5ELDA 1HQRD 1EWCA 2J4XA 3URYA 5I4DA 1I4PA 4L6TB 1HA5A 4UDUC 1V1PB 2QILA 2G9HD 1XTCD 2NTSA 1MD2D 2O2LD 4RGOS 4DXGA 1EEFD 1FD7D 2XNAC 1CT1D 1D5ZC 1FGBD 5ELCA 4K6LA 5D3DA 1LT4D 1S5BD 1ESFA 1RCVD 1CHQD 1B44D 1SJED 3MC0B 2IJ0A 3BYYB 4RH6A 1PYWD 3R2IA 1RD9D 1SEBD 1LTBD 1JWUD 1EU4A 1BCPF 3CHBD 1RDPD 4RGNA 4RCOA 1S5ED 3BYTB 3KLSX 1LTID 1S5DD 1JWSD 1TY0A 2AQ3B 2AQ1B 1T5XD 1M4VA 1TY2A 1PTOD 5ELBA 1CHPD 1DJRD 2CHBD 2XRQD 1I4RA 1JQYD 1FNUA 1LTRD 2TSSA 3DWPA 3OWEB 1EEID 1LTSD 5FK9C 4O1NA 1PTOF 1LTTD 4ZYSA 4RGTA 1TS4A 1UNSA 4TSSA 1PTOC 1SJHD 4C56C 1I4HA 1D6EC 1BCPB 1ET9A 1RF2D 1S5CD 1FNVA 1L0YB 1LLRD 2NTTA 5ELEA 1PRTB 1SE4A 3BZDB 3R2TA 3DWQA 1I4QA
chains in the Genus database with same CATH superfamily
4X6AH 4YY3Q 4R8IA 1E7ZA 2EYLA 2ICEC 1CFMA 5FLMG 5C4JH 4GLXA 1GUTA 3GTLH 5IP9H 3MXNB 2L15A 3KUPA 3K5NA 1E3PA 3H0GH 4UP9A 1OXXK 1EUJA 2EPBA 1UE6A 3FMCA 1WTVA 4R9WA 2EYFA 1KAAA 1GXDC 3NPPA 3VA5A 4X3TA 4ZQ3A 2MUYA 3D8GA 5IP7G 3E5SA 2B63H 3HKZB 4OELB 3I91A 1R9TH 4OO1H 1GOZA 1WVLA 1P8LA 1RL2A 2K4KA 1CTMA 4QY7A 3TDQA 3HKZG 1KL9A 4BBRH 5C0XI 3RMHA 4FVMA 1QG7A 2X69A 1YHAA 1GUGA 4ZKBB 2DNCA 4F87A 4KY5A 1SYCA 4A3MB 1VQIA 1ASYA 4AYBB 4LW1A 4N9PA 1DXMA 4A3FG 2K50A 2PCFB 2VL6A 3HZXA 3BZCA 4DPGA 4DNIA 3I4OA 3K58A 3DM1A 1IBKQ 1XTCD 1KNEA 1JOKA 1QUQB 4IPDA 4Y52H 1SSOA 4KTAA 4DK0A 3W1BA 4FP5D 3B6YA 2VUMG 4RH6A 4TRDA 2NVTH 4KY6A 1GUSA 2EXZA 4A3CG 1A63A 1DM0B 1EU4A 3RNUA 2A6EC 4R8NA 3W1GA 4DF7A 1JB7A 4B3TQ 4JG2A 1F2YA 2EJGC 1NCVA 4A4IA 3KLSX 2HHHQ 3J81L 3RLFA 3S1NB 1DGSA 1M4VA 1TY2A 3M4QA 2F0FA 3M85A 4GLAC 4BY1H 2G9DA 1GJXA 2BOSA 2KENA 4O1NA 5BR8Q 2Y0SG 2JXMB 2ZTDA 3KBGA 2F0MA 2N49A 4BXXH 3Q23A 1D7QA 1N34Q 4K2KA 3JAMi 3KF6B 2Y0SB 2PQEA 1PRTB 3L9AX 3A7AB 4FDBA 1I94L 4I7ZC 3K5OA 3DUZA 1F9SA 5HGQA 5IGBA 4J1MA 3E6ZX 1A3TA 2NVYH 1EIFA 4K6DA 3J7YW 1R9TB 1XPOA 3DMUA 3M9BA 3GTOB 1XMOQ 1KC8C 3OW7A 1IW7D 3D4DA 1STHA 1KLGD 2HDLA 4HSVA 1PH9A 2JE6I 1JB3A 1PLFA 1Q1BA 2C5CA 4DUYQ 1JMCA 2RCFA 1LO5D 4JV5L 3PIO3 2MQHA 1H9JA 5HGTA 4LNQA 1I50H 4RGMA 1B9NA 1BBUA 1ZKOA 1TWFB 1QCBD 2HCCA 4WJWA 4FXDA 2QDLA 4LF4Q 4JI8Q 4DV6Q 3J80c 2BE5D 4DV2Q 2WIIB 2BA0A 4YWKA 5ELDA 3J81j 5CMDA 2R92B 2F0TA 4DAMA 3ND8A 4JV5Q 4L6TB 2KHIA 3CRLC 3J7A5 1NR4A 4DAPA 2KOLA 5LL6X 4JPBW 3GTLB 1YZ6A 3F1ZA 2D62A 4WFN3 5IGCA 3GDEA 1ONLA 1H9MA 3U58A 4IUVA 3TREA 4OO1G 3J81i 3HOZH 1HUMA 1HZAA 1Q8KA 5ELOA 1I3QB 3HEJA 1NTGA 1N32L 5GAGC 4A3EG 5DAUA 5F2DA 4X62L 2AHOB 2VS1A 2UXCL 3R2IA 2V1CC 5C3WA 1PFMA 4KY7A 1NY4A 2KHSA 1II3A 2F3VA 1E2WA 2I5HA 4HAEA 1N33Q 1KRSA 3KK7A 3HOZG 1I4RA 3QB3A 2YV5A 2NZ1D 3J7ZC 5C4XG 2NN6G 4UY8C 2FJ2A 4I7AA 2B63B 4BS9A 2KCCA 4GN3B 1IKLA 2WAQE 1VQJA 1J5EL 3NBHA 2DY7A 2PO4A 4UHVA 1BO0A 1S5CD 4K8IA 3HRZC 4KKUA 4P75A 2HT1A 1WOCA 2D9UA 3D6CA 2RDHA 2VW9A 2K04A 5CV8A 4JCVE 2UUAQ 1CQVA 4Z9CB 1DD2A 2FFKB 4XXEA 1YNND 5CV7A 1JJCB 5FO9B 2C35B 1HNWQ 4XYQA 2KCNA 4DV5Q 1YHBA 2DN8A 1U0LA 4LMQD 2SOBA 1HRJA 1PRTC 2XGTA 3S14B 1SAPA 1IBLL 5KEEA 4A3JB 3S2DB 2F4IA 2E76C 5EBCA 3MFGA 3OWFA 3C46A 5EBDA 4JI0Q 2EE1A 4BXXG 1RIPA 2F4VL 1PTOB 3NSWA 1VQCA 2PZWA 3O13A 5CC4A 3H09A 4DV7L 1PA6A 3MXUA 4CKEA 1B50A 4UP8A 3PUWA 1SFOB 1U9RA 1B9MA 4KHPQ 1C0AA 2YTXA 3BVGA 4PZ7A 4A3GG 1SNCA 2KA7A 5I6WA 1Q86C 3CKIB 1PZKD 1CSPA 5LMNL 2HIXA 1BQQT 1T9HA 3URYA 3D4WA 4JYAL 4PNYA 1DONA 2NZOA 1TWHB 2WP8J 4PG3A 4JI0L 3S14H 2OQKA 3HOXG 3HOVG 4C2MB 3J81c 4A75A 1VQFA 1XJVA 5JPNC 1F2ZA 4YY3L 5ELCA 4LWCA 2K5DA 3JAMc 3PUZA 4OIKA 3T13A 3UI2A 5G3LD 4A3GH 1WCMB 4HMJA 1KDCA 2UU9L 1V43A 2OCEA 1EIGA 5KNDA 1LTBD 4J6HA 4HIDA 2D0PA 4X3SA 1Z7TA 1CZGA 5C4ZA 2EXDA 1VQEA 2KCTA 4V190 3OSOA 1TY0A 2R7ZB 2AQ1B 1AE2A 3UE1A 4OWWB 5ELBA 3A56A 4QIWE 4R4IA 2F0IA 4A3FB 2VB2X 4DR7Q 1SYDA 4QJFA 1EWIA 1YNJC 1PTOF 4TSSA 4IUTA 3HOXB 1MJEA 4NW2A 4A3IB 4YCWA 5IGEA 1VQMA 1IL2A 3QJYA 3J80i 1K83H 2HCIA 2RBMA 4MHEA 5LMNW 3A5UA 3IKJA 1K8AC 1E1TA 3DWQA 4P71A 4EQ5A 4MZ9A 1EYDA 3CF5A 4B3RL 1AN8A 1K3BC 3ER0A 2RHQB 5FLXL 2B8GA 1SMYC 4ULLA 1DOMA 5FJ8G 3I4NB 1JCKB 1UAPA 3CMAA 4BY7H 1L1OC 4BWGB 1Q12A 3NTHA 1LTLA 3K6OA 4HN7A 1SE3A 2ICIA 3MWYW 1TVXA 2AQ2B 2BE5C 3T1HQ 1C4QA 2CH4W 4WJ3M 2JA7B 2CH4A 4FF4A 1ICFB 4JK1C 3VR2A 1EL0A 2HDMA 4HJ9A 1Y14B 2NVTB 5EQ0A 1QNUA 1SYFA 4AQYQ 4QUCA 2VB3X 1EWHA 3NTKA 3L3OC 3JC66 3FPUB 2L12A 3I4MB 2MHVA 1N9WA 2UU9Q 5CV6A 1VQ9A 4BY1B 2IW3A 4H02A 1SN8A 5BN5A 2AWOA 3L7ZC 4JI4Q 5AJ3L 4OONA 3VR6A 4OX9Q 5FOBB 4C3IH 5IP9G 4X65Q 2XWJB 5D3DA 4LF8L 5KNBA 1RCVD 1CKOA 2YYZA 1OTCA 4K2LA 1NE3A 1B7YB 4NKLA 1GHJA 3PV0A 4GN4B 3STBD 1VCIA 4O42A 5EKLA 2EYMA 2EIFA 1QE6A 2O5IC 4A3IG 1GUNA 1K3RA 3ULPA 4QQBX 1Q46A 4A93H 3LNNA 3F2UA 3NBIA 3TP7A 1VQ4A 1UWVA 4IJLA 2E2HB 3S1NH 4C56C 2ASBA 1K8GA 4DV4Q 1YITA 1KDBA 5IE8A 4R4TA 3BZDB 3DM3A 1I4QA 2HHHL 5E7NA 4MTKA 1YJWA 3ULJA 3C1EA 1KLUD 4YCUA 2CWAA 4DR2L 1N36L 4RFBA 1JICA 2CFMA 2M9VA 1DYQA 1X3GA 4XQNA 2B2WA 5G3LF 4LF6Q 1KTKA 2PZUA 1EQQA 4B3SQ 2R61A 5E4XA 1TS2A 3U4ZA 2MFIA 2JJQA 3K7AB 2G5DA 4G7ZC 5ISRA 2OTLA 4QCLA 3BG3A 1HH2P 3TSSA 4DUZL 1XX8A 3G71A 1J5EQ 1VS0A 4FO2A 1BXTA 3FVQA 3QO2A 3AU7A 3I4LA 3G6EA 2JA6H 2RSNA 3E3XA 3QOLA 2XN9C 5E3FA 2IX0A 4EGVA 4DR7L 1I6VC 2UUCL 2LS01 3V96A 3S24A 2WAQB 5KIXA 3AFQA 2SDFA 2K03A 5C4XH 1BBWA 1S40A 4A3DG 1HA5A 4IFDG 4B9XA 3M4PA 5IOCA 1STNA 2PW7A 4A3JH 5KRUA 4U68A 4CJ0B 1EY9A 3CW2C 1QJOA 5J22A 2JA9A 1PYSB 4OL7A 2PZTA 2YTVA 4ZUIA 1D1IA 3KFUA 3OHXC 1Q8IA 4IFDH 2A6HD 2JQOA 1SMXA 2E2HH 5IYBG 1GD7A 5DNFA 4HEDA 2SNMA 4GN5A 3CC4A 1CM9A 2Q2TA 4HR7B 1EQRA 5M5WB 3I90A 2UUBQ 3HFZB 1I4HA 4B08A 4KHVA 1BCPB 4TKOB 4EX5A 2VZAA 3G6JB 1VQGA 2ZJRA 2WKDA 2D5DA 1PH3A 2KHJA 5AFWA 2VQEL 1LLRD 4N8FA 4CDEC 1EFWA 5D3IB 1UEBA 1XMOL 2F1MA 3CP0A 3G7LA 5JOBA 5M5XB 3MTSA 2VUMB 1EZ6A 3Q22A 1XNRQ 5GAEC 4ILWA 2VY3A 1QNKA 5EPKA 4FF3A 1SNQA 3H0GB 1SR3A 2HUGA 3PCOB 1L2FA 1HNZL 1Q82C 1NMGA 2N3SA 3DXJC 4OO1I 1QVGA 1PZJD 2ZJQA 4BBSG 4JI2L 4TVAB 3SE0A 2O4XA 4IO9A 2XVSA 3VR5A 1I6HB 1VF7A 4QL5A 4L5SA 5J3BA 5IYCH 1BCPC 2GA4B 3T1YL 2ZJPA 3HOYG 3NE5B 4NXMQ 3HP3A 2Y0SE 3ERQA 1KDAA 1QILA 2N8NA 1D5XC 3P1HA 4C3HG 4JI2Q 1E24A 2Z4IA 4RMFA 4KV6A 4RKBA 5FO8B 1SLJA 1TWCB 2H4OA 2J4XA 4N9TA 1HNXL 3D6WA 3H0GG 1AFPA 2EOTA 2K5VA 3KF8A 2K32A 1SNMA 1A6XA 1EQTA 1DCZA 4HCEA 1XNRL 3HS0C 4JI1Q 1RHPA 1DOKA 1CSQA 5H1SE 3ICEA 1D5ZC 4DR3L 1WCMH 4J8QA 3K8AA 4DNTB 3C1FA 2J7ZA 2V4DA 3PGZA 5DM63 2K5WA 3OTOL 3BYYB 4NXNL 1HHVA 2F0OA 3GTPH 2JA7G 4H44C 4JI6Q 5C5MA 4GLVB 3HOYB 3H3VC 1U5KA 2F0GA 3OMGA 3UDGA 1NJIC 3TRZA 1EY0A 5M3FH 1JJ2A 1STGA 1SFOH 4F8MA 3I73A 4LF4L 1EYAA 2E2IH 3I4MG 3CAMA 3LX0A 4AYBE 3KLSA 1SMYD 1R4PB 1X6OA 3NELA 4IQZA 3T4AC 4A3CH 5C0XH 2L5TA 1WD0A 1IYUA 3KDFA 3VR4A 3PF5A 4DUYL 4IALA 3K5MA 2Q2UA 5ELEA 1OXVA 2EQSA 3K7UC 1F2LA 3EVQA 5KYLA 1C7YA 4GKKL 2QDBA 1I5FA 1PH1A 2JEBI 4EQNA 1QUQA 4XQQA 4ZLTF 4J15A 3PIOA 4FXKC 2OQ0A 1K8OA 1WFQA 1U4MA 5FJ8H 4XIGS 2N78A 4JYAQ 4HSPA 1AH9A 4RHSA 3S1RB 2VQFQ 3U4VA 1DZ1A 3GTOH 4GNXC 1BBXC 1YIJA 3HOUG 1X54A 1Z6HA 3D3RA 2XWBB 5FKAC 3GO5A 4O2DA 2FHTA 3LWUA 5FLMH 2OTJA 3NENA 1XXGA 2JA8H 1Z9FA 5CYUA 4R4OA 4FXGC 2EY1A 4WORA 1D5MC 4IPCA 2MGSA 4CBVA 5CBEE 4GS3A 3S1MH 2R6GA 1I50B 2IPKD 4YWLA 2Z6KA 4BBRB 3S1QB 2B29A 2SNSA 4DR6L 4MN3A 4LUVA 2RA4A 4RHRA 2PQAB 4XYOA 2I5LX 1RTNA 1IKMA 5LL6S 5K36G 2EYJA 3GV3A 4ALPA 3MXNA 4DV0Q 5C6AA 4X66Q 2XIWA 3KJPA 1HFGA 1WI5A 1Z47A 4A3BB 3S1RH 4DUZQ 3GTGB 1EEFD 1X3QA 2UUAL 2XNAC 1CT1D 1FGBD 3LWEA 3CPFA 5IGFA 2KCMA 1C9OA 3HKSA 1ZXTA 3HOWH 5JVH3 1ESFA 1S4ZA 4LF6L 4X66L 3JAME 3CCSA 3TS2A 1K28A 2QGQA 3VYTA 1L1OB 3L0OA 1PH2A 1FVIA 3K0YA 1S5ED 1PV4A 3M4OB 1PTOD 5M5WH 1X9NA 2EYPA 1VF5C 1WD1A 3BU2A 4PMWA 1LTRD 2F0SA 1S3OA 4DV4L 1OXUA 2WFWA 2O5JC 2QA4A 3IL8A 5IYDG 1STBA 1U4LA 3W5OA 2ES2A 1STAA 1PH6A 1GM5A 3HOVB 2UXCQ 1F9RA 1NMFA 4LFCL 1A15A 1CA5A 4A3DH 3F2BA 4C3HB 3PO2H 3KOJA 3NXWA 1A2TA 2PNRC 4X65L 4CHTB 4KD3A 1XNQQ 2EYHA 1YBYA 3CQZB 4MIUA 5JEAJ 3GTMB 2DUDA 1BOSA 4DK6C 2OXPA 1PH7A 1PHJA 1EOTA 2WKCA 4IUUA 1XMQQ 1XNQL 1M90C 5CV4A 3SK6A 3J80L 1PVOA 3MFYA 2A5HA 4LFCQ 4QMGA 3I4MH 4KJNA 4Q0FA 1A3VA 1EFID 5BR8L 1SYBA 4WRDA 4AYBG 3I7FA 3S2HB 1O7ZA 2F0QA 3GTKB 4ME5A 1GUOA 1IBMQ 1JR0D 5CV9A 4GKJQ 4CGYB 4K5XA 1XPUA 1WYDA 1A3UA 3CCMA 3CCJA 4DN4M 1SNOA 2R93H 3BVZA 1HQRD 4DV1Q 1GUWA 1KHIA 1ZEQX 5L37A 3S2DH 3PO3B 1EY8A 2J0TD 3K0XA 1D2BA 2NTSA 3T16A 4RGOS 3LGJA 1FD7D 2QKIC 3UDXA 3I4NG 2NWGA 2FXQA 3KLWA 2ZXOA 2B2UC 2A73B 1LT4D 1PH8A 2IT1A 3CCLA 1K73C 3OW2A 4H0LC 4JI1L 2PMZE 3PQIA 2B3GA 5K36H 1LYLA 1QWYA 4FYDA 5C4HA 4Y7NH 1X55A 1AZQA 5M3MH 1JC7A 2PNHA 4C3JG 3K5LA 4A3IH 3K59A 2KUMA 2RSOA 2LMCB 4JI5L 1RODA 1BVSA 4A3FH 3D31A 2KECA 2K75A 4HJ8A 4BY1G 4ZYSA 4RGTA 1UE7A 4NXML 4ID6A 1PTOC 4DR1Q 2AMCB 1J8IA 4IN3A 2PYKA 2JA5B 2EY6A 1L0YB 2B2YA 3S17B 4RA8A 1P16A 1ENAA 5T1GA 2M2LA 1W6KA 2JA5G 1AP0A 3J80E 1RJTA 1L1OA 4IPHA 3VA7A 4DAYB 4QGUA 4A3KH 5GADC 3C2PA 1JJGA 4GKKQ 2B2WC 1SE8A 3NHHA 2F03A 1HZBA 1V9PA 1ENFA 2BH8A 3KBXA 2EJMA 1V1QA 4OHJA 3VYSA 5JVG3 5CBAE 4L5QA 4NP5A 1G2TA 1D8LA 1H9RA 3GTJB 3RZOB 3SXHA 4DK3C 5C3EH 3G4SA 2K05A 1IW7C 2Z9HA 2F4VQ 5IIFA 3OOCA 4JI5Q 4DNRB 4IUNA 5I9OA 2RKSA 3AQQA 2QEJC 2NB0A 1O7LA 1J6QA 1G51A 1CKNA 5CR3A 3V05A 4DAVA 1VQLA 1LT3D 5I2XA 1PXUA 3FRPB 1IXRA 4A76A 2L55A 3CRKC 3M4OH 1ENCA 4KK7A 1HR0Q 4EVOA 1VQ5A 1H9KA 1HNWL 2ZXPA 2WAQG 3HOWB 2G9HD 3BDLA 4IUPA 1VQ8A 4PV1C 4GZYC 1IBLQ 2Q8RE 3N52A 1TWCH 1CI3M 2B39A 3NK9A 3VDYA 4HIKA 5CORA 2OT2A 2IJ0A 2L1BA 4TQUS 1Y8NB 1PYWD 4DR5L 1KABA 4MTNA 2WINB 1X3EA 4ZUJA 3E0EA 1VMPA 2RCNA 1GVPA 2LFNA 2LXKA 4LF7L 3CC2A 1QZGA 2F0VA 2WACA 1IBML 2FMMA 1FNUA 3DWPA 1YJNA 2JEAI 3MEFA 2MP1A 4JW0A 5FK9C 4OEMB 4HJ7A 2IWHA 3RR5A 5JJLA 3HOYH 2MO1A 1HZ9A 1UNSA 1YJ9A 4AIMA 1HA6A 2B2VA 2K5QA 1O80A 3TMEA 1D6EC 5J39A 3J7AF 1B2TA 5E4WC 2R7DA 4X3KA 1HNZQ 2PI2A 1BR9A 2NVXH 3CCRA 3GTKH 4IJHA 2DJGC 3WDNA 3PMFA 1G8ZD 3AFPA 1QVCA 3MA2B 2XTIA 4F7XA 4LF9L 4C2MH 3ITPA 2K5NA 2VQFL 2CWPA 1HXYD 1N32Q 5I2YA 2F0UA 4RAUC 1SBBB 3T51B 2F52A 4KJOA 4KLKA 2VQEQ 4C3HH 4JI4L 1VQBA 2A69C 4G7HC 2JN4A 3MEHA 1V1PA 2HD3A 3IRBA 4LFBL 3IFTA 2VUMH 4HIOA 1PRTD 5IYCG 3KF8B 4A3MG 2JSOA 2Z8LA 4B3ML 1Q3LA 3TP6A 4G7OC 4HIMA 4RWSC 1LTGD 1L0WA 1PH4A 2EVBA 3DEPA 1C48A 1V1OA 4XT3B 4OWXB 1IYVA 3GTQH 2Q8IB 3GTJH 4JI3Q 2GN5A 5JJKA 3EIVA 4B3MQ 3FHWA 1HUNA 2MJ8A 4ZAIA 5IWAL 2DNEA 4LFBQ 1CKMA 5KYIA 1V1PB 4OGQC 1H9SB 4BY7B 5M5XH 1KAWA 3VYUA 4RKLA 4LF8Q 4A3BH 1NSNS 2K52A 1S5BD 1RKNA 3E9HA 5T1IA 1VQKA 2K14A 3NQIA 1TWGB 3AEVA 2IY5B 4RG1A 1TWFH 5FLXc 3CCEA 4B3RQ 1TWAH 4KN7C 2Q2HA 1Y8OB 3SK5A 2EY5A 1LTID 2B63G 2E2JB 1B4OA 1VQPA 3FKIH 3Q8DA 2Q8TA 1T5XD 2E8GA 1PDQA 5E1FA 2I07B 2NVQH 3RD4A 4AQYL 2RVLA 4XTCS 1EEID 1MBYA 4FF2A 3M7GA 5COYA 3I2ZA 1K8MA 3R93A 2H1EA 4JI7Q 5D14A 1PH5A 4NB3A 1BKBA 1NBWA 3NWTA 1E0BA 1YNJD 1E2ZA 4JOIC 2NN6I 1WTPA 1SE4A 2H5XA 3R2TA 2K5HA 2YU9B 3BJUA 3CQZH 1TWGH 4IFDJ 4A3EB 2I0QA 2EJFC 4DXFA 2FMCA 1ET6A 1Y1WH 3M3YB 1I4XA 3CXCA 3AB9A 1ICWA 3BVMA 1JOQA 3H15A 3CU7A 4A3DB 1TS5A 3H91A 5ELNA 1FNWA 5GQOA 1VQ6A 2K7VA 1KQSA 1CA6A 1V8QA 1HR0L 1A62A 3EFXD 3MXGA 1MSGA 4L5TA 4A93B 4L63B 1CKNB 1G91A 5ELFA 2A8VA 2L9HA 2GVBA 5C4JB 1EYGA 2JA6G 5TSSA 4PQXA 3GTQB 2F0PA 5DEHA 1CZWA 3R8BA 4AH6A 2Z6KC 1B1ZA 4R4CA 1PZID 2I46A 3CD6A 4C3JH 3K80C 4HJ5A 1ESRA 2QF7A 2JA8B 3PUVA 1UE1A 4I65A 2EZVA 4LAAA 1FGUA 3K81C 1XTDA 1E22A 2VNUD 1I3QH 1I6HH 3G48A 4DV3Q 4GNXA 1BF4A 1MD2D 1D1KA 1F9PA 2EY2A 1XWEA 2BDNA 5M9OA 3GTPB 4EQPA 2IHFA 3PO3H 4GOPB 3U50C 4C3IG 2WB1B 1QZHA 4P2CB 4IOCA 4DR1L 4IOAA 4R1JA 5C44B 5KNCA 1CQFA 1S5DD 4OIJA 4HMIA 3T56B 2E74C 4JBJA 1DJRD 5IODA 2UUCQ 1JQYD 5BN4A 2NYZD 1A2UA 5A2QE 3NBHB 3ZYYX 2C9OA 1M1KC 1YVCA 3P20A 4A3LH 1W6JA 2K01A 3OTOQ 3PUXA 1MJCA 4PMBA 4ZKCB 2F3IA 4QF4A 3RZOH 1NR2A 4K0KQ 1WCMG 2CQAA 2L0CA 3HGBA 2A6ED 2K33A 1BDOA 4KHZA 3GD7A 4G4KA 4JBMA 3HOUB 4UPAA 4QB4A 4ZCKA 1YEZA 3W2DA 5FO7B 2KQ3A 4X62Q 3NTIA 3R3OA 3RLNA 3GTGH 3CPWA 4P74A 1EY6A 1TU2B 3TQYA 3X3MA 5M5YB 2CQOA 2DJFC 1BNZA 1W3SA 4PZ6A 2A74C 3D0FA 1PFBA 1B8AA 1Y1WB 3QR8A 5C3EG 1G2SA 4YIJA 2A1AA 2PPBC 2PI2E 5IP7H 2AUJD 1VMCA 1STYA 1U4PA 3DEOA 3PUYA 4MNOA 5EAYA 3SR1A 5JAVA 1Y1WG 4DV1L 1TS3A 2AWNA 3NQTA 3FDTA 5LHY1 2TMPA 4QUFA 1SE2A 4K8JA 1AW7A 2JA5H 1VDZA 3CCVA 3P75A 2SEBD 4P73A 3ERSX 2B2VC 2JYOA 4IURA 2NBFA 4NMZA 2L4NA 5I4DA 1I4PA 2IHEA 3TEHB 4C1NI 1EZ8A 4XQJA 2O2LD 4X3UA 3K57A 1JE5A 1SYEA 3ND9A 1B70B 1M8AA 5A2QL 2R3ZA 3MZ5A 1G291 1ASZA 1XMQL 3TN2A 2WB1E 1HQMC 4R4QA 1GO3E 3BDOA 1VQDA 4A3EH 3CC7A 1SEBD 4M1UB 4JBWA 2KEDA 4IPGA 1RDPD 3SGIA 4KHPL 1HFNA 3BYTB 3RN5A 2VXWA 1MIUA 1XYIA 3I55A 2XRQD 3KF6A 3TS0A 1WTOA 4JI8L 2A68C 1LTSD 1HCZA 2R92G 3WOEA 1ZYRC 2B2UA 2PW5A 4IUQA 4ME3A 4RCNA 3VR3A 3A8IE 3V2TA 3S15H 4KKSA 1WTQA 5M3MB 1MKHA 2F0JA 3BDCA 1FYCA 1TXYA 1X3FA 2UXDQ 1F2MA 5DM73 1EQVA 4LF7Q 3GP7A 5I6YA 1FJGL 4B3SL 4H7BA 5CV5A 3F8TA 4GNXB 4B3TL 1MSHA 4UP7A 4POGA 2IX1A 4DV0L 2ALYB 3SEBA 2E75C 3BZKA 3EA6A 3H6MA 3TP5A 4DR2Q 1IL8A 1W2BA 1CK1A 2PQAA 2RHSB 1B3QA 2I5MX 4A3LG 1WJJA 3SVMA 1X32A 5IT9c 2B2TA 2X6GA 1IBKL 5JEAH 2M00A 4DR4Q 4QIWB 3TZUA 5HY6A 5FLXE 2E5LL 1PFNA 3FEWX 2F0KA 1N8RC 1MHWC 4UAIA 1HZCA 5NUCA 3S2HH 3DLLA 2E2IB 1E2VA 2E2DC 1SYGA 2BCOA 2NN6H 4FF1A 4S3SA 5EPLA 3A74A 5I9PA 3PIPA 3X3NA 3MVVA 1JT8A 2K28A 4LK1C 2NUCA 3EBEA 5HURA 3FKIG 3H3VH 1EYCA 3OIPA 4KN4C 3A7LA 2QW7A 1BUVT 5AJ3Q 4OX9L 5JJIA 1NAPA 4Y7NB 3K7AH 4K6LA 3UDFA 2HQEA 3L2PA 2K1BA 3STBC 4DA2A 2KEEA 4P72A 1VQHA 1B44D 2BH2A 4DV3L 4APVA 1SNDA 3JAML 2YU9H 1BCPF 1CUKA 1O7YA 2BA1A 3GQBA 3M7NA 4DV2L 3PO2B 3MHBA 4RCOA 2UXBQ 4BBRG 3S1QH 3RZDB 1WTWA 2HIVA 3PSIA 1YNXA 2AKWB 3NP8A 3FP9A 2QCPX 3M4YA 3CMEA 2IL8A 1WTRA 4C1NK 2L11A 5EJWA 1B3AA 3KDFB 4BBSB 4DGZA 3SDZA 1JE4A 3A5ZB 1EY5A 3S16B 1Y1VG 2ZTCA 3Q0AA 1A0IA 3D4RA 1SRUA 1ZYRD 3E0JA 4A3KB 4A3BG 1FNVA 4OWTB 3KLRA 1OXTA 4U673 2R7ZH 2F3WA 1QB5D 2Z4HA 1ML0D 2RQXA 1A8VA 2B8FA 2CCZA 3SK8A 1KNAA 1I4GA 2Z0SA 3W3AA 5M5YH 2ZM6Q 1X65A 4IFDI 4C3IB 1KRTA 3A54A 4JC0A 4CDDC 3OIQA 3NWSA 2K6AA 5JJZA 1TIID 1HPCA 1I94Q 3OMCA 2P5ZX 4K0KL 2NVXB 3KJOA 2R7ZG 1SROA 1TT2A 1TWHH 1PRTF 4POFA 4BY7G 1H95A 5LMUQ 1N34L 1JWMD 3IFDA 4PZ8A 3OYYA 4G57A 4A3MH 3QWNA 3T1HL 1Q7YC 2LSSA 3AMUA 4HTHA 4JI7L 2JA8G 4B9WA 4A3JG 5J1ZA 5M3FG 2LKVA 1TKWB 1ILQA 4PMCA 5IYBH 3T53B 2WV6D 5K5PA 1LTAD 4F88A 2A6HC 1EWCA 4CDFC 1G6PA 2AUKA 2NZHA 2A69D 1OO9B 2DY8A 4NPSA 2NVQB 3HG9A 5CGKA 2B2TC 3N6RA 2CW0D 2D2CC 1LUZA 1DOLA 3QOJA 5JEAG 1PMRA 2F0NA 1SJED 3VYRA 1VQOA 2A19A 2LXJA 2KJXA 3ZJYC 2ZM6L 1LACA 5IWAQ 3J7AV 1SDFA 2A68D 3CCUA 3QIAA 1JWSD 1Q1EA 3S16H 1YNNC 2R93B 2X6LA 3A8KE 1CHPD 3QG1A 4K5WA 4LUZA 2TSSA 1UEAB 4A93G 2UUBL 2R93G 2YTYA 4XDXA 1SJHD 3F2DA 3RZDH 1XPRA 1RF2D 2ZTEA 5EPJA 4ABNA 1Q90A 2FINB 4CKCA 1AEXA 4NDXA 4KKTA 5IGDA 2XSCA 4JOIA 2UXBL 4DK1A 4JVZA 4DV5L 3WOFA 1KXLA 3DWAA 3H3VI 1LT5D 4A3GB 3OPOA 2NVYB 2JK8A 3ONAB 4OXPA 4A3KG 1GHKA 4GOPA 2RDFA 5LMNQ 3FPPA 4X64Q 1YI2A 1WTHA 1SXTA 3HOZB 3HOWG 3GTMH 5C0XJ 1WTXA 4LF9Q 4DFAA 1HTLD 1BCPD 3AYHB 1Y69U 1JORA 2XRSD 1PYBA 4FNFA 4CJ2C 1E1OA 5M3FB 1HTPA 1STEA 3NUCA 1LV9A 3A0JA 4YHHQ 4CDCC 5IY0A 3CCQA 4DV7Q 4CKBA 1Y1VH 1C8CA 2MO0A 2E2JH 2EDGA 4KMUC 3H94A 1JOOA 4XT1B 1EIYB 2OEOA 3SHLA 1EY7A 4DR6Q 2RDGA 1FL0A 4DR4L 1N33L 5C3XA 2F0DA 2RF4A 2ID0A 2CKZB 3RUZA 2JP1A 1T5EA 2N88A 1LM0A 3I56A 2D0OA 4LF5L 5D65A 2E5LQ 1TR5A 1SNPA 5DLQE 4LFAQ 2B2YC 5GAHC 4YHHL 4DAYA 4Q5VA 2BDOA 2QILA 1IHZA 3U9SA 4DXGA 3M3YH 1FJGQ 5C5LA 5EKKA 1UE5A 1G6ZA 2PMZB 5KGUA 3PIP3 3KYHC 4N8X1 3PO3G 1K83B 3Q6SA 2CW0C 3EN2A 1QOHA 1PFSA 4V0BA 5C4XB 1VQNA 1JWUD 1FR3A 3I72A 2ZT9C 1N36Q 4JI3L 4LFAL 4L8JA 4KD4A 2ZXRA 3CHBD 3S1MB 2KVMA 1GKHA 4RGNA 4HCSA 1AE3A 2AQ3B 1EY4A 3PF4A 2UXDL 4GKJL 2ATWA 4K14A 5C3EB 2QEXA 5IT9E 5M3MG 1X3PA 1YHQA 3EROA 2EYOA 3HKZE 1LTTD 2GVAA 1TS4A 4DKAC 4HJAA 3RLOA 4EQOA 2Z6BA 3EQLC 1F9QA 3ULLA 2NTTA 3NEMA 3I4NH 2F0HA 2DGYA 5IGGA 1K9MC 4E6IA 1H9SA 1S72A 4JI6L 4DU9A 4X64L 3TP8A 1J9OA 3S17H 4WJ4A 2WB1G 1MGSA 3Q24A 3A8JE 3WWVA 1L0XB 2F0EA 2OWOA 1IZ6A 1AZPA 1Y8PB 2R7FA 3HOXH 1MI2A 1NNXA 1OXSC 1S5FD 4DV6L 2LY7A 4K5VA 4IZ8A 2F0WA 3TBIB 2F0LA 1HJPA 4L5RC 4GOPC 1U4RA 1PTOH 3SK4A 1KD1C 3HOVH 4CJ1B 3MAQA 2OF1A 5BN3A 1KIXA 3RN2A 1EU3A 2MNAA 1F77A 3A55A 4LJZC 3P7JA 4C3JB 1IYJB 3UDIA 3J81E 3FKIB 4LUOA 1UUPA 2Q2IA 1LABA 4O0AA 4JBKA 2JA6B 3E9IA 3UE0A 1VQ7A 5EGTA 1LT6D 2KBNA 2Z1CA 1TWAB 4KI0A 4YWMA 1O78A 4UDUC 1EIHA 4NXNQ 3C3LA 1K0SA 3TZDA 3I70A 2ENBA 4M8AA 5C44G 5C44H 3PO2G 2N55A 4DR3Q 3DHQA 3U9OA 1HR0W 3IAYA 1CHQD 5EKIA 5IYDH 1NUCA 3MC0B 5IT9L 4BA1I 2HQLA 1RD9D 4YCVA 4LF5Q 1B53A 1Q81C 5C0XG 3S15B 3EJIA 4ZRZA 5A35A 2CVRA 3S9WA 2MPMA 1HNXQ 1QVFA 5GROA 1Y1VB 3GV6A 1VQAA 1TQOA 1EOVA 3F2CA 1X56A 2CHBD 3I3CA 1RTOA 3OWEB 4BBSH 2R92H 1O7IA 4BA2I 4ODGA 2JA7H 3MXPA 4ZK9B 3T1YQ 1ET9A 4DR5Q 3I8ZA 5JPMC 2IX3A 1K0RA 4H13C 3BS1A 1ILPA 1R4QB 5LMUL 3HOUH
chains in the Genus database with same CATH topology
4R8IA 2EYLA 2ICEC 1CFMA 1GUTA 3KUPA 3K5NA 1OXXK 2EPBA 3FMCA 1WTVA 4R9WA 2EYFA 1KAAA 1GXDC 3NPPA 3VA5A 4X3TA 4ZQ3A 2MUYA 3D8GA 3E5SA 3HKZB 3I91A 4OO1H 1GOZA 1WVLA 1CTMA 3TDQA 5C0XI 3RMHA 4FVMA 1QG7A 2X69A 1GUGA 4ZKBB 2DNCA 4F87A 4KY5A 1SYCA 4A3MB 4AYBB 4N9PA 1DXMA 2PCFB 3HZXA 3K58A 3DM1A 1XTCD 1KNEA 1JOKA 1SSOA 4KTAA 4DK0A 4FP5D 4RH6A 4TRDA 4KY6A 1GUSA 2EXZA 1DM0B 1EU4A 2A6EC 4R8NA 4DF7A 1F2YA 2EJGC 1NCVA 3KLSX 3J81L 3RLFA 3S1NB 1M4VA 1TY2A 3M85A 2F0FA 1GJXA 2G9DA 2BOSA 4O1NA 2JXMB 3KBGA 2F0MA 3Q23A 4K2KA 2Y0SB 2PQEA 1PRTB 3L9AX 3A7AB 4I7ZC 3K5OA 3DUZA 1F9SA 5IGBA 4J1MA 3E6ZX 1A3TA 4K6DA 3J7YW 1R9TB 3DMUA 3GTOB 3OW7A 1IW7D 3D4DA 1STHA 1KLGD 2HDLA 4HSVA 2JE6I 1JB3A 1PLFA 1Q1BA 2C5CA 1LO5D 3PIO3 1H9JA 5HGTA 4RGMA 1B9NA 1ZKOA 1TWFB 1QCBD 2HCCA 4WJWA 4FXDA 2BE5D 2WIIB 2BA0A 5ELDA 5CMDA 2R92B 2F0TA 3ND8A 4L6TB 3CRLC 1NR4A 4DAPA 2KOLA 5LL6X 3GTLB 2D62A 4WFN3 5IGCA 1ONLA 1H9MA 4IUVA 4OO1G 1HUMA 1I3QB 3HEJA 5DAUA 5F2DA 3R2IA 5C3WA 1PFMA 4KY7A 2KHSA 1II3A 2F3VA 1E2WA 4HAEA 3KK7A 1I4RA 3QB3A 2NZ1D 2NN6G 2FJ2A 2B63B 4BS9A 2KCCA 1IKLA 3NBHA 2DY7A 2PO4A 1BO0A 1S5CD 4K8IA 3HRZC 4KKUA 2D9UA 3D6CA 2RDHA 2K04A 5CV8A 1CQVA 4Z9CB 1DD2A 2FFKB 4XXEA 1YNND 5CV7A 5FO9B 4XYQA 2KCNA 2DN8A 4LMQD 2SOBA 1HRJA 1PRTC 3S14B 1SAPA 5KEEA 4A3JB 3S2DB 2F4IA 2E76C 5EBCA 3MFGA 3OWFA 3C46A 5EBDA 2EE1A 1PTOB 3NSWA 2PZWA 3O13A 5CC4A 3H09A 3MXUA 4CKEA 1B50A 3PUWA 1SFOB 1U9RA 1B9MA 3BVGA 1SNCA 2KA7A 5I6WA 3CKIB 1PZKD 1BQQT 3URYA 3D4WA 1DONA 4PNYA 2WP8J 1TWHB 4C2MB 5JPNC 1F2ZA 5ELCA 2K5DA 3PUZA 4OIKA 3T13A 3UI2A 5G3LD 1WCMB 4HMJA 1KDCA 1V43A 1EIGA 5KNDA 1LTBD 4J6HA 4X3SA 1Z7TA 1CZGA 5C4ZA 4V190 3OSOA 1TY0A 2R7ZB 2AQ1B 5ELBA 3A56A 2F0IA 4A3FB 2VB2X 1SYDA 1YNJC 1PTOF 4TSSA 4IUTA 3HOXB 4NW2A 4A3IB 5IGEA 3QJYA 2HCIA 2RBMA 4MHEA 3IKJA 3DWQA 1EYDA 1AN8A 5FLXL 2B8GA 1SMYC 4ULLA 1DOMA 3I4NB 1JCKB 1UAPA 4BWGB 1Q12A 3NTHA 3K6OA 4HN7A 1SE3A 2ICIA 3MWYW 1TVXA 2AQ2B 2BE5C 1C4QA 2JA7B 4FF4A 4JK1C 3VR2A 1EL0A 2HDMA 2NVTB 5EQ0A 1QNUA 1SYFA 4QUCA 2VB3X 1EWHA 3NTKA 3L3OC 3FPUB 2L12A 3I4MB 2MHVA 5CV6A 4BY1B 2IW3A 5BN5A 2AWOA 3L7ZC 3VR6A 5FOBB 2XWJB 5D3DA 5KNBA 1RCVD 2YYZA 4K2LA 4NKLA 1GHJA 3PV0A 1VCIA 4O42A 5EKLA 2EYMA 1QE6A 2O5IC 1GUNA 3LNNA 3F2UA 3NBIA 3TP7A 2E2HB 4C56C 1KDBA 3BZDB 1I4QA 3C1EA 1KLUD 4RFBA 1JICA 2M9VA 1DYQA 4XQNA 2B2WA 5G3LF 1KTKA 2PZUA 2R61A 5E4XA 1TS2A 3K7AB 4G7ZC 5ISRA 4QCLA 3BG3A 3TSSA 1XX8A 4FO2A 1BXTA 3FVQA 3QO2A 3AU7A 3I4LA 2RSNA 3QOLA 2XN9C 5E3FA 2IX0A 4EGVA 1I6VC 2LS01 3V96A 2WAQB 5KIXA 2SDFA 2K03A 1HA5A 4IFDG 4B9XA 5IOCA 1STNA 2PW7A 5KRUA 4U68A 4CJ0B 1EY9A 5J22A 1QJOA 4OL7A 2PZTA 4ZUIA 1D1IA 3OHXC 1Q8IA 4IFDH 2A6HD 5DNFA 4HEDA 2SNMA 1CM9A 4HR7B 5M5WB 3I90A 4B08A 1I4HA 4KHVA 1BCPB 4TKOB 3G6JB 2WKDA 2D5DA 5AFWA 1LLRD 5D3IB 2F1MA 3G7LA 5JOBA 5M5XB 3MTSA 2VUMB 1EZ6A 3Q22A 4ILWA 1QNKA 5EPKA 4FF3A 1SNQA 3H0GB 2HUGA 3DXJC 4OO1I 1PZJD 3SE0A 2O4XA 1I6HB 2XVSA 3VR5A 1VF7A 1BCPC 2GA4B 3NE5B 3HP3A 3ERQA 1KDAA 1QILA 1D5XC 3P1HA 4C3HG 2Z4IA 4KV6A 4RKBA 5FO8B 1TWCB 2H4OA 2J4XA 4N9TA 3D6WA 1AFPA 2EOTA 3KF8A 1A6XA 2K32A 1SNMA 1EQTA 1DCZA 4HCEA 3HS0C 1RHPA 1DOKA 1D5ZC 4J8QA 4DNTB 3C1FA 2J7ZA 2V4DA 5DM63 2K5WA 3BYYB 1HHVA 2F0OA 4H44C 5C5MA 3HOYB 3H3VC 2F0GA 3OMGA 1EY0A 1STGA 4F8MA 3I73A 1EYAA 3LX0A 3KLSA 1SMYD 1R4PB 3T4AC 4IQZA 5C0XH 2L5TA 1WD0A 1IYUA 3VR4A 4IALA 3K5MA 5ELEA 1OXVA 1F2LA 3EVQA 5KYLA 2QDBA 4EQNA 2JEBI 4XQQA 4ZLTF 4FXKC 1K8OA 1U4MA 4XIGS 4HSPA 4RHSA 3S1RB 1DZ1A 1BBXC 1Z6HA 3D3RA 2XWBB 5FKAC 3GO5A 2FHTA 3LWUA 1XXGA 5CYUA 4FXGC 2EY1A 4WORA 1D5MC 2MGSA 4CBVA 5CBEE 2R6GA 1I50B 2IPKD 4BBRB 3S1QB 2SNSA 4MN3A 2RA4A 4RHRA 4XYOA 1RTNA 1IKMA 5LL6S 5K36G 2EYJA 3GV3A 3MXNA 5C6AA 2XIWA 1HFGA 1Z47A 4A3BB 3GTGB 1EEFD 1X3QA 2XNAC 1CT1D 1FGBD 3LWEA 5IGFA 1ZXTA 5JVH3 1ESFA 1S4ZA 3JAME 3VYTA 3K0YA 1S5ED 3M4OB 1PTOD 2EYPA 1VF5C 1WD1A 4PMWA 1LTRD 2F0SA 1OXUA 2O5JC 3IL8A 1STBA 1U4LA 1STAA 3HOVB 1F9RA 1CA5A 1A15A 4C3HB 3NXWA 1A2TA 2PNRC 4CHTB 4KD3A 2EYHA 3CQZB 4MIUA 5JEAJ 3GTMB 1BOSA 2OXPA 1EOTA 2WKCA 4IUUA 5CV4A 3SK6A 3J80L 3MFYA 2A5HA 4QMGA 4Q0FA 4KJNA 1A3VA 1EFID 1SYBA 4WRDA 3S2HB 1O7ZA 2F0QA 3GTKB 4ME5A 1GUOA 1JR0D 5CV9A 4CGYB 4K5XA 1A3UA 4DN4M 1SNOA 3BVZA 1HQRD 1GUWA 1ZEQX 3PO3B 1EY8A 2J0TD 1D2BA 2NTSA 3T16A 4RGOS 1FD7D 2QKIC 2NWGA 2ZXOA 2B2UC 2A73B 1LT4D 2IT1A 4H0LC 5K36H 1QWYA 4FYDA 5C4HA 1AZQA 1JC7A 4C3JG 3K5LA 3K59A 2KUMA 2RSOA 2LMCB 1RODA 3D31A 2KECA 4ZYSA 4RGTA 4ID6A 1PTOC 1J8IA 4IN3A 2PYKA 2JA5B 2EY6A 1L0YB 2B2YA 3S17B 4RA8A 1ENAA 5T1GA 2M2LA 1W6KA 1AP0A 3J80E 1RJTA 3VA7A 3C2PA 2B2WC 3NHHA 2F03A 1ENFA 3KBXA 2EJMA 4OHJA 3VYSA 5JVG3 5CBAE 4NP5A 1G2TA 1H9RA 3GTJB 3RZOB 3SXHA 2K05A 1IW7C 5IIFA 3OOCA 4DNRB 4IUNA 5I9OA 2RKSA 2QEJC 2NB0A 1O7LA 5CR3A 3V05A 4DAVA 1LT3D 5I2XA 1PXUA 3FRPB 2L55A 3CRKC 1ENCA 4KK7A 4EVOA 1H9KA 2ZXPA 3HOWB 2G9HD 3BDLA 4IUPA 4PV1C 4GZYC 2Q8RE 3N52A 1CI3M 2B39A 3NK9A 5CORA 2OT2A 2IJ0A 2L1BA 4TQUS 1Y8NB 1PYWD 1KABA 2WINB 4ZUJA 1VMPA 2LFNA 2F0VA 2WACA 2FMMA 1FNUA 3DWPA 2JEAI 2MP1A 5FK9C 2IWHA 1UNSA 1HA6A 2B2VA 2K5QA 1O80A 3TMEA 1D6EC 5J39A 3J7AF 1B2TA 5E4WC 4X3KA 1BR9A 3WDNA 3PMFA 1G8ZD 3MA2B 4F7XA 3ITPA 1HXYD 5I2YA 2F0UA 4RAUC 1SBBB 3T51B 4KJOA 2A69C 4G7HC 3MEHA 1V1PA 3IFTA 1PRTD 2JSOA 2Z8LA 1Q3LA 3TP6A 4G7OC 4RWSC 1LTGD 2EVBA 3DEPA 1C48A 1V1OA 4XT3B 1IYVA 2Q8IB 1HUNA 2MJ8A 4ZAIA 2DNEA 5KYIA 1V1PB 4OGQC 1H9SB 4BY7B 3VYUA 4RKLA 1NSNS 1S5BD 1RKNA 5T1IA 3NQIA 1TWGB 4KN7C 1Y8OB 3SK5A 2EY5A 1LTID 2E2JB 1B4OA 2Q8TA 1T5XD 1PDQA 5E1FA 2I07B 3RD4A 2RVLA 4XTCS 1EEID 1MBYA 4FF2A 3M7GA 5COYA 1K8MA 3R93A 2H1EA 5D14A 3NWTA 1E0BA 1YNJD 1E2ZA 2NN6I 1WTPA 1SE4A 3R2TA 2YU9B 4IFDJ 4A3EB 2EJFC 4DXFA 2FMCA 1ET6A 3M3YB 1I4XA 3AB9A 1ICWA 3BVMA 1JOQA 3CU7A 4A3DB 1TS5A 3H91A 1FNWA 2K7VA 1CA6A 1V8QA 3EFXD 3MXGA 1MSGA 4A93B 4L63B 1G91A 5ELFA 2L9HA 5C4JB 5TSSA 4PQXA 3GTQB 2F0PA 5DEHA 1CZWA 3R8BA 1B1ZA 1PZID 2I46A 1ESRA 2QF7A 2JA8B 3PUVA 4I65A 2EZVA 4LAAA 2VNUD 1BF4A 1MD2D 1D1KA 1F9PA 2EY2A 1XWEA 2BDNA 5M9OA 3GTPB 4EQPA 4C3IG 2WB1B 4P2CB 5C44B 5KNCA 1CQFA 1S5DD 4OIJA 4HMIA 3T56B 2E74C 1DJRD 5IODA 1JQYD 5BN4A 2NYZD 1A2UA 5A2QE 3ZYYX 2C9OA 3P20A 1W6JA 2K01A 3PUXA 4PMBA 4ZKCB 4QF4A 1NR2A 2CQAA 3HGBA 2L0CA 2A6ED 2K33A 1BDOA 4KHZA 3GD7A 4G4KA 3HOUB 4QB4A 3W2DA 5FO7B 2KQ3A 3NTIA 3R3OA 1EY6A 1TU2B 3X3MA 5M5YB 1BNZA 2A74C 1PFBA 1Y1WB 1G2SA 4YIJA 2PPBC 2AUJD 1VMCA 1STYA 1U4PA 3DEOA 3PUYA 3SR1A 5JAVA 1TS3A 2AWNA 3NQTA 3FDTA 5LHY1 2TMPA 4QUFA 1SE2A 4K8JA 1AW7A 1VDZA 3P75A 2SEBD 2B2VC 2JYOA 4IURA 2NBFA 4NMZA 2L4NA 5I4DA 1I4PA 4C1NI 1EZ8A 4XQJA 2O2LD 4X3UA 3K57A 1SYEA 3ND9A 1M8AA 5A2QL 2R3ZA 3MZ5A 1G291 3TN2A 1HQMC 3BDOA 1SEBD 4M1UB 4JBWA 2KEDA 1RDPD 1HFNA 3BYTB 2VXWA 1XYIA 2XRQD 1WTOA 2A68C 1LTSD 1HCZA 3WOEA 1ZYRC 2B2UA 2PW5A 4IUQA 4RCNA 3VR3A 3A8IE 3V2TA 4KKSA 1WTQA 5M3MB 2F0JA 3BDCA 1FYCA 1F2MA 5DM73 1EQVA 3GP7A 5I6YA 4H7BA 5CV5A 1MSHA 2IX1A 3SEBA 2E75C 3EA6A 3H6MA 3TP5A 1IL8A 1CK1A 3SVMA 1X32A 2B2TA 2X6GA 5JEAH 2M00A 4QIWB 3TZUA 5FLXE 1PFNA 3FEWX 2F0KA 4UAIA 5NUCA 2E2IB 1E2VA 2E2DC 1SYGA 2BCOA 2NN6H 4FF1A 4S3SA 5EPLA 5I9PA 3X3NA 3MVVA 2K28A 4LK1C 2NUCA 5HURA 1EYCA 3OIPA 4KN4C 3A7LA 1BUVT 1NAPA 4Y7NB 4K6LA 2HQEA 2K1BA 4DA2A 2KEEA 1B44D 1SNDA 3JAML 1BCPF 3GQBA 1O7YA 2BA1A 3M7NA 3PO2B 3MHBA 4RCOA 3RZDB 1WTWA 3NP8A 2QCPX 3M4YA 2IL8A 1WTRA 4C1NK 2L11A 5EJWA 1B3AA 4BBSB 4DGZA 3SDZA 1JE4A 1EY5A 3S16B 3Q0AA 3D4RA 1ZYRD 3E0JA 4A3KB 1FNVA 3KLRA 1OXTA 4U673 2F3WA 1QB5D 2Z4HA 1ML0D 2RQXA 2B8FA 3SK8A 1KNAA 1I4GA 3W3AA 4IFDI 4C3IB 3A54A 3OIQA 3NWSA 2K6AA 5JJZA 1TIID 1HPCA 3OMCA 2NVXB 1TT2A 1PRTF 1JWMD 3IFDA 4G57A 3QWNA 3AMUA 4HTHA 4B9WA 5J1ZA 2LKVA 1TKWB 1ILQA 4PMCA 3T53B 2WV6D 5K5PA 1LTAD 4F88A 2A6HC 1EWCA 2AUKA 2A69D 1OO9B 2DY8A 2NVQB 3HG9A 5CGKA 2B2TC 3N6RA 2CW0D 2D2CC 1DOLA 3QOJA 5JEAG 1PMRA 2F0NA 1SJED 3VYRA 2KJXA 1LACA 3J7AV 1SDFA 2A68D 3QIAA 1JWSD 1Q1EA 1YNNC 2R93B 2X6LA 3A8KE 1CHPD 3QG1A 4K5WA 2TSSA 1UEAB 4XDXA 1SJHD 1RF2D 5EPJA 4ABNA 1Q90A 2FINB 4CKCA 1AEXA 4NDXA 4KKTA 5IGDA 2XSCA 4DK1A 3WOFA 3DWAA 1LT5D 4A3GB 3OPOA 2NVYB 3ONAB 1GHKA 2RDFA 3FPPA 3HOZB 1SXTA 5C0XJ 1WTXA 4DFAA 1HTLD 1BCPD 1Y69U 1JORA 2XRSD 4FNFA 4CJ2C 5M3FB 1HTPA 1STEA 3NUCA 1LV9A 4CKBA 1C8CA 2EDGA 4KMUC 3H94A 1JOOA 4XT1B 2OEOA 3SHLA 1EY7A 2RDGA 5C3XA 2F0DA 2ID0A 3RUZA 2JP1A 1T5EA 2N88A 5D65A 1TR5A 1SNPA 2B2YC 4DAYA 4Q5VA 2BDOA 2QILA 1IHZA 3U9SA 4DXGA 5C5LA 5EKKA 1G6ZA 2PMZB 5KGUA 3PIP3 1K83B 3Q6SA 2CW0C 1QOHA 4V0BA 5C4XB 1JWUD 1FR3A 3I72A 2ZT9C 4L8JA 4KD4A 2ZXRA 3CHBD 3S1MB 2KVMA 4RGNA 4HCSA 2AQ3B 1EY4A 4K14A 5C3EB 5IT9E 1X3PA 3EROA 2EYOA 1LTTD 1TS4A 4EQOA 3EQLC 1F9QA 2NTTA 2F0HA 5IGGA 4E6IA 1H9SA 4DU9A 3TP8A 1J9OA 1MGSA 3Q24A 3A8JE 1L0XB 2F0EA 1AZPA 1Y8PB 1MI2A 1OXSC 1S5FD 2LY7A 4K5VA 4IZ8A 2F0WA 3TBIB 2F0LA 1U4RA 1PTOH 3SK4A 4CJ1B 3MAQA 2OF1A 5BN3A 1EU3A 1F77A 3A55A 4LJZC 3P7JA 4C3JB 3J81E 3FKIB 1UUPA 1LABA 2JA6B 5EGTA 1LT6D 2Z1CA 1TWAB 4KI0A 1O78A 4UDUC 1EIHA 3C3LA 3TZDA 3I70A 2ENBA 4M8AA 2N55A 3DHQA 3U9OA 3IAYA 1CHQD 5EKIA 1NUCA 3MC0B 5IT9L 4BA1I 1RD9D 1B53A 3S15B 5C0XG 3EJIA 4ZRZA 5A35A 2CVRA 3S9WA 2MPMA 1Y1VB 3GV6A 1TQOA 2CHBD 3I3CA 1RTOA 3OWEB 4BA2I 4ODGA 3MXPA 4ZK9B 1ET9A 3I8ZA 5JPMC 2IX3A 4H13C 3BS1A 1ILPA 1R4QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDH A;  3GP7 A;  1G8Z D;  4DXF A;  1ET6 A;  3DWA A;  1I4X A;  1KLU D;  1LT5 D;  1CQV A;  4Z9C B;  1I4G A;  4RFB A;  1AN8 A;  3BVM A;  1DYQ A;  3W2D A;  3SEB A;  1HXY D;  3EA6 A;  1KTK A;  1TS5 A;  5D3I B;  1CK1 A;  1FNW A;  1L0X B;  4RHS A;  2R61 A;  1TS2 A;  1SBB B;  1SXT A;  1PRT C;  3EFX D;  1ENF A;  1HTL D;  4OHJ A;  1S5F D;  1BCP D;  1JCK B;  1KLG D;  1PRT F;  5FKA C;  3TSS A;  1PZJ D;  4BWG B;  2XRS D;  4L63 B;  3MFG A;  1JWM D;  1V1P A;  1STE A;  1XXG A;  5ELF A;  1GOZ A;  1PRT D;  1LO5 D;  1PTO H;  1BXT A;  1EFI D;  5TSS A;  1D5M C;  1SE3 A;  1BCP C;  2ICI A;  2Z8L A;  2AQ2 B;  1EU3 A;  1TS3 A;  3R8B A;  1F77 A;  1PTO B;  3O13 A;  2XN9 C;  1B1Z A;  4RGM A;  1LTG D;  2IPK D;  2QEJ C;  1SE2 A;  2RDG A;  1QIL A;  1JR0 D;  1D5X C;  3V05 A;  1PZI D;  1LT3 D;  1AW7 A;  1V1O A;  1UUP A;  2WV6 D;  3BVG A;  2SEB D;  1LTA D;  3BVZ A;  1LT6 D;  1PZK D;  4RHR A;  5ELD A;  1HQR D;  1EWC A;  2J4X A;  3URY A;  5I4D A;  1I4P A;  4L6T B;  1HA5 A;  4UDU C;  1V1P B;  2QIL A;  2G9H D;  1XTC D;  2NTS A;  1MD2 D;  2O2L D;  4RGO S;  4DXG A;  1EEF D;  1FD7 D;  2XNA C;  1CT1 D;  1D5Z C;  1FGB D;  5ELC A;  4K6L A;  5D3D A;  1LT4 D;  1S5B D;  1ESF A;  1RCV D;  1CHQ D;  1B44 D;  1SJE D;  3MC0 B;  2IJ0 A;  3BYY B;  4RH6 A;  1PYW D;  3R2I A;  1RD9 D;  1SEB D;  1LTB D;  1JWU D;  1EU4 A;  1BCP F;  3CHB D;  1RDP D;  4RGN A;  4RCO A;  1S5E D;  3BYT B;  3KLS X;  1LTI D;  1S5D D;  1JWS D;  1TY0 A;  2AQ3 B;  2AQ1 B;  1T5X D;  1M4V A;  1TY2 A;  1PTO D;  5ELB A;  1CHP D;  1DJR D;  2CHB D;  2XRQ D;  1I4R A;  1JQY D;  1FNU A;  1LTR D;  2TSS A;  3DWP A;  3OWE B;  1EEI D;  1LTS D;  5FK9 C;  4O1N A;  1PTO F;  1LTT D;  4ZYS A;  4RGT A;  1TS4 A;  1UNS A;  4TSS A;  1PTO C;  1SJH D;  4C56 C;  1I4H A;  1D6E C;  1BCP B;  1ET9 A;  1RF2 D;  1S5C D;  1FNV A;  1L0Y B;  1LLR D;  2NTT A;  5ELE A;  1PRT B;  1SE4 A;  3BZD B;  3R2T A;  3DWQ A;  1I4Q A; 
#chains in the Genus database with same CATH topology
 4X6A H;  4YY3 Q;  4R8I A;  1E7Z A;  2EYL A;  2ICE C;  1CFM A;  5FLM G;  5C4J H;  4GLX A;  1GUT A;  3GTL H;  5IP9 H;  3MXN B;  2L15 A;  3KUP A;  3K5N A;  1E3P A;  3H0G H;  4UP9 A;  1OXX K;  1EUJ A;  2EPB A;  1UE6 A;  3FMC A;  1WTV A;  4R9W A;  2EYF A;  1KAA A;  1GXD C;  3NPP A;  3VA5 A;  4X3T A;  4ZQ3 A;  2MUY A;  3D8G A;  5IP7 G;  3E5S A;  2B63 H;  3HKZ B;  4OEL B;  3I91 A;  1R9T H;  4OO1 H;  1GOZ A;  1WVL A;  1P8L A;  1RL2 A;  2K4K A;  1CTM A;  4QY7 A;  3TDQ A;  3HKZ G;  1KL9 A;  4BBR H;  5C0X I;  3RMH A;  4FVM A;  1QG7 A;  2X69 A;  1YHA A;  1GUG A;  4ZKB B;  2DNC A;  4F87 A;  4KY5 A;  1SYC A;  4A3M B;  1VQI A;  1ASY A;  4AYB B;  4LW1 A;  4N9P A;  1DXM A;  4A3F G;  2K50 A;  2PCF B;  2VL6 A;  3HZX A;  3BZC A;  4DPG A;  4DNI A;  3I4O A;  3K58 A;  3DM1 A;  1IBK Q;  1XTC D;  1KNE A;  1JOK A;  1QUQ B;  4IPD A;  4Y52 H;  1SSO A;  4KTA A;  4DK0 A;  3W1B A;  4FP5 D;  3B6Y A;  2VUM G;  4RH6 A;  4TRD A;  2NVT H;  4KY6 A;  1GUS A;  2EXZ A;  4A3C G;  1A63 A;  1DM0 B;  1EU4 A;  3RNU A;  2A6E C;  4R8N A;  3W1G A;  4DF7 A;  1JB7 A;  4B3T Q;  4JG2 A;  1F2Y A;  2EJG C;  1NCV A;  4A4I A;  3KLS X;  2HHH Q;  3J81 L;  3RLF A;  3S1N B;  1DGS A;  1M4V A;  1TY2 A;  3M4Q A;  2F0F A;  3M85 A;  4GLA C;  4BY1 H;  2G9D A;  1GJX A;  2BOS A;  2KEN A;  4O1N A;  5BR8 Q;  2Y0S G;  2JXM B;  2ZTD A;  3KBG A;  2F0M A;  2N49 A;  4BXX H;  3Q23 A;  1D7Q A;  1N34 Q;  4K2K A;  3JAM i;  3KF6 B;  2Y0S B;  2PQE A;  1PRT B;  3L9A X;  3A7A B;  4FDB A;  1I94 L;  4I7Z C;  3K5O A;  3DUZ A;  1F9S A;  5HGQ A;  5IGB A;  4J1M A;  3E6Z X;  1A3T A;  2NVY H;  1EIF A;  4K6D A;  3J7Y W;  1R9T B;  1XPO A;  3DMU A;  3M9B A;  3GTO B;  1XMO Q;  1KC8 C;  3OW7 A;  1IW7 D;  3D4D A;  1STH A;  1KLG D;  2HDL A;  4HSV A;  1PH9 A;  2JE6 I;  1JB3 A;  1PLF A;  1Q1B A;  2C5C A;  4DUY Q;  1JMC A;  2RCF A;  1LO5 D;  4JV5 L;  3PIO 3;  2MQH A;  1H9J A;  5HGT A;  4LNQ A;  1I50 H;  4RGM A;  1B9N A;  1BBU A;  1ZKO A;  1TWF B;  1QCB D;  2HCC A;  4WJW A;  4FXD A;  2QDL A;  4LF4 Q;  4JI8 Q;  4DV6 Q;  3J80 c;  2BE5 D;  4DV2 Q;  2WII B;  2BA0 A;  4YWK A;  5ELD A;  3J81 j;  5CMD A;  2R92 B;  2F0T A;  4DAM A;  3ND8 A;  4JV5 Q;  4L6T B;  2KHI A;  3CRL C;  3J7A 5;  1NR4 A;  4DAP A;  2KOL A;  5LL6 X;  4JPB W;  3GTL B;  1YZ6 A;  3F1Z A;  2D62 A;  4WFN 3;  5IGC A;  3GDE A;  1ONL A;  1H9M A;  3U58 A;  4IUV A;  3TRE A;  4OO1 G;  3J81 i;  3HOZ H;  1HUM A;  1HZA A;  1Q8K A;  5ELO A;  1I3Q B;  3HEJ A;  1NTG A;  1N32 L;  5GAG C;  4A3E G;  5DAU A;  5F2D A;  4X62 L;  2AHO B;  2VS1 A;  2UXC L;  3R2I A;  2V1C C;  5C3W A;  1PFM A;  4KY7 A;  1NY4 A;  2KHS A;  1II3 A;  2F3V A;  1E2W A;  2I5H A;  4HAE A;  1N33 Q;  1KRS A;  3KK7 A;  3HOZ G;  1I4R A;  3QB3 A;  2YV5 A;  2NZ1 D;  3J7Z C;  5C4X G;  2NN6 G;  4UY8 C;  2FJ2 A;  4I7A A;  2B63 B;  4BS9 A;  2KCC A;  4GN3 B;  1IKL A;  2WAQ E;  1VQJ A;  1J5E L;  3NBH A;  2DY7 A;  2PO4 A;  4UHV A;  1BO0 A;  1S5C D;  4K8I A;  3HRZ C;  4KKU A;  4P75 A;  2HT1 A;  1WOC A;  2D9U A;  3D6C A;  2RDH A;  2VW9 A;  2K04 A;  5CV8 A;  4JCV E;  2UUA Q;  1CQV A;  4Z9C B;  1DD2 A;  2FFK B;  4XXE A;  1YNN D;  5CV7 A;  1JJC B;  5FO9 B;  2C35 B;  1HNW Q;  4XYQ A;  2KCN A;  4DV5 Q;  1YHB A;  2DN8 A;  1U0L A;  4LMQ D;  2SOB A;  1HRJ A;  1PRT C;  2XGT A;  3S14 B;  1SAP A;  1IBL L;  5KEE A;  4A3J B;  3S2D B;  2F4I A;  2E76 C;  5EBC A;  3MFG A;  3OWF A;  3C46 A;  5EBD A;  4JI0 Q;  2EE1 A;  4BXX G;  1RIP A;  2F4V L;  1PTO B;  3NSW A;  1VQC A;  2PZW A;  3O13 A;  5CC4 A;  3H09 A;  4DV7 L;  1PA6 A;  3MXU A;  4CKE A;  1B50 A;  4UP8 A;  3PUW A;  1SFO B;  1U9R A;  1B9M A;  4KHP Q;  1C0A A;  2YTX A;  3BVG A;  4PZ7 A;  4A3G G;  1SNC A;  2KA7 A;  5I6W A;  1Q86 C;  3CKI B;  1PZK D;  1CSP A;  5LMN L;  2HIX A;  1BQQ T;  1T9H A;  3URY A;  3D4W A;  4JYA L;  4PNY A;  1DON A;  2NZO A;  1TWH B;  2WP8 J;  4PG3 A;  4JI0 L;  3S14 H;  2OQK A;  3HOX G;  3HOV G;  4C2M B;  3J81 c;  4A75 A;  1VQF A;  1XJV A;  5JPN C;  1F2Z A;  4YY3 L;  5ELC A;  4LWC A;  2K5D A;  3JAM c;  3PUZ A;  4OIK A;  3T13 A;  3UI2 A;  5G3L D;  4A3G H;  1WCM B;  4HMJ A;  1KDC A;  2UU9 L;  1V43 A;  2OCE A;  1EIG A;  5KND A;  1LTB D;  4J6H A;  4HID A;  2D0P A;  4X3S A;  1Z7T A;  1CZG A;  5C4Z A;  2EXD A;  1VQE A;  2KCT A;  4V19 0;  3OSO A;  1TY0 A;  2R7Z B;  2AQ1 B;  1AE2 A;  3UE1 A;  4OWW B;  5ELB A;  3A56 A;  4QIW E;  4R4I A;  2F0I A;  4A3F B;  2VB2 X;  4DR7 Q;  1SYD A;  4QJF A;  1EWI A;  1YNJ C;  1PTO F;  4TSS A;  4IUT A;  3HOX B;  1MJE A;  4NW2 A;  4A3I B;  4YCW A;  5IGE A;  1VQM A;  1IL2 A;  3QJY A;  3J80 i;  1K83 H;  2HCI A;  2RBM A;  4MHE A;  5LMN W;  3A5U A;  3IKJ A;  1K8A C;  1E1T A;  3DWQ A;  4P71 A;  4EQ5 A;  4MZ9 A;  1EYD A;  3CF5 A;  4B3R L;  1AN8 A;  1K3B C;  3ER0 A;  2RHQ B;  5FLX L;  2B8G A;  1SMY C;  4ULL A;  1DOM A;  5FJ8 G;  3I4N B;  1JCK B;  1UAP A;  3CMA A;  4BY7 H;  1L1O C;  4BWG B;  1Q12 A;  3NTH A;  1LTL A;  3K6O A;  4HN7 A;  1SE3 A;  2ICI A;  3MWY W;  1TVX A;  2AQ2 B;  2BE5 C;  3T1H Q;  1C4Q A;  2CH4 W;  4WJ3 M;  2JA7 B;  2CH4 A;  4FF4 A;  1ICF B;  4JK1 C;  3VR2 A;  1EL0 A;  2HDM A;  4HJ9 A;  1Y14 B;  2NVT B;  5EQ0 A;  1QNU A;  1SYF A;  4AQY Q;  4QUC A;  2VB3 X;  1EWH A;  3NTK A;  3L3O C;  3JC6 6;  3FPU B;  2L12 A;  3I4M B;  2MHV A;  1N9W A;  2UU9 Q;  5CV6 A;  1VQ9 A;  4BY1 B;  2IW3 A;  4H02 A;  1SN8 A;  5BN5 A;  2AWO A;  3L7Z C;  4JI4 Q;  5AJ3 L;  4OON A;  3VR6 A;  4OX9 Q;  5FOB B;  4C3I H;  5IP9 G;  4X65 Q;  2XWJ B;  5D3D A;  4LF8 L;  5KNB A;  1RCV D;  1CKO A;  2YYZ A;  1OTC A;  4K2L A;  1NE3 A;  1B7Y B;  4NKL A;  1GHJ A;  3PV0 A;  4GN4 B;  3STB D;  1VCI A;  4O42 A;  5EKL A;  2EYM A;  2EIF A;  1QE6 A;  2O5I C;  4A3I G;  1GUN A;  1K3R A;  3ULP A;  4QQB X;  1Q46 A;  4A93 H;  3LNN A;  3F2U A;  3NBI A;  3TP7 A;  1VQ4 A;  1UWV A;  4IJL A;  2E2H B;  3S1N H;  4C56 C;  2ASB A;  1K8G A;  4DV4 Q;  1YIT A;  1KDB A;  5IE8 A;  4R4T A;  3BZD B;  3DM3 A;  1I4Q A;  2HHH L;  5E7N A;  4MTK A;  1YJW A;  3ULJ A;  3C1E A;  1KLU D;  4YCU A;  2CWA A;  4DR2 L;  1N36 L;  4RFB A;  1JIC A;  2CFM A;  2M9V A;  1DYQ A;  1X3G A;  4XQN A;  2B2W A;  5G3L F;  4LF6 Q;  1KTK A;  2PZU A;  1EQQ A;  4B3S Q;  2R61 A;  5E4X A;  1TS2 A;  3U4Z A;  2MFI A;  2JJQ A;  3K7A B;  2G5D A;  4G7Z C;  5ISR A;  2OTL A;  4QCL A;  3BG3 A;  1HH2 P;  3TSS A;  4DUZ L;  1XX8 A;  3G71 A;  1J5E Q;  1VS0 A;  4FO2 A;  1BXT A;  3FVQ A;  3QO2 A;  3AU7 A;  3I4L A;  3G6E A;  2JA6 H;  2RSN A;  3E3X A;  3QOL A;  2XN9 C;  5E3F A;  2IX0 A;  4EGV A;  4DR7 L;  1I6V C;  2UUC L;  2LS0 1;  3V96 A;  3S24 A;  2WAQ B;  5KIX A;  3AFQ A;  2SDF A;  2K03 A;  5C4X H;  1BBW A;  1S40 A;  4A3D G;  1HA5 A;  4IFD G;  4B9X A;  3M4P A;  5IOC A;  1STN A;  2PW7 A;  4A3J H;  5KRU A;  4U68 A;  4CJ0 B;  1EY9 A;  3CW2 C;  1QJO A;  5J22 A;  2JA9 A;  1PYS B;  4OL7 A;  2PZT A;  2YTV A;  4ZUI A;  1D1I A;  3KFU A;  3OHX C;  1Q8I A;  4IFD H;  2A6H D;  2JQO A;  1SMX A;  2E2H H;  5IYB G;  1GD7 A;  5DNF A;  4HED A;  2SNM A;  4GN5 A;  3CC4 A;  1CM9 A;  2Q2T A;  4HR7 B;  1EQR A;  5M5W B;  3I90 A;  2UUB Q;  3HFZ B;  1I4H A;  4B08 A;  4KHV A;  1BCP B;  4TKO B;  4EX5 A;  2VZA A;  3G6J B;  1VQG A;  2ZJR A;  2WKD A;  2D5D A;  1PH3 A;  2KHJ A;  5AFW A;  2VQE L;  1LLR D;  4N8F A;  4CDE C;  1EFW A;  5D3I B;  1UEB A;  1XMO L;  2F1M A;  3CP0 A;  3G7L A;  5JOB A;  5M5X B;  3MTS A;  2VUM B;  1EZ6 A;  3Q22 A;  1XNR Q;  5GAE C;  4ILW A;  2VY3 A;  1QNK A;  5EPK A;  4FF3 A;  1SNQ A;  3H0G B;  1SR3 A;  2HUG A;  3PCO B;  1L2F A;  1HNZ L;  1Q82 C;  1NMG A;  2N3S A;  3DXJ C;  4OO1 I;  1QVG A;  1PZJ D;  2ZJQ A;  4BBS G;  4JI2 L;  4TVA B;  3SE0 A;  2O4X A;  4IO9 A;  2XVS A;  3VR5 A;  1I6H B;  1VF7 A;  4QL5 A;  4L5S A;  5J3B A;  5IYC H;  1BCP C;  2GA4 B;  3T1Y L;  2ZJP A;  3HOY G;  3NE5 B;  4NXM Q;  3HP3 A;  2Y0S E;  3ERQ A;  1KDA A;  1QIL A;  2N8N A;  1D5X C;  3P1H A;  4C3H G;  4JI2 Q;  1E24 A;  2Z4I A;  4RMF A;  4KV6 A;  4RKB A;  5FO8 B;  1SLJ A;  1TWC B;  2H4O A;  2J4X A;  4N9T A;  1HNX L;  3D6W A;  3H0G G;  1AFP A;  2EOT A;  2K5V A;  3KF8 A;  2K32 A;  1SNM A;  1A6X A;  1EQT A;  1DCZ A;  4HCE A;  1XNR L;  3HS0 C;  4JI1 Q;  1RHP A;  1DOK A;  1CSQ A;  5H1S E;  3ICE A;  1D5Z C;  4DR3 L;  1WCM H;  4J8Q A;  3K8A A;  4DNT B;  3C1F A;  2J7Z A;  2V4D A;  3PGZ A;  5DM6 3;  2K5W A;  3OTO L;  3BYY B;  4NXN L;  1HHV A;  2F0O A;  3GTP H;  2JA7 G;  4H44 C;  4JI6 Q;  5C5M A;  4GLV B;  3HOY B;  3H3V C;  1U5K A;  2F0G A;  3OMG A;  3UDG A;  1NJI C;  3TRZ A;  1EY0 A;  5M3F H;  1JJ2 A;  1STG A;  1SFO H;  4F8M A;  3I73 A;  4LF4 L;  1EYA A;  2E2I H;  3I4M G;  3CAM A;  3LX0 A;  4AYB E;  3KLS A;  1SMY D;  1R4P B;  1X6O A;  3NEL A;  4IQZ A;  3T4A C;  4A3C H;  5C0X H;  2L5T A;  1WD0 A;  1IYU A;  3KDF A;  3VR4 A;  3PF5 A;  4DUY L;  4IAL A;  3K5M A;  2Q2U A;  5ELE A;  1OXV A;  2EQS A;  3K7U C;  1F2L A;  3EVQ A;  5KYL A;  1C7Y A;  4GKK L;  2QDB A;  1I5F A;  1PH1 A;  2JEB I;  4EQN A;  1QUQ A;  4XQQ A;  4ZLT F;  4J15 A;  3PIO A;  4FXK C;  2OQ0 A;  1K8O A;  1WFQ A;  1U4M A;  5FJ8 H;  4XIG S;  2N78 A;  4JYA Q;  4HSP A;  1AH9 A;  4RHS A;  3S1R B;  2VQF Q;  3U4V A;  1DZ1 A;  3GTO H;  4GNX C;  1BBX C;  1YIJ A;  3HOU G;  1X54 A;  1Z6H A;  3D3R A;  2XWB B;  5FKA C;  3GO5 A;  4O2D A;  2FHT A;  3LWU A;  5FLM H;  2OTJ A;  3NEN A;  1XXG A;  2JA8 H;  1Z9F A;  5CYU A;  4R4O A;  4FXG C;  2EY1 A;  4WOR A;  1D5M C;  4IPC A;  2MGS A;  4CBV A;  5CBE E;  4GS3 A;  3S1M H;  2R6G A;  1I50 B;  2IPK D;  4YWL A;  2Z6K A;  4BBR B;  3S1Q B;  2B29 A;  2SNS A;  4DR6 L;  4MN3 A;  4LUV A;  2RA4 A;  4RHR A;  2PQA B;  4XYO A;  2I5L X;  1RTN A;  1IKM A;  5LL6 S;  5K36 G;  2EYJ A;  3GV3 A;  4ALP A;  3MXN A;  4DV0 Q;  5C6A A;  4X66 Q;  2XIW A;  3KJP A;  1HFG A;  1WI5 A;  1Z47 A;  4A3B B;  3S1R H;  4DUZ Q;  3GTG B;  1EEF D;  1X3Q A;  2UUA L;  2XNA C;  1CT1 D;  1FGB D;  3LWE A;  3CPF A;  5IGF A;  2KCM A;  1C9O A;  3HKS A;  1ZXT A;  3HOW H;  5JVH 3;  1ESF A;  1S4Z A;  4LF6 L;  4X66 L;  3JAM E;  3CCS A;  3TS2 A;  1K28 A;  2QGQ A;  3VYT A;  1L1O B;  3L0O A;  1PH2 A;  1FVI A;  3K0Y A;  1S5E D;  1PV4 A;  3M4O B;  1PTO D;  5M5W H;  1X9N A;  2EYP A;  1VF5 C;  1WD1 A;  3BU2 A;  4PMW A;  1LTR D;  2F0S A;  1S3O A;  4DV4 L;  1OXU A;  2WFW A;  2O5J C;  2QA4 A;  3IL8 A;  5IYD G;  1STB A;  1U4L A;  3W5O A;  2ES2 A;  1STA A;  1PH6 A;  1GM5 A;  3HOV B;  2UXC Q;  1F9R A;  1NMF A;  4LFC L;  1A15 A;  1CA5 A;  4A3D H;  3F2B A;  4C3H B;  3PO2 H;  3KOJ A;  3NXW A;  1A2T A;  2PNR C;  4X65 L;  4CHT B;  4KD3 A;  1XNQ Q;  2EYH A;  1YBY A;  3CQZ B;  4MIU A;  5JEA J;  3GTM B;  2DUD A;  1BOS A;  4DK6 C;  2OXP A;  1PH7 A;  1PHJ A;  1EOT A;  2WKC A;  4IUU A;  1XMQ Q;  1XNQ L;  1M90 C;  5CV4 A;  3SK6 A;  3J80 L;  1PVO A;  3MFY A;  2A5H A;  4LFC Q;  4QMG A;  3I4M H;  4KJN A;  4Q0F A;  1A3V A;  1EFI D;  5BR8 L;  1SYB A;  4WRD A;  4AYB G;  3I7F A;  3S2H B;  1O7Z A;  2F0Q A;  3GTK B;  4ME5 A;  1GUO A;  1IBM Q;  1JR0 D;  5CV9 A;  4GKJ Q;  4CGY B;  4K5X A;  1XPU A;  1WYD A;  1A3U A;  3CCM A;  3CCJ A;  4DN4 M;  1SNO A;  2R93 H;  3BVZ A;  1HQR D;  4DV1 Q;  1GUW A;  1KHI A;  1ZEQ X;  5L37 A;  3S2D H;  3PO3 B;  1EY8 A;  2J0T D;  3K0X A;  1D2B A;  2NTS A;  3T16 A;  4RGO S;  3LGJ A;  1FD7 D;  2QKI C;  3UDX A;  3I4N G;  2NWG A;  2FXQ A;  3KLW A;  2ZXO A;  2B2U C;  2A73 B;  1LT4 D;  1PH8 A;  2IT1 A;  3CCL A;  1K73 C;  3OW2 A;  4H0L C;  4JI1 L;  2PMZ E;  3PQI A;  2B3G A;  5K36 H;  1LYL A;  1QWY A;  4FYD A;  5C4H A;  4Y7N H;  1X55 A;  1AZQ A;  5M3M H;  1JC7 A;  2PNH A;  4C3J G;  3K5L A;  4A3I H;  3K59 A;  2KUM A;  2RSO A;  2LMC B;  4JI5 L;  1ROD A;  1BVS A;  4A3F H;  3D31 A;  2KEC A;  2K75 A;  4HJ8 A;  4BY1 G;  4ZYS A;  4RGT A;  1UE7 A;  4NXM L;  4ID6 A;  1PTO C;  4DR1 Q;  2AMC B;  1J8I A;  4IN3 A;  2PYK A;  2JA5 B;  2EY6 A;  1L0Y B;  2B2Y A;  3S17 B;  4RA8 A;  1P16 A;  1ENA A;  5T1G A;  2M2L A;  1W6K A;  2JA5 G;  1AP0 A;  3J80 E;  1RJT A;  1L1O A;  4IPH A;  3VA7 A;  4DAY B;  4QGU A;  4A3K H;  5GAD C;  3C2P A;  1JJG A;  4GKK Q;  2B2W C;  1SE8 A;  3NHH A;  2F03 A;  1HZB A;  1V9P A;  1ENF A;  2BH8 A;  3KBX A;  2EJM A;  1V1Q A;  4OHJ A;  3VYS A;  5JVG 3;  5CBA E;  4L5Q A;  4NP5 A;  1G2T A;  1D8L A;  1H9R A;  3GTJ B;  3RZO B;  3SXH A;  4DK3 C;  5C3E H;  3G4S A;  2K05 A;  1IW7 C;  2Z9H A;  2F4V Q;  5IIF A;  3OOC A;  4JI5 Q;  4DNR B;  4IUN A;  5I9O A;  2RKS A;  3AQQ A;  2QEJ C;  2NB0 A;  1O7L A;  1J6Q A;  1G51 A;  1CKN A;  5CR3 A;  3V05 A;  4DAV A;  1VQL A;  1LT3 D;  5I2X A;  1PXU A;  3FRP B;  1IXR A;  4A76 A;  2L55 A;  3CRK C;  3M4O H;  1ENC A;  4KK7 A;  1HR0 Q;  4EVO A;  1VQ5 A;  1H9K A;  1HNW L;  2ZXP A;  2WAQ G;  3HOW B;  2G9H D;  3BDL A;  4IUP A;  1VQ8 A;  4PV1 C;  4GZY C;  1IBL Q;  2Q8R E;  3N52 A;  1TWC H;  1CI3 M;  2B39 A;  3NK9 A;  3VDY A;  4HIK A;  5COR A;  2OT2 A;  2IJ0 A;  2L1B A;  4TQU S;  1Y8N B;  1PYW D;  4DR5 L;  1KAB A;  4MTN A;  2WIN B;  1X3E A;  4ZUJ A;  3E0E A;  1VMP A;  2RCN A;  1GVP A;  2LFN A;  2LXK A;  4LF7 L;  3CC2 A;  1QZG A;  2F0V A;  2WAC A;  1IBM L;  2FMM A;  1FNU A;  3DWP A;  1YJN A;  2JEA I;  3MEF A;  2MP1 A;  4JW0 A;  5FK9 C;  4OEM B;  4HJ7 A;  2IWH A;  3RR5 A;  5JJL A;  3HOY H;  2MO1 A;  1HZ9 A;  1UNS A;  1YJ9 A;  4AIM A;  1HA6 A;  2B2V A;  2K5Q A;  1O80 A;  3TME A;  1D6E C;  5J39 A;  3J7A F;  1B2T A;  5E4W C;  2R7D A;  4X3K A;  1HNZ Q;  2PI2 A;  1BR9 A;  2NVX H;  3CCR A;  3GTK H;  4IJH A;  2DJG C;  3WDN A;  3PMF A;  1G8Z D;  3AFP A;  1QVC A;  3MA2 B;  2XTI A;  4F7X A;  4LF9 L;  4C2M H;  3ITP A;  2K5N A;  2VQF L;  2CWP A;  1HXY D;  1N32 Q;  5I2Y A;  2F0U A;  4RAU C;  1SBB B;  3T51 B;  2F52 A;  4KJO A;  4KLK A;  2VQE Q;  4C3H H;  4JI4 L;  1VQB A;  2A69 C;  4G7H C;  2JN4 A;  3MEH A;  1V1P A;  2HD3 A;  3IRB A;  4LFB L;  3IFT A;  2VUM H;  4HIO A;  1PRT D;  5IYC G;  3KF8 B;  4A3M G;  2JSO A;  2Z8L A;  4B3M L;  1Q3L A;  3TP6 A;  4G7O C;  4HIM A;  4RWS C;  1LTG D;  1L0W A;  1PH4 A;  2EVB A;  3DEP A;  1C48 A;  1V1O A;  4XT3 B;  4OWX B;  1IYV A;  3GTQ H;  2Q8I B;  3GTJ H;  4JI3 Q;  2GN5 A;  5JJK A;  3EIV A;  4B3M Q;  3FHW A;  1HUN A;  2MJ8 A;  4ZAI A;  5IWA L;  2DNE A;  4LFB Q;  1CKM A;  5KYI A;  1V1P B;  4OGQ C;  1H9S B;  4BY7 B;  5M5X H;  1KAW A;  3VYU A;  4RKL A;  4LF8 Q;  4A3B H;  1NSN S;  2K52 A;  1S5B D;  1RKN A;  3E9H A;  5T1I A;  1VQK A;  2K14 A;  3NQI A;  1TWG B;  3AEV A;  2IY5 B;  4RG1 A;  1TWF H;  5FLX c;  3CCE A;  4B3R Q;  1TWA H;  4KN7 C;  2Q2H A;  1Y8O B;  3SK5 A;  2EY5 A;  1LTI D;  2B63 G;  2E2J B;  1B4O A;  1VQP A;  3FKI H;  3Q8D A;  2Q8T A;  1T5X D;  2E8G A;  1PDQ A;  5E1F A;  2I07 B;  2NVQ H;  3RD4 A;  4AQY L;  2RVL A;  4XTC S;  1EEI D;  1MBY A;  4FF2 A;  3M7G A;  5COY A;  3I2Z A;  1K8M A;  3R93 A;  2H1E A;  4JI7 Q;  5D14 A;  1PH5 A;  4NB3 A;  1BKB A;  1NBW A;  3NWT A;  1E0B A;  1YNJ D;  1E2Z A;  4JOI C;  2NN6 I;  1WTP A;  1SE4 A;  2H5X A;  3R2T A;  2K5H A;  2YU9 B;  3BJU A;  3CQZ H;  1TWG H;  4IFD J;  4A3E B;  2I0Q A;  2EJF C;  4DXF A;  2FMC A;  1ET6 A;  1Y1W H;  3M3Y B;  1I4X A;  3CXC A;  3AB9 A;  1ICW A;  3BVM A;  1JOQ A;  3H15 A;  3CU7 A;  4A3D B;  1TS5 A;  3H91 A;  5ELN A;  1FNW A;  5GQO A;  1VQ6 A;  2K7V A;  1KQS A;  1CA6 A;  1V8Q A;  1HR0 L;  1A62 A;  3EFX D;  3MXG A;  1MSG A;  4L5T A;  4A93 B;  4L63 B;  1CKN B;  1G91 A;  5ELF A;  2A8V A;  2L9H A;  2GVB A;  5C4J B;  1EYG A;  2JA6 G;  5TSS A;  4PQX A;  3GTQ B;  2F0P A;  5DEH A;  1CZW A;  3R8B A;  4AH6 A;  2Z6K C;  1B1Z A;  4R4C A;  1PZI D;  2I46 A;  3CD6 A;  4C3J H;  3K80 C;  4HJ5 A;  1ESR A;  2QF7 A;  2JA8 B;  3PUV A;  1UE1 A;  4I65 A;  2EZV A;  4LAA A;  1FGU A;  3K81 C;  1XTD A;  1E22 A;  2VNU D;  1I3Q H;  1I6H H;  3G48 A;  4DV3 Q;  4GNX A;  1BF4 A;  1MD2 D;  1D1K A;  1F9P A;  2EY2 A;  1XWE A;  2BDN A;  5M9O A;  3GTP B;  4EQP A;  2IHF A;  3PO3 H;  4GOP B;  3U50 C;  4C3I G;  2WB1 B;  1QZH A;  4P2C B;  4IOC A;  4DR1 L;  4IOA A;  4R1J A;  5C44 B;  5KNC A;  1CQF A;  1S5D D;  4OIJ A;  4HMI A;  3T56 B;  2E74 C;  4JBJ A;  1DJR D;  5IOD A;  2UUC Q;  1JQY D;  5BN4 A;  2NYZ D;  1A2U A;  5A2Q E;  3NBH B;  3ZYY X;  2C9O A;  1M1K C;  1YVC A;  3P20 A;  4A3L H;  1W6J A;  2K01 A;  3OTO Q;  3PUX A;  1MJC A;  4PMB A;  4ZKC B;  2F3I A;  4QF4 A;  3RZO H;  1NR2 A;  4K0K Q;  1WCM G;  2CQA A;  2L0C A;  3HGB A;  2A6E D;  2K33 A;  1BDO A;  4KHZ A;  3GD7 A;  4G4K A;  4JBM A;  3HOU B;  4UPA A;  4QB4 A;  4ZCK A;  1YEZ A;  3W2D A;  5FO7 B;  2KQ3 A;  4X62 Q;  3NTI A;  3R3O A;  3RLN A;  3GTG H;  3CPW A;  4P74 A;  1EY6 A;  1TU2 B;  3TQY A;  3X3M A;  5M5Y B;  2CQO A;  2DJF C;  1BNZ A;  1W3S A;  4PZ6 A;  2A74 C;  3D0F A;  1PFB A;  1B8A A;  1Y1W B;  3QR8 A;  5C3E G;  1G2S A;  4YIJ A;  2A1A A;  2PPB C;  2PI2 E;  5IP7 H;  2AUJ D;  1VMC A;  1STY A;  1U4P A;  3DEO A;  3PUY A;  4MNO A;  5EAY A;  3SR1 A;  5JAV A;  1Y1W G;  4DV1 L;  1TS3 A;  2AWN A;  3NQT A;  3FDT A;  5LHY 1;  2TMP A;  4QUF A;  1SE2 A;  4K8J A;  1AW7 A;  2JA5 H;  1VDZ A;  3CCV A;  3P75 A;  2SEB D;  4P73 A;  3ERS X;  2B2V C;  2JYO A;  4IUR A;  2NBF A;  4NMZ A;  2L4N A;  5I4D A;  1I4P A;  2IHE A;  3TEH B;  4C1N I;  1EZ8 A;  4XQJ A;  2O2L D;  4X3U A;  3K57 A;  1JE5 A;  1SYE A;  3ND9 A;  1B70 B;  1M8A A;  5A2Q L;  2R3Z A;  3MZ5 A;  1G29 1;  1ASZ A;  1XMQ L;  3TN2 A;  2WB1 E;  1HQM C;  4R4Q A;  1GO3 E;  3BDO A;  1VQD A;  4A3E H;  3CC7 A;  1SEB D;  4M1U B;  4JBW A;  2KED A;  4IPG A;  1RDP D;  3SGI A;  4KHP L;  1HFN A;  3BYT B;  3RN5 A;  2VXW A;  1MIU A;  1XYI A;  3I55 A;  2XRQ D;  3KF6 A;  3TS0 A;  1WTO A;  4JI8 L;  2A68 C;  1LTS D;  1HCZ A;  2R92 G;  3WOE A;  1ZYR C;  2B2U A;  2PW5 A;  4IUQ A;  4ME3 A;  4RCN A;  3VR3 A;  3A8I E;  3V2T A;  3S15 H;  4KKS A;  1WTQ A;  5M3M B;  1MKH A;  2F0J A;  3BDC A;  1FYC A;  1TXY A;  1X3F A;  2UXD Q;  1F2M A;  5DM7 3;  1EQV A;  4LF7 Q;  3GP7 A;  5I6Y A;  1FJG L;  4B3S L;  4H7B A;  5CV5 A;  3F8T A;  4GNX B;  4B3T L;  1MSH A;  4UP7 A;  4POG A;  2IX1 A;  4DV0 L;  2ALY B;  3SEB A;  2E75 C;  3BZK A;  3EA6 A;  3H6M A;  3TP5 A;  4DR2 Q;  1IL8 A;  1W2B A;  1CK1 A;  2PQA A;  2RHS B;  1B3Q A;  2I5M X;  4A3L G;  1WJJ A;  3SVM A;  1X32 A;  5IT9 c;  2B2T A;  2X6G A;  1IBK L;  5JEA H;  2M00 A;  4DR4 Q;  4QIW B;  3TZU A;  5HY6 A;  5FLX E;  2E5L L;  1PFN A;  3FEW X;  2F0K A;  1N8R C;  1MHW C;  4UAI A;  1HZC A;  5NUC A;  3S2H H;  3DLL A;  2E2I B;  1E2V A;  2E2D C;  1SYG A;  2BCO A;  2NN6 H;  4FF1 A;  4S3S A;  5EPL A;  3A74 A;  5I9P A;  3PIP A;  3X3N A;  3MVV A;  1JT8 A;  2K28 A;  4LK1 C;  2NUC A;  3EBE A;  5HUR A;  3FKI G;  3H3V H;  1EYC A;  3OIP A;  4KN4 C;  3A7L A;  2QW7 A;  1BUV T;  5AJ3 Q;  4OX9 L;  5JJI A;  1NAP A;  4Y7N B;  3K7A H;  4K6L A;  3UDF A;  2HQE A;  3L2P A;  2K1B A;  3STB C;  4DA2 A;  2KEE A;  4P72 A;  1VQH A;  1B44 D;  2BH2 A;  4DV3 L;  4APV A;  1SND A;  3JAM L;  2YU9 H;  1BCP F;  1CUK A;  1O7Y A;  2BA1 A;  3GQB A;  3M7N A;  4DV2 L;  3PO2 B;  3MHB A;  4RCO A;  2UXB Q;  4BBR G;  3S1Q H;  3RZD B;  1WTW A;  2HIV A;  3PSI A;  1YNX A;  2AKW B;  3NP8 A;  3FP9 A;  2QCP X;  3M4Y A;  3CME A;  2IL8 A;  1WTR A;  4C1N K;  2L11 A;  5EJW A;  1B3A A;  3KDF B;  4BBS B;  4DGZ A;  3SDZ A;  1JE4 A;  3A5Z B;  1EY5 A;  3S16 B;  1Y1V G;  2ZTC A;  3Q0A A;  1A0I A;  3D4R A;  1SRU A;  1ZYR D;  3E0J A;  4A3K B;  4A3B G;  1FNV A;  4OWT B;  3KLR A;  1OXT A;  4U67 3;  2R7Z H;  2F3W A;  1QB5 D;  2Z4H A;  1ML0 D;  2RQX A;  1A8V A;  2B8F A;  2CCZ A;  3SK8 A;  1KNA A;  1I4G A;  2Z0S A;  3W3A A;  5M5Y H;  2ZM6 Q;  1X65 A;  4IFD I;  4C3I B;  1KRT A;  3A54 A;  4JC0 A;  4CDD C;  3OIQ A;  3NWS A;  2K6A A;  5JJZ A;  1TII D;  1HPC A;  1I94 Q;  3OMC A;  2P5Z X;  4K0K L;  2NVX B;  3KJO A;  2R7Z G;  1SRO A;  1TT2 A;  1TWH H;  1PRT F;  4POF A;  4BY7 G;  1H95 A;  5LMU Q;  1N34 L;  1JWM D;  3IFD A;  4PZ8 A;  3OYY A;  4G57 A;  4A3M H;  3QWN A;  3T1H L;  1Q7Y C;  2LSS A;  3AMU A;  4HTH A;  4JI7 L;  2JA8 G;  4B9W A;  4A3J G;  5J1Z A;  5M3F G;  2LKV A;  1TKW B;  1ILQ A;  4PMC A;  5IYB H;  3T53 B;  2WV6 D;  5K5P A;  1LTA D;  4F88 A;  2A6H C;  1EWC A;  4CDF C;  1G6P A;  2AUK A;  2NZH A;  2A69 D;  1OO9 B;  2DY8 A;  4NPS A;  2NVQ B;  3HG9 A;  5CGK A;  2B2T C;  3N6R A;  2CW0 D;  2D2C C;  1LUZ A;  1DOL A;  3QOJ A;  5JEA G;  1PMR A;  2F0N A;  1SJE D;  3VYR A;  1VQO A;  2A19 A;  2LXJ A;  2KJX A;  3ZJY C;  2ZM6 L;  1LAC A;  5IWA Q;  3J7A V;  1SDF A;  2A68 D;  3CCU A;  3QIA A;  1JWS D;  1Q1E A;  3S16 H;  1YNN C;  2R93 B;  2X6L A;  3A8K E;  1CHP D;  3QG1 A;  4K5W A;  4LUZ A;  2TSS A;  1UEA B;  4A93 G;  2UUB L;  2R93 G;  2YTY A;  4XDX A;  1SJH D;  3F2D A;  3RZD H;  1XPR A;  1RF2 D;  2ZTE A;  5EPJ A;  4ABN A;  1Q90 A;  2FIN B;  4CKC A;  1AEX A;  4NDX A;  4KKT A;  5IGD A;  2XSC A;  4JOI A;  2UXB L;  4DK1 A;  4JVZ A;  4DV5 L;  3WOF A;  1KXL A;  3DWA A;  3H3V I;  1LT5 D;  4A3G B;  3OPO A;  2NVY B;  2JK8 A;  3ONA B;  4OXP A;  4A3K G;  1GHK A;  4GOP A;  2RDF A;  5LMN Q;  3FPP A;  4X64 Q;  1YI2 A;  1WTH A;  1SXT A;  3HOZ B;  3HOW G;  3GTM H;  5C0X J;  1WTX A;  4LF9 Q;  4DFA A;  1HTL D;  1BCP D;  3AYH B;  1Y69 U;  1JOR A;  2XRS D;  1PYB A;  4FNF A;  4CJ2 C;  1E1O A;  5M3F B;  1HTP A;  1STE A;  3NUC A;  1LV9 A;  3A0J A;  4YHH Q;  4CDC C;  5IY0 A;  3CCQ A;  4DV7 Q;  4CKB A;  1Y1V H;  1C8C A;  2MO0 A;  2E2J H;  2EDG A;  4KMU C;  3H94 A;  1JOO A;  4XT1 B;  1EIY B;  2OEO A;  3SHL A;  1EY7 A;  4DR6 Q;  2RDG A;  1FL0 A;  4DR4 L;  1N33 L;  5C3X A;  2F0D A;  2RF4 A;  2ID0 A;  2CKZ B;  3RUZ A;  2JP1 A;  1T5E A;  2N88 A;  1LM0 A;  3I56 A;  2D0O A;  4LF5 L;  5D65 A;  2E5L Q;  1TR5 A;  1SNP A;  5DLQ E;  4LFA Q;  2B2Y C;  5GAH C;  4YHH L;  4DAY A;  4Q5V A;  2BDO A;  2QIL A;  1IHZ A;  3U9S A;  4DXG A;  3M3Y H;  1FJG Q;  5C5L A;  5EKK A;  1UE5 A;  1G6Z A;  2PMZ B;  5KGU A;  3PIP 3;  3KYH C;  4N8X 1;  3PO3 G;  1K83 B;  3Q6S A;  2CW0 C;  3EN2 A;  1QOH A;  1PFS A;  4V0B A;  5C4X B;  1VQN A;  1JWU D;  1FR3 A;  3I72 A;  2ZT9 C;  1N36 Q;  4JI3 L;  4LFA L;  4L8J A;  4KD4 A;  2ZXR A;  3CHB D;  3S1M B;  2KVM A;  1GKH A;  4RGN A;  4HCS A;  1AE3 A;  2AQ3 B;  1EY4 A;  3PF4 A;  2UXD L;  4GKJ L;  2ATW A;  4K14 A;  5C3E B;  2QEX A;  5IT9 E;  5M3M G;  1X3P A;  1YHQ A;  3ERO A;  2EYO A;  3HKZ E;  1LTT D;  2GVA A;  1TS4 A;  4DKA C;  4HJA A;  3RLO A;  4EQO A;  2Z6B A;  3EQL C;  1F9Q A;  3ULL A;  2NTT A;  3NEM A;  3I4N H;  2F0H A;  2DGY A;  5IGG A;  1K9M C;  4E6I A;  1H9S A;  1S72 A;  4JI6 L;  4DU9 A;  4X64 L;  3TP8 A;  1J9O A;  3S17 H;  4WJ4 A;  2WB1 G;  1MGS A;  3Q24 A;  3A8J E;  3WWV A;  1L0X B;  2F0E A;  2OWO A;  1IZ6 A;  1AZP A;  1Y8P B;  2R7F A;  3HOX H;  1MI2 A;  1NNX A;  1OXS C;  1S5F D;  4DV6 L;  2LY7 A;  4K5V A;  4IZ8 A;  2F0W A;  3TBI B;  2F0L A;  1HJP A;  4L5R C;  4GOP C;  1U4R A;  1PTO H;  3SK4 A;  1KD1 C;  3HOV H;  4CJ1 B;  3MAQ A;  2OF1 A;  5BN3 A;  1KIX A;  3RN2 A;  1EU3 A;  2MNA A;  1F77 A;  3A55 A;  4LJZ C;  3P7J A;  4C3J B;  1IYJ B;  3UDI A;  3J81 E;  3FKI B;  4LUO A;  1UUP A;  2Q2I A;  1LAB A;  4O0A A;  4JBK A;  2JA6 B;  3E9I A;  3UE0 A;  1VQ7 A;  5EGT A;  1LT6 D;  2KBN A;  2Z1C A;  1TWA B;  4KI0 A;  4YWM A;  1O78 A;  4UDU C;  1EIH A;  4NXN Q;  3C3L A;  1K0S A;  3TZD A;  3I70 A;  2ENB A;  4M8A A;  5C44 G;  5C44 H;  3PO2 G;  2N55 A;  4DR3 Q;  3DHQ A;  3U9O A;  1HR0 W;  3IAY A;  1CHQ D;  5EKI A;  5IYD H;  1NUC A;  3MC0 B;  5IT9 L;  4BA1 I;  2HQL A;  1RD9 D;  4YCV A;  4LF5 Q;  1B53 A;  1Q81 C;  5C0X G;  3S15 B;  3EJI A;  4ZRZ A;  5A35 A;  2CVR A;  3S9W A;  2MPM A;  1HNX Q;  1QVF A;  5GRO A;  1Y1V B;  3GV6 A;  1VQA A;  1TQO A;  1EOV A;  3F2C A;  1X56 A;  2CHB D;  3I3C A;  1RTO A;  3OWE B;  4BBS H;  2R92 H;  1O7I A;  4BA2 I;  4ODG A;  2JA7 H;  3MXP A;  4ZK9 B;  3T1Y Q;  1ET9 A;  4DR5 Q;  3I8Z A;  5JPM C;  2IX3 A;  1K0R A;  4H13 C;  3BS1 A;  1ILP A;  1R4Q B;  5LMU L;  3HOU H; 
#chains in the Genus database with same CATH homology
 4R8I A;  2EYL A;  2ICE C;  1CFM A;  1GUT A;  3KUP A;  3K5N A;  1OXX K;  2EPB A;  3FMC A;  1WTV A;  4R9W A;  2EYF A;  1KAA A;  1GXD C;  3NPP A;  3VA5 A;  4X3T A;  4ZQ3 A;  2MUY A;  3D8G A;  3E5S A;  3HKZ B;  3I91 A;  4OO1 H;  1GOZ A;  1WVL A;  1CTM A;  3TDQ A;  5C0X I;  3RMH A;  4FVM A;  1QG7 A;  2X69 A;  1GUG A;  4ZKB B;  2DNC A;  4F87 A;  4KY5 A;  1SYC A;  4A3M B;  4AYB B;  4N9P A;  1DXM A;  2PCF B;  3HZX A;  3K58 A;  3DM1 A;  1XTC D;  1KNE A;  1JOK A;  1SSO A;  4KTA A;  4DK0 A;  4FP5 D;  4RH6 A;  4TRD A;  4KY6 A;  1GUS A;  2EXZ A;  1DM0 B;  1EU4 A;  2A6E C;  4R8N A;  4DF7 A;  1F2Y A;  2EJG C;  1NCV A;  3KLS X;  3J81 L;  3RLF A;  3S1N B;  1M4V A;  1TY2 A;  3M85 A;  2F0F A;  1GJX A;  2G9D A;  2BOS A;  4O1N A;  2JXM B;  3KBG A;  2F0M A;  3Q23 A;  4K2K A;  2Y0S B;  2PQE A;  1PRT B;  3L9A X;  3A7A B;  4I7Z C;  3K5O A;  3DUZ A;  1F9S A;  5IGB A;  4J1M A;  3E6Z X;  1A3T A;  4K6D A;  3J7Y W;  1R9T B;  3DMU A;  3GTO B;  3OW7 A;  1IW7 D;  3D4D A;  1STH A;  1KLG D;  2HDL A;  4HSV A;  2JE6 I;  1JB3 A;  1PLF A;  1Q1B A;  2C5C A;  1LO5 D;  3PIO 3;  1H9J A;  5HGT A;  4RGM A;  1B9N A;  1ZKO A;  1TWF B;  1QCB D;  2HCC A;  4WJW A;  4FXD A;  2BE5 D;  2WII B;  2BA0 A;  5ELD A;  5CMD A;  2R92 B;  2F0T A;  3ND8 A;  4L6T B;  3CRL C;  1NR4 A;  4DAP A;  2KOL A;  5LL6 X;  3GTL B;  2D62 A;  4WFN 3;  5IGC A;  1ONL A;  1H9M A;  4IUV A;  4OO1 G;  1HUM A;  1I3Q B;  3HEJ A;  5DAU A;  5F2D A;  3R2I A;  5C3W A;  1PFM A;  4KY7 A;  2KHS A;  1II3 A;  2F3V A;  1E2W A;  4HAE A;  3KK7 A;  1I4R A;  3QB3 A;  2NZ1 D;  2NN6 G;  2FJ2 A;  2B63 B;  4BS9 A;  2KCC A;  1IKL A;  3NBH A;  2DY7 A;  2PO4 A;  1BO0 A;  1S5C D;  4K8I A;  3HRZ C;  4KKU A;  2D9U A;  3D6C A;  2RDH A;  2K04 A;  5CV8 A;  1CQV A;  4Z9C B;  1DD2 A;  2FFK B;  4XXE A;  1YNN D;  5CV7 A;  5FO9 B;  4XYQ A;  2KCN A;  2DN8 A;  4LMQ D;  2SOB A;  1HRJ A;  1PRT C;  3S14 B;  1SAP A;  5KEE A;  4A3J B;  3S2D B;  2F4I A;  2E76 C;  5EBC A;  3MFG A;  3OWF A;  3C46 A;  5EBD A;  2EE1 A;  1PTO B;  3NSW A;  2PZW A;  3O13 A;  5CC4 A;  3H09 A;  3MXU A;  4CKE A;  1B50 A;  3PUW A;  1SFO B;  1U9R A;  1B9M A;  3BVG A;  1SNC A;  2KA7 A;  5I6W A;  3CKI B;  1PZK D;  1BQQ T;  3URY A;  3D4W A;  1DON A;  4PNY A;  2WP8 J;  1TWH B;  4C2M B;  5JPN C;  1F2Z A;  5ELC A;  2K5D A;  3PUZ A;  4OIK A;  3T13 A;  3UI2 A;  5G3L D;  1WCM B;  4HMJ A;  1KDC A;  1V43 A;  1EIG A;  5KND A;  1LTB D;  4J6H A;  4X3S A;  1Z7T A;  1CZG A;  5C4Z A;  4V19 0;  3OSO A;  1TY0 A;  2R7Z B;  2AQ1 B;  5ELB A;  3A56 A;  2F0I A;  4A3F B;  2VB2 X;  1SYD A;  1YNJ C;  1PTO F;  4TSS A;  4IUT A;  3HOX B;  4NW2 A;  4A3I B;  5IGE A;  3QJY A;  2HCI A;  2RBM A;  4MHE A;  3IKJ A;  3DWQ A;  1EYD A;  1AN8 A;  5FLX L;  2B8G A;  1SMY C;  4ULL A;  1DOM A;  3I4N B;  1JCK B;  1UAP A;  4BWG B;  1Q12 A;  3NTH A;  3K6O A;  4HN7 A;  1SE3 A;  2ICI A;  3MWY W;  1TVX A;  2AQ2 B;  2BE5 C;  1C4Q A;  2JA7 B;  4FF4 A;  4JK1 C;  3VR2 A;  1EL0 A;  2HDM A;  2NVT B;  5EQ0 A;  1QNU A;  1SYF A;  4QUC A;  2VB3 X;  1EWH A;  3NTK A;  3L3O C;  3FPU B;  2L12 A;  3I4M B;  2MHV A;  5CV6 A;  4BY1 B;  2IW3 A;  5BN5 A;  2AWO A;  3L7Z C;  3VR6 A;  5FOB B;  2XWJ B;  5D3D A;  5KNB A;  1RCV D;  2YYZ A;  4K2L A;  4NKL A;  1GHJ A;  3PV0 A;  1VCI A;  4O42 A;  5EKL A;  2EYM A;  1QE6 A;  2O5I C;  1GUN A;  3LNN A;  3F2U A;  3NBI A;  3TP7 A;  2E2H B;  4C56 C;  1KDB A;  3BZD B;  1I4Q A;  3C1E A;  1KLU D;  4RFB A;  1JIC A;  2M9V A;  1DYQ A;  4XQN A;  2B2W A;  5G3L F;  1KTK A;  2PZU A;  2R61 A;  5E4X A;  1TS2 A;  3K7A B;  4G7Z C;  5ISR A;  4QCL A;  3BG3 A;  3TSS A;  1XX8 A;  4FO2 A;  1BXT A;  3FVQ A;  3QO2 A;  3AU7 A;  3I4L A;  2RSN A;  3QOL A;  2XN9 C;  5E3F A;  2IX0 A;  4EGV A;  1I6V C;  2LS0 1;  3V96 A;  2WAQ B;  5KIX A;  2SDF A;  2K03 A;  1HA5 A;  4IFD G;  4B9X A;  5IOC A;  1STN A;  2PW7 A;  5KRU A;  4U68 A;  4CJ0 B;  1EY9 A;  5J22 A;  1QJO A;  4OL7 A;  2PZT A;  4ZUI A;  1D1I A;  3OHX C;  1Q8I A;  4IFD H;  2A6H D;  5DNF A;  4HED A;  2SNM A;  1CM9 A;  4HR7 B;  5M5W B;  3I90 A;  4B08 A;  1I4H A;  4KHV A;  1BCP B;  4TKO B;  3G6J B;  2WKD A;  2D5D A;  5AFW A;  1LLR D;  5D3I B;  2F1M A;  3G7L A;  5JOB A;  5M5X B;  3MTS A;  2VUM B;  1EZ6 A;  3Q22 A;  4ILW A;  1QNK A;  5EPK A;  4FF3 A;  1SNQ A;  3H0G B;  2HUG A;  3DXJ C;  4OO1 I;  1PZJ D;  3SE0 A;  2O4X A;  1I6H B;  2XVS A;  3VR5 A;  1VF7 A;  1BCP C;  2GA4 B;  3NE5 B;  3HP3 A;  3ERQ A;  1KDA A;  1QIL A;  1D5X C;  3P1H A;  4C3H G;  2Z4I A;  4KV6 A;  4RKB A;  5FO8 B;  1TWC B;  2H4O A;  2J4X A;  4N9T A;  3D6W A;  1AFP A;  2EOT A;  3KF8 A;  1A6X A;  2K32 A;  1SNM A;  1EQT A;  1DCZ A;  4HCE A;  3HS0 C;  1RHP A;  1DOK A;  1D5Z C;  4J8Q A;  4DNT B;  3C1F A;  2J7Z A;  2V4D A;  5DM6 3;  2K5W A;  3BYY B;  1HHV A;  2F0O A;  4H44 C;  5C5M A;  3HOY B;  3H3V C;  2F0G A;  3OMG A;  1EY0 A;  1STG A;  4F8M A;  3I73 A;  1EYA A;  3LX0 A;  3KLS A;  1SMY D;  1R4P B;  3T4A C;  4IQZ A;  5C0X H;  2L5T A;  1WD0 A;  1IYU A;  3VR4 A;  4IAL A;  3K5M A;  5ELE A;  1OXV A;  1F2L A;  3EVQ A;  5KYL A;  2QDB A;  4EQN A;  2JEB I;  4XQQ A;  4ZLT F;  4FXK C;  1K8O A;  1U4M A;  4XIG S;  4HSP A;  4RHS A;  3S1R B;  1DZ1 A;  1BBX C;  1Z6H A;  3D3R A;  2XWB B;  5FKA C;  3GO5 A;  2FHT A;  3LWU A;  1XXG A;  5CYU A;  4FXG C;  2EY1 A;  4WOR A;  1D5M C;  2MGS A;  4CBV A;  5CBE E;  2R6G A;  1I50 B;  2IPK D;  4BBR B;  3S1Q B;  2SNS A;  4MN3 A;  2RA4 A;  4RHR A;  4XYO A;  1RTN A;  1IKM A;  5LL6 S;  5K36 G;  2EYJ A;  3GV3 A;  3MXN A;  5C6A A;  2XIW A;  1HFG A;  1Z47 A;  4A3B B;  3GTG B;  1EEF D;  1X3Q A;  2XNA C;  1CT1 D;  1FGB D;  3LWE A;  5IGF A;  1ZXT A;  5JVH 3;  1ESF A;  1S4Z A;  3JAM E;  3VYT A;  3K0Y A;  1S5E D;  3M4O B;  1PTO D;  2EYP A;  1VF5 C;  1WD1 A;  4PMW A;  1LTR D;  2F0S A;  1OXU A;  2O5J C;  3IL8 A;  1STB A;  1U4L A;  1STA A;  3HOV B;  1F9R A;  1CA5 A;  1A15 A;  4C3H B;  3NXW A;  1A2T A;  2PNR C;  4CHT B;  4KD3 A;  2EYH A;  3CQZ B;  4MIU A;  5JEA J;  3GTM B;  1BOS A;  2OXP A;  1EOT A;  2WKC A;  4IUU A;  5CV4 A;  3SK6 A;  3J80 L;  3MFY A;  2A5H A;  4QMG A;  4Q0F A;  4KJN A;  1A3V A;  1EFI D;  1SYB A;  4WRD A;  3S2H B;  1O7Z A;  2F0Q A;  3GTK B;  4ME5 A;  1GUO A;  1JR0 D;  5CV9 A;  4CGY B;  4K5X A;  1A3U A;  4DN4 M;  1SNO A;  3BVZ A;  1HQR D;  1GUW A;  1ZEQ X;  3PO3 B;  1EY8 A;  2J0T D;  1D2B A;  2NTS A;  3T16 A;  4RGO S;  1FD7 D;  2QKI C;  2NWG A;  2ZXO A;  2B2U C;  2A73 B;  1LT4 D;  2IT1 A;  4H0L C;  5K36 H;  1QWY A;  4FYD A;  5C4H A;  1AZQ A;  1JC7 A;  4C3J G;  3K5L A;  3K59 A;  2KUM A;  2RSO A;  2LMC B;  1ROD A;  3D31 A;  2KEC A;  4ZYS A;  4RGT A;  4ID6 A;  1PTO C;  1J8I A;  4IN3 A;  2PYK A;  2JA5 B;  2EY6 A;  1L0Y B;  2B2Y A;  3S17 B;  4RA8 A;  1ENA A;  5T1G A;  2M2L A;  1W6K A;  1AP0 A;  3J80 E;  1RJT A;  3VA7 A;  3C2P A;  2B2W C;  3NHH A;  2F03 A;  1ENF A;  3KBX A;  2EJM A;  4OHJ A;  3VYS A;  5JVG 3;  5CBA E;  4NP5 A;  1G2T A;  1H9R A;  3GTJ B;  3RZO B;  3SXH A;  2K05 A;  1IW7 C;  5IIF A;  3OOC A;  4DNR B;  4IUN A;  5I9O A;  2RKS A;  2QEJ C;  2NB0 A;  1O7L A;  5CR3 A;  3V05 A;  4DAV A;  1LT3 D;  5I2X A;  1PXU A;  3FRP B;  2L55 A;  3CRK C;  1ENC A;  4KK7 A;  4EVO A;  1H9K A;  2ZXP A;  3HOW B;  2G9H D;  3BDL A;  4IUP A;  4PV1 C;  4GZY C;  2Q8R E;  3N52 A;  1CI3 M;  2B39 A;  3NK9 A;  5COR A;  2OT2 A;  2IJ0 A;  2L1B A;  4TQU S;  1Y8N B;  1PYW D;  1KAB A;  2WIN B;  4ZUJ A;  1VMP A;  2LFN A;  2F0V A;  2WAC A;  2FMM A;  1FNU A;  3DWP A;  2JEA I;  2MP1 A;  5FK9 C;  2IWH A;  1UNS A;  1HA6 A;  2B2V A;  2K5Q A;  1O80 A;  3TME A;  1D6E C;  5J39 A;  3J7A F;  1B2T A;  5E4W C;  4X3K A;  1BR9 A;  3WDN A;  3PMF A;  1G8Z D;  3MA2 B;  4F7X A;  3ITP A;  1HXY D;  5I2Y A;  2F0U A;  4RAU C;  1SBB B;  3T51 B;  4KJO A;  2A69 C;  4G7H C;  3MEH A;  1V1P A;  3IFT A;  1PRT D;  2JSO A;  2Z8L A;  1Q3L A;  3TP6 A;  4G7O C;  4RWS C;  1LTG D;  2EVB A;  3DEP A;  1C48 A;  1V1O A;  4XT3 B;  1IYV A;  2Q8I B;  1HUN A;  2MJ8 A;  4ZAI A;  2DNE A;  5KYI A;  1V1P B;  4OGQ C;  1H9S B;  4BY7 B;  3VYU A;  4RKL A;  1NSN S;  1S5B D;  1RKN A;  5T1I A;  3NQI A;  1TWG B;  4KN7 C;  1Y8O B;  3SK5 A;  2EY5 A;  1LTI D;  2E2J B;  1B4O A;  2Q8T A;  1T5X D;  1PDQ A;  5E1F A;  2I07 B;  3RD4 A;  2RVL A;  4XTC S;  1EEI D;  1MBY A;  4FF2 A;  3M7G A;  5COY A;  1K8M A;  3R93 A;  2H1E A;  5D14 A;  3NWT A;  1E0B A;  1YNJ D;  1E2Z A;  2NN6 I;  1WTP A;  1SE4 A;  3R2T A;  2YU9 B;  4IFD J;  4A3E B;  2EJF C;  4DXF A;  2FMC A;  1ET6 A;  3M3Y B;  1I4X A;  3AB9 A;  1ICW A;  3BVM A;  1JOQ A;  3CU7 A;  4A3D B;  1TS5 A;  3H91 A;  1FNW A;  2K7V A;  1CA6 A;  1V8Q A;  3EFX D;  3MXG A;  1MSG A;  4A93 B;  4L63 B;  1G91 A;  5ELF A;  2L9H A;  5C4J B;  5TSS A;  4PQX A;  3GTQ B;  2F0P A;  5DEH A;  1CZW A;  3R8B A;  1B1Z A;  1PZI D;  2I46 A;  1ESR A;  2QF7 A;  2JA8 B;  3PUV A;  4I65 A;  2EZV A;  4LAA A;  2VNU D;  1BF4 A;  1MD2 D;  1D1K A;  1F9P A;  2EY2 A;  1XWE A;  2BDN A;  5M9O A;  3GTP B;  4EQP A;  4C3I G;  2WB1 B;  4P2C B;  5C44 B;  5KNC A;  1CQF A;  1S5D D;  4OIJ A;  4HMI A;  3T56 B;  2E74 C;  1DJR D;  5IOD A;  1JQY D;  5BN4 A;  2NYZ D;  1A2U A;  5A2Q E;  3ZYY X;  2C9O A;  3P20 A;  1W6J A;  2K01 A;  3PUX A;  4PMB A;  4ZKC B;  4QF4 A;  1NR2 A;  2CQA A;  3HGB A;  2L0C A;  2A6E D;  2K33 A;  1BDO A;  4KHZ A;  3GD7 A;  4G4K A;  3HOU B;  4QB4 A;  3W2D A;  5FO7 B;  2KQ3 A;  3NTI A;  3R3O A;  1EY6 A;  1TU2 B;  3X3M A;  5M5Y B;  1BNZ A;  2A74 C;  1PFB A;  1Y1W B;  1G2S A;  4YIJ A;  2PPB C;  2AUJ D;  1VMC A;  1STY A;  1U4P A;  3DEO A;  3PUY A;  3SR1 A;  5JAV A;  1TS3 A;  2AWN A;  3NQT A;  3FDT A;  5LHY 1;  2TMP A;  4QUF A;  1SE2 A;  4K8J A;  1AW7 A;  1VDZ A;  3P75 A;  2SEB D;  2B2V C;  2JYO A;  4IUR A;  2NBF A;  4NMZ A;  2L4N A;  5I4D A;  1I4P A;  4C1N I;  1EZ8 A;  4XQJ A;  2O2L D;  4X3U A;  3K57 A;  1SYE A;  3ND9 A;  1M8A A;  5A2Q L;  2R3Z A;  3MZ5 A;  1G29 1;  3TN2 A;  1HQM C;  3BDO A;  1SEB D;  4M1U B;  4JBW A;  2KED A;  1RDP D;  1HFN A;  3BYT B;  2VXW A;  1XYI A;  2XRQ D;  1WTO A;  2A68 C;  1LTS D;  1HCZ A;  3WOE A;  1ZYR C;  2B2U A;  2PW5 A;  4IUQ A;  4RCN A;  3VR3 A;  3A8I E;  3V2T A;  4KKS A;  1WTQ A;  5M3M B;  2F0J A;  3BDC A;  1FYC A;  1F2M A;  5DM7 3;  1EQV A;  3GP7 A;  5I6Y A;  4H7B A;  5CV5 A;  1MSH A;  2IX1 A;  3SEB A;  2E75 C;  3EA6 A;  3H6M A;  3TP5 A;  1IL8 A;  1CK1 A;  3SVM A;  1X32 A;  2B2T A;  2X6G A;  5JEA H;  2M00 A;  4QIW B;  3TZU A;  5FLX E;  1PFN A;  3FEW X;  2F0K A;  4UAI A;  5NUC A;  2E2I B;  1E2V A;  2E2D C;  1SYG A;  2BCO A;  2NN6 H;  4FF1 A;  4S3S A;  5EPL A;  5I9P A;  3X3N A;  3MVV A;  2K28 A;  4LK1 C;  2NUC A;  5HUR A;  1EYC A;  3OIP A;  4KN4 C;  3A7L A;  1BUV T;  1NAP A;  4Y7N B;  4K6L A;  2HQE A;  2K1B A;  4DA2 A;  2KEE A;  1B44 D;  1SND A;  3JAM L;  1BCP F;  3GQB A;  1O7Y A;  2BA1 A;  3M7N A;  3PO2 B;  3MHB A;  4RCO A;  3RZD B;  1WTW A;  3NP8 A;  2QCP X;  3M4Y A;  2IL8 A;  1WTR A;  4C1N K;  2L11 A;  5EJW A;  1B3A A;  4BBS B;  4DGZ A;  3SDZ A;  1JE4 A;  1EY5 A;  3S16 B;  3Q0A A;  3D4R A;  1ZYR D;  3E0J A;  4A3K B;  1FNV A;  3KLR A;  1OXT A;  4U67 3;  2F3W A;  1QB5 D;  2Z4H A;  1ML0 D;  2RQX A;  2B8F A;  3SK8 A;  1KNA A;  1I4G A;  3W3A A;  4IFD I;  4C3I B;  3A54 A;  3OIQ A;  3NWS A;  2K6A A;  5JJZ A;  1TII D;  1HPC A;  3OMC A;  2NVX B;  1TT2 A;  1PRT F;  1JWM D;  3IFD A;  4G57 A;  3QWN A;  3AMU A;  4HTH A;  4B9W A;  5J1Z A;  2LKV A;  1TKW B;  1ILQ A;  4PMC A;  3T53 B;  2WV6 D;  5K5P A;  1LTA D;  4F88 A;  2A6H C;  1EWC A;  2AUK A;  2A69 D;  1OO9 B;  2DY8 A;  2NVQ B;  3HG9 A;  5CGK A;  2B2T C;  3N6R A;  2CW0 D;  2D2C C;  1DOL A;  3QOJ A;  5JEA G;  1PMR A;  2F0N A;  1SJE D;  3VYR A;  2KJX A;  1LAC A;  3J7A V;  1SDF A;  2A68 D;  3QIA A;  1JWS D;  1Q1E A;  1YNN C;  2R93 B;  2X6L A;  3A8K E;  1CHP D;  3QG1 A;  4K5W A;  2TSS A;  1UEA B;  4XDX A;  1SJH D;  1RF2 D;  5EPJ A;  4ABN A;  1Q90 A;  2FIN B;  4CKC A;  1AEX A;  4NDX A;  4KKT A;  5IGD A;  2XSC A;  4DK1 A;  3WOF A;  3DWA A;  1LT5 D;  4A3G B;  3OPO A;  2NVY B;  3ONA B;  1GHK A;  2RDF A;  3FPP A;  3HOZ B;  1SXT A;  5C0X J;  1WTX A;  4DFA A;  1HTL D;  1BCP D;  1Y69 U;  1JOR A;  2XRS D;  4FNF A;  4CJ2 C;  5M3F B;  1HTP A;  1STE A;  3NUC A;  1LV9 A;  4CKB A;  1C8C A;  2EDG A;  4KMU C;  3H94 A;  1JOO A;  4XT1 B;  2OEO A;  3SHL A;  1EY7 A;  2RDG A;  5C3X A;  2F0D A;  2ID0 A;  3RUZ A;  2JP1 A;  1T5E A;  2N88 A;  5D65 A;  1TR5 A;  1SNP A;  2B2Y C;  4DAY A;  4Q5V A;  2BDO A;  2QIL A;  1IHZ A;  3U9S A;  4DXG A;  5C5L A;  5EKK A;  1G6Z A;  2PMZ B;  5KGU A;  3PIP 3;  1K83 B;  3Q6S A;  2CW0 C;  1QOH A;  4V0B A;  5C4X B;  1JWU D;  1FR3 A;  3I72 A;  2ZT9 C;  4L8J A;  4KD4 A;  2ZXR A;  3CHB D;  3S1M B;  2KVM A;  4RGN A;  4HCS A;  2AQ3 B;  1EY4 A;  4K14 A;  5C3E B;  5IT9 E;  1X3P A;  3ERO A;  2EYO A;  1LTT D;  1TS4 A;  4EQO A;  3EQL C;  1F9Q A;  2NTT A;  2F0H A;  5IGG A;  4E6I A;  1H9S A;  4DU9 A;  3TP8 A;  1J9O A;  1MGS A;  3Q24 A;  3A8J E;  1L0X B;  2F0E A;  1AZP A;  1Y8P B;  1MI2 A;  1OXS C;  1S5F D;  2LY7 A;  4K5V A;  4IZ8 A;  2F0W A;  3TBI B;  2F0L A;  1U4R A;  1PTO H;  3SK4 A;  4CJ1 B;  3MAQ A;  2OF1 A;  5BN3 A;  1EU3 A;  1F77 A;  3A55 A;  4LJZ C;  3P7J A;  4C3J B;  3J81 E;  3FKI B;  1UUP A;  1LAB A;  2JA6 B;  5EGT A;  1LT6 D;  2Z1C A;  1TWA B;  4KI0 A;  1O78 A;  4UDU C;  1EIH A;  3C3L A;  3TZD A;  3I70 A;  2ENB A;  4M8A A;  2N55 A;  3DHQ A;  3U9O A;  3IAY A;  1CHQ D;  5EKI A;  1NUC A;  3MC0 B;  5IT9 L;  4BA1 I;  1RD9 D;  1B53 A;  3S15 B;  5C0X G;  3EJI A;  4ZRZ A;  5A35 A;  2CVR A;  3S9W A;  2MPM A;  1Y1V B;  3GV6 A;  1TQO A;  2CHB D;  3I3C A;  1RTO A;  3OWE B;  4BA2 I;  4ODG A;  3MXP A;  4ZK9 B;  1ET9 A;  3I8Z A;  5JPM C;  2IX3 A;  4H13 C;  3BS1 A;  1ILP A;  1R4Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...