1RCVD

Cholera toxin b-pentamer complexed with bivalent nitrophenol-galactoside ligand bv1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonspanning bivalent ligands as improved surface receptor binding inhibitors of the cholera toxin B pentamer.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
molecule keywords cholera toxin B protein (CTB)
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rcvD00
4DXFA 1I4PA 1I4XA 1HQRD 1PRTC 1PTOH 1I4GA 5ELDA 2J4XA 1I4QA 1RF2D 1JQYD 1EU4A 3BVMA 1LTSD 3BVZA 1DYQA 2IJ0A 1TY2A 1FNWA 1KLUD 3BVGA 1PZJD 1CHQD 5D3IB 2TSSA 1ET9A 4L63B 2O2LD 4RGTA 2AQ1B 1JCKB 1L0YB 1TY0A 1UNSA 1UUPA 1FNVA 1S5CD 1V1PA 5FKAC 1V1OA 4RHRA 1BCPF 1I4RA 2AQ3B 1BCPD 3URYA 3CHBD 3O13A 4K6LA 4RFBA 1EWCA 1BXTA 4BWGB 4UDUC 1PRTD 1CHPD 1ET6A 4C56C 2G9HD 1PZKD 1I4HA 2SEBD 1S5BD 1B44D 1LO5D 1TS3A 1LTBD 1PYWD 1PRTF 5ELBA 1EFID 1LTTD 4O1NA 1PTOB 1V1PB 3MFGA 2ICIA 2XN9C 1EU3A 1FGBD 2QILA 1LTRD 3GP7A 1QILA 1SE2A 1KLGD 1RDPD 3DWPA 3EA6A 2WV6D 4OHJA 3W2DA 1PRTB 3KLSX 1SE4A 1LT6D 1PZID 2RDHA 1EEFD 3R8BA 1LTGD 3BZDB 1S5DD 1LLRD 3BYTB 1AW7A 1HA5A 1CQVA 3BYYB 1XXGA 1HTLD 5ELEA 3MC0B 1FNUA 1KTKA 1RCVD 1SEBD 1JWMD 2AQ2B 1STEA 1T5XD 4L6TB 4RGOS 2NTSA 1GOZA 1LT5D 1PTOC 1BCPB 1AN8A 1EEID 1B1ZA 2XRSD 4RHSA 3EFXD 1D5MC 4TSSA 1LT3D 4ZYSA 3DWQA 1JR0D 1TS2A 2IPKD 1D5XC 5TSSA 5D3DA 1D6EC 1PTOF 3SEBA 1RD9D 1CT1D 3V05A 1SJED 1FD7D 1LT4D 2Z8LA 2XRQD 2QEJC 1S5ED 1PTOD 1XTCD 3R2TA 1ENFA 2R61A 1TS4A 5ELFA 1SE3A 1SXTA 4RGNA 2RDGA 4Z9CB 3OWEB 1JWSD 1LTAD 1TS5A 1MD2D 1M4VA 3DWAA 1SJHD 3TSSA 4DXGA 5FK9C 1CK1A 4RH6A 5ELCA 1BCPC 2NTTA 1LTID 2XNAC 1DJRD 1JWUD 1ESFA 2CHBD 4RGMA 1L0XB 1G8ZD 1F77A 1S5FD 4RCOA 1D5ZC 1SBBB 1HXYD 3R2IA 5I4DA
chains in the Genus database with same CATH superfamily
5I9OA 1O78A 1PRTC 4G7HC 1EY7A 1L0WA 2VW9A 1CI3M 4HCSA 2F0SA 4GN5A 2F0PA 2HUGA 2Q8TA 1EOVA 2Y0SB 1A8VA 3J81i 5C44H 2WAQE 4A93G 5FKAC 2M00A 5EPLA 2A68D 3AQQA 5A2QL 1XMQQ 4LF5Q 4X3UA 1WCMB 4ALPA 2YU9H 2ES2A 3CHBD 5COYA 4DGZA 4X66Q 4IUPA 2K28A 5AFWA 4DPGA 3PO3B 1PRTD 1HHVA 4JI7Q 2F0DA 3PUWA 1D1KA 3PUXA 3V96A 5M5YB 2NVYB 2E74C 1C8CA 1KLGD 3DWPA 1MHWC 4DV4Q 2UXBQ 3KLSX 4AYBB 5JJZA 1HZ9A 3HOXB 1NE3A 3OTOL 1S5DD 1EUJA 3OSOA 2JA9A 1O7ZA 4YWMA 2C35B 5DM63 4RCNA 1VMCA 3HOVH 1AN8A 2AWNA 4NXNQ 2OTJA 2JYOA 1XYIA 1KXLA 4ZYSA 4NDXA 5IT9E 2JA5G 3K7AB 2B2VC 4ULLA 4EGVA 1JMCA 1J5EL 2BH8A 4DF7A 2K5WA 3HOXH 3GTOB 4A3DH 4DV2L 1EIHA 5LL6X 5EPKA 1PH2A 5CV6A 1B4OA 3OWEB 2X69A 4HTHA 1SJHD 4CDFC 3KLSA 4FO2A 2KA7A 3D4RA 3AEVA 2EJMA 1Q7YC 2Z0SA 1I94L 2CHBD 4RGMA 1EQRA 3K7AH 3QO2A 1STHA 1DOKA 5JEAH 2R92G 3GTOH 4A3DB 4FF3A 1YJWA 3H3VH 1I4QA 5JVG3 4DV0Q 2F0GA 3LWEA 3VR2A 1I50H 4L63B 4A3FH 2RCFA 4IFDJ 2HQLA 4F87A 2J7ZA 4KK7A 1NCVA 2MO0A 1K9MC 4OWTB 1BCPF 5IGCA 5C4XG 3RMHA 1VQKA 3KFUA 1IXRA 1JC7A 2A5HA 4A93B 2VQEQ 1H9MA 1BKBA 3AB9A 2K33A 2G9HD 2F0MA 1SNPA 3E3XA 2M2LA 1HNZL 2KEEA 1MIUA 1O7IA 3NXWA 4GOPB 3NTKA 3GTJH 4APVA 5D65A 1YIJA 1QWYA 4IFDG 2EE1A 2MPMA 1LTRD 2YU9B 1N32L 2LSSA 1I50B 4XYOA 2MGSA 4XT3B 2PMZE 1LYLA 2GVAA 3I72A 1NY4A 3M4OH 1LLRD 2PNRC 4YCVA 4B3SQ 5ELEA 2R92H 2R7ZG 4A93H 1FNUA 4GNXB 1IKMA 1XPOA 1BBUA 3H3VC 4ZUIA 5C3EG 1PTOC 3HG9A 3S2HH 1EY0A 4GOPC 3KJOA 1ML0D 5FLXL 4A3FG 1IW7D 5EAYA 4XTCS 1PYSB 3UE0A 3HFZB 4GOPA 1VCIA 1R9TH 4H0LC 4B3TL 1EWIA 1UEBA 2DGYA 2PO4A 1K3BC 3RLFA 4CKEA 3FMCA 1XMQL 1KD1C 3R2TA 3STBC 1YHBA 1C48A 3EQLC 3I3CA 4JI2L 2RSNA 1DZ1A 2K04A 4LF6L 5J39A 2F0JA 1JWSD 1LACA 4EVOA 2EDGA 2RBMA 4K2KA 5IOCA 2N49A 2B3GA 1GVPA 3S2HB 3PMFA 3S1NB 4HJ5A 2NTTA 4OEMB 3WOEA 2Z4IA 4DUYQ 3F2CA 1ESFA 3HOYH 4K8JA 1HNXL 2A69D 3A56A 1RTOA 4JI3Q 1GKHA 2BA0A 3GTGH 3B6YA 2QCPX 5JOBA 1H9SA 3VR3A 1L1OA 3I7FA 5EPJA 4JI1Q 2UUCL 1I4XA 5GAGC 4DR1Q 2ZTDA 2TMPA 1MGSA 3BVGA 3CQZB 4Q0FA 2XWBB 4OL7A 5EJWA 2K01A 5D3IB 3MXNA 1SFOB 3TEHB 4DV1L 4JV5L 4A3DG 2DNEA 3J7YW 2RA4A 3ULJA 3M7GA 3GTKH 4RHRA 4FXGC 2UUBQ 2A6HC 3S1NH 4DV3Q 1N36L 1TXYA 3HOYB 4UDUC 3K5LA 1JB7A 1QG7A 2CWPA 4PMWA 5C4JH 1CHPD 1PHJA 1P8LA 2UXBL 1DGSA 3KBGA 5ELBA 4AIMA 1N8RC 1L2FA 1RJTA 1TWFB 4DR2L 1KHIA 2K6AA 2JA6H 1MBYA 4KHVA 1AE2A 3M3YB 3BU2A 1PRTB 1SE4A 4R8NA 2NUCA 2JP1A 2IT1A 4ODGA 1VQDA 3U9SA 1SNQA 4CBVA 3ER0A 5BN4A 2F0QA 2VUMH 3DEOA 4DU9A 5I6WA 1AH9A 5CYUA 2B63H 3D31A 3OMCA 5C3WA 2YTXA 2E2HH 2QA4A 2AQ2B 4KI0A 4LW1A 3ERSX 4R4OA 1E7ZA 3J81L 1SSOA 2A74C 1SYEA 1HH2P 1Y8NB 4C3IG 1PFBA 5D3DA 3S9WA 4DV0L 3CU7A 1CZGA 3KK7A 3I4MH 1RHPA 3KLWA 3M4OB 2WB1E 1XMOL 4K5VA 3K81C 2KCTA 2Z8LA 4DR7Q 2YYZA 1QUQA 5CV9A 4KD3A 4BY1B 5KEEA 1Q1EA 1GUSA 1Y8OB 2J0TD 5EQ0A 2B2WA 2VS1A 3VA7A 1SROA 4IFDI 4A3IB 2RVLA 2DY8A 1YNND 2ZXRA 3LWUA 2EJFC 3NWTA 2OF1A 2ZXPA 4LF9Q 2BH2A 5I9PA 2IY5B 2NZ1D 1Y69U 2N88A 1H95A 1Q8KA 4ZLTF 3GDEA 4AYBE 5IGBA 3OW7A 1JJGA 1IKLA 2FMMA 1A3TA 1GHKA 4J8QA 1VS0A 2PZUA 1WTPA 4NXMQ 5IYCG 4G7OC 3MEHA 1IHZA 1HR0Q 4PZ6A 4ZQ3A 5C5MA 2M9VA 3Q6SA 2K5HA 1B70B 1F9QA 1V1OA 2HT1A 3MA2B 4A3IH 5M3MB 1STBA 2H4OA 1C0AA 1F2YA 4ZUJA 5IYBG 2O4XA 4DV5Q 3C46A 1IL2A 1E3PA 4QIWB 4DR4L 3RR5A 1TWHH 3SXHA 1LO5D 1F2LA 1TS3A 1X54A 4N8FA 2F0FA 1PRTF 4P74A 4CDEC 3VYUA 3HOZB 2O5JC 2DY7A 4N9TA 3CF5A 5FOBB 1DM0B 2BDOA 1NR4A 4GS3A 3T1YQ 1MI2A 4XQJA 3CC2A 5JJLA 1PZID 1VQ9A 5GROA 3MWYW 5C4XH 1GM5A 4AQYL 2JA8G 4K14A 1KTKA 4I7AA 1JWMD 5IGEA 2CWAA 1LT5D 1B1ZA 4JVZA 3S2DH 3M3YH 4TSSA 3ULLA 4WRDA 1TS2A 1Q3LA 1Y8PB 4NB3A 2EQSA 4KMUC 5M3FB 2N3SA 2XWJB 3NK9A 4KN7C 1PH6A 3U50C 2Q8RE 1PFMA 5C3XA 1B7YB 1KRSA 2H5XA 2SNMA 1C4QA 1KL9A 3I4NB 4OO1H 1UWVA 3ERQA 1KC8C 4BXXH 1PVOA 3G7LA 4KN4C 5C44B 1F9PA 3AMUA 1WTOA 5BR8L 1JICA 1XWEA 4JCVE 1XPUA 4IJHA 1DJRD 5K36G 1OXVA 1E2WA 2VL6A 4A3IG 5JPMC 4RAUC 4YY3L 2JE6I 1PV4A 2D62A 4L5TA 1F9SA 3T56B 2KECA 1WI5A 3NQIA 1K0SA 1RTNA 1Y1VH 2NB0A 1DYQA 2MO1A 1TY2A 2PPBC 1YITA 2LMCB 1QNKA 4OIKA 1JB3A 4GLVB 2O2LD 4XQQA 1Q86C 1ZKOA 1HNWL 1JCKB 4DNTB 2B39A 1WTQA 1DCZA 3GV6A 1M1KC 1SYGA 4POFA 2JA5B 1U0LA 3H94A 3URYA 3HOUG 1A62A 4K6LA 1YVCA 3SK4A 5FO8B 1QCBD 1ET6A 3H3VI 1KRTA 4C3IH 4OX9L 1OTCA 4DV7Q 1A0IA 4HCEA 1V1PB 1AFPA 1F2ZA 3P75A 1L1OB 4G57A 2JK8A 1ICFB 3NTHA 1NAPA 4DR3Q 2D5DA 2IHFA 2L55A 2SOBA 3PF4A 5IYCH 2JA5H 3JAMi 2B2UC 5E3FA 4HSPA 1EFWA 1D2BA 3OTOQ 1X56A 1X3QA 3CCJA 5IYDH 4QF4A 5E7NA 3DLLA 1JJCB 2NVXB 4IURA 1E22A 5L37A 1SMYD 5F2DA 5GAEC 3CPFA 1XNQQ 4X6AH 2F4IA 1EY6A 4DA2A 2L1BA 3HP3A 1WVLA 2CH4W 2F0WA 1HZBA 4K0KQ 5C4XB 1I3QH 5C4ZA 3HOWG 1YI2A 3N52A 4DNIA 1LTLA 2JEAI 1Q46A 2GA4B 4FF4A 1IYJB 2K05A 3K7UC 4KJOA 2WKCA 3OIPA 4QMGA 2EXZA 3J81j 2AKWB 5IODA 1HFNA 2RQXA 5IP9G 1K8MA 3S15H 5M3FH 4JW0A 4QJFA 1K3RA 3A8IE 4PV1C 5EBDA 3A7AB 1JORA 1F77A 4JI5Q 3ICEA 4GZYC 4R4TA 3PIPA 1G291 3BDCA 1EYDA 3I4NH 3C1EA 4RA8A 1NR2A 1I4PA 1EQQA 2DN8A 1HQRD 3GTJB 1QOHA 1NSNS 1U4RA 3FP9A 5ELDA 4GKKL 2ICEC 2NVQB 2K4KA 4MIUA 3D6CA 1KLUD 1PZJD 1O7LA 4DUZL 3FHWA 1ET9A 4P72A 3UE1A 3RLNA 1L0YB 1BVSA 3PV0A 2HDLA 4BBSB 5EBCA 3OOCA 1G2TA 1EY4A 2L0CA 1EWHA 4YY3Q 4RFBA 1T9HA 3PUYA 4TRDA 4Y7NH 1XJVA 2B2TC 3D8GA 3G6JB 3M85A 3G48A 3MHBA 4C3JH 2PYKA 5E4XA 1IBKL 1P16A 4I65A 1BO0A 1LTBD 1PYWD 4UAIA 3W1GA 4GKKQ 2R3ZA 3CXCA 1HRJA 3D0FA 3NPPA 1QILA 1WCMH 4A75A 1RDPD 1B9NA 3E0EA 3HKZB 4JBJA 1EYCA 4J1MA 3PO3H 5KYIA 3BZDB 4JI6L 3BYTB 5LL6S 3TDQA 3J81E 4Y7NB 1EQVA 3KUPA 4RGOS 1ESRA 1D8LA 1V9PA 1VQAA 1WD1A 4IUNA 5C0XH 4QGUA 2VY3A 3PF5A 1D5MC 5I2YA 3G6EA 1WTHA 1D5XC 4LFBQ 4FXKC 3EVQA 1BBXC 4KJNA 3CCLA 4JI3L 2OQ0A 2BE5C 2IW3A 1Y14B 4NMZA 1PH1A 1S5ED 5EKIA 1EZ8A 5IGGA 3A54A 2NVXH 2NVTH 1AEXA 2KVMA 3ND9A 1Z6HA 2RSOA 3NSWA 3TREA 2VQFQ 1EYGA 2PZTA 3QWNA 1ZEQX 4Q5VA 1YZ6A 4JI8Q 2EJGC 2B2YC 1CK1A 4L8JA 3TRZA 1XX8A 3RD4A 5KNDA 2BOSA 2NZOA 3DXJC 3K5MA 2WINB 1H9JA 3TP8A 3NBIA 5ELOA 4LF8L 2PCFB 1VQNA 4DR3L 3CRLC 4R9WA 5KIXA 1LABA 2Z6KA 2NVTB 1UE7A 3GTLH 1VQEA 1GUOA 3M4YA 1CTMA 3TZDA 5JEAG 5HURA 2CFMA 4OO1G 2A6HD 1TY0A 4LF7L 3I4OA 2A68C 2EOTA 4JI7L 2BDNA 1FJGQ 3KLRA 1WTXA 1ONLA 2A19A 4KHZA 4R4IA 1JT8A 5G3LD 3OW2A 4JYAQ 1BXTA 4HIDA 2NVQH 1EY9A 2AHOB 2KHIA 1QE6A 4PG3A 5GQOA 4KHPQ 1S5BD 3R93A 4JBKA 1E24A 1I5FA 4CDDC 2Q2TA 3H09A 2Q2IA 5HY6A 3NHHA 4MZ9A 4DUZQ 2UUCQ 1QJOA 4X65Q 3I4MB 3GP7A 2VXWA 4RKLA 1CKMA 5IYBH 4R4CA 4BY1H 1A6XA 1ENAA 4JG2A 2EYMA 1J5EQ 1EIFA 3K5OA 4A3MB 1N33Q 3F2DA 1N32Q 2PNHA 2D0OA 3BJUA 3F1ZA 3QR8A 3JAML 4X64L 1SR3A 1LT3D 1GHJA 2B29A 2K5QA 3L2PA 2B2VA 3FPPA 1QUQB 1Y1VG 4QY7A 1QVFA 2K14A 3CMAA 2XGTA 2VB3X 5CORA 2R92B 2QEJC 3ULPA 1PTOD 2L4NA 4A3BB 4JI6Q 4B9XA 2R61A 2DJGC 3PUZA 1GUTA 3QG1A 2HCIA 1XNRQ 1CSQA 5C4HA 3DWAA 4A3MH 1HA6A 4LFAQ 4LK1C 4LUZA 4E6IA 5AJ3Q 5JVH3 2JA7H 4WORA 2K7VA 1SNMA 1JWUD 1FVIA 1BBWA 4H44C 5C5LA 4HJAA 1D5ZC 1BUVT 1FNVA 3MVVA 5I4DA 4IOCA 2OWOA 3FKIG 1JOKA 4A3BH 1QNUA 3HOZH 1RF2D 5DEHA 3PO2B 3E5SA 3OIQA 4ZCKA 2K52A 4JPBW 1H9RA 4JI8L 1ZYRC 5DLQE 3K58A 2CH4A 1GUNA 2EYFA 2KCMA 4DK0A 1C9OA 4K2LA 2HHHQ 1GXDC 4YWKA 1G2SA 2E76C 2VNUD 3TP7A 2F52A 5C3EB 1G6PA 3OYYA 2JN4A 3QJYA 1LUZA 3CQZH 3FVQA 4OWWB 4B3ML 2SEBD 5DNFA 2KENA 1VQ8A 4FXDA 1CM9A 3NBHA 1K8GA 4IN3A 4R8IA 3GTKB 3PO2H 2KOLA 4L5SA 2OCEA 1SE2A 4PMCA 1A2TA 2WV6D 4OHJA 2AMCB 4OGQC 4FF1A 4PMBA 3Q24A 1LTGD 1JOQA 2B2UA 4OXPA 3CC7A 2KHJA 4XIGS 1E2ZA 5KNCA 1T5XD 3H0GB 3MXGA 1X3FA 3CCQA 2WAQB 2XRSD 4RHSA 1D7QA 3DHQA 1Q12A 4H7BA 4HIOA 4JI1L 4A3MG 4C2MH 5E4WC 1PTOF 2VUMB 1CT1D 2EY5A 4JI5L 1DD2A 2V4DA 3LX0A 3CP0A 4FVMA 2F0OA 3T1YL 1NNXA 1Y1VB 3KYHC 4YWLA 1WOCA 2PQEA 5ELNA 1UE5A 1N36Q 2K32A 4O0AA 2IX1A 2N8NA 3D4WA 3J7AV 2B2TA 4G7ZC 3S17B 4ZKCB 4DXGA 2JEBI 4GNXA 4KHPL 4DR2Q 4BY7G 3F2BA 1VQFA 4RH6A 4OIJA 4UPAA 4IUQA 2Q8IB 1SNOA 1L0XB 4KY7A 3HOWH 2RHQB 2Z6KC 3DM3A 5FJ8G 2E5LQ 1SMXA 3HKSA 2QGQA 1U4PA 4F88A 5FLMG 3W3AA 2G9DA 3T1HL 1G91A 1EU4A 1WFQA 2TSSA 4XT1B 4QCLA 1S5CD 3VR6A 2JQOA 3MZ5A 4MTKA 2WB1G 4YIJA 1S40A 2EYLA 2OTLA 1TWAH 4QUFA 1O7YA 3I91A 1EWCA 3HOWB 1HZCA 4PZ8A 2E75C 2KHSA 4WJ4A 4C56C 1U5KA 3EN2A 4AYBG 5I6YA 4LAAA 2PI2A 3E9IA 4B3RL 4EX5A 5LMUL 1WCMG 3HOUH 3A0JA 3A5UA 2RDFA 3C3LA 3CKIB 1FGBD 2OXPA 1M8AA 2Q2HA 1VQ6A 3PO3G 4DN4M 3PIP3 2F1MA 1SYCA 1DXMA 2RDHA 4PQXA 3KDFA 1KAAA 3HRZC 1SMYC 1QZGA 1CQVA 3D6WA 3J81c 4GN4B 2K75A 1TR5A 3Q8DA 3GTPB 3FEWX 1RODA 3W1BA 2FXQA 4NXNL 1PH8A 3S15B 1BCPB 2BE5D 1IBLL 1HR0W 1SNCA 4GKJL 3DWQA 1D6EC 2WAQG 3V05A 4CJ1B 2IX3A 4FDBA 1WYDA 1PFSA 3VR4A 4U673 1CKNB 2XRQD 2K1BA 5IP7H 2LKVA 1EQTA 3RLOA 3NWSA 2A6EC 5IIFA 3S16B 1SXTA 5H1SE 4NKLA 1FL0A 2IX0A 3I8ZA 1TS5A 3I90A 2NWGA 2X6GA 3Q23A 3L3OC 1VQ4A 3GQBA 1AP0A 3Q22A 1IBLQ 1BOSA 2C5CA 1CZWA 2OQKA 1PH5A 1HZAA 2Y0SE 3HKZG 3BZKA 4ME3A 3IL8A 4DV3L 2D0PA 5GAHC 1Z9FA 5KRUA 1CUKA 1VQIA 3F8TA 3E0JA 5M5XB 2KEDA 2C9OA 3HOZG 1E1OA 1PYBA 3FRPB 1HFGA 2F0HA 2PI2E 4C3HB 1VQJA 1A63A 4P75A 2CW0D 3PUVA 4IQZA 4DV6Q 1I4RA 1ZYRD 5JJIA 1X55A 3KBXA 1S3OA 3KF6B 4DR7L 2F0IA 2MFIA 4A3LH 2WIIB 2WB1B 2LY7A 5BN5A 3NE5B 3UDFA 1KQSA 1I4HA 3CCMA 1F2MA 5IYDG 1TQOA 3UDGA 3UDIA 3NELA 3RN2A 2UXCL 4BA2I 4JBWA 2QILA 1YHQA 1TWAB 1X3PA 3E9HA 4A3LG 4DR4Q 1SYDA 4RG1A 3X3NA 1EEFD 3R8BA 2L15A 3T13A 3DMUA 3I4NG 1NJIC 5CV4A 4HJ8A 3IAYA 5A35A 3MC0B 5C44G 1G6ZA 1X32A 4OO1I 2EYOA 4HIKA 1VQ5A 3WDNA 5LMUQ 1UE6A 1KNAA 4DAYB 3M4PA 3I56A 2XVSA 1HQMC 1YJNA 1VF7A 2D9UA 1B3AA 2R7ZB 3SEBA 1J8IA 2E2JB 1RD9D 2HQEA 1II3A 4HMJA 4LF8Q 4TVAB 1GUGA 5NUCA 2F0NA 4AQYQ 1M90C 2K03A 4KTAA 2IWHA 3IKJA 1I6HH 1TS4A 2X6LA 4DAVA 3GTLB 3IFTA 5J3BA 3KF8A 2ASBA 2I07B 2MUYA 2ZJRA 4ZAIA 3J7AF 4MNOA 3TSSA 5FK9C 2F4VQ 1EIGA 3TBIB 1VMPA 1SYFA 2VZAA 3AFQA 3MXNB 1BCPC 3SR1A 4A3EH 1I3QB 5EKKA 2ZTCA 4V190 4R1JA 2R7ZH 1A2UA 3S16H 1H9SB 4MHEA 2R93G 4DV5L 5CMDA 4A3EG 1IL8A 4A3CH 1MKHA 1Z7TA 1AE3A 2PQAB 3BVZA 1K83B 3CCVA 4KY5A 3L7ZC 3VYRA 4IFDH 3J80i 2ID0A 2QDLA 5IP7G 3NENA 4LF6Q 2IHEA 5A2QE 1KABA 4XYQA 2VQEL 1Q90A 1SLJA 4X62L 1E1TA 5G3LF 2ZXOA 1YNNC 4JC0A 1WTWA 2L11A 4RMFA 4BWGB 4NW2A 2UUAL 1X3GA 5IP9H 1VQOA 4BS9A 3OHXC 1TWGB 1OXXK 5IGFA 5CGKA 3SK5A 1HNXQ 5KGUA 1YBYA 3PGZA 3K0XA 4O42A 2LS01 1IBML 4ILWA 2A1AA 2YV5A 1LTTD 3G71A 1EOTA 4B3MQ 4BBSH 3CAMA 3L0OA 4IUTA 4KKUA 4QIWE 2E5LL 2Y0SG 3HKZE 1EY5A 4UY8C 2WFWA 4LUOA 5M5WH 3I55A 1HPCA 3K59A 4C3JB 1A3UA 1HA5A 1JJ2A 1RIPA 3JAMc 1RCVD 1HTPA 3S1MH 3TS0A 4IPGA 2KUMA 3I73A 4Y52H 2E2DC 2JA7B 1GJXA 5AJ3L 2P5ZX 1OXUA 2G5DA 2F3IA 4LWCA 3MFYA 5TSSA 4DAPA 4LF4L 2KCCA 5ISRA 1QVCA 4BBRG 1SJED 1S4ZA 3KF6A 5C0XG 3RZDB 2R6GA 4IJLA 4DNRB 2UXDQ 5IWAQ 5M5WB 5DM73 4K5XA 1K28A 2BCOA 4DK6C 4NPSA 4V0BA 3S1MB 4F7XA 1MD2D 1NMFA 1N34L 4ZKBB 1UAPA 3F2UA 1WTVA 3LGJA 1DOLA 3OWFA 4U68A 1G8ZD 4ID6A 1B3QA 4TKOB 5C3EH 1YNJC 1S5FD 2KQ3A 2DNCA 2FFKB 1RL2A 1SBBB 3GD7A 4I7ZC 3H15A 5IWAL 4DXFA 5I2XA 4XQNA 3NEMA 1XMOQ 1OXTA 5FO7B 1W6JA 5GADC 2J4XA 2F0EA 4ZRZA 2Z6BA 3NP8A 4A76A 1HR0L 2IJ0A 4A3KG 3QB3A 3H0GG 4A3EB 1A3VA 3A7LA 2DUDA 1EY8A 4OELB 2I0QA 4P71A 3CCUA 1XNRL 4DV2Q 4LMQD 2WACA 2QF7A 1X3EA 1KDCA 5CC4A 5M5YH 1HJPA 5EGTA 4KKTA 3SGIA 3S1QH 4FYDA 1BNZA 4S3SA 3W5OA 1V43A 1IZ6A 1U4LA 1W6KA 1PZKD 2B2WC 3FPUB 3DM1A 3STBD 2PQAA 4DV6L 4LF7Q 1EFID 1PTOB 4C2MB 2L5TA 1VQCA 1K8AC 1BDOA 3I2ZA 4GNXC 3JAME 2EXDA 4IOAA 3T1HQ 1VQMA 3VA5A 1AZQA 3FDTA 1NTGA 3CD6A 4K5WA 3BYYB 3E6ZX 4QUCA 2EYJA 1STEA 1TU2B 4C3JG 5HGTA 4HAEA 3OMGA 5IT9c 5LHY1 1JR0D 1SE8A 4DV7L 2JA7G 2MP1A 1CQFA 3N6RA 4O2DA 1K73C 1WD0A 3MXUA 1FD7D 2PZWA 2XIWA 1W3SA 2YTVA 5FLXc 4A3CG 4B3SL 3U4VA 4HMIA 1SRUA 2HIXA 2ZM6L 1SE3A 2BA1A 4RGNA 1SYBA 4DFAA 1ICWA 4X64Q 1LTAD 1UEAB 3HZXA 3P7JA 1CA5A 4LF4Q 5JAVA 1M4VA 1UE1A 2JJQA 3G4SA 1W2BA 1MSGA 1STGA 3S14H 1YHAA 4JOIC 1ASYA 1IYVA 4A3FB 3RZOB 3BG3A 4QB4A 2XTIA 2FJ2A 2ZJPA 1HXYD 3R2IA 1E0BA 3SK8A 2EY1A 3TZUA 4CDCC 1TVXA 4K0KL 3HOUB 1NBWA 2ZTEA 2RKSA 3A55A 2K5DA 1LTSD 3HS0C 1N33L 2JA6G 3P20A 1YNJD 2RHSB 1PLFA 1ZXTA 2R7DA 4UHVA 3TS2A 3PIOA 1KAWA 3M7NA 1Y1WB 4A3KB 3K0YA 4GN3B 3H91A 1K8OA 5BN3A 1FYCA 2OEOA 4IUUA 1B53A 2NZHA 3RZOH 3J80L 3CRKC 4KLKA 2N78A 2EVBA 4FNFA 4KKSA 4N8X1 2I5MX 1MSHA 1STYA 2B8FA 2F4VL 2A6ED 1B44D 3GTQH 2LFNA 3SK6A 4B3RQ 2A69C 1IBKQ 1EU3A 2D2CC 1AZPA 1E2VA 3J80E 2EZVA 3S1QB 2JSOA 2QW7A 4JOIA 4A3BG 1X9NA 4XDXA 3KDFB 4HN7A 1NMGA 1OXSC 3GO5A 4A3KH 1R9TB 4IPCA 4DAMA 3JC66 1DOMA 1X65A 5FJ8H 5FLMH 1PMRA 1YNXA 4JK1C 3J80c 2PW7A 2CVRA 4DR6L 4B08A 3HOYG 4WFN3 3PIO3 2F03A 1XNQL 2I5HA 1EIYB 2HDMA 3CW2C 1PH3A 4NXML 2GN5A 5DAUA 3ZYYX 2VQFL 1PH7A 1J6QA 5T1IA 1VDZA 3WOFA 1FGUA 4LUVA 3SE0A 3GTQB 1EYAA 3V2TA 4KY6A 4C3HG 2ZM6Q 1VQLA 2UU9Q 1VQGA 2ZJQA 1HUNA 1CKNA 4IUVA 3RNUA 4PZ7A 5T1GA 1PA6A 2F0KA 4YCUA 3VYTA 4X3KA 1GO3E 2ATWA 3VYSA 2OT2A 4CKCA 4LFCL 1GD7A 3UDXA 2E2IH 1GUWA 3H0GH 4RKBA 4DAYA 4EQOA 1NUCA 4P73A 4C3HH 4YHHL 2E8GA 4ME5A 4UP8A 5EKLA 1KDBA 1MJEA 1CSPA 3HOVB 4A4IA 4DR1L 1BQQT 2L9HA 2QEXA 3D4DA 4MN3A 5ELCA 4C1NI 1Q82C 5LMNQ 1VQHA 1WJJA 1SFOH 4EQ5A 3Q0AA 4IO9A 4HEDA 3SHLA 3M9BA 4JI4L 2N55A 4IPDA 2NN6I 3SVMA 2I5LX 3S24A 4DV4L 1F9RA 5K36H 4DUYL 2HHHL 3S17H 1A15A 4IPHA 3WWVA 2E2IB 1SAPA 4ZK9B 1MJCA 3SDZA 4LF9L 1I4GA 4LFAL 1N9WA 5C6AA 3BVMA 1FNWA 2MNAA 3CC4A 2CCZA 1KDAA 1UUPA 1UNSA 4HSVA 1V1PA 3PCOB 3NBHB 4LNQA 4CKBA 3AYHB 2CW0C 1H9KA 3KOJA 2JA6B 1BCPD 1D1IA 4G4KA 1QZHA 5E1FA 3PSIA 1Y1WG 2HIVA 1QB5D 2FHTA 5D14A 1R4PB 2EY6A 4X3TA 1R4QB 2MHVA 1N34Q 3TP6A 4BBSG 2B63B 2E2HB 5J22A 4EQNA 2QDBA 3MFGA 3CCEA 2VB2X 2VUMG 2E2JH 3T16A 4YHHQ 3R3OA 4HJ9A 2EIFA 4OWXB 2Q2UA 3NTIA 1IW7C 5M9OA 1EZ6A 4TQUS 2L12A 1XXGA 1HTLD 1I6VC 4GKJQ 2R93B 3EIVA 1GOZA 4BY7B 4CGYB 3RN5A 3QOLA 1YEZA 1U9RA 2F3WA 2NYZD 2AUKA 2IPKD 3A5ZB 4N9PA 1B50A 1IBMQ 4GLXA 3H6MA 4WJ3M 1LT4D 3PQIA 4J6HA 3C2PA 4PNYA 1SNDA 4RWSC 1XTCD 3GTPH 4FP5D 1G51A 3T53B 1J9OA 1SDFA 5JJKA 4YCWA 1RKNA 2FMCA 2RF4A 3U9OA 2JA8B 2O5IC 2B2YA 2AWOA 4JI0Q 1B2TA 4BY7H 4A3JG 5JPNC 3MTSA 2KJXA 1LTID 2XNAC 4KD4A 3K57A 4AH6A 1PH4A 2SNSA 3TMEA 2RCNA 5IT9L 1C7YA 2MQHA 4C1NK 3HOVG 1PFNA 1PXUA 3A8KE 1S72A 1STNA 1VF5C 1DONA 1TWGH 5M3FG 2IL8A 4FF2A 1CA6A 3UI2A 1CFMA 1TIID 3TQYA 5BR8Q 2WKDA 3S1RB 4KV6A 5LMNL 1L1OC 1TWHB 2I46A 4NP5A 1U4MA 4DR5Q 3C1FA 2HD3A 4RGTA 4F8MA 3GTMB 3EROA 4DR6Q 3A8JE 3EBEA 1PDQA 5C0XJ 4CJ0B 2ENBA 4BBRB 3CCSA 5M5XH 4X62Q 1T5EA 1ASZA 3I4MG 3QOJA 3IRBA 3NQTA 2Z9HA 3GTGB 4LF5L 3DUZA 3AFPA 4O1NA 2QKIC 4H13C 4DKAC 1YJ9A 2ICIA 1PH9A 1JE5A 4DR5L 3VDYA 2B63G 3S2DB 4HIMA 1JE4A 3EA6A 3I70A 3W2DA 4OX9Q 2F0VA 5CV5A 1IYUA 1LT6D 2PW5A 5FO9B 3J7A5 3RUZA 4A3GB 4QL5A 4JI4Q 1AW7A 1ILQA 3BDOA 3ONAB 2MJ8A 1SEBD 2F3VA 2Z1CA 5CV7A 2NBFA 4UP7A 2NTSA 2K5NA 5C4JB 2ZT9C 3T4AC 3DEPA 2NN6G 4K8IA 4HR7B 1VQ7A 4B9WA 3K6OA 1KIXA 1TWFH 3KJPA 3K5NA 5FLXE 3K8AA 5KYLA 4BXXG 3LNNA 3A74A 2R93H 3BS1A 1TWCB 4XXEA 1I94Q 4A3GH 2UXDL 5ELFA 4HJ7A 3OPOA 2A8VA 1HUMA 2Z4HA 1WTRA 2UU9L 4K6DA 3CCRA 1STAA 4DK3C 1B8AA 1CKOA 4UP9A 4QQBX 4J15A 5CBAE 3ZJYC 1BR9A 2EYHA 2LXKA 3PO2G 4EQPA 4A3JB 2WP8J 3GV3A 4P2CB 5IE8A 1I6HB 3MAQA 5IGDA 1JOOA 1LV9A 1B9MA 1SN8A 3IFDA 4X66L 2JA8H 1EL0A 4BA1I 4X65L 3U58A 1TWCH 3EJIA 1PTOH 2PMZB 4DV1Q 1JQYD 4C3IB 4ABNA 1CHQD 2HCCA 1ILPA 2NN6H 2AQ1B 1ENCA 1OO9B 4JI0L 4MTNA 1K0RA 3FKIB 2NVYH 2AQ3B 5HGQA 1V8QA 1VQPA 5IY0A 1Q81C 4LFCQ 4JYAL 2LXJA 1X6OA 3MEFA 3O13A 2ALYB 2SDFA 1LM0A 4A3JH 4BY1G 5CBEE 2EPBA 2GVBA 3S1RH 1K83H 3J7ZC 4POGA 3GTMH 2V1CC 1V1QA 2XSCA 3T51B 3HOXG 2CKZB 2H1EA 2XN9C 5C0XI 4JV5Q 3HGBA 1Q1BA 1O80A 3CMEA 2JXMB 5LMNW 4OONA 4BBRH 3CPWA 1HNZQ 5J1ZA 3U4ZA 2UUAQ 1HCZA 5K5PA 4GLAC 3FKIH 4DK1A 5M3MH 3NUCA 2F0TA 2A73B 4CHTB 4B3TQ 3QIAA 2EY2A 3MXPA 4A3GG 2K5VA 4L6TB 1TKWB 4L5QA 2UXCQ 2F0UA 5CV8A 3S14B 1EEID 2F0LA 3BDLA 3K80C 3EFXD 3KF8B 4WJWA 4X3SA 1Q8IA 3I4LA 5M3MG 3VR5A 2R7FA 2CQOA 1BF4A 3HEJA 3BZCA 5KNBA 1Z47A 1VQBA 1QVGA 4JBMA 2KCNA 5CR3A 2UUBL 2B8GA 1ENFA 3ITPA 3L9AX 4LFBL 2YTYA 3X3MA 5JEAJ 1HNWQ 2CQAA 2RDGA 4Z9CB 1FR3A 3M4QA 1XTDA 2DJFC 4R4QA 4L5RC 4H02A 3D3RA 2KBNA 1KNEA 4IALA 3P1HA 1Y1WH 4CJ2C 3TN2A 1XPRA 4JI2Q 4M1UB 3ND8A 3RZDH 3AU7A 4IZ8A 2K50A 2EYPA 1TT2A 4LJZC 3TP5A 2FINB 4RCOA 4M8AA 1FJGL 2AUJD
chains in the Genus database with same CATH topology
5I9OA 1O78A 1PRTC 4G7HC 1EY7A 1CI3M 4HCSA 2F0SA 2F0PA 2HUGA 2Q8TA 2Y0SB 5FKAC 2M00A 5EPLA 2A68D 5A2QL 4X3UA 1WCMB 3CHBD 5COYA 4DGZA 4IUPA 2K28A 5AFWA 3PO3B 1PRTD 1HHVA 2F0DA 3PUWA 1D1KA 3PUXA 3V96A 5M5YB 2NVYB 2E74C 1C8CA 1KLGD 3DWPA 3KLSX 4AYBB 5JJZA 3HOXB 1S5DD 3OSOA 1O7ZA 5DM63 4RCNA 1VMCA 1AN8A 2AWNA 2JYOA 1XYIA 4ZYSA 4NDXA 5IT9E 3K7AB 2B2VC 4ULLA 4EGVA 4DF7A 2K5WA 3GTOB 1EIHA 5LL6X 5EPKA 5CV6A 1B4OA 3OWEB 2X69A 4HTHA 1SJHD 3KLSA 4FO2A 2KA7A 3D4RA 2EJMA 2CHBD 4RGMA 3QO2A 1STHA 1DOKA 5JEAH 4A3DB 4FF3A 1I4QA 5JVG3 2F0GA 3LWEA 3VR2A 4L63B 4IFDJ 4F87A 2J7ZA 4KK7A 1NCVA 1BCPF 5IGCA 3RMHA 1JC7A 2A5HA 4A93B 1H9MA 3AB9A 2K33A 2G9HD 2F0MA 1SNPA 2M2LA 2KEEA 3NXWA 3NTKA 5D65A 1QWYA 4IFDG 2EE1A 2MPMA 1LTRD 2YU9B 1I50B 4XYOA 2MGSA 4XT3B 3I72A 1LLRD 2PNRC 5ELEA 1FNUA 1IKMA 3H3VC 4ZUIA 1PTOC 3HG9A 1EY0A 1ML0D 5FLXL 1IW7D 4XTCS 1VCIA 4H0LC 2PO4A 3RLFA 4CKEA 3FMCA 3R2TA 3I3CA 1C48A 3EQLC 2RSNA 1DZ1A 2K04A 5J39A 2F0JA 1JWSD 1LACA 4EVOA 2EDGA 2RBMA 4K2KA 5IOCA 3S2HB 3PMFA 3S1NB 2NTTA 3WOEA 2Z4IA 1ESFA 4K8JA 2A69D 3A56A 1RTOA 2BA0A 2QCPX 5JOBA 1H9SA 3VR3A 5EPJA 1I4XA 2TMPA 1MGSA 3BVGA 3CQZB 4Q0FA 2XWBB 4OL7A 5EJWA 2K01A 5D3IB 3MXNA 1SFOB 2DNEA 3J7YW 2RA4A 3M7GA 4RHRA 4FXGC 2A6HC 3HOYB 4UDUC 3K5LA 1QG7A 4PMWA 1CHPD 3KBGA 5ELBA 1RJTA 1TWFB 2K6AA 1MBYA 4KHVA 3M3YB 1PRTB 1SE4A 4R8NA 2NUCA 2JP1A 2IT1A 4ODGA 3U9SA 1SNQA 4CBVA 5BN4A 2F0QA 3DEOA 4DU9A 5I6WA 5CYUA 5C3WA 3D31A 3OMCA 2AQ2B 4KI0A 3J81L 1SSOA 2A74C 1SYEA 1Y8NB 4C3IG 1PFBA 5D3DA 3S9WA 3CU7A 1CZGA 3KK7A 1RHPA 3M4OB 4K5VA 2Z8LA 2YYZA 5CV9A 4KD3A 4BY1B 5KEEA 1Q1EA 1GUSA 1Y8OB 2J0TD 5EQ0A 2B2WA 3VA7A 4IFDI 4A3IB 2RVLA 2DY8A 1YNND 2ZXRA 3LWUA 2EJFC 3NWTA 2OF1A 2ZXPA 5I9PA 2NZ1D 1Y69U 2N88A 4ZLTF 5IGBA 3OW7A 1IKLA 2FMMA 1A3TA 1GHKA 4J8QA 2PZUA 1WTPA 4G7OC 3MEHA 1IHZA 4ZQ3A 5C5MA 2M9VA 3Q6SA 1F9QA 1V1OA 3MA2B 5M3MB 1STBA 2H4OA 1F2YA 4ZUJA 2O4XA 3C46A 4QIWB 3SXHA 1LO5D 1F2LA 1TS3A 2F0FA 1PRTF 3VYUA 3HOZB 2O5JC 2DY7A 4N9TA 5FOBB 1DM0B 2BDOA 1NR4A 1MI2A 4XQJA 1PZID 3MWYW 4K14A 1KTKA 1JWMD 5IGEA 1LT5D 1B1ZA 4TSSA 4WRDA 1TS2A 1Q3LA 1Y8PB 4KMUC 5M3FB 2XWJB 3NK9A 4KN7C 2Q8RE 1PFMA 5C3XA 2SNMA 1C4QA 3I4NB 4OO1H 3ERQA 3G7LA 4KN4C 5C44B 1F9PA 3AMUA 1WTOA 1JICA 1XWEA 1DJRD 5K36G 1OXVA 1E2WA 5JPMC 4RAUC 2JE6I 2D62A 1F9SA 3T56B 2KECA 3NQIA 1RTNA 2NB0A 1DYQA 2PPBC 1TY2A 2LMCB 1QNKA 4OIKA 1JB3A 2O2LD 4XQQA 1ZKOA 1JCKB 4DNTB 2B39A 1WTQA 1DCZA 3GV6A 1SYGA 2JA5B 3H94A 3URYA 4K6LA 3SK4A 5FO8B 1QCBD 1ET6A 4HCEA 1V1PB 1AFPA 1F2ZA 3P75A 4G57A 3NTHA 1NAPA 2D5DA 2L55A 2SOBA 2B2UC 5E3FA 4HSPA 1D2BA 1X3QA 4QF4A 2NVXB 4IURA 1SMYD 5F2DA 2F4IA 1EY6A 4DA2A 2L1BA 3HP3A 1WVLA 2F0WA 5C4XB 5C4ZA 3N52A 2JEAI 2GA4B 4FF4A 2K05A 4KJOA 2WKCA 3OIPA 4QMGA 2EXZA 5IODA 1HFNA 2RQXA 1K8MA 3A8IE 4PV1C 5EBDA 3A7AB 1JORA 1F77A 4GZYC 1G291 3BDCA 1EYDA 3C1EA 4RA8A 1NR2A 1I4PA 2DN8A 1HQRD 3GTJB 1QOHA 1NSNS 1U4RA 5ELDA 2NVQB 2ICEC 4MIUA 3D6CA 1KLUD 1PZJD 1O7LA 1ET9A 1L0YB 3PV0A 2HDLA 4BBSB 5EBCA 3OOCA 1G2TA 1EY4A 2L0CA 1EWHA 4RFBA 3PUYA 4TRDA 2B2TC 3D8GA 3G6JB 3M85A 3MHBA 2PYKA 5E4XA 4I65A 1BO0A 1LTBD 1PYWD 4UAIA 2R3ZA 1HRJA 3NPPA 1QILA 1RDPD 1B9NA 3HKZB 1EYCA 4J1MA 5KYIA 3BZDB 3BYTB 5LL6S 3TDQA 3J81E 4Y7NB 1EQVA 3KUPA 4RGOS 1ESRA 1WD1A 4IUNA 5C0XH 1D5MC 5I2YA 1D5XC 4FXKC 3EVQA 1BBXC 4KJNA 2BE5C 2IW3A 4NMZA 1S5ED 5EKIA 1EZ8A 5IGGA 3A54A 1AEXA 2KVMA 3ND9A 1Z6HA 2RSOA 3NSWA 2PZTA 3QWNA 1ZEQX 4Q5VA 2EJGC 2B2YC 1CK1A 4L8JA 1XX8A 3RD4A 5KNDA 2BOSA 3DXJC 3K5MA 2WINB 1H9JA 3TP8A 3NBIA 2PCFB 3CRLC 4R9WA 5KIXA 1LABA 2NVTB 1GUOA 3M4YA 1CTMA 3TZDA 5JEAG 5HURA 4OO1G 2A6HD 1TY0A 2A68C 2EOTA 2BDNA 3KLRA 1WTXA 1ONLA 4KHZA 5G3LD 1BXTA 1EY9A 1QE6A 1S5BD 3R93A 3H09A 3NHHA 1QJOA 3I4MB 3GP7A 2VXWA 4RKLA 1A6XA 1ENAA 2EYMA 3K5OA 4A3MB 3JAML 1LT3D 1GHJA 2K5QA 2B2VA 3FPPA 2VB3X 5CORA 2R92B 2QEJC 1PTOD 2L4NA 4A3BB 4B9XA 2R61A 3PUZA 1GUTA 3QG1A 2HCIA 5C4HA 3DWAA 1HA6A 4LK1C 4E6IA 5JVH3 4WORA 2K7VA 1SNMA 1JWUD 4H44C 5C5LA 1D5ZC 1BUVT 1FNVA 3MVVA 5I4DA 1JOKA 1QNUA 1RF2D 5DEHA 3PO2B 3E5SA 3OIQA 1H9RA 1ZYRC 3K58A 1GUNA 2EYFA 4DK0A 4K2LA 1GXDC 1G2SA 2E76C 2VNUD 3TP7A 5C3EB 3QJYA 3FVQA 2SEBD 5DNFA 4FXDA 1CM9A 3NBHA 4IN3A 4R8IA 3GTKB 2KOLA 1SE2A 4PMCA 1A2TA 2WV6D 4OHJA 4OGQC 4FF1A 4PMBA 3Q24A 1LTGD 1JOQA 2B2UA 4XIGS 1E2ZA 5KNCA 1T5XD 3H0GB 3MXGA 2WAQB 2XRSD 4RHSA 3DHQA 1Q12A 4H7BA 5E4WC 1PTOF 2VUMB 1CT1D 2EY5A 1DD2A 2V4DA 3LX0A 4FVMA 2F0OA 1Y1VB 2PQEA 2K32A 2IX1A 3D4WA 3J7AV 2B2TA 4G7ZC 3S17B 4ZKCB 4DXGA 2JEBI 4RH6A 4OIJA 4IUQA 2Q8IB 1SNOA 1L0XB 4KY7A 1U4PA 4F88A 3W3AA 2G9DA 1G91A 1EU4A 2TSSA 4XT1B 4QCLA 1S5CD 3VR6A 3MZ5A 4YIJA 2EYLA 4QUFA 1O7YA 3I91A 1EWCA 3HOWB 2E75C 2KHSA 4C56C 5I6YA 4LAAA 2RDFA 3C3LA 3CKIB 1FGBD 2OXPA 1M8AA 4DN4M 3PIP3 2F1MA 1SYCA 1DXMA 2RDHA 4PQXA 1KAAA 3HRZC 1SMYC 1CQVA 3D6WA 1TR5A 3GTPB 3FEWX 1RODA 3S15B 1BCPB 2BE5D 1SNCA 3DWQA 1D6EC 3V05A 4CJ1B 2IX3A 3VR4A 4U673 2XRQD 2K1BA 2LKVA 1EQTA 3NWSA 2A6EC 5IIFA 3S16B 1SXTA 4NKLA 2IX0A 3I8ZA 1TS5A 3I90A 2NWGA 2X6GA 3Q23A 3L3OC 1AP0A 3GQBA 3Q22A 1BOSA 2C5CA 1CZWA 3IL8A 5KRUA 3E0JA 5M5XB 2KEDA 2C9OA 3FRPB 1HFGA 2F0HA 4C3HB 2CW0D 3PUVA 4IQZA 1I4RA 1ZYRD 3KBXA 2F0IA 2WIIB 2WB1B 2LY7A 5BN5A 3NE5B 1I4HA 1F2MA 1TQOA 4BA2I 4JBWA 2QILA 1TWAB 1X3PA 1SYDA 3X3NA 1EEFD 3R8BA 3T13A 3DMUA 5CV4A 3IAYA 5A35A 3MC0B 1G6ZA 1X32A 4OO1I 2EYOA 3WDNA 1KNAA 2XVSA 1HQMC 1VF7A 2D9UA 1B3AA 2R7ZB 3SEBA 1J8IA 2E2JB 1RD9D 2HQEA 1II3A 4HMJA 5NUCA 1GUGA 2F0NA 2K03A 4KTAA 2IWHA 3IKJA 1TS4A 2X6LA 4DAVA 3GTLB 3IFTA 3KF8A 2I07B 2MUYA 4ZAIA 3J7AF 3TSSA 5FK9C 1EIGA 3TBIB 1VMPA 1SYFA 3SR1A 1BCPC 1I3QB 5EKKA 4V190 1A2UA 1H9SB 4MHEA 5CMDA 1IL8A 1Z7TA 3BVZA 1K83B 4KY5A 3L7ZC 3VYRA 4IFDH 2ID0A 5A2QE 1KABA 4XYQA 1Q90A 5G3LF 2ZXOA 1YNNC 1WTWA 2L11A 4BWGB 4NW2A 4BS9A 3OHXC 1TWGB 1OXXK 5IGFA 5CGKA 3SK5A 5KGUA 4O42A 2LS01 4ILWA 1LTTD 1EOTA 4IUTA 4KKUA 1EY5A 1HPCA 3K59A 4C3JB 1A3UA 1HA5A 1RCVD 1HTPA 2KUMA 3I73A 2E2DC 2JA7B 1GJXA 1OXUA 3MFYA 5TSSA 4DAPA 2KCCA 5ISRA 1SJED 1S4ZA 5C0XG 3RZDB 2R6GA 4DNRB 5M5WB 5DM73 4K5XA 2BCOA 4V0BA 3S1MB 4F7XA 1MD2D 4ZKBB 1UAPA 3F2UA 1WTVA 1DOLA 3OWFA 4U68A 1G8ZD 4ID6A 4TKOB 1YNJC 1S5FD 2KQ3A 2DNCA 2FFKB 1SBBB 3GD7A 4I7ZC 4DXFA 5I2XA 4XQNA 1OXTA 5FO7B 1W6JA 2J4XA 2F0EA 4ZRZA 3NP8A 2IJ0A 3QB3A 4A3EB 1A3VA 3A7LA 1EY8A 2WACA 4LMQD 2QF7A 5CC4A 1KDCA 5EGTA 4KKTA 4FYDA 1BNZA 4S3SA 1V43A 1U4LA 1W6KA 1PZKD 2B2WC 3FPUB 3DM1A 1EFID 1PTOB 4C2MB 2L5TA 1BDOA 3JAME 3VA5A 1AZQA 3FDTA 4K5WA 3BYYB 3E6ZX 4QUCA 2EYJA 1STEA 1TU2B 4C3JG 5HGTA 4HAEA 3OMGA 5LHY1 1JR0D 2MP1A 1CQFA 3N6RA 1WD0A 3MXUA 1FD7D 2PZWA 2XIWA 4HMIA 1SE3A 2BA1A 4RGNA 1SYBA 4DFAA 1ICWA 1LTAD 1UEAB 3HZXA 3P7JA 1CA5A 5JAVA 1M4VA 1MSGA 1STGA 1IYVA 4A3FB 3RZOB 3BG3A 4QB4A 2FJ2A 1HXYD 3R2IA 3SK8A 1E0BA 2EY1A 3TZUA 1TVXA 3HOUB 2RKSA 3A55A 2K5DA 1LTSD 3HS0C 3P20A 1YNJD 1PLFA 1ZXTA 3M7NA 1Y1WB 4A3KB 3K0YA 3H91A 1K8OA 5BN3A 1FYCA 2OEOA 4IUUA 1B53A 3J80L 3CRKC 2EVBA 4FNFA 4KKSA 1MSHA 1STYA 2B8FA 2A6ED 1B44D 2LFNA 3SK6A 2A69C 1EU3A 2D2CC 1AZPA 1E2VA 3J80E 2EZVA 3S1QB 2JSOA 4XDXA 4HN7A 3GO5A 1OXSC 1R9TB 1DOMA 1PMRA 4JK1C 2PW7A 2CVRA 4B08A 4WFN3 3PIO3 2F03A 2HDMA 5DAUA 3ZYYX 5T1IA 1VDZA 3WOFA 3SE0A 3GTQB 1EYAA 3V2TA 4KY6A 4C3HG 1HUNA 4IUVA 5T1GA 2F0KA 3VYTA 4X3KA 3VYSA 2OT2A 4CKCA 1GUWA 4RKBA 4DAYA 4EQOA 1NUCA 4ME5A 5EKLA 1KDBA 3HOVB 1BQQT 2L9HA 3D4DA 4MN3A 5ELCA 4C1NI 3Q0AA 4HEDA 3SHLA 2N55A 2NN6I 3SVMA 1F9RA 5K36H 1A15A 2E2IB 1SAPA 4ZK9B 3SDZA 1I4GA 5C6AA 3BVMA 1FNWA 1KDAA 1UUPA 1UNSA 4HSVA 1V1PA 4CKBA 2CW0C 1H9KA 2JA6B 1BCPD 1D1IA 4G4KA 5E1FA 1QB5D 5D14A 2FHTA 1R4PB 2EY6A 4X3TA 1R4QB 2MHVA 3TP6A 2B63B 2E2HB 5J22A 4EQNA 2QDBA 3MFGA 2VB2X 3T16A 3R3OA 3NTIA 1IW7C 5M9OA 1EZ6A 4TQUS 2L12A 1XXGA 1HTLD 1I6VC 2R93B 1GOZA 4BY7B 4CGYB 3QOLA 1U9RA 2F3WA 2NYZD 2AUKA 2IPKD 4N9PA 1B50A 3H6MA 1LT4D 4J6HA 3C2PA 4PNYA 1SNDA 4RWSC 1XTCD 4FP5D 3T53B 1J9OA 1SDFA 1RKNA 2FMCA 3U9OA 2JA8B 2O5IC 2B2YA 2AWOA 1B2TA 5JPNC 3MTSA 2KJXA 1LTID 2XNAC 4KD4A 3K57A 2SNSA 3TMEA 5IT9L 4C1NK 1PFNA 1PXUA 3A8KE 1STNA 1VF5C 1DONA 2IL8A 4FF2A 1CA6A 3UI2A 1CFMA 1TIID 2WKDA 3S1RB 4KV6A 1TWHB 4NP5A 2I46A 1U4MA 3C1FA 3GTMB 4RGTA 4F8MA 3EROA 3A8JE 1PDQA 5C0XJ 4CJ0B 2ENBA 4BBRB 1T5EA 3QOJA 3GTGB 3NQTA 3DUZA 2QKIC 4H13C 4O1NA 2ICIA 3S2DB 1JE4A 3EA6A 3I70A 3W2DA 2F0VA 5CV5A 1IYUA 1LT6D 2PW5A 5FO9B 3RUZA 4A3GB 1AW7A 1ILQA 3BDOA 3ONAB 2MJ8A 1SEBD 2F3VA 2Z1CA 5CV7A 2NBFA 2NTSA 5C4JB 2ZT9C 3T4AC 3DEPA 2NN6G 4K8IA 4HR7B 4B9WA 3K6OA 3K5NA 5FLXE 5KYLA 3LNNA 3BS1A 1TWCB 4XXEA 5ELFA 3OPOA 1HUMA 2Z4HA 1WTRA 4K6DA 1STAA 5CBAE 1BR9A 2EYHA 4EQPA 4A3JB 2WP8J 3GV3A 4P2CB 1I6HB 3MAQA 5IGDA 1JOOA 1LV9A 1B9MA 3IFDA 1EL0A 4BA1I 3EJIA 1PTOH 2PMZB 1JQYD 4C3IB 4ABNA 1CHQD 2HCCA 1ILPA 2NN6H 2AQ1B 1ENCA 1OO9B 3FKIB 2AQ3B 1V8QA 3O13A 2SDFA 5CBEE 2EPBA 2XSCA 3T51B 2H1EA 2XN9C 5C0XI 3HGBA 1Q1BA 1O80A 2JXMB 5J1ZA 1HCZA 5K5PA 4DK1A 3NUCA 2F0TA 2A73B 4CHTB 3QIAA 2EY2A 3MXPA 4L6TB 1TKWB 2F0UA 5CV8A 3S14B 1EEID 2F0LA 3BDLA 3EFXD 4WJWA 4X3SA 1Q8IA 3I4LA 3VR5A 1BF4A 3HEJA 5KNBA 1Z47A 2KCNA 5CR3A 2B8GA 1ENFA 3ITPA 3L9AX 3X3MA 5JEAJ 2CQAA 2RDGA 4Z9CB 1FR3A 3D3RA 4IALA 1KNEA 3P1HA 4CJ2C 3TN2A 4M1UB 3ND8A 3AU7A 4IZ8A 2EYPA 1TT2A 4LJZC 3TP5A 2FINB 4RCOA 4M8AA 2AUJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DXF A;  1I4P A;  1I4X A;  1HQR D;  1PRT C;  1PTO H;  1I4G A;  5ELD A;  2J4X A;  1I4Q A;  1RF2 D;  1JQY D;  1EU4 A;  3BVM A;  1LTS D;  3BVZ A;  1DYQ A;  2IJ0 A;  1TY2 A;  1FNW A;  1KLU D;  3BVG A;  1PZJ D;  1CHQ D;  5D3I B;  2TSS A;  1ET9 A;  4L63 B;  2O2L D;  4RGT A;  2AQ1 B;  1JCK B;  1L0Y B;  1TY0 A;  1UNS A;  1UUP A;  1FNV A;  1S5C D;  1V1P A;  5FKA C;  1V1O A;  4RHR A;  1BCP F;  1I4R A;  2AQ3 B;  1BCP D;  3URY A;  3CHB D;  3O13 A;  4K6L A;  4RFB A;  1EWC A;  1BXT A;  4BWG B;  4UDU C;  1PRT D;  1CHP D;  1ET6 A;  4C56 C;  2G9H D;  1PZK D;  1I4H A;  2SEB D;  1S5B D;  1B44 D;  1LO5 D;  1TS3 A;  1LTB D;  1PYW D;  1PRT F;  5ELB A;  1EFI D;  1LTT D;  4O1N A;  1PTO B;  1V1P B;  3MFG A;  2ICI A;  2XN9 C;  1EU3 A;  1FGB D;  2QIL A;  1LTR D;  3GP7 A;  1QIL A;  1SE2 A;  1KLG D;  1RDP D;  3DWP A;  3EA6 A;  2WV6 D;  4OHJ A;  3W2D A;  1PRT B;  3KLS X;  1SE4 A;  1LT6 D;  1PZI D;  2RDH A;  1EEF D;  3R8B A;  1LTG D;  3BZD B;  1S5D D;  1LLR D;  3BYT B;  1AW7 A;  1HA5 A;  1CQV A;  3BYY B;  1XXG A;  1HTL D;  5ELE A;  3MC0 B;  1FNU A;  1KTK A;  1RCV D;  1SEB D;  1JWM D;  2AQ2 B;  1STE A;  1T5X D;  4L6T B;  4RGO S;  2NTS A;  1GOZ A;  1LT5 D;  1PTO C;  1BCP B;  1AN8 A;  1EEI D;  1B1Z A;  2XRS D;  4RHS A;  3EFX D;  1D5M C;  4TSS A;  1LT3 D;  4ZYS A;  3DWQ A;  1JR0 D;  1TS2 A;  2IPK D;  1D5X C;  5TSS A;  5D3D A;  1D6E C;  1PTO F;  3SEB A;  1RD9 D;  1CT1 D;  3V05 A;  1SJE D;  1FD7 D;  1LT4 D;  2Z8L A;  2XRQ D;  2QEJ C;  1S5E D;  1PTO D;  1XTC D;  3R2T A;  1ENF A;  2R61 A;  1TS4 A;  5ELF A;  1SE3 A;  1SXT A;  4RGN A;  2RDG A;  4Z9C B;  3OWE B;  1JWS D;  1LTA D;  1TS5 A;  1MD2 D;  1M4V A;  3DWA A;  1SJH D;  3TSS A;  4DXG A;  5FK9 C;  1CK1 A;  4RH6 A;  5ELC A;  1BCP C;  2NTT A;  1LTI D;  2XNA C;  1DJR D;  1JWU D;  1ESF A;  2CHB D;  4RGM A;  1L0X B;  1G8Z D;  1F77 A;  1S5F D;  4RCO A;  1D5Z C;  1SBB B;  1HXY D;  3R2I A;  5I4D A; 
#chains in the Genus database with same CATH topology
 5I9O A;  1O78 A;  1PRT C;  4G7H C;  1EY7 A;  1L0W A;  2VW9 A;  1CI3 M;  4HCS A;  2F0S A;  4GN5 A;  2F0P A;  2HUG A;  2Q8T A;  1EOV A;  2Y0S B;  1A8V A;  3J81 i;  5C44 H;  2WAQ E;  4A93 G;  5FKA C;  2M00 A;  5EPL A;  2A68 D;  3AQQ A;  5A2Q L;  1XMQ Q;  4LF5 Q;  4X3U A;  1WCM B;  4ALP A;  2YU9 H;  2ES2 A;  3CHB D;  5COY A;  4DGZ A;  4X66 Q;  4IUP A;  2K28 A;  5AFW A;  4DPG A;  3PO3 B;  1PRT D;  1HHV A;  4JI7 Q;  2F0D A;  3PUW A;  1D1K A;  3PUX A;  3V96 A;  5M5Y B;  2NVY B;  2E74 C;  1C8C A;  1KLG D;  3DWP A;  1MHW C;  4DV4 Q;  2UXB Q;  3KLS X;  4AYB B;  5JJZ A;  1HZ9 A;  3HOX B;  1NE3 A;  3OTO L;  1S5D D;  1EUJ A;  3OSO A;  2JA9 A;  1O7Z A;  4YWM A;  2C35 B;  5DM6 3;  4RCN A;  1VMC A;  3HOV H;  1AN8 A;  2AWN A;  4NXN Q;  2OTJ A;  2JYO A;  1XYI A;  1KXL A;  4ZYS A;  4NDX A;  5IT9 E;  2JA5 G;  3K7A B;  2B2V C;  4ULL A;  4EGV A;  1JMC A;  1J5E L;  2BH8 A;  4DF7 A;  2K5W A;  3HOX H;  3GTO B;  4A3D H;  4DV2 L;  1EIH A;  5LL6 X;  5EPK A;  1PH2 A;  5CV6 A;  1B4O A;  3OWE B;  2X69 A;  4HTH A;  1SJH D;  4CDF C;  3KLS A;  4FO2 A;  2KA7 A;  3D4R A;  3AEV A;  2EJM A;  1Q7Y C;  2Z0S A;  1I94 L;  2CHB D;  4RGM A;  1EQR A;  3K7A H;  3QO2 A;  1STH A;  1DOK A;  5JEA H;  2R92 G;  3GTO H;  4A3D B;  4FF3 A;  1YJW A;  3H3V H;  1I4Q A;  5JVG 3;  4DV0 Q;  2F0G A;  3LWE A;  3VR2 A;  1I50 H;  4L63 B;  4A3F H;  2RCF A;  4IFD J;  2HQL A;  4F87 A;  2J7Z A;  4KK7 A;  1NCV A;  2MO0 A;  1K9M C;  4OWT B;  1BCP F;  5IGC A;  5C4X G;  3RMH A;  1VQK A;  3KFU A;  1IXR A;  1JC7 A;  2A5H A;  4A93 B;  2VQE Q;  1H9M A;  1BKB A;  3AB9 A;  2K33 A;  2G9H D;  2F0M A;  1SNP A;  3E3X A;  2M2L A;  1HNZ L;  2KEE A;  1MIU A;  1O7I A;  3NXW A;  4GOP B;  3NTK A;  3GTJ H;  4APV A;  5D65 A;  1YIJ A;  1QWY A;  4IFD G;  2EE1 A;  2MPM A;  1LTR D;  2YU9 B;  1N32 L;  2LSS A;  1I50 B;  4XYO A;  2MGS A;  4XT3 B;  2PMZ E;  1LYL A;  2GVA A;  3I72 A;  1NY4 A;  3M4O H;  1LLR D;  2PNR C;  4YCV A;  4B3S Q;  5ELE A;  2R92 H;  2R7Z G;  4A93 H;  1FNU A;  4GNX B;  1IKM A;  1XPO A;  1BBU A;  3H3V C;  4ZUI A;  5C3E G;  1PTO C;  3HG9 A;  3S2H H;  1EY0 A;  4GOP C;  3KJO A;  1ML0 D;  5FLX L;  4A3F G;  1IW7 D;  5EAY A;  4XTC S;  1PYS B;  3UE0 A;  3HFZ B;  4GOP A;  1VCI A;  1R9T H;  4H0L C;  4B3T L;  1EWI A;  1UEB A;  2DGY A;  2PO4 A;  1K3B C;  3RLF A;  4CKE A;  3FMC A;  1XMQ L;  1KD1 C;  3R2T A;  3STB C;  1YHB A;  1C48 A;  3EQL C;  3I3C A;  4JI2 L;  2RSN A;  1DZ1 A;  2K04 A;  4LF6 L;  5J39 A;  2F0J A;  1JWS D;  1LAC A;  4EVO A;  2EDG A;  2RBM A;  4K2K A;  5IOC A;  2N49 A;  2B3G A;  1GVP A;  3S2H B;  3PMF A;  3S1N B;  4HJ5 A;  2NTT A;  4OEM B;  3WOE A;  2Z4I A;  4DUY Q;  3F2C A;  1ESF A;  3HOY H;  4K8J A;  1HNX L;  2A69 D;  3A56 A;  1RTO A;  4JI3 Q;  1GKH A;  2BA0 A;  3GTG H;  3B6Y A;  2QCP X;  5JOB A;  1H9S A;  3VR3 A;  1L1O A;  3I7F A;  5EPJ A;  4JI1 Q;  2UUC L;  1I4X A;  5GAG C;  4DR1 Q;  2ZTD A;  2TMP A;  1MGS A;  3BVG A;  3CQZ B;  4Q0F A;  2XWB B;  4OL7 A;  5EJW A;  2K01 A;  5D3I B;  3MXN A;  1SFO B;  3TEH B;  4DV1 L;  4JV5 L;  4A3D G;  2DNE A;  3J7Y W;  2RA4 A;  3ULJ A;  3M7G A;  3GTK H;  4RHR A;  4FXG C;  2UUB Q;  2A6H C;  3S1N H;  4DV3 Q;  1N36 L;  1TXY A;  3HOY B;  4UDU C;  3K5L A;  1JB7 A;  1QG7 A;  2CWP A;  4PMW A;  5C4J H;  1CHP D;  1PHJ A;  1P8L A;  2UXB L;  1DGS A;  3KBG A;  5ELB A;  4AIM A;  1N8R C;  1L2F A;  1RJT A;  1TWF B;  4DR2 L;  1KHI A;  2K6A A;  2JA6 H;  1MBY A;  4KHV A;  1AE2 A;  3M3Y B;  3BU2 A;  1PRT B;  1SE4 A;  4R8N A;  2NUC A;  2JP1 A;  2IT1 A;  4ODG A;  1VQD A;  3U9S A;  1SNQ A;  4CBV A;  3ER0 A;  5BN4 A;  2F0Q A;  2VUM H;  3DEO A;  4DU9 A;  5I6W A;  1AH9 A;  5CYU A;  2B63 H;  3D31 A;  3OMC A;  5C3W A;  2YTX A;  2E2H H;  2QA4 A;  2AQ2 B;  4KI0 A;  4LW1 A;  3ERS X;  4R4O A;  1E7Z A;  3J81 L;  1SSO A;  2A74 C;  1SYE A;  1HH2 P;  1Y8N B;  4C3I G;  1PFB A;  5D3D A;  3S9W A;  4DV0 L;  3CU7 A;  1CZG A;  3KK7 A;  3I4M H;  1RHP A;  3KLW A;  3M4O B;  2WB1 E;  1XMO L;  4K5V A;  3K81 C;  2KCT A;  2Z8L A;  4DR7 Q;  2YYZ A;  1QUQ A;  5CV9 A;  4KD3 A;  4BY1 B;  5KEE A;  1Q1E A;  1GUS A;  1Y8O B;  2J0T D;  5EQ0 A;  2B2W A;  2VS1 A;  3VA7 A;  1SRO A;  4IFD I;  4A3I B;  2RVL A;  2DY8 A;  1YNN D;  2ZXR A;  3LWU A;  2EJF C;  3NWT A;  2OF1 A;  2ZXP A;  4LF9 Q;  2BH2 A;  5I9P A;  2IY5 B;  2NZ1 D;  1Y69 U;  2N88 A;  1H95 A;  1Q8K A;  4ZLT F;  3GDE A;  4AYB E;  5IGB A;  3OW7 A;  1JJG A;  1IKL A;  2FMM A;  1A3T A;  1GHK A;  4J8Q A;  1VS0 A;  2PZU A;  1WTP A;  4NXM Q;  5IYC G;  4G7O C;  3MEH A;  1IHZ A;  1HR0 Q;  4PZ6 A;  4ZQ3 A;  5C5M A;  2M9V A;  3Q6S A;  2K5H A;  1B70 B;  1F9Q A;  1V1O A;  2HT1 A;  3MA2 B;  4A3I H;  5M3M B;  1STB A;  2H4O A;  1C0A A;  1F2Y A;  4ZUJ A;  5IYB G;  2O4X A;  4DV5 Q;  3C46 A;  1IL2 A;  1E3P A;  4QIW B;  4DR4 L;  3RR5 A;  1TWH H;  3SXH A;  1LO5 D;  1F2L A;  1TS3 A;  1X54 A;  4N8F A;  2F0F A;  1PRT F;  4P74 A;  4CDE C;  3VYU A;  3HOZ B;  2O5J C;  2DY7 A;  4N9T A;  3CF5 A;  5FOB B;  1DM0 B;  2BDO A;  1NR4 A;  4GS3 A;  3T1Y Q;  1MI2 A;  4XQJ A;  3CC2 A;  5JJL A;  1PZI D;  1VQ9 A;  5GRO A;  3MWY W;  5C4X H;  1GM5 A;  4AQY L;  2JA8 G;  4K14 A;  1KTK A;  4I7A A;  1JWM D;  5IGE A;  2CWA A;  1LT5 D;  1B1Z A;  4JVZ A;  3S2D H;  3M3Y H;  4TSS A;  3ULL A;  4WRD A;  1TS2 A;  1Q3L A;  1Y8P B;  4NB3 A;  2EQS A;  4KMU C;  5M3F B;  2N3S A;  2XWJ B;  3NK9 A;  4KN7 C;  1PH6 A;  3U50 C;  2Q8R E;  1PFM A;  5C3X A;  1B7Y B;  1KRS A;  2H5X A;  2SNM A;  1C4Q A;  1KL9 A;  3I4N B;  4OO1 H;  1UWV A;  3ERQ A;  1KC8 C;  4BXX H;  1PVO A;  3G7L A;  4KN4 C;  5C44 B;  1F9P A;  3AMU A;  1WTO A;  5BR8 L;  1JIC A;  1XWE A;  4JCV E;  1XPU A;  4IJH A;  1DJR D;  5K36 G;  1OXV A;  1E2W A;  2VL6 A;  4A3I G;  5JPM C;  4RAU C;  4YY3 L;  2JE6 I;  1PV4 A;  2D62 A;  4L5T A;  1F9S A;  3T56 B;  2KEC A;  1WI5 A;  3NQI A;  1K0S A;  1RTN A;  1Y1V H;  2NB0 A;  1DYQ A;  2MO1 A;  1TY2 A;  2PPB C;  1YIT A;  2LMC B;  1QNK A;  4OIK A;  1JB3 A;  4GLV B;  2O2L D;  4XQQ A;  1Q86 C;  1ZKO A;  1HNW L;  1JCK B;  4DNT B;  2B39 A;  1WTQ A;  1DCZ A;  3GV6 A;  1M1K C;  1SYG A;  4POF A;  2JA5 B;  1U0L A;  3H94 A;  3URY A;  3HOU G;  1A62 A;  4K6L A;  1YVC A;  3SK4 A;  5FO8 B;  1QCB D;  1ET6 A;  3H3V I;  1KRT A;  4C3I H;  4OX9 L;  1OTC A;  4DV7 Q;  1A0I A;  4HCE A;  1V1P B;  1AFP A;  1F2Z A;  3P75 A;  1L1O B;  4G57 A;  2JK8 A;  1ICF B;  3NTH A;  1NAP A;  4DR3 Q;  2D5D A;  2IHF A;  2L55 A;  2SOB A;  3PF4 A;  5IYC H;  2JA5 H;  3JAM i;  2B2U C;  5E3F A;  4HSP A;  1EFW A;  1D2B A;  3OTO Q;  1X56 A;  1X3Q A;  3CCJ A;  5IYD H;  4QF4 A;  5E7N A;  3DLL A;  1JJC B;  2NVX B;  4IUR A;  1E22 A;  5L37 A;  1SMY D;  5F2D A;  5GAE C;  3CPF A;  1XNQ Q;  4X6A H;  2F4I A;  1EY6 A;  4DA2 A;  2L1B A;  3HP3 A;  1WVL A;  2CH4 W;  2F0W A;  1HZB A;  4K0K Q;  5C4X B;  1I3Q H;  5C4Z A;  3HOW G;  1YI2 A;  3N52 A;  4DNI A;  1LTL A;  2JEA I;  1Q46 A;  2GA4 B;  4FF4 A;  1IYJ B;  2K05 A;  3K7U C;  4KJO A;  2WKC A;  3OIP A;  4QMG A;  2EXZ A;  3J81 j;  2AKW B;  5IOD A;  1HFN A;  2RQX A;  5IP9 G;  1K8M A;  3S15 H;  5M3F H;  4JW0 A;  4QJF A;  1K3R A;  3A8I E;  4PV1 C;  5EBD A;  3A7A B;  1JOR A;  1F77 A;  4JI5 Q;  3ICE A;  4GZY C;  4R4T A;  3PIP A;  1G29 1;  3BDC A;  1EYD A;  3I4N H;  3C1E A;  4RA8 A;  1NR2 A;  1I4P A;  1EQQ A;  2DN8 A;  1HQR D;  3GTJ B;  1QOH A;  1NSN S;  1U4R A;  3FP9 A;  5ELD A;  4GKK L;  2ICE C;  2NVQ B;  2K4K A;  4MIU A;  3D6C A;  1KLU D;  1PZJ D;  1O7L A;  4DUZ L;  3FHW A;  1ET9 A;  4P72 A;  3UE1 A;  3RLN A;  1L0Y B;  1BVS A;  3PV0 A;  2HDL A;  4BBS B;  5EBC A;  3OOC A;  1G2T A;  1EY4 A;  2L0C A;  1EWH A;  4YY3 Q;  4RFB A;  1T9H A;  3PUY A;  4TRD A;  4Y7N H;  1XJV A;  2B2T C;  3D8G A;  3G6J B;  3M85 A;  3G48 A;  3MHB A;  4C3J H;  2PYK A;  5E4X A;  1IBK L;  1P16 A;  4I65 A;  1BO0 A;  1LTB D;  1PYW D;  4UAI A;  3W1G A;  4GKK Q;  2R3Z A;  3CXC A;  1HRJ A;  3D0F A;  3NPP A;  1QIL A;  1WCM H;  4A75 A;  1RDP D;  1B9N A;  3E0E A;  3HKZ B;  4JBJ A;  1EYC A;  4J1M A;  3PO3 H;  5KYI A;  3BZD B;  4JI6 L;  3BYT B;  5LL6 S;  3TDQ A;  3J81 E;  4Y7N B;  1EQV A;  3KUP A;  4RGO S;  1ESR A;  1D8L A;  1V9P A;  1VQA A;  1WD1 A;  4IUN A;  5C0X H;  4QGU A;  2VY3 A;  3PF5 A;  1D5M C;  5I2Y A;  3G6E A;  1WTH A;  1D5X C;  4LFB Q;  4FXK C;  3EVQ A;  1BBX C;  4KJN A;  3CCL A;  4JI3 L;  2OQ0 A;  2BE5 C;  2IW3 A;  1Y14 B;  4NMZ A;  1PH1 A;  1S5E D;  5EKI A;  1EZ8 A;  5IGG A;  3A54 A;  2NVX H;  2NVT H;  1AEX A;  2KVM A;  3ND9 A;  1Z6H A;  2RSO A;  3NSW A;  3TRE A;  2VQF Q;  1EYG A;  2PZT A;  3QWN A;  1ZEQ X;  4Q5V A;  1YZ6 A;  4JI8 Q;  2EJG C;  2B2Y C;  1CK1 A;  4L8J A;  3TRZ A;  1XX8 A;  3RD4 A;  5KND A;  2BOS A;  2NZO A;  3DXJ C;  3K5M A;  2WIN B;  1H9J A;  3TP8 A;  3NBI A;  5ELO A;  4LF8 L;  2PCF B;  1VQN A;  4DR3 L;  3CRL C;  4R9W A;  5KIX A;  1LAB A;  2Z6K A;  2NVT B;  1UE7 A;  3GTL H;  1VQE A;  1GUO A;  3M4Y A;  1CTM A;  3TZD A;  5JEA G;  5HUR A;  2CFM A;  4OO1 G;  2A6H D;  1TY0 A;  4LF7 L;  3I4O A;  2A68 C;  2EOT A;  4JI7 L;  2BDN A;  1FJG Q;  3KLR A;  1WTX A;  1ONL A;  2A19 A;  4KHZ A;  4R4I A;  1JT8 A;  5G3L D;  3OW2 A;  4JYA Q;  1BXT A;  4HID A;  2NVQ H;  1EY9 A;  2AHO B;  2KHI A;  1QE6 A;  4PG3 A;  5GQO A;  4KHP Q;  1S5B D;  3R93 A;  4JBK A;  1E24 A;  1I5F A;  4CDD C;  2Q2T A;  3H09 A;  2Q2I A;  5HY6 A;  3NHH A;  4MZ9 A;  4DUZ Q;  2UUC Q;  1QJO A;  4X65 Q;  3I4M B;  3GP7 A;  2VXW A;  4RKL A;  1CKM A;  5IYB H;  4R4C A;  4BY1 H;  1A6X A;  1ENA A;  4JG2 A;  2EYM A;  1J5E Q;  1EIF A;  3K5O A;  4A3M B;  1N33 Q;  3F2D A;  1N32 Q;  2PNH A;  2D0O A;  3BJU A;  3F1Z A;  3QR8 A;  3JAM L;  4X64 L;  1SR3 A;  1LT3 D;  1GHJ A;  2B29 A;  2K5Q A;  3L2P A;  2B2V A;  3FPP A;  1QUQ B;  1Y1V G;  4QY7 A;  1QVF A;  2K14 A;  3CMA A;  2XGT A;  2VB3 X;  5COR A;  2R92 B;  2QEJ C;  3ULP A;  1PTO D;  2L4N A;  4A3B B;  4JI6 Q;  4B9X A;  2R61 A;  2DJG C;  3PUZ A;  1GUT A;  3QG1 A;  2HCI A;  1XNR Q;  1CSQ A;  5C4H A;  3DWA A;  4A3M H;  1HA6 A;  4LFA Q;  4LK1 C;  4LUZ A;  4E6I A;  5AJ3 Q;  5JVH 3;  2JA7 H;  4WOR A;  2K7V A;  1SNM A;  1JWU D;  1FVI A;  1BBW A;  4H44 C;  5C5L A;  4HJA A;  1D5Z C;  1BUV T;  1FNV A;  3MVV A;  5I4D A;  4IOC A;  2OWO A;  3FKI G;  1JOK A;  4A3B H;  1QNU A;  3HOZ H;  1RF2 D;  5DEH A;  3PO2 B;  3E5S A;  3OIQ A;  4ZCK A;  2K52 A;  4JPB W;  1H9R A;  4JI8 L;  1ZYR C;  5DLQ E;  3K58 A;  2CH4 A;  1GUN A;  2EYF A;  2KCM A;  4DK0 A;  1C9O A;  4K2L A;  2HHH Q;  1GXD C;  4YWK A;  1G2S A;  2E76 C;  2VNU D;  3TP7 A;  2F52 A;  5C3E B;  1G6P A;  3OYY A;  2JN4 A;  3QJY A;  1LUZ A;  3CQZ H;  3FVQ A;  4OWW B;  4B3M L;  2SEB D;  5DNF A;  2KEN A;  1VQ8 A;  4FXD A;  1CM9 A;  3NBH A;  1K8G A;  4IN3 A;  4R8I A;  3GTK B;  3PO2 H;  2KOL A;  4L5S A;  2OCE A;  1SE2 A;  4PMC A;  1A2T A;  2WV6 D;  4OHJ A;  2AMC B;  4OGQ C;  4FF1 A;  4PMB A;  3Q24 A;  1LTG D;  1JOQ A;  2B2U A;  4OXP A;  3CC7 A;  2KHJ A;  4XIG S;  1E2Z A;  5KNC A;  1T5X D;  3H0G B;  3MXG A;  1X3F A;  3CCQ A;  2WAQ B;  2XRS D;  4RHS A;  1D7Q A;  3DHQ A;  1Q12 A;  4H7B A;  4HIO A;  4JI1 L;  4A3M G;  4C2M H;  5E4W C;  1PTO F;  2VUM B;  1CT1 D;  2EY5 A;  4JI5 L;  1DD2 A;  2V4D A;  3LX0 A;  3CP0 A;  4FVM A;  2F0O A;  3T1Y L;  1NNX A;  1Y1V B;  3KYH C;  4YWL A;  1WOC A;  2PQE A;  5ELN A;  1UE5 A;  1N36 Q;  2K32 A;  4O0A A;  2IX1 A;  2N8N A;  3D4W A;  3J7A V;  2B2T A;  4G7Z C;  3S17 B;  4ZKC B;  4DXG A;  2JEB I;  4GNX A;  4KHP L;  4DR2 Q;  4BY7 G;  3F2B A;  1VQF A;  4RH6 A;  4OIJ A;  4UPA A;  4IUQ A;  2Q8I B;  1SNO A;  1L0X B;  4KY7 A;  3HOW H;  2RHQ B;  2Z6K C;  3DM3 A;  5FJ8 G;  2E5L Q;  1SMX A;  3HKS A;  2QGQ A;  1U4P A;  4F88 A;  5FLM G;  3W3A A;  2G9D A;  3T1H L;  1G91 A;  1EU4 A;  1WFQ A;  2TSS A;  4XT1 B;  4QCL A;  1S5C D;  3VR6 A;  2JQO A;  3MZ5 A;  4MTK A;  2WB1 G;  4YIJ A;  1S40 A;  2EYL A;  2OTL A;  1TWA H;  4QUF A;  1O7Y A;  3I91 A;  1EWC A;  3HOW B;  1HZC A;  4PZ8 A;  2E75 C;  2KHS A;  4WJ4 A;  4C56 C;  1U5K A;  3EN2 A;  4AYB G;  5I6Y A;  4LAA A;  2PI2 A;  3E9I A;  4B3R L;  4EX5 A;  5LMU L;  1WCM G;  3HOU H;  3A0J A;  3A5U A;  2RDF A;  3C3L A;  3CKI B;  1FGB D;  2OXP A;  1M8A A;  2Q2H A;  1VQ6 A;  3PO3 G;  4DN4 M;  3PIP 3;  2F1M A;  1SYC A;  1DXM A;  2RDH A;  4PQX A;  3KDF A;  1KAA A;  3HRZ C;  1SMY C;  1QZG A;  1CQV A;  3D6W A;  3J81 c;  4GN4 B;  2K75 A;  1TR5 A;  3Q8D A;  3GTP B;  3FEW X;  1ROD A;  3W1B A;  2FXQ A;  4NXN L;  1PH8 A;  3S15 B;  1BCP B;  2BE5 D;  1IBL L;  1HR0 W;  1SNC A;  4GKJ L;  3DWQ A;  1D6E C;  2WAQ G;  3V05 A;  4CJ1 B;  2IX3 A;  4FDB A;  1WYD A;  1PFS A;  3VR4 A;  4U67 3;  1CKN B;  2XRQ D;  2K1B A;  5IP7 H;  2LKV A;  1EQT A;  3RLO A;  3NWS A;  2A6E C;  5IIF A;  3S16 B;  1SXT A;  5H1S E;  4NKL A;  1FL0 A;  2IX0 A;  3I8Z A;  1TS5 A;  3I90 A;  2NWG A;  2X6G A;  3Q23 A;  3L3O C;  1VQ4 A;  3GQB A;  1AP0 A;  3Q22 A;  1IBL Q;  1BOS A;  2C5C A;  1CZW A;  2OQK A;  1PH5 A;  1HZA A;  2Y0S E;  3HKZ G;  3BZK A;  4ME3 A;  3IL8 A;  4DV3 L;  2D0P A;  5GAH C;  1Z9F A;  5KRU A;  1CUK A;  1VQI A;  3F8T A;  3E0J A;  5M5X B;  2KED A;  2C9O A;  3HOZ G;  1E1O A;  1PYB A;  3FRP B;  1HFG A;  2F0H A;  2PI2 E;  4C3H B;  1VQJ A;  1A63 A;  4P75 A;  2CW0 D;  3PUV A;  4IQZ A;  4DV6 Q;  1I4R A;  1ZYR D;  5JJI A;  1X55 A;  3KBX A;  1S3O A;  3KF6 B;  4DR7 L;  2F0I A;  2MFI A;  4A3L H;  2WII B;  2WB1 B;  2LY7 A;  5BN5 A;  3NE5 B;  3UDF A;  1KQS A;  1I4H A;  3CCM A;  1F2M A;  5IYD G;  1TQO A;  3UDG A;  3UDI A;  3NEL A;  3RN2 A;  2UXC L;  4BA2 I;  4JBW A;  2QIL A;  1YHQ A;  1TWA B;  1X3P A;  3E9H A;  4A3L G;  4DR4 Q;  1SYD A;  4RG1 A;  3X3N A;  1EEF D;  3R8B A;  2L15 A;  3T13 A;  3DMU A;  3I4N G;  1NJI C;  5CV4 A;  4HJ8 A;  3IAY A;  5A35 A;  3MC0 B;  5C44 G;  1G6Z A;  1X32 A;  4OO1 I;  2EYO A;  4HIK A;  1VQ5 A;  3WDN A;  5LMU Q;  1UE6 A;  1KNA A;  4DAY B;  3M4P A;  3I56 A;  2XVS A;  1HQM C;  1YJN A;  1VF7 A;  2D9U A;  1B3A A;  2R7Z B;  3SEB A;  1J8I A;  2E2J B;  1RD9 D;  2HQE A;  1II3 A;  4HMJ A;  4LF8 Q;  4TVA B;  1GUG A;  5NUC A;  2F0N A;  4AQY Q;  1M90 C;  2K03 A;  4KTA A;  2IWH A;  3IKJ A;  1I6H H;  1TS4 A;  2X6L A;  4DAV A;  3GTL B;  3IFT A;  5J3B A;  3KF8 A;  2ASB A;  2I07 B;  2MUY A;  2ZJR A;  4ZAI A;  3J7A F;  4MNO A;  3TSS A;  5FK9 C;  2F4V Q;  1EIG A;  3TBI B;  1VMP A;  1SYF A;  2VZA A;  3AFQ A;  3MXN B;  1BCP C;  3SR1 A;  4A3E H;  1I3Q B;  5EKK A;  2ZTC A;  4V19 0;  4R1J A;  2R7Z H;  1A2U A;  3S16 H;  1H9S B;  4MHE A;  2R93 G;  4DV5 L;  5CMD A;  4A3E G;  1IL8 A;  4A3C H;  1MKH A;  1Z7T A;  1AE3 A;  2PQA B;  3BVZ A;  1K83 B;  3CCV A;  4KY5 A;  3L7Z C;  3VYR A;  4IFD H;  3J80 i;  2ID0 A;  2QDL A;  5IP7 G;  3NEN A;  4LF6 Q;  2IHE A;  5A2Q E;  1KAB A;  4XYQ A;  2VQE L;  1Q90 A;  1SLJ A;  4X62 L;  1E1T A;  5G3L F;  2ZXO A;  1YNN C;  4JC0 A;  1WTW A;  2L11 A;  4RMF A;  4BWG B;  4NW2 A;  2UUA L;  1X3G A;  5IP9 H;  1VQO A;  4BS9 A;  3OHX C;  1TWG B;  1OXX K;  5IGF A;  5CGK A;  3SK5 A;  1HNX Q;  5KGU A;  1YBY A;  3PGZ A;  3K0X A;  4O42 A;  2LS0 1;  1IBM L;  4ILW A;  2A1A A;  2YV5 A;  1LTT D;  3G71 A;  1EOT A;  4B3M Q;  4BBS H;  3CAM A;  3L0O A;  4IUT A;  4KKU A;  4QIW E;  2E5L L;  2Y0S G;  3HKZ E;  1EY5 A;  4UY8 C;  2WFW A;  4LUO A;  5M5W H;  3I55 A;  1HPC A;  3K59 A;  4C3J B;  1A3U A;  1HA5 A;  1JJ2 A;  1RIP A;  3JAM c;  1RCV D;  1HTP A;  3S1M H;  3TS0 A;  4IPG A;  2KUM A;  3I73 A;  4Y52 H;  2E2D C;  2JA7 B;  1GJX A;  5AJ3 L;  2P5Z X;  1OXU A;  2G5D A;  2F3I A;  4LWC A;  3MFY A;  5TSS A;  4DAP A;  4LF4 L;  2KCC A;  5ISR A;  1QVC A;  4BBR G;  1SJE D;  1S4Z A;  3KF6 A;  5C0X G;  3RZD B;  2R6G A;  4IJL A;  4DNR B;  2UXD Q;  5IWA Q;  5M5W B;  5DM7 3;  4K5X A;  1K28 A;  2BCO A;  4DK6 C;  4NPS A;  4V0B A;  3S1M B;  4F7X A;  1MD2 D;  1NMF A;  1N34 L;  4ZKB B;  1UAP A;  3F2U A;  1WTV A;  3LGJ A;  1DOL A;  3OWF A;  4U68 A;  1G8Z D;  4ID6 A;  1B3Q A;  4TKO B;  5C3E H;  1YNJ C;  1S5F D;  2KQ3 A;  2DNC A;  2FFK B;  1RL2 A;  1SBB B;  3GD7 A;  4I7Z C;  3H15 A;  5IWA L;  4DXF A;  5I2X A;  4XQN A;  3NEM A;  1XMO Q;  1OXT A;  5FO7 B;  1W6J A;  5GAD C;  2J4X A;  2F0E A;  4ZRZ A;  2Z6B A;  3NP8 A;  4A76 A;  1HR0 L;  2IJ0 A;  4A3K G;  3QB3 A;  3H0G G;  4A3E B;  1A3V A;  3A7L A;  2DUD A;  1EY8 A;  4OEL B;  2I0Q A;  4P71 A;  3CCU A;  1XNR L;  4DV2 Q;  4LMQ D;  2WAC A;  2QF7 A;  1X3E A;  1KDC A;  5CC4 A;  5M5Y H;  1HJP A;  5EGT A;  4KKT A;  3SGI A;  3S1Q H;  4FYD A;  1BNZ A;  4S3S A;  3W5O A;  1V43 A;  1IZ6 A;  1U4L A;  1W6K A;  1PZK D;  2B2W C;  3FPU B;  3DM1 A;  3STB D;  2PQA A;  4DV6 L;  4LF7 Q;  1EFI D;  1PTO B;  4C2M B;  2L5T A;  1VQC A;  1K8A C;  1BDO A;  3I2Z A;  4GNX C;  3JAM E;  2EXD A;  4IOA A;  3T1H Q;  1VQM A;  3VA5 A;  1AZQ A;  3FDT A;  1NTG A;  3CD6 A;  4K5W A;  3BYY B;  3E6Z X;  4QUC A;  2EYJ A;  1STE A;  1TU2 B;  4C3J G;  5HGT A;  4HAE A;  3OMG A;  5IT9 c;  5LHY 1;  1JR0 D;  1SE8 A;  4DV7 L;  2JA7 G;  2MP1 A;  1CQF A;  3N6R A;  4O2D A;  1K73 C;  1WD0 A;  3MXU A;  1FD7 D;  2PZW A;  2XIW A;  1W3S A;  2YTV A;  5FLX c;  4A3C G;  4B3S L;  3U4V A;  4HMI A;  1SRU A;  2HIX A;  2ZM6 L;  1SE3 A;  2BA1 A;  4RGN A;  1SYB A;  4DFA A;  1ICW A;  4X64 Q;  1LTA D;  1UEA B;  3HZX A;  3P7J A;  1CA5 A;  4LF4 Q;  5JAV A;  1M4V A;  1UE1 A;  2JJQ A;  3G4S A;  1W2B A;  1MSG A;  1STG A;  3S14 H;  1YHA A;  4JOI C;  1ASY A;  1IYV A;  4A3F B;  3RZO B;  3BG3 A;  4QB4 A;  2XTI A;  2FJ2 A;  2ZJP A;  1HXY D;  3R2I A;  1E0B A;  3SK8 A;  2EY1 A;  3TZU A;  4CDC C;  1TVX A;  4K0K L;  3HOU B;  1NBW A;  2ZTE A;  2RKS A;  3A55 A;  2K5D A;  1LTS D;  3HS0 C;  1N33 L;  2JA6 G;  3P20 A;  1YNJ D;  2RHS B;  1PLF A;  1ZXT A;  2R7D A;  4UHV A;  3TS2 A;  3PIO A;  1KAW A;  3M7N A;  1Y1W B;  4A3K B;  3K0Y A;  4GN3 B;  3H91 A;  1K8O A;  5BN3 A;  1FYC A;  2OEO A;  4IUU A;  1B53 A;  2NZH A;  3RZO H;  3J80 L;  3CRK C;  4KLK A;  2N78 A;  2EVB A;  4FNF A;  4KKS A;  4N8X 1;  2I5M X;  1MSH A;  1STY A;  2B8F A;  2F4V L;  2A6E D;  1B44 D;  3GTQ H;  2LFN A;  3SK6 A;  4B3R Q;  2A69 C;  1IBK Q;  1EU3 A;  2D2C C;  1AZP A;  1E2V A;  3J80 E;  2EZV A;  3S1Q B;  2JSO A;  2QW7 A;  4JOI A;  4A3B G;  1X9N A;  4XDX A;  3KDF B;  4HN7 A;  1NMG A;  1OXS C;  3GO5 A;  4A3K H;  1R9T B;  4IPC A;  4DAM A;  3JC6 6;  1DOM A;  1X65 A;  5FJ8 H;  5FLM H;  1PMR A;  1YNX A;  4JK1 C;  3J80 c;  2PW7 A;  2CVR A;  4DR6 L;  4B08 A;  3HOY G;  4WFN 3;  3PIO 3;  2F03 A;  1XNQ L;  2I5H A;  1EIY B;  2HDM A;  3CW2 C;  1PH3 A;  4NXM L;  2GN5 A;  5DAU A;  3ZYY X;  2VQF L;  1PH7 A;  1J6Q A;  5T1I A;  1VDZ A;  3WOF A;  1FGU A;  4LUV A;  3SE0 A;  3GTQ B;  1EYA A;  3V2T A;  4KY6 A;  4C3H G;  2ZM6 Q;  1VQL A;  2UU9 Q;  1VQG A;  2ZJQ A;  1HUN A;  1CKN A;  4IUV A;  3RNU A;  4PZ7 A;  5T1G A;  1PA6 A;  2F0K A;  4YCU A;  3VYT A;  4X3K A;  1GO3 E;  2ATW A;  3VYS A;  2OT2 A;  4CKC A;  4LFC L;  1GD7 A;  3UDX A;  2E2I H;  1GUW A;  3H0G H;  4RKB A;  4DAY A;  4EQO A;  1NUC A;  4P73 A;  4C3H H;  4YHH L;  2E8G A;  4ME5 A;  4UP8 A;  5EKL A;  1KDB A;  1MJE A;  1CSP A;  3HOV B;  4A4I A;  4DR1 L;  1BQQ T;  2L9H A;  2QEX A;  3D4D A;  4MN3 A;  5ELC A;  4C1N I;  1Q82 C;  5LMN Q;  1VQH A;  1WJJ A;  1SFO H;  4EQ5 A;  3Q0A A;  4IO9 A;  4HED A;  3SHL A;  3M9B A;  4JI4 L;  2N55 A;  4IPD A;  2NN6 I;  3SVM A;  2I5L X;  3S24 A;  4DV4 L;  1F9R A;  5K36 H;  4DUY L;  2HHH L;  3S17 H;  1A15 A;  4IPH A;  3WWV A;  2E2I B;  1SAP A;  4ZK9 B;  1MJC A;  3SDZ A;  4LF9 L;  1I4G A;  4LFA L;  1N9W A;  5C6A A;  3BVM A;  1FNW A;  2MNA A;  3CC4 A;  2CCZ A;  1KDA A;  1UUP A;  1UNS A;  4HSV A;  1V1P A;  3PCO B;  3NBH B;  4LNQ A;  4CKB A;  3AYH B;  2CW0 C;  1H9K A;  3KOJ A;  2JA6 B;  1BCP D;  1D1I A;  4G4K A;  1QZH A;  5E1F A;  3PSI A;  1Y1W G;  2HIV A;  1QB5 D;  2FHT A;  5D14 A;  1R4P B;  2EY6 A;  4X3T A;  1R4Q B;  2MHV A;  1N34 Q;  3TP6 A;  4BBS G;  2B63 B;  2E2H B;  5J22 A;  4EQN A;  2QDB A;  3MFG A;  3CCE A;  2VB2 X;  2VUM G;  2E2J H;  3T16 A;  4YHH Q;  3R3O A;  4HJ9 A;  2EIF A;  4OWX B;  2Q2U A;  3NTI A;  1IW7 C;  5M9O A;  1EZ6 A;  4TQU S;  2L12 A;  1XXG A;  1HTL D;  1I6V C;  4GKJ Q;  2R93 B;  3EIV A;  1GOZ A;  4BY7 B;  4CGY B;  3RN5 A;  3QOL A;  1YEZ A;  1U9R A;  2F3W A;  2NYZ D;  2AUK A;  2IPK D;  3A5Z B;  4N9P A;  1B50 A;  1IBM Q;  4GLX A;  3H6M A;  4WJ3 M;  1LT4 D;  3PQI A;  4J6H A;  3C2P A;  4PNY A;  1SND A;  4RWS C;  1XTC D;  3GTP H;  4FP5 D;  1G51 A;  3T53 B;  1J9O A;  1SDF A;  5JJK A;  4YCW A;  1RKN A;  2FMC A;  2RF4 A;  3U9O A;  2JA8 B;  2O5I C;  2B2Y A;  2AWO A;  4JI0 Q;  1B2T A;  4BY7 H;  4A3J G;  5JPN C;  3MTS A;  2KJX A;  1LTI D;  2XNA C;  4KD4 A;  3K57 A;  4AH6 A;  1PH4 A;  2SNS A;  3TME A;  2RCN A;  5IT9 L;  1C7Y A;  2MQH A;  4C1N K;  3HOV G;  1PFN A;  1PXU A;  3A8K E;  1S72 A;  1STN A;  1VF5 C;  1DON A;  1TWG H;  5M3F G;  2IL8 A;  4FF2 A;  1CA6 A;  3UI2 A;  1CFM A;  1TII D;  3TQY A;  5BR8 Q;  2WKD A;  3S1R B;  4KV6 A;  5LMN L;  1L1O C;  1TWH B;  2I46 A;  4NP5 A;  1U4M A;  4DR5 Q;  3C1F A;  2HD3 A;  4RGT A;  4F8M A;  3GTM B;  3ERO A;  4DR6 Q;  3A8J E;  3EBE A;  1PDQ A;  5C0X J;  4CJ0 B;  2ENB A;  4BBR B;  3CCS A;  5M5X H;  4X62 Q;  1T5E A;  1ASZ A;  3I4M G;  3QOJ A;  3IRB A;  3NQT A;  2Z9H A;  3GTG B;  4LF5 L;  3DUZ A;  3AFP A;  4O1N A;  2QKI C;  4H13 C;  4DKA C;  1YJ9 A;  2ICI A;  1PH9 A;  1JE5 A;  4DR5 L;  3VDY A;  2B63 G;  3S2D B;  4HIM A;  1JE4 A;  3EA6 A;  3I70 A;  3W2D A;  4OX9 Q;  2F0V A;  5CV5 A;  1IYU A;  1LT6 D;  2PW5 A;  5FO9 B;  3J7A 5;  3RUZ A;  4A3G B;  4QL5 A;  4JI4 Q;  1AW7 A;  1ILQ A;  3BDO A;  3ONA B;  2MJ8 A;  1SEB D;  2F3V A;  2Z1C A;  5CV7 A;  2NBF A;  4UP7 A;  2NTS A;  2K5N A;  5C4J B;  2ZT9 C;  3T4A C;  3DEP A;  2NN6 G;  4K8I A;  4HR7 B;  1VQ7 A;  4B9W A;  3K6O A;  1KIX A;  1TWF H;  3KJP A;  3K5N A;  5FLX E;  3K8A A;  5KYL A;  4BXX G;  3LNN A;  3A74 A;  2R93 H;  3BS1 A;  1TWC B;  4XXE A;  1I94 Q;  4A3G H;  2UXD L;  5ELF A;  4HJ7 A;  3OPO A;  2A8V A;  1HUM A;  2Z4H A;  1WTR A;  2UU9 L;  4K6D A;  3CCR A;  1STA A;  4DK3 C;  1B8A A;  1CKO A;  4UP9 A;  4QQB X;  4J15 A;  5CBA E;  3ZJY C;  1BR9 A;  2EYH A;  2LXK A;  3PO2 G;  4EQP A;  4A3J B;  2WP8 J;  3GV3 A;  4P2C B;  5IE8 A;  1I6H B;  3MAQ A;  5IGD A;  1JOO A;  1LV9 A;  1B9M A;  1SN8 A;  3IFD A;  4X66 L;  2JA8 H;  1EL0 A;  4BA1 I;  4X65 L;  3U58 A;  1TWC H;  3EJI A;  1PTO H;  2PMZ B;  4DV1 Q;  1JQY D;  4C3I B;  4ABN A;  1CHQ D;  2HCC A;  1ILP A;  2NN6 H;  2AQ1 B;  1ENC A;  1OO9 B;  4JI0 L;  4MTN A;  1K0R A;  3FKI B;  2NVY H;  2AQ3 B;  5HGQ A;  1V8Q A;  1VQP A;  5IY0 A;  1Q81 C;  4LFC Q;  4JYA L;  2LXJ A;  1X6O A;  3MEF A;  3O13 A;  2ALY B;  2SDF A;  1LM0 A;  4A3J H;  4BY1 G;  5CBE E;  2EPB A;  2GVB A;  3S1R H;  1K83 H;  3J7Z C;  4POG A;  3GTM H;  2V1C C;  1V1Q A;  2XSC A;  3T51 B;  3HOX G;  2CKZ B;  2H1E A;  2XN9 C;  5C0X I;  4JV5 Q;  3HGB A;  1Q1B A;  1O80 A;  3CME A;  2JXM B;  5LMN W;  4OON A;  4BBR H;  3CPW A;  1HNZ Q;  5J1Z A;  3U4Z A;  2UUA Q;  1HCZ A;  5K5P A;  4GLA C;  3FKI H;  4DK1 A;  5M3M H;  3NUC A;  2F0T A;  2A73 B;  4CHT B;  4B3T Q;  3QIA A;  2EY2 A;  3MXP A;  4A3G G;  2K5V A;  4L6T B;  1TKW B;  4L5Q A;  2UXC Q;  2F0U A;  5CV8 A;  3S14 B;  1EEI D;  2F0L A;  3BDL A;  3K80 C;  3EFX D;  3KF8 B;  4WJW A;  4X3S A;  1Q8I A;  3I4L A;  5M3M G;  3VR5 A;  2R7F A;  2CQO A;  1BF4 A;  3HEJ A;  3BZC A;  5KNB A;  1Z47 A;  1VQB A;  1QVG A;  4JBM A;  2KCN A;  5CR3 A;  2UUB L;  2B8G A;  1ENF A;  3ITP A;  3L9A X;  4LFB L;  2YTY A;  3X3M A;  5JEA J;  1HNW Q;  2CQA A;  2RDG A;  4Z9C B;  1FR3 A;  3M4Q A;  1XTD A;  2DJF C;  4R4Q A;  4L5R C;  4H02 A;  3D3R A;  2KBN A;  1KNE A;  4IAL A;  3P1H A;  1Y1W H;  4CJ2 C;  3TN2 A;  1XPR A;  4JI2 Q;  4M1U B;  3ND8 A;  3RZD H;  3AU7 A;  4IZ8 A;  2K50 A;  2EYP A;  1TT2 A;  4LJZ C;  3TP5 A;  2FIN B;  4RCO A;  4M8A A;  1FJG L;  2AUJ D; 
#chains in the Genus database with same CATH homology
 5I9O A;  1O78 A;  1PRT C;  4G7H C;  1EY7 A;  1CI3 M;  4HCS A;  2F0S A;  2F0P A;  2HUG A;  2Q8T A;  2Y0S B;  5FKA C;  2M00 A;  5EPL A;  2A68 D;  5A2Q L;  4X3U A;  1WCM B;  3CHB D;  5COY A;  4DGZ A;  4IUP A;  2K28 A;  5AFW A;  3PO3 B;  1PRT D;  1HHV A;  2F0D A;  3PUW A;  1D1K A;  3PUX A;  3V96 A;  5M5Y B;  2NVY B;  2E74 C;  1C8C A;  1KLG D;  3DWP A;  3KLS X;  4AYB B;  5JJZ A;  3HOX B;  1S5D D;  3OSO A;  1O7Z A;  5DM6 3;  4RCN A;  1VMC A;  1AN8 A;  2AWN A;  2JYO A;  1XYI A;  4ZYS A;  4NDX A;  5IT9 E;  3K7A B;  2B2V C;  4ULL A;  4EGV A;  4DF7 A;  2K5W A;  3GTO B;  1EIH A;  5LL6 X;  5EPK A;  5CV6 A;  1B4O A;  3OWE B;  2X69 A;  4HTH A;  1SJH D;  3KLS A;  4FO2 A;  2KA7 A;  3D4R A;  2EJM A;  2CHB D;  4RGM A;  3QO2 A;  1STH A;  1DOK A;  5JEA H;  4A3D B;  4FF3 A;  1I4Q A;  5JVG 3;  2F0G A;  3LWE A;  3VR2 A;  4L63 B;  4IFD J;  4F87 A;  2J7Z A;  4KK7 A;  1NCV A;  1BCP F;  5IGC A;  3RMH A;  1JC7 A;  2A5H A;  4A93 B;  1H9M A;  3AB9 A;  2K33 A;  2G9H D;  2F0M A;  1SNP A;  2M2L A;  2KEE A;  3NXW A;  3NTK A;  5D65 A;  1QWY A;  4IFD G;  2EE1 A;  2MPM A;  1LTR D;  2YU9 B;  1I50 B;  4XYO A;  2MGS A;  4XT3 B;  3I72 A;  1LLR D;  2PNR C;  5ELE A;  1FNU A;  1IKM A;  3H3V C;  4ZUI A;  1PTO C;  3HG9 A;  1EY0 A;  1ML0 D;  5FLX L;  1IW7 D;  4XTC S;  1VCI A;  4H0L C;  2PO4 A;  3RLF A;  4CKE A;  3FMC A;  3R2T A;  3I3C A;  1C48 A;  3EQL C;  2RSN A;  1DZ1 A;  2K04 A;  5J39 A;  2F0J A;  1JWS D;  1LAC A;  4EVO A;  2EDG A;  2RBM A;  4K2K A;  5IOC A;  3S2H B;  3PMF A;  3S1N B;  2NTT A;  3WOE A;  2Z4I A;  1ESF A;  4K8J A;  2A69 D;  3A56 A;  1RTO A;  2BA0 A;  2QCP X;  5JOB A;  1H9S A;  3VR3 A;  5EPJ A;  1I4X A;  2TMP A;  1MGS A;  3BVG A;  3CQZ B;  4Q0F A;  2XWB B;  4OL7 A;  5EJW A;  2K01 A;  5D3I B;  3MXN A;  1SFO B;  2DNE A;  3J7Y W;  2RA4 A;  3M7G A;  4RHR A;  4FXG C;  2A6H C;  3HOY B;  4UDU C;  3K5L A;  1QG7 A;  4PMW A;  1CHP D;  3KBG A;  5ELB A;  1RJT A;  1TWF B;  2K6A A;  1MBY A;  4KHV A;  3M3Y B;  1PRT B;  1SE4 A;  4R8N A;  2NUC A;  2JP1 A;  2IT1 A;  4ODG A;  3U9S A;  1SNQ A;  4CBV A;  5BN4 A;  2F0Q A;  3DEO A;  4DU9 A;  5I6W A;  5CYU A;  5C3W A;  3D31 A;  3OMC A;  2AQ2 B;  4KI0 A;  3J81 L;  1SSO A;  2A74 C;  1SYE A;  1Y8N B;  4C3I G;  1PFB A;  5D3D A;  3S9W A;  3CU7 A;  1CZG A;  3KK7 A;  1RHP A;  3M4O B;  4K5V A;  2Z8L A;  2YYZ A;  5CV9 A;  4KD3 A;  4BY1 B;  5KEE A;  1Q1E A;  1GUS A;  1Y8O B;  2J0T D;  5EQ0 A;  2B2W A;  3VA7 A;  4IFD I;  4A3I B;  2RVL A;  2DY8 A;  1YNN D;  2ZXR A;  3LWU A;  2EJF C;  3NWT A;  2OF1 A;  2ZXP A;  5I9P A;  2NZ1 D;  1Y69 U;  2N88 A;  4ZLT F;  5IGB A;  3OW7 A;  1IKL A;  2FMM A;  1A3T A;  1GHK A;  4J8Q A;  2PZU A;  1WTP A;  4G7O C;  3MEH A;  1IHZ A;  4ZQ3 A;  5C5M A;  2M9V A;  3Q6S A;  1F9Q A;  1V1O A;  3MA2 B;  5M3M B;  1STB A;  2H4O A;  1F2Y A;  4ZUJ A;  2O4X A;  3C46 A;  4QIW B;  3SXH A;  1LO5 D;  1F2L A;  1TS3 A;  2F0F A;  1PRT F;  3VYU A;  3HOZ B;  2O5J C;  2DY7 A;  4N9T A;  5FOB B;  1DM0 B;  2BDO A;  1NR4 A;  1MI2 A;  4XQJ A;  1PZI D;  3MWY W;  4K14 A;  1KTK A;  1JWM D;  5IGE A;  1LT5 D;  1B1Z A;  4TSS A;  4WRD A;  1TS2 A;  1Q3L A;  1Y8P B;  4KMU C;  5M3F B;  2XWJ B;  3NK9 A;  4KN7 C;  2Q8R E;  1PFM A;  5C3X A;  2SNM A;  1C4Q A;  3I4N B;  4OO1 H;  3ERQ A;  3G7L A;  4KN4 C;  5C44 B;  1F9P A;  3AMU A;  1WTO A;  1JIC A;  1XWE A;  1DJR D;  5K36 G;  1OXV A;  1E2W A;  5JPM C;  4RAU C;  2JE6 I;  2D62 A;  1F9S A;  3T56 B;  2KEC A;  3NQI A;  1RTN A;  2NB0 A;  1DYQ A;  2PPB C;  1TY2 A;  2LMC B;  1QNK A;  4OIK A;  1JB3 A;  2O2L D;  4XQQ A;  1ZKO A;  1JCK B;  4DNT B;  2B39 A;  1WTQ A;  1DCZ A;  3GV6 A;  1SYG A;  2JA5 B;  3H94 A;  3URY A;  4K6L A;  3SK4 A;  5FO8 B;  1QCB D;  1ET6 A;  4HCE A;  1V1P B;  1AFP A;  1F2Z A;  3P75 A;  4G57 A;  3NTH A;  1NAP A;  2D5D A;  2L55 A;  2SOB A;  2B2U C;  5E3F A;  4HSP A;  1D2B A;  1X3Q A;  4QF4 A;  2NVX B;  4IUR A;  1SMY D;  5F2D A;  2F4I A;  1EY6 A;  4DA2 A;  2L1B A;  3HP3 A;  1WVL A;  2F0W A;  5C4X B;  5C4Z A;  3N52 A;  2JEA I;  2GA4 B;  4FF4 A;  2K05 A;  4KJO A;  2WKC A;  3OIP A;  4QMG A;  2EXZ A;  5IOD A;  1HFN A;  2RQX A;  1K8M A;  3A8I E;  4PV1 C;  5EBD A;  3A7A B;  1JOR A;  1F77 A;  4GZY C;  1G29 1;  3BDC A;  1EYD A;  3C1E A;  4RA8 A;  1NR2 A;  1I4P A;  2DN8 A;  1HQR D;  3GTJ B;  1QOH A;  1NSN S;  1U4R A;  5ELD A;  2NVQ B;  2ICE C;  4MIU A;  3D6C A;  1KLU D;  1PZJ D;  1O7L A;  1ET9 A;  1L0Y B;  3PV0 A;  2HDL A;  4BBS B;  5EBC A;  3OOC A;  1G2T A;  1EY4 A;  2L0C A;  1EWH A;  4RFB A;  3PUY A;  4TRD A;  2B2T C;  3D8G A;  3G6J B;  3M85 A;  3MHB A;  2PYK A;  5E4X A;  4I65 A;  1BO0 A;  1LTB D;  1PYW D;  4UAI A;  2R3Z A;  1HRJ A;  3NPP A;  1QIL A;  1RDP D;  1B9N A;  3HKZ B;  1EYC A;  4J1M A;  5KYI A;  3BZD B;  3BYT B;  5LL6 S;  3TDQ A;  3J81 E;  4Y7N B;  1EQV A;  3KUP A;  4RGO S;  1ESR A;  1WD1 A;  4IUN A;  5C0X H;  1D5M C;  5I2Y A;  1D5X C;  4FXK C;  3EVQ A;  1BBX C;  4KJN A;  2BE5 C;  2IW3 A;  4NMZ A;  1S5E D;  5EKI A;  1EZ8 A;  5IGG A;  3A54 A;  1AEX A;  2KVM A;  3ND9 A;  1Z6H A;  2RSO A;  3NSW A;  2PZT A;  3QWN A;  1ZEQ X;  4Q5V A;  2EJG C;  2B2Y C;  1CK1 A;  4L8J A;  1XX8 A;  3RD4 A;  5KND A;  2BOS A;  3DXJ C;  3K5M A;  2WIN B;  1H9J A;  3TP8 A;  3NBI A;  2PCF B;  3CRL C;  4R9W A;  5KIX A;  1LAB A;  2NVT B;  1GUO A;  3M4Y A;  1CTM A;  3TZD A;  5JEA G;  5HUR A;  4OO1 G;  2A6H D;  1TY0 A;  2A68 C;  2EOT A;  2BDN A;  3KLR A;  1WTX A;  1ONL A;  4KHZ A;  5G3L D;  1BXT A;  1EY9 A;  1QE6 A;  1S5B D;  3R93 A;  3H09 A;  3NHH A;  1QJO A;  3I4M B;  3GP7 A;  2VXW A;  4RKL A;  1A6X A;  1ENA A;  2EYM A;  3K5O A;  4A3M B;  3JAM L;  1LT3 D;  1GHJ A;  2K5Q A;  2B2V A;  3FPP A;  2VB3 X;  5COR A;  2R92 B;  2QEJ C;  1PTO D;  2L4N A;  4A3B B;  4B9X A;  2R61 A;  3PUZ A;  1GUT A;  3QG1 A;  2HCI A;  5C4H A;  3DWA A;  1HA6 A;  4LK1 C;  4E6I A;  5JVH 3;  4WOR A;  2K7V A;  1SNM A;  1JWU D;  4H44 C;  5C5L A;  1D5Z C;  1BUV T;  1FNV A;  3MVV A;  5I4D A;  1JOK A;  1QNU A;  1RF2 D;  5DEH A;  3PO2 B;  3E5S A;  3OIQ A;  1H9R A;  1ZYR C;  3K58 A;  1GUN A;  2EYF A;  4DK0 A;  4K2L A;  1GXD C;  1G2S A;  2E76 C;  2VNU D;  3TP7 A;  5C3E B;  3QJY A;  3FVQ A;  2SEB D;  5DNF A;  4FXD A;  1CM9 A;  3NBH A;  4IN3 A;  4R8I A;  3GTK B;  2KOL A;  1SE2 A;  4PMC A;  1A2T A;  2WV6 D;  4OHJ A;  4OGQ C;  4FF1 A;  4PMB A;  3Q24 A;  1LTG D;  1JOQ A;  2B2U A;  4XIG S;  1E2Z A;  5KNC A;  1T5X D;  3H0G B;  3MXG A;  2WAQ B;  2XRS D;  4RHS A;  3DHQ A;  1Q12 A;  4H7B A;  5E4W C;  1PTO F;  2VUM B;  1CT1 D;  2EY5 A;  1DD2 A;  2V4D A;  3LX0 A;  4FVM A;  2F0O A;  1Y1V B;  2PQE A;  2K32 A;  2IX1 A;  3D4W A;  3J7A V;  2B2T A;  4G7Z C;  3S17 B;  4ZKC B;  4DXG A;  2JEB I;  4RH6 A;  4OIJ A;  4IUQ A;  2Q8I B;  1SNO A;  1L0X B;  4KY7 A;  1U4P A;  4F88 A;  3W3A A;  2G9D A;  1G91 A;  1EU4 A;  2TSS A;  4XT1 B;  4QCL A;  1S5C D;  3VR6 A;  3MZ5 A;  4YIJ A;  2EYL A;  4QUF A;  1O7Y A;  3I91 A;  1EWC A;  3HOW B;  2E75 C;  2KHS A;  4C56 C;  5I6Y A;  4LAA A;  2RDF A;  3C3L A;  3CKI B;  1FGB D;  2OXP A;  1M8A A;  4DN4 M;  3PIP 3;  2F1M A;  1SYC A;  1DXM A;  2RDH A;  4PQX A;  1KAA A;  3HRZ C;  1SMY C;  1CQV A;  3D6W A;  1TR5 A;  3GTP B;  3FEW X;  1ROD A;  3S15 B;  1BCP B;  2BE5 D;  1SNC A;  3DWQ A;  1D6E C;  3V05 A;  4CJ1 B;  2IX3 A;  3VR4 A;  4U67 3;  2XRQ D;  2K1B A;  2LKV A;  1EQT A;  3NWS A;  2A6E C;  5IIF A;  3S16 B;  1SXT A;  4NKL A;  2IX0 A;  3I8Z A;  1TS5 A;  3I90 A;  2NWG A;  2X6G A;  3Q23 A;  3L3O C;  1AP0 A;  3GQB A;  3Q22 A;  1BOS A;  2C5C A;  1CZW A;  3IL8 A;  5KRU A;  3E0J A;  5M5X B;  2KED A;  2C9O A;  3FRP B;  1HFG A;  2F0H A;  4C3H B;  2CW0 D;  3PUV A;  4IQZ A;  1I4R A;  1ZYR D;  3KBX A;  2F0I A;  2WII B;  2WB1 B;  2LY7 A;  5BN5 A;  3NE5 B;  1I4H A;  1F2M A;  1TQO A;  4BA2 I;  4JBW A;  2QIL A;  1TWA B;  1X3P A;  1SYD A;  3X3N A;  1EEF D;  3R8B A;  3T13 A;  3DMU A;  5CV4 A;  3IAY A;  5A35 A;  3MC0 B;  1G6Z A;  1X32 A;  4OO1 I;  2EYO A;  3WDN A;  1KNA A;  2XVS A;  1HQM C;  1VF7 A;  2D9U A;  1B3A A;  2R7Z B;  3SEB A;  1J8I A;  2E2J B;  1RD9 D;  2HQE A;  1II3 A;  4HMJ A;  5NUC A;  1GUG A;  2F0N A;  2K03 A;  4KTA A;  2IWH A;  3IKJ A;  1TS4 A;  2X6L A;  4DAV A;  3GTL B;  3IFT A;  3KF8 A;  2I07 B;  2MUY A;  4ZAI A;  3J7A F;  3TSS A;  5FK9 C;  1EIG A;  3TBI B;  1VMP A;  1SYF A;  3SR1 A;  1BCP C;  1I3Q B;  5EKK A;  4V19 0;  1A2U A;  1H9S B;  4MHE A;  5CMD A;  1IL8 A;  1Z7T A;  3BVZ A;  1K83 B;  4KY5 A;  3L7Z C;  3VYR A;  4IFD H;  2ID0 A;  5A2Q E;  1KAB A;  4XYQ A;  1Q90 A;  5G3L F;  2ZXO A;  1YNN C;  1WTW A;  2L11 A;  4BWG B;  4NW2 A;  4BS9 A;  3OHX C;  1TWG B;  1OXX K;  5IGF A;  5CGK A;  3SK5 A;  5KGU A;  4O42 A;  2LS0 1;  4ILW A;  1LTT D;  1EOT A;  4IUT A;  4KKU A;  1EY5 A;  1HPC A;  3K59 A;  4C3J B;  1A3U A;  1HA5 A;  1RCV D;  1HTP A;  2KUM A;  3I73 A;  2E2D C;  2JA7 B;  1GJX A;  1OXU A;  3MFY A;  5TSS A;  4DAP A;  2KCC A;  5ISR A;  1SJE D;  1S4Z A;  5C0X G;  3RZD B;  2R6G A;  4DNR B;  5M5W B;  5DM7 3;  4K5X A;  2BCO A;  4V0B A;  3S1M B;  4F7X A;  1MD2 D;  4ZKB B;  1UAP A;  3F2U A;  1WTV A;  1DOL A;  3OWF A;  4U68 A;  1G8Z D;  4ID6 A;  4TKO B;  1YNJ C;  1S5F D;  2KQ3 A;  2DNC A;  2FFK B;  1SBB B;  3GD7 A;  4I7Z C;  4DXF A;  5I2X A;  4XQN A;  1OXT A;  5FO7 B;  1W6J A;  2J4X A;  2F0E A;  4ZRZ A;  3NP8 A;  2IJ0 A;  3QB3 A;  4A3E B;  1A3V A;  3A7L A;  1EY8 A;  2WAC A;  4LMQ D;  2QF7 A;  5CC4 A;  1KDC A;  5EGT A;  4KKT A;  4FYD A;  1BNZ A;  4S3S A;  1V43 A;  1U4L A;  1W6K A;  1PZK D;  2B2W C;  3FPU B;  3DM1 A;  1EFI D;  1PTO B;  4C2M B;  2L5T A;  1BDO A;  3JAM E;  3VA5 A;  1AZQ A;  3FDT A;  4K5W A;  3BYY B;  3E6Z X;  4QUC A;  2EYJ A;  1STE A;  1TU2 B;  4C3J G;  5HGT A;  4HAE A;  3OMG A;  5LHY 1;  1JR0 D;  2MP1 A;  1CQF A;  3N6R A;  1WD0 A;  3MXU A;  1FD7 D;  2PZW A;  2XIW A;  4HMI A;  1SE3 A;  2BA1 A;  4RGN A;  1SYB A;  4DFA A;  1ICW A;  1LTA D;  1UEA B;  3HZX A;  3P7J A;  1CA5 A;  5JAV A;  1M4V A;  1MSG A;  1STG A;  1IYV A;  4A3F B;  3RZO B;  3BG3 A;  4QB4 A;  2FJ2 A;  1HXY D;  3R2I A;  3SK8 A;  1E0B A;  2EY1 A;  3TZU A;  1TVX A;  3HOU B;  2RKS A;  3A55 A;  2K5D A;  1LTS D;  3HS0 C;  3P20 A;  1YNJ D;  1PLF A;  1ZXT A;  3M7N A;  1Y1W B;  4A3K B;  3K0Y A;  3H91 A;  1K8O A;  5BN3 A;  1FYC A;  2OEO A;  4IUU A;  1B53 A;  3J80 L;  3CRK C;  2EVB A;  4FNF A;  4KKS A;  1MSH A;  1STY A;  2B8F A;  2A6E D;  1B44 D;  2LFN A;  3SK6 A;  2A69 C;  1EU3 A;  2D2C C;  1AZP A;  1E2V A;  3J80 E;  2EZV A;  3S1Q B;  2JSO A;  4XDX A;  4HN7 A;  3GO5 A;  1OXS C;  1R9T B;  1DOM A;  1PMR A;  4JK1 C;  2PW7 A;  2CVR A;  4B08 A;  4WFN 3;  3PIO 3;  2F03 A;  2HDM A;  5DAU A;  3ZYY X;  5T1I A;  1VDZ A;  3WOF A;  3SE0 A;  3GTQ B;  1EYA A;  3V2T A;  4KY6 A;  4C3H G;  1HUN A;  4IUV A;  5T1G A;  2F0K A;  3VYT A;  4X3K A;  3VYS A;  2OT2 A;  4CKC A;  1GUW A;  4RKB A;  4DAY A;  4EQO A;  1NUC A;  4ME5 A;  5EKL A;  1KDB A;  3HOV B;  1BQQ T;  2L9H A;  3D4D A;  4MN3 A;  5ELC A;  4C1N I;  3Q0A A;  4HED A;  3SHL A;  2N55 A;  2NN6 I;  3SVM A;  1F9R A;  5K36 H;  1A15 A;  2E2I B;  1SAP A;  4ZK9 B;  3SDZ A;  1I4G A;  5C6A A;  3BVM A;  1FNW A;  1KDA A;  1UUP A;  1UNS A;  4HSV A;  1V1P A;  4CKB A;  2CW0 C;  1H9K A;  2JA6 B;  1BCP D;  1D1I A;  4G4K A;  5E1F A;  1QB5 D;  5D14 A;  2FHT A;  1R4P B;  2EY6 A;  4X3T A;  1R4Q B;  2MHV A;  3TP6 A;  2B63 B;  2E2H B;  5J22 A;  4EQN A;  2QDB A;  3MFG A;  2VB2 X;  3T16 A;  3R3O A;  3NTI A;  1IW7 C;  5M9O A;  1EZ6 A;  4TQU S;  2L12 A;  1XXG A;  1HTL D;  1I6V C;  2R93 B;  1GOZ A;  4BY7 B;  4CGY B;  3QOL A;  1U9R A;  2F3W A;  2NYZ D;  2AUK A;  2IPK D;  4N9P A;  1B50 A;  3H6M A;  1LT4 D;  4J6H A;  3C2P A;  4PNY A;  1SND A;  4RWS C;  1XTC D;  4FP5 D;  3T53 B;  1J9O A;  1SDF A;  1RKN A;  2FMC A;  3U9O A;  2JA8 B;  2O5I C;  2B2Y A;  2AWO A;  1B2T A;  5JPN C;  3MTS A;  2KJX A;  1LTI D;  2XNA C;  4KD4 A;  3K57 A;  2SNS A;  3TME A;  5IT9 L;  4C1N K;  1PFN A;  1PXU A;  3A8K E;  1STN A;  1VF5 C;  1DON A;  2IL8 A;  4FF2 A;  1CA6 A;  3UI2 A;  1CFM A;  1TII D;  2WKD A;  3S1R B;  4KV6 A;  1TWH B;  4NP5 A;  2I46 A;  1U4M A;  3C1F A;  3GTM B;  4RGT A;  4F8M A;  3ERO A;  3A8J E;  1PDQ A;  5C0X J;  4CJ0 B;  2ENB A;  4BBR B;  1T5E A;  3QOJ A;  3GTG B;  3NQT A;  3DUZ A;  2QKI C;  4H13 C;  4O1N A;  2ICI A;  3S2D B;  1JE4 A;  3EA6 A;  3I70 A;  3W2D A;  2F0V A;  5CV5 A;  1IYU A;  1LT6 D;  2PW5 A;  5FO9 B;  3RUZ A;  4A3G B;  1AW7 A;  1ILQ A;  3BDO A;  3ONA B;  2MJ8 A;  1SEB D;  2F3V A;  2Z1C A;  5CV7 A;  2NBF A;  2NTS A;  5C4J B;  2ZT9 C;  3T4A C;  3DEP A;  2NN6 G;  4K8I A;  4HR7 B;  4B9W A;  3K6O A;  3K5N A;  5FLX E;  5KYL A;  3LNN A;  3BS1 A;  1TWC B;  4XXE A;  5ELF A;  3OPO A;  1HUM A;  2Z4H A;  1WTR A;  4K6D A;  1STA A;  5CBA E;  1BR9 A;  2EYH A;  4EQP A;  4A3J B;  2WP8 J;  3GV3 A;  4P2C B;  1I6H B;  3MAQ A;  5IGD A;  1JOO A;  1LV9 A;  1B9M A;  3IFD A;  1EL0 A;  4BA1 I;  3EJI A;  1PTO H;  2PMZ B;  1JQY D;  4C3I B;  4ABN A;  1CHQ D;  2HCC A;  1ILP A;  2NN6 H;  2AQ1 B;  1ENC A;  1OO9 B;  3FKI B;  2AQ3 B;  1V8Q A;  3O13 A;  2SDF A;  5CBE E;  2EPB A;  2XSC A;  3T51 B;  2H1E A;  2XN9 C;  5C0X I;  3HGB A;  1Q1B A;  1O80 A;  2JXM B;  5J1Z A;  1HCZ A;  5K5P A;  4DK1 A;  3NUC A;  2F0T A;  2A73 B;  4CHT B;  3QIA A;  2EY2 A;  3MXP A;  4L6T B;  1TKW B;  2F0U A;  5CV8 A;  3S14 B;  1EEI D;  2F0L A;  3BDL A;  3EFX D;  4WJW A;  4X3S A;  1Q8I A;  3I4L A;  3VR5 A;  1BF4 A;  3HEJ A;  5KNB A;  1Z47 A;  2KCN A;  5CR3 A;  2B8G A;  1ENF A;  3ITP A;  3L9A X;  3X3M A;  5JEA J;  2CQA A;  2RDG A;  4Z9C B;  1FR3 A;  3D3R A;  4IAL A;  1KNE A;  3P1H A;  4CJ2 C;  3TN2 A;  4M1U B;  3ND8 A;  3AU7 A;  4IZ8 A;  2EYP A;  1TT2 A;  4LJZ C;  3TP5 A;  2FIN B;  4RCO A;  4M8A A;  2AUJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...