1RCVD

Cholera toxin b-pentamer complexed with bivalent nitrophenol-galactoside ligand bv1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cholera toxin B protein (CTB)
publication title Nonspanning bivalent ligands as improved surface receptor binding inhibitors of the cholera toxin B pentamer.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rcvD00
1LTBD 1EEFD 1HA5A 5D3IB 1AN8A 1D6EC 3V05A 1UUPA 3MC0B 1STEA 1JR0D 1DJRD 1LTAD 1V1PB 2SEBD 3BZDB 5ELCA 1S5FD 2ICIA 1L0YB 1I4RA 1PZJD 2XRSD 1PTOC 3BVGA 2XN9C 1EFID 1PRTD 1V1OA 1SBBB 3EA6A 1D5XC 3SEBA 3R2IA 1ET9A 3BYTB 4DXFA 4RGNA 2O2LD 2AQ3B 1LT3D 4RHRA 1JWMD 3OWEB 4DXGA 1FNUA 1PRTC 1BCPB 1CHQD 1I4GA 1LTTD 1RD9D 1AW7A 3O13A 1KTKA 4RCOA 1RF2D 1BCPF 4O1NA 1RCVD 4OHJA 1SE4A 1TY0A 1SE2A 1TS2A 1G8ZD 1TS4A 1EU3A 1LO5D 1B44D 4K6LA 3BVMA 2Z8LA 1CHPD 1DYQA 1S5ED 2QILA 5ELBA 1CT1D 4RFBA 5ELEA 1ET6A 1LTGD 4L6TB 5TSSA 1JCKB 3MFGA 1LTSD 2NTTA 1S5CD 2AQ1B 5FK9C 1D5MC 1LT5D 4BWGB 4ZYSA 1PTOB 1SJED 3URYA 1BCPD 1QILA 1B1ZA 4RGMA 2IPKD 1LTID 5ELDA 1PTOF 1PYWD 1LT6D 1JWUD 2XNAC 3GP7A 3EFXD 5D3DA 5ELFA 3CHBD 3W2DA 2XRQD 1I4XA 2IJ0A 1TS3A 1XXGA 1FNWA 3DWPA 1GOZA 1S5DD 1PRTB 2G9HD 4Z9CB 4TSSA 1SEBD 1ENFA 3BVZA 2R61A 3BYYB 1EWCA 1L0XB 1HXYD 1PRTF 1I4QA 1LLRD 1RDPD 1FD7D 1BXTA 1D5ZC 1FGBD 1I4PA 4RHSA 3KLSX 3TSSA 4C56C 1PZID 3DWQA 1HTLD 1TS5A 1EEID 1SE3A 1ESFA 1PTOD 1T5XD 4RGTA 2J4XA 5I4DA 1XTCD 4RH6A 1PZKD 1F77A 3DWAA 1SXTA 1I4HA 1KLGD 1JQYD 1MD2D 4RGOS 2AQ2B 1KLUD 1SJHD 5FKAC 3R8BA 1LT4D 2TSSA 1EU4A 1S5BD 1V1PA 2RDHA 1BCPC 2CHBD 1JWSD 2WV6D 4L63B 1M4VA 1LTRD 2RDGA 1CK1A 1PTOH 1UNSA 3R2TA 4UDUC 1FNVA 1TY2A 1HQRD 2NTSA 1CQVA 2QEJC
chains in the Genus database with same CATH superfamily
1MGSA 5FLXc 2A5HA 1F9SA 2HCIA 4DK0A 5D14A 1WOCA 4RAUC 1AFPA 4A3MB 4TKOB 3J7A5 2M00A 1HUNA 1N34L 1HPCA 2ICIA 3BZKA 1KQSA 4CDEC 3HKZB 4DUZL 3MEHA 1QZGA 4JV5L 2X6GA 4DUYL 2JA6H 2FMCA 4DV7L 5ELNA 4LF8Q 2AQ3B 3NWSA 2Q8IB 3J81j 1HNZL 4X62L 4IZ8A 1BVSA 1GUOA 3MXGA 3VYSA 5CV8A 4A3LG 1EQVA 1VS0A 2N88A 1D8LA 3L2PA 1CHPD 1DYQA 3A5ZB 4JI1Q 2GA4B 2UXDQ 4IUNA 4J8QA 2WKDA 3FMCA 2VL6A 1SNCA 4AYBG 5JPNC 1IYJB 5M5WH 3CCRA 2ZTCA 2ZM6Q 4HJ8A 2I5MX 1UEBA 4FO2A 5FK9C 2EY5A 3S17B 5M3MG 4B3RQ 3RZDB 2B2VC 1SRUA 2KCMA 1A15A 3K8AA 4FDBA 5C4XH 2Z6BA 4A3JG 2Q8TA 1NE3A 3I72A 5K5PA 3DWPA 3J81c 4F87A 5C4HA 1VDZA 2AWNA 1DOLA 3L9AX 1MIUA 5CORA 1C9OA 1SNQA 1YJWA 4NXNQ 1I3QB 1M90C 1IBKL 2MPMA 1SNDA 3SR1A 1HTLD 4ZQ3A 3T13A 4KKTA 2NB0A 3GD7A 2JA8G 1RKNA 5CMDA 4LF7L 4RKLA 4K2LA 5EPJA 3I70A 1WTQA 1SFOB 3QO2A 1HH2P 4HJ9A 4RGOS 1G6PA 5IT9E 3S24A 1HJPA 2MO1A 1OXVA 4XQJA 2JA7H 2Z4HA 2TMPA 4KY7A 2RA4A 3H94A 4LF4Q 4C3HH 3HFZB 1X3QA 3F2CA 1XNQL 4DV5L 2EVBA 3EJIA 1HA5A 5IYBG 3RN5A 4P75A 3KLSA 3RLFA 4GOPA 1STGA 1WD0A 3CC2A 2EYFA 3MC0B 1STEA 4POFA 1E1TA 4YCUA 4TQUS 2B63G 3LGJA 3BZDB 5KNDA 4IFDI 3HZXA 1BUVT 1VMCA 4PMCA 4N8X1 1PH2A 4FVMA 1MJEA 5C44B 1TU2B 3GTGB 2XRSD 3NP8A 5J3BA 1IBMQ 3EQLC 5GQOA 1FYCA 3K5MA 1XMOQ 2YV5A 3UDIA 4HJAA 2PPBC 5JPMC 1L2FA 2VQFL 1QB5D 4Y7NB 1B4OA 3KYHC 3UDXA 3C46A 5IP7H 2LXKA 2WAQG 2NVQH 3J80L 1DD2A 4LNQA 3FKIB 1TWHH 4BY7G 4OEMB 1RF2D 1BCPF 3HOXB 4BBSG 4O1NA 1RCVD 4CKCA 4DFAA 4OL7A 4IOCA 1AE3A 4DV0Q 1JB7A 3BVMA 2KECA 3W1GA 2CW0C 3F1ZA 1TXYA 3S2DH 1ZKOA 4XDXA 1S3OA 3FPUB 1VQCA 1HUMA 3NBIA 5M5YB 2L4NA 1VQEA 2EXZA 4N8FA 4GLVB 5CV9A 4QY7A 5KNBA 2P5ZX 4GS3A 1A3TA 4YHHL 5HGQA 2IX3A 2JA6G 3I4LA 3EBEA 4KHPL 4ZKCB 5DEHA 1YNJC 3S1MB 1XXGA 1AEXA 4A3KB 2NBFA 1PRTB 2G9HD 4A3FB 4B3MQ 1ICWA 1W3SA 1I4QA 3T1YL 2I07B 1I50B 1WJJA 4JI6L 3MXNA 4LFBQ 2FMMA 4NXMQ 4LW1A 3PO2B 2NVXH 5C3EH 1JE5A 1EEID 3CCUA 2F4VQ 4IUUA 4RGTA 2AKWB 4KKSA 1K8MA 2ICEC 1ZYRD 3W3AA 2N78A 4HR7B 2R7ZH 1MD2D 1V1PA 2F3VA 3VYTA 2E2JB 4IN3A 2NYZD 3ERQA 5C4XG 2DUDA 4RMFA 2JQOA 1EFWA 3I73A 3S1QB 3R2TA 4F7XA 4UDUC 2NZHA 4WJWA 3HOYB 1CQVA 4NKLA 2B2UC 2UUAL 1E2VA 5I9OA 3FVQA 4X3TA 1CA6A 3S14B 3T4AC 4DV4Q 3HP3A 2SEBD 2PQAA 2Z6KC 4P71A 1HZCA 5JVG3 4ODGA 2F0OA 1CA5A 1IBLL 1PYBA 2DJGC 2E2DC 2BE5D 4DR1L 2KA7A 4NP5A 4O0AA 1NJIC 3LWUA 1E2WA 3I55A 3H3VI 3TS0A 2UXBQ 2OXPA 4KJOA 2F0SA 1N32L 1YITA 2JA7G 4LFCQ 4GKKL 5JEAH 2HD3A 2VUMH 5ISRA 1PXUA 4C3HG 1KTKA 1WVLA 2CFMA 4PMWA 4ID6A 4OHJA 2E8GA 4GNXB 1SE4A 4LK1C 1K28A 1QNUA 5FJ8H 1X56A 2HT1A 1E2ZA 4JOIA 2BCOA 3K0XA 3VR5A 2QILA 2K5DA 1EIGA 1WCMB 1CZGA 4ZUIA 5DAUA 1LTSD 3G7LA 4JBJA 3L7ZC 3KF8A 3T56B 1YJ9A 4CHTB 3ER0A 4KV6A 3MXUA 1EY4A 1PH5A 4JG2A 4IURA 1PTOF 2I46A 1O78A 1O80A 5IP7G 1ZEQX 1XX8A 2B63B 3EVQA 2CQAA 1HXYD 4R4CA 4OO1H 5GAHC 5KRUA 1U4RA 3TP5A 5IE8A 3ULPA 2EY6A 4C56C 1CFMA 3RZOB 1GVPA 2KQ3A 1SYGA 4ZKBB 4X6AH 2DGYA 1Y1WB 3A54A 2JYOA 4RH6A 3LWEA 2KCNA 4RWSC 2UUBQ 4HIMA 4X64Q 4LF9Q 5E4WC 2AQ2B 5EAYA 4P73A 4DV2L 1VQ4A 3H3VH 5E1FA 1Y8PB 1YBYA 2Y0SB 2F03A 3S17H 3NSWA 1H9KA 5EPKA 3K57A 2EE1A 3RZDH 2L12A 4H02A 1DONA 3MXPA 3TRZA 4CBVA 1PLFA 3D0FA 5C3EG 3HOWB 1JR0D 3GTJB 1HHVA 2RHQB 4R1JA 1B2TA 1EYDA 3FDTA 1L0YB 2A69D 3IAYA 4DAYA 2K14A 1I3QH 1QOHA 4HEDA 4ZK9B 1NCVA 2OQKA 2WP8J 3EA6A 2R7ZG 1MHWC 2SOBA 2WACA 2G5DA 4JI7Q 1Y8OB 4U673 1GUWA 4DV3Q 1UEAB 5IT9c 2M9VA 1EOTA 1PRTC 1SFOH 5GROA 1AW7A 4R4TA 2ZXPA 3AEVA 1RODA 3CCVA 5EKKA 1LO5D 1Q1BA 2E2IB 2PW7A 4LF6Q 1CKMA 2IT1A 3TMEA 4YCWA 5K36H 1I5FA 1N36L 4DR6L 3J7AF 1KRSA 1YEZA 4DR7Q 2R93B 5GAEC 3J7ZC 5DLQE 2HHHL 1LUZA 3TQYA 2AUJD 2DN8A 1B7YB 3J7AV 4FYDA 4JYAL 5C44H 4LUZA 1JOOA 3GTGH 2YTXA 3J80i 3GP7A 3EFXD 2ID0A 5JEAG 4YY3Q 4R8IA 3BZCA 3SXHA 2VUMG 4N9TA 1FNWA 1PFMA 3CCLA 1B3AA 3VYRA 2L9HA 1L1OB 2NN6I 4Y7NH 5KIXA 3BG3A 2E2HH 5FJ8G 4A3DB 3S15B 1I4PA 3CW2C 3FKIH 1PZID 3HOXH 5FLXL 1ESFA 3OMGA 4FXKC 1H9MA 1F77A 4ME5A 2G9DA 1NY4A 1STYA 4J1MA 2FXQA 4OX9L 1KLUD 2NWGA 3AFPA 5M5YH 4JI0Q 2TSSA 1JMCA 4K5XA 2ZTDA 3L3OC 3HKZG 3VR4A 3SK6A 3NWTA 4GNXC 4JBWA 2KEEA 1Q86C 1D1IA 2UU9Q 3CRKC 3Q23A 4DNTB 2NTSA 2CW0D 1XWEA 4PZ8A 4DR3Q 5FO7B 2KHJA 1ASYA 4JI3Q 2KHSA 4OWTB 4B3SL 1VQLA 3GTOB 1D6EC 2KVMA 3S1MH 4EQPA 3KDFB 4JI8Q 3X3NA 4A3KH 4X3KA 2GVAA 4A3FH 1X9NA 5ELCA 4X65Q 2IW3A 3G4SA 5T1GA 3I4NH 4PG3A 4WORA 1EFID 2JA5H 1JJ2A 3PO2H 3P7JA 2JEBI 5C0XJ 1YNJD 1E3PA 3TEHB 3M4OB 3Q0AA 2PI2E 1Z6HA 5IP9H 1BCPB 1LTTD 3CKIB 2K5HA 2F1MA 1EYAA 2OCEA 3F8TA 4K0KQ 1X55A 3BDLA 3QJYA 4PZ7A 2FFKB 1EY7A 4HJ5A 5A2QL 3J81L 3MFYA 3S1QH 3TN2A 1IXRA 2C35B 2DNCA 1GO3E 2NN6H 2PI2A 5JOBA 4R4QA 5CGKA 1VF7A 3HOYH 2O4XA 2RHSB 4DF7A 3G48A 1PH7A 3S14H 5JAVA 4GLXA 2AMCB 3KOJA 3D3RA 5JVH3 4DR4Q 4PV1C 4UY8C 5M3FB 2E76C 5C5LA 4B9XA 4OIJA 1EIHA 5C3EB 5LMUL 5C4JB 1MJCA 1VQAA 1A63A 1A8VA 1PVOA 4TSSA 1HZBA 2R61A 1ONLA 4LWCA 3ICEA 1FGBD 3HOVB 1GD7A 2K50A 1PH9A 2EYMA 5K36G 4X3SA 4JI4Q 1WD1A 2RKSA 2PZWA 2UXCQ 1RTNA 4V0BA 1VQBA 4CJ0B 5D65A 1QCBD 3IRBA 2MGSA 1WCMH 2Q8RE 3CAMA 3H09A 4EGVA 2JJQA 4DV1L 4C3IH 1J8IA 1Q90A 4G57A 2ZTEA 4B3TL 3I91A 2OWOA 1IKLA 1ML0D 4DUZQ 3JAMi 1K0RA 1X3EA 1PA6A 4H7BA 1GUGA 2PW5A 4DV7Q 1KIXA 1TQOA 1NNXA 4JI2Q 3WOFA 2CWAA 1MKHA 1QZHA 3GDEA 4X62Q 3FKIG 1HNZQ 2MP1A 3HOXG 4DR5L 1U5KA 2EOTA 1X3FA 1HQMC 2VUMB 2HDLA 2RF4A 3BVGA 2Z1CA 4K5WA 1LACA 4LF5L 1KAWA 4OWWB 3E6ZX 1QUQA 1BBXC 3R2IA 3MHBA 4MTNA 1QVFA 1U4LA 1K9MC 1Y1WH 4ZRZA 1VQ5A 4RGNA 4NW2A 4QIWE 1LT3D 4A93B 1TVXA 3DM1A 4KY6A 1B50A 2K01A 2X6LA 1HFGA 4R4OA 1L1OC 1RD9D 4G7HC 1EZ6A 1RTOA 1X3GA 2EPBA 2EY2A 4A3EH 4XQQA 3H91A 4IJLA 4A3KG 3LNNA 5BN3A 1EQQA 2EYJA 1VQNA 2ZXRA 2HDMA 5HGTA 4A3FG 2IHEA 2B29A 1JCKB 2BDNA 1A3UA 3I4NG 4OELB 1IYVA 2K28A 3MVVA 2JA5G 4I7AA 2K4KA 1GJXA 3RD4A 3PO2G 4WJ3M 1PTOB 3HOWH 3D8GA 3GTJH 1IBKQ 1QILA 4A3CH 1KXLA 3M7GA 5BN5A 4BY1H 2C5CA 2A19A 3OYYA 1Q1EA 1F2YA 1Q3LA 2D0OA 3E0EA 2XIWA 5IP9G 1LV9A 2PQEA 4LF7Q 1WTPA 2K32A 5IGGA 3TDQA 2PZTA 3BYYB 2RSNA 5IGFA 1RDPD 2V4DA 2F4IA 3KJOA 2NN6G 2F0UA 4G4KA 2KUMA 1DZ1A 1I94L 1GHKA 1GXDC 3HOYG 3A55A 1EY0A 3M85A 2UUCL 4YWKA 4F88A 3CCMA 1DCZA 2E2IH 1SXTA 4DV5Q 5IWAQ 1UE6A 2KBNA 5HY6A 4NMZA 3PUXA 1SJHD 3Q6SA 3R8BA 3NENA 4ALPA 2R93H 1BCPC 2BOSA 1JWSD 4ZLTF 3J80E 4CKEA 3HOZB 4H0LC 3MEFA 4IUPA 3CRLC 1JOKA 1VQHA 2R7FA 3S1NB 2XGTA 1DOKA 3U4VA 2CH4W 3M3YB 5CV7A 3KFUA 1XJVA 4XT1B 4K6DA 2L1BA 5ELOA 1VQKA 4QQBX 1HR0W 2J7ZA 1E1OA 5KGUA 1LTAD 1V1PB 2VB2X 1H9RA 1IKMA 1IW7C 4A3DH 3S15H 1A6XA 1NMGA 1BO0A 1U4PA 1QNKA 4UHVA 2Z4IA 4DXFA 1K3BC 1WCMG 2VB3X 1MSGA 4AQYL 1N9WA 4C3IG 4Q0FA 2YU9B 3VR2A 4DK1A 3HOUB 2Q2UA 2AHOB 3CP0A 2D62A 3O13A 3STBC 2UXDL 4YHHQ 2HCCA 2NUCA 4P74A 1QVCA 3PQIA 2A6HC 3C1FA 1OXXK 4K6LA 4KHPQ 1OTCA 2ZM6L 1UE7A 3E5SA 1E22A 3NE5B 1HFNA 1PFNA 4P72A 3PSIA 2WINB 1EL0A 2CH4A 1B9NA 1BR9A 2NTTA 3GTOH 2MNAA 3T1YQ 1B53A 1AH9A 2I5HA 2E2HB 4CKBA 3URYA 2N8NA 2VY3A 5KEEA 3H0GB 4GKJL 1HRJA 4OONA 1Y1WG 4AH6A 1PH8A 3DUZA 2F0FA 1GKHA 3HKZE 1LT6D 3Q24A 1ILPA 3NPPA 3A7AB 5ELFA 2XRQD 1SEBD 3J81i 3M4OH 4PMBA 2PNRC 2B8FA 2K33A 1W6JA 3KJPA 4CDDC 1FD7D 4A3EG 2Y0SG 3NQIA 4HN7A 5C5MA 4XTCS 1NUCA 1HTPA 4K2KA 4DNRB 4ME3A 1C7YA 2XWJB 1XNRL 4QUFA 2D2CC 1OO9B 2UUAQ 2F0MA 1VQ8A 1JJGA 3TP7A 3HOWG 2EJMA 4A3CG 1M1KC 4LF4L 4XYOA 4BY1G 2IX1A 1F2ZA 4L63B 2B2UA 1WTXA 5FLMH 1K8GA 1DOMA 2EJGC 2CWPA 4DR1Q 2HQLA 4P2CB 5M3FH 3I4NB 1VQDA 2ENBA 2JA5B 3CC4A 5IT9L 3FPPA 2Z6KA 1SN8A 3KBXA 1VQFA 3VR3A 1EYGA 5C4JH 1UWVA 1OXTA 1OXUA 1AZPA 4GKKQ 4GN5A 1IBML 4IFDH 1SNPA 1FJGL 1S5FD 3IFTA 2EYLA 5EJWA 3HOVH 1PTOC 4GLAC 1F9QA 4N9PA 4PNYA 1QG7A 3S2HB 3WOEA 5KNCA 2RCNA 1ET9A 4IPHA 1D2BA 2R93G 3BS1A 1HR0L 3A74A 4Y52H 3UDGA 2GVBA 3OWEB 4DXGA 4HIDA 1DM0B 1KDCA 2SNMA 3CPWA 3M4YA 2KJXA 3GTMB 1N33L 3C3LA 3JAME 1TY0A 4DAYB 1G8ZD 1BBWA 2B8GA 3H3VC 2DNEA 3K59A 3T1HL 4GN3B 5ELBA 1YJNA 1RL2A 4A3DG 1U4MA 4ZUJA 1S5CD 2F3IA 2YYZA 1KNAA 3OTOL 5G3LD 5FOBB 1SYDA 3MTSA 4B3ML 3HRZC 4F8MA 2M2LA 1PH1A 1YHAA 2WKCA 4LFBL 2LMCB 2RQXA 4DGZA 2I5LX 4MTKA 4PQXA 2OEOA 4A93H 1LABA 1VMPA 2F0EA 4HSVA 3UI2A 3NBHA 4HMIA 4TRDA 4DV2Q 1HZAA 2PYKA 3SK4A 3I2ZA 4JI5L 2L55A 3OPOA 1BF4A 1EQRA 2BA0A 4C3IB 2CVRA 1SE3A 2QKIC 2FJ2A 4HMJA 4KK7A 1SLJA 1SYBA 1D7QA 2MHVA 2ZJPA 1GUSA 1CSPA 1HNWQ 5A35A 5C4ZA 1PTOH 2I0QA 1TY2A 1WTVA 1TWCB 3GQBA 4KN4C 4MN3A 4DV4L 1JT8A 3KLSX 3A8IE 1G291 1SNMA 2N55A 5IY0A 2F0PA 4X66L 2VS1A 1R9TB 1PV4A 1SYEA 2EQSA 3FEWX 1DJRD 1SYCA 2FINB 1YI2A 3ULJA 2SDFA 5DNFA 1T5EA 4JPBW 3PUZA 3WDNA 3I4MB 1KDBA 2EXDA 4A3EB 4LUVA 1Y14B 1GHJA 1QWYA 4DR6Q 2O5JC 2O5IC 5FLMG 3CCSA 3UDFA 5LL6X 2HHHQ 5M3FG 1EQTA 4QB4A 2EY1A 3DMUA 5AJ3L 1TS2A 3A5UA 1GM5A 3HOZH 1TR5A 3LX0A 2HUGA 3P20A 4IFDJ 4BY1B 5GAGC 4IFDG 3S1NH 5I2YA 2DY8A 3PF5A 1ET6A 3M3YH 3HOVG 1F2MA 5EQ0A 4TVAB 4JW0A 3TZUA 4IPCA 1Z9FA 3PMFA 4KI0A 1BCPD 3I7FA 2IPKD 5ELDA 1K3RA 1ENCA 1H9SA 2K52A 2BH8A 2KENA 3H15A 4FXDA 3D31A 3W2DA 3AB9A 2MJ8A 1Q7YC 2KCTA 1ENFA 2F0DA 4EQ5A 1JORA 2YU9H 2JXMB 3S9WA 2OT2A 4A3IB 3T16A 3HOUH 3M4PA 1FL0A 3RLOA 3VYUA 5CBAE 5CV6A 3DWQA 3Q8DA 2ZXOA 2LFNA 2UUBL 5EKLA 1IW7D 1AP0A 4LJZC 4MIUA 3DXJC 1I6VC 2F0TA 5JEAJ 3UE1A 1V8QA 4NDXA 3CCJA 4B3SQ 2F0HA 1EY6A 2A8VA 2RDFA 5LHY1 4EVOA 5FO8B 1AZQA 1GUNA 1Z7TA 1EWIA 1Q46A 3STBD 1CK1A 1YHQA 2NVTB 1STHA 4UP7A 1UNSA 1XMQQ 1EIYB 3H0GH 2A6HD 4DV6L 3J81E 3D4DA 4A93G 1TWGH 3RNUA 4BXXH 1NR2A 3G6JB 2NZ1D 1EEFD 2D0PA 2ASBA 4IOAA 3PO3B 3V05A 3FRPB 2R92B 2LSSA 1WFQA 4NPSA 4DAVA 2YTYA 5T1IA 2F0QA 3G6EA 1PH3A 4DV3L 1PYSB 4G7ZC 2VQEL 3SEBA 4H44C 3FP9A 2C9OA 1Y69U 2D9UA 5J1ZA 1CUKA 2RBMA 3DLLA 1CHQD 4HCEA 3K6OA 3MA2B 2AWOA 2H4OA 1X65A 1SYFA 1SR3A 2RVLA 2Y0SE 1OXSC 1SSOA 3R93A 4DR7L 2Z8LA 5LMUQ 1QUQB 4IPGA 1DXMA 3QR8A 4RFBA 5EKIA 5ELEA 2HIVA 3BU2A 5E4XA 5IGEA 2QCPX 4C2MB 2ES2A 5LMNW 3D6WA 2AQ1B 4DR2Q 2B2YA 1Y1VB 1EZ8A 2B2TC 2QEXA 2F52A 2MFIA 2EYHA 4S3SA 3IL8A 4DK3C 3X3MA 1JWUD 1Z47A 3HS0C 3S1RB 1I4XA 2IJ0A 3S2HH 3U58A 1KHIA 1Q8IA 4FNFA 1EWCA 2JP1A 1L0XB 4C3JH 4KY5A 3HOZG 3JAMc 4KN7C 4DV1Q 3GTMH 1PTOD 3U50C 2BH2A 4RCNA 2OQ0A 2NZOA 2RDHA 3P75A 1ZYRC 3U9OA 2UU9L 2A6EC 2OTLA 2Q2IA 3M7NA 1X3PA 4JI3L 4XIGS 2A1AA 3Q22A 1W2BA 1J5EL 1ICFB 2QEJC 3SK8A 4QCLA 2E5LL 4IUTA 3HOUG 5FO9B 1UUPA 1NAPA 3G71A 3QWNA 1CI3M 4JC0A 3OIPA 1E0BA 5C3XA 1Y8NB 4BBRG 3OOCA 3GTLB 1SBBB 1YNXA 2B2WC 3MZ5A 1N34Q 1L1OA 2QW7A 4FXGC 3AMUA 4LFAL 3BYTB 1SAPA 3MWYW 3U9SA 3DEOA 1JWMD 4KD4A 4JV5Q 4HIKA 1I4GA 4DUYQ 4FF2A 3V96A 4C1NI 4FF3A 3ZYYX 3H0GG 4DPGA 2E74C 5LL6S 4BXXG 4A3GH 1A2UA 3CQZB 1HNXL 4KD3A 2MUYA 4A4IA 3C1EA 4L5QA 4ILWA 3HGBA 4DK6C 5HURA 1TWCH 2QDBA 1BNZA 2EIFA 1ZXTA 1PFBA 4L6TB 5E3FA 1XPUA 3EIVA 2OTJA 2CCZA 1PFSA 1VCIA 3K58A 1TT2A 2F0JA 2JSOA 2YTVA 5EBDA 3K5LA 1R9TH 1LM0A 2QF7A 1X6OA 4GOPB 4JBMA 2K6AA 3ZJYC 3AU7A 3H6MA 1I94Q 1H95A 2XNAC 3I4MH 1C0AA 2UUCQ 4DN4M 1A0IA 5M5XB 5LMNL 4NB3A 3NQTA 3OW2A 5KYLA 4I7ZC 4CDFC 3KF6A 4JI4L 2B2VA 2UXCL 4QJFA 3RN2A 2E75C 2J4XA 3AQQA 1VQGA 3OMCA 1G51A 1TWAH 3GV6A 5J22A 4LMQD 1KL9A 3BJUA 1KD1C 1L0WA 3NTKA 1V9PA 4KKUA 4C1NK 3V2TA 3OHXC 4L5SA 1G2TA 4WFN3 3OSOA 2WIIB 3AFQA 1Q8KA 1BKBA 3W1BA 4KHVA 2IHFA 4ABNA 4JI2L 5KYIA 3B6YA 4A3BB 2WFWA 4C3JG 1BQQT 1NR4A 2WB1G 2XSCA 4AQYQ 1AN8A 4KJNA 2GN5A 3DM3A 5L37A 5G3LF 1XNQQ 3VR6A 4WJ4A 1K0SA 1F9RA 3BDCA 5CYUA 4JVZA 5I9PA 5BR8L 1VF5C 2F0WA 3P1HA 3KLRA 4A3IH 1TIID 1YVCA 1CKNA 1FVIA 1PRTD 1V1OA 3ND9A 4FF1A 3MXNB 2SNSA 1MSHA 4HJ7A 1Q81C 4QMGA 2XVSA 2Z0SA 3ULLA 2A69C 2O2LD 1AE2A 5M9OA 1X54A 1FNUA 1PHJA 1YHBA 1KABA 4QL5A 1XPOA 2VQFQ 3ONAB 1IL2A 2RCFA 3CD6A 4GKJQ 2HQEA 1V43A 1QE6A 1WTWA 2F0GA 5I6WA 2NVTH 2RSOA 1YZ6A 3GTQH 2K5VA 4U68A 3NHHA 2H5XA 1O7ZA 4LF8L 1CTMA 2PMZB 4EX5A 3A56A 5CV4A 3PO3H 3PUVA 4BWGB 3BDOA 2R92H 3QOJA 4RGMA 4BA2I 2KHIA 1QJOA 2PQAB 4JI1L 4UP9A 3ERSX 1F9PA 4BBRB 1XNRQ 1ESRA 1LYLA 2IX0A 4O2DA 3K80C 3I56A 4A3GG 1D5ZC 5DM63 4B3RL 4M1UB 1B3QA 1IL8A 5IWAL 2BA1A 3GO5A 5IYCH 4JI6Q 5I4DA 1RJTA 1XTCD 2IWHA 2KCCA 3TP6A 2R7DA 3DWAA 2EJFC 2VW9A 3KK7A 3KUPA 1TWGB 3A7LA 1JQYD 4HSPA 2H1EA 1IZ6A 5IGDA 4NXNL 3CPFA 3NBHB 1WTOA 1ASZA 4C2MH 1FJGQ 3SGIA 1BBUA 1HCZA 4E6IA 3I4MG 2K03A 3K81C 4V190 3PCOB 4GN4B 1C48A 3KF8B 1Y1VH 3HEJA 2ZJQA 1VQJA 4R9WA 4EQNA 2NVYB 3S1RH 1HR0Q 3EN2A 3QG1A 3SDZA 1PH4A 2F0IA 1SE8A 1N33Q 4IQZA 5CBEE 2ZT9C 3I3CA 4J15A 4OIKA 1K83H 4ZCKA 4K8JA 3NTIA 4J6HA 4GOPC 2L15A 3K7AH 5EGTA 2K1BA 5GADC 4EQOA 3T51B 4R8NA 1IBLQ 3T1HQ 1JICA 3OWFA 4RHRA 3NK9A 3E3XA 3MAQA 3K0YA 3GTPB 4CDCC 4H13C 5C3WA 1N32Q 1P8LA 1SE2A 3OTOQ 2F0VA 1VQ6A 3RMHA 1JB3A 1XMOL 2A68C 1R4QB 1DGSA 4A3IG 1VQ9A 4JBKA 3S16B 3NUCA 3R3OA 1JE4A 4G7OC 4C3JB 1C4QA 1VQ7A 2JN4A 2WB1B 4JI5Q 1B1ZA 1EY9A 2VNUD 2K04A 2A6ED 4DV0L 1NMFA 2PMZE 2X69A 1IHZA 3QB3A 3GTLH 3CHBD 2LXJA 4RKBA 1S4ZA 1TS3A 4CGYB 1S5DD 3VDYA 1T9HA 4AYBB 4GZYC 3AYHB 4OO1I 1PH6A 1BXTA 1HA6A 1M8AA 1SMXA 2DY7A 3A0JA 5M3MB 4OWXB 1H9SB 1T5XD 1SMYC 3E9IA 5JJKA 3CQZH 3PO3G 3NEMA 4KHZA 2DJFC 4A3JB 1KLGD 4X66Q 2R92G 3TS2A 1IYUA 3TBIB 1ENAA 3J7YW 1XYIA 4L5TA 2CHBD 4XT3B 4NXML 5C0XI 3U4ZA 3HKSA 4XYQA 1Q82C 1VQIA 2F4VL 5I2XA 5F2DA 1FNVA 3UE0A 3QOLA 2JA8B 1LTBD 3PIOA 1JOQA 5CV5A 4IUVA 3PUYA 4IO9A 5M5XH 3CMAA 3D6CA 1TKWB 2B3GA 5IYCG 3K5NA 1EYCA 1PZJD 2XN9C 5IGBA 5AJ3Q 3GV3A 4FP5D 3GTKH 1EWHA 2AUKA 4A3GB 1SROA 1CQFA 4RA8A 5IGCA 3F2BA 1N8RC 3TREA 4A3MH 1LTLA 1YNNC 4KLKA 2LKVA 2K5NA 1Y1VG 1WTRA 1KNEA 4RCOA 4A76A 1CSQA 1TWFB 2L5TA 1STBA 1B44D 1I6HB 1NSNS 3CXCA 2F0NA 2UXBL 4Q5VA 2K5QA 4DAMA 2F0LA 4A3BH 4YWLA 3JAML 4LFCL 2FHTA 1A62A 1CM9A 3MFGA 3VA7A 1J9OA 2KOLA 4JOIC 3NELA 1EIFA 2OF1A 2WAQB 1N36Q 3SK5A 4DU9A 4BY7B 4BBSB 1BDOA 3J80c 1FGUA 5IOCA 2VZAA 5BN4A 2PZUA 4POGA 4JYAQ 1TWAB 1KAAA 4QGUA 1NBWA 5FLXE 2WB1E 3BVZA 5C0XH 3CCQA 3IKJA 3D4WA 1PMRA 1LLRD 1B70B 5CC4A 3JC66 5EPLA 4HTHA 1VQOA 3PGZA 2HIXA 1O7LA 3TSSA 2PCFB 4IALA 3PIPA 2JA6B 3W5OA 1C8CA 4AYBE 4DV6Q 4JCVE 2MO0A 1HNWL 5JJIA 3CCEA 2EYPA 5E7NA 1B8AA 4KMUC 5FKAC 1LT4D 3SE0A 1EU4A 2XTIA 2VXWA 4DKAC 1UAPA 2RDGA 4FF4A 4OX9Q 1PDQA 3A8JE 3HG9A 2VQEQ 4RG1A 4YCVA 1E24A 5C6AA 1J6QA 5M5WB 4X64L 1WI5A 3WWVA 4LF9L 1WYDA 5D3IB 4BBRH 4BA1I 1UE1A 1SNOA 3F2DA 3ITPA 3RLNA 3CU7A 4KTAA 2BDOA 5IYDH 1BOSA 2KEDA 3E0JA 4IUQA 4GNXA 3T53B 5C4XB 2LY7A 5DM73 4MZ9A 3I4OA 3KBGA 3N6RA 2QDLA 1F2LA 2ATWA 4JK1C 3GTQB 1EY5A 2F0KA 5A2QE 2F3WA 2XWBB 3NXWA 1X32A 3F2UA 1TS4A 2LS01 2K05A 4O42A 2QA4A 4JI7L 5IODA 1XPRA 1CT1D 2EYOA 1XTDA 2EZVA 5EBCA 4M8AA 1LTGD 2B2TA 3TP8A 4OGQC 1QVGA 2NVYH 2JA7B 3DHQA 1CKOA 4I65A 1E7ZA 4IPDA 1II3A 5CR3A 1D1KA 1JJCB 4C3HB 1Q12A 1STNA 1PYWD 1K8OA 2JK8A 4A3MG 1YIJA 4LF6L 3SHLA 2IL8A 5D3DA 4HIOA 4MNOA 1S40A 4B9WA 2D5DA 2WAQE 3PUWA 4WRDA 2JEAI 3KLWA 5COYA 2A73B 1PRTF 1MI2A 2ALYB 2JE6I 4HAEA 4YIJA 3GTPH 4DNIA 2PNHA 4RHSA 4UAIA 1S72A 1TS5A 1V1QA 4OO1G 1GUTA 4PZ6A 4A3BG 1NTGA 2R3ZA 3C2PA 4YY3L 1J5EQ 1PZKD 2L11A 1RIPA 3N52A 4K14A 2A74C 1I4HA 2E5LQ 2NVQB 4QIWB 4YWMA 1I50H 1TWHB 2L0CA 1EY8A 3A8KE 1XMQL 3KF6B 2WV6D 4BS9A 1M4VA 3S16H 1LTRD 5JJLA 4A75A 3S2DB 1A2TA 2CQOA 1K83B 4DA2A 5C0XG 4CJ1B 3K7AB 4X3UA 1CZWA 4LFAQ 1KC8C 2A68D 4B3TQ 2K75A 4A3LH 1G2SA 1RHPA 2N3SA 4JI0L 2E2JH 2B2WA 1EUJA 2B39A 2K5WA 3NTHA 1MBYA 4DAPA 3M4QA 3QIAA 1I4RA 4IJHA 1ILQA 3L0OA 1VQMA 4MHEA 5NUCA 4DR5Q 3EROA 1D5XC 4XXEA 3DEPA 5M3MH 1HNXQ 3PV0A 4DR3L 1KDAA 3PIO3 1STAA 4LF5Q 1HZ9A 2J0TD 2Z9HA 4CJ2C 4JI8L 2CKZB 4K5VA 4A3JH 5H1SE 1G6ZA 2MQHA 4QUCA 2N49A 1KRTA 3ND8A 4B08A 4X65L 2NVXB 3OIQA 2IY5B 1FR3A 1EOVA 1H9JA 2Q2TA 5I6YA 3K5OA 4XQNA 1W6KA 1CKNB 1EU3A 2B2YC 4ZAIA 3CMEA 1VQPA 3IFDA 3D4RA 1SMYD 1S5ED 2R7ZB 2JA8H 2R6GA 1K73C 5IYDG 1O7IA 5TSSA 5LMNQ 4DR2L 3PF4A 5JJZA 3FHWA 4K0KL 1D5MC 1LT5D 3TZDA 3RUZA 4ZYSA 3I90A 4OXPA 1SJED 2BE5C 1O7YA 1LTID 4QF4A 4AIMA 2ZJRA 1R4PB 3K7UC 2JA9A 3M9BA 2K7VA 1GOZA 5C44G 4UP8A 1K8AC 4Z9CB 5IIFA 1U9RA 4HCSA 4DR4L 5IYBH 3SVMA 1UE5A 4UPAA 4R4IA 2B63H 4L8JA 1G91A 1TWFH 2PO4A 1A3VA 3I8ZA 2Q2HA 1I6HH 5AFWA 3VA5A 2EDGA 1B9MA 3E9HA 3KDFA 4ULLA 1YNND 4LUOA 1S5BD 3RZOH 3CC7A 1JC7A 3RR5A 5BR8Q 4K8IA 3CF5A 5J39A 3OW7A 1SDFA 2QGQA 2V1CC 1WTHA 4L5RC 3PIP3 4BY7H 1P16A 4APVA 4LAAA 4BBSH 1U0LA 1HQRD 3GTKB
chains in the Genus database with same CATH topology
1MGSA 2A5HA 1F9SA 2HCIA 4DK0A 5D14A 4RAUC 1AFPA 4A3MB 4TKOB 2M00A 1HUNA 1HPCA 2ICIA 3HKZB 3MEHA 2X6GA 2FMCA 2AQ3B 3NWSA 2Q8IB 4IZ8A 1GUOA 3MXGA 3VYSA 5CV8A 1EQVA 2N88A 1CHPD 1DYQA 2GA4B 4IUNA 4J8QA 2WKDA 3FMCA 1SNCA 5JPNC 4FO2A 5FK9C 2EY5A 3S17B 3RZDB 2B2VC 1A15A 2Q8TA 3I72A 5K5PA 3DWPA 4F87A 5C4HA 1VDZA 2AWNA 1DOLA 3L9AX 5CORA 1SNQA 1I3QB 2MPMA 1SNDA 3SR1A 1HTLD 4ZQ3A 3T13A 4KKTA 2NB0A 3GD7A 1RKNA 5CMDA 4RKLA 4K2LA 5EPJA 3I70A 1WTQA 1SFOB 3QO2A 4RGOS 5IT9E 1OXVA 4XQJA 2Z4HA 2TMPA 4KY7A 2RA4A 3H94A 1X3QA 2EVBA 3EJIA 1HA5A 3KLSA 3RLFA 1WD0A 1STGA 2EYFA 3MC0B 1STEA 4IFDI 4TQUS 5KNDA 3BZDB 3HZXA 1BUVT 1VMCA 4PMCA 4FVMA 5C44B 1TU2B 3GTGB 2XRSD 3NP8A 3EQLC 3K5MA 1FYCA 2PPBC 5JPMC 1QB5D 4Y7NB 1B4OA 3C46A 3J80L 1DD2A 3FKIB 1RF2D 1BCPF 3HOXB 4O1NA 1RCVD 4CKCA 4DFAA 4OL7A 3BVMA 2KECA 2CW0C 1ZKOA 4XDXA 3FPUB 1HUMA 3NBIA 5M5YB 2L4NA 2EXZA 5CV9A 5KNBA 1A3TA 2IX3A 3I4LA 4ZKCB 5DEHA 1YNJC 3S1MB 1XXGA 1AEXA 4A3KB 2NBFA 1PRTB 2G9HD 4A3FB 1ICWA 1I4QA 2I07B 1I50B 3MXNA 2FMMA 3PO2B 1EEID 4IUUA 4RGTA 4KKSA 1K8MA 2ICEC 1ZYRD 3W3AA 4HR7B 1MD2D 1V1PA 2F3VA 3VYTA 2E2JB 4IN3A 2NYZD 3ERQA 3I73A 3S1QB 3R2TA 4F7XA 4UDUC 4WJWA 3HOYB 1CQVA 4NKLA 2B2UC 1E2VA 5I9OA 3FVQA 4X3TA 1CA6A 3S14B 3T4AC 3HP3A 2SEBD 5JVG3 4ODGA 2F0OA 1CA5A 2E2DC 2BE5D 2KA7A 4NP5A 3LWUA 1E2WA 2OXPA 4KJOA 2F0SA 5JEAH 5ISRA 1PXUA 4C3HG 1KTKA 1WVLA 4PMWA 4ID6A 4OHJA 1SE4A 4LK1C 1QNUA 1E2ZA 2BCOA 3VR5A 2QILA 2K5DA 1EIGA 1WCMB 1CZGA 4ZUIA 5DAUA 1LTSD 3G7LA 3L7ZC 3KF8A 3T56B 4CHTB 4KV6A 3MXUA 1EY4A 4IURA 1PTOF 2I46A 1O78A 1O80A 1ZEQX 1XX8A 2B63B 3EVQA 2CQAA 1HXYD 4OO1H 5KRUA 1U4RA 3TP5A 2EY6A 4C56C 1CFMA 3RZOB 2KQ3A 1SYGA 4ZKBB 1Y1WB 3A54A 2JYOA 4RH6A 3LWEA 2KCNA 4RWSC 5E4WC 2AQ2B 5E1FA 1Y8PB 2Y0SB 2F03A 3NSWA 1H9KA 5EPKA 3K57A 2EE1A 2L12A 1DONA 3MXPA 4CBVA 1PLFA 3HOWB 1JR0D 3GTJB 1HHVA 1B2TA 1EYDA 3FDTA 1L0YB 2A69D 3IAYA 4DAYA 1QOHA 4HEDA 4ZK9B 1NCVA 2WP8J 3EA6A 2SOBA 2WACA 1Y8OB 4U673 1GUWA 1UEAB 2M9VA 1EOTA 1PRTC 1AW7A 2ZXPA 1RODA 5EKKA 1LO5D 1Q1BA 2E2IB 2PW7A 2IT1A 3TMEA 5K36H 3J7AF 2R93B 2AUJD 2DN8A 3J7AV 4FYDA 1JOOA 3GP7A 3EFXD 2ID0A 5JEAG 4R8IA 3SXHA 4N9TA 1FNWA 1PFMA 1B3AA 3VYRA 2L9HA 2NN6I 5KIXA 3BG3A 4A3DB 3S15B 1I4PA 1PZID 5FLXL 1ESFA 3OMGA 4FXKC 1H9MA 1F77A 4ME5A 2G9DA 4J1MA 1STYA 1KLUD 2NWGA 2TSSA 4K5XA 3L3OC 3VR4A 3SK6A 3NWTA 4JBWA 2KEEA 1D1IA 3CRKC 3Q23A 4DNTB 2NTSA 2CW0D 1XWEA 5FO7B 2KHSA 3GTOB 1D6EC 2KVMA 4EQPA 3X3NA 4X3KA 5ELCA 2IW3A 5T1GA 4WORA 1EFID 3P7JA 2JEBI 5C0XJ 1YNJD 3M4OB 3Q0AA 1Z6HA 1BCPB 1LTTD 3CKIB 2F1MA 1EYAA 3BDLA 3QJYA 2FFKB 1EY7A 5A2QL 3J81L 3MFYA 3TN2A 2DNCA 2NN6H 5JOBA 5CGKA 1VF7A 2O4XA 4DF7A 5JAVA 3D3RA 5JVH3 4PV1C 5M3FB 2E76C 5C5LA 4B9XA 4OIJA 1EIHA 5C3EB 5C4JB 4TSSA 2R61A 1ONLA 1FGBD 3HOVB 2EYMA 5K36G 4X3SA 1WD1A 2RKSA 2PZWA 1RTNA 4V0BA 4CJ0B 5D65A 1QCBD 2MGSA 2Q8RE 4EGVA 3H09A 1J8IA 1Q90A 4G57A 3I91A 1IKLA 1ML0D 4H7BA 1GUGA 2PW5A 1TQOA 3WOFA 2MP1A 2EOTA 1HQMC 2VUMB 2HDLA 3BVGA 2Z1CA 4K5WA 1LACA 3E6ZX 1BBXC 3R2IA 3MHBA 1U4LA 4ZRZA 4RGNA 4NW2A 1LT3D 4A93B 1TVXA 3DM1A 4KY6A 1B50A 2K01A 2X6LA 1HFGA 1RD9D 4G7HC 1EZ6A 1RTOA 2EPBA 2EY2A 4XQQA 3H91A 3LNNA 5BN3A 2EYJA 2ZXRA 2HDMA 5HGTA 1JCKB 2BDNA 1A3UA 1IYVA 2K28A 3MVVA 1GJXA 3RD4A 1PTOB 3D8GA 1QILA 3M7GA 5BN5A 2C5CA 1Q1EA 1F2YA 1Q3LA 2XIWA 1LV9A 2PQEA 1WTPA 2K32A 5IGGA 3TDQA 2PZTA 3BYYB 2RSNA 5IGFA 1RDPD 2V4DA 2F4IA 2NN6G 2F0UA 4G4KA 2KUMA 1DZ1A 1GHKA 1GXDC 3A55A 1EY0A 3M85A 4F88A 1DCZA 1SXTA 4NMZA 3PUXA 1SJHD 3Q6SA 3R8BA 1BCPC 2BOSA 1JWSD 4ZLTF 3J80E 4CKEA 3HOZB 4H0LC 4IUPA 3CRLC 1JOKA 3S1NB 1DOKA 3M3YB 5CV7A 4XT1B 4K6DA 2L1BA 2J7ZA 5KGUA 1LTAD 1V1PB 2VB2X 1H9RA 1IKMA 1IW7C 1A6XA 1BO0A 1U4PA 1QNKA 2Z4IA 4DXFA 2VB3X 1MSGA 4C3IG 4Q0FA 2YU9B 3VR2A 4DK1A 3HOUB 2D62A 3O13A 2HCCA 2NUCA 2A6HC 3C1FA 1OXXK 4K6LA 3E5SA 3NE5B 1HFNA 1PFNA 2WINB 1EL0A 1B9NA 1BR9A 2NTTA 1B53A 2E2HB 4CKBA 3URYA 5KEEA 3H0GB 1HRJA 2F0FA 3DUZA 3Q24A 1LT6D 1ILPA 3NPPA 3A7AB 5ELFA 2XRQD 1SEBD 4PMBA 2PNRC 2B8FA 2K33A 1W6JA 1FD7D 4HN7A 3NQIA 5C5MA 4XTCS 1NUCA 1HTPA 4K2KA 4DNRB 2XWJB 4QUFA 2D2CC 1OO9B 2F0MA 3TP7A 2EJMA 4XYOA 2IX1A 1F2ZA 4L63B 2B2UA 1WTXA 1DOMA 2EJGC 4P2CB 3I4NB 2ENBA 2JA5B 5IT9L 3FPPA 3KBXA 3VR3A 1OXTA 1OXUA 1AZPA 4IFDH 1SNPA 1S5FD 3IFTA 2EYLA 5EJWA 1PTOC 1F9QA 4N9PA 4PNYA 1QG7A 3S2HB 3WOEA 5KNCA 1ET9A 1D2BA 3BS1A 3OWEB 4DXGA 1DM0B 1KDCA 2SNMA 3M4YA 2KJXA 3GTMB 3C3LA 3JAME 1TY0A 1G8ZD 2B8GA 3H3VC 2DNEA 3K59A 5ELBA 1U4MA 4ZUJA 1S5CD 2YYZA 1KNAA 5G3LD 5FOBB 1SYDA 3MTSA 3HRZC 4F8MA 2M2LA 2WKCA 2LMCB 2RQXA 4DGZA 4PQXA 2OEOA 1LABA 1VMPA 2F0EA 4HSVA 3UI2A 3NBHA 4HMIA 4TRDA 2PYKA 3SK4A 2L55A 3OPOA 1BF4A 2BA0A 4C3IB 2CVRA 1SE3A 2QKIC 2FJ2A 4HMJA 4KK7A 1SYBA 2MHVA 1GUSA 5A35A 5C4ZA 1PTOH 1TY2A 1WTVA 1TWCB 3GQBA 4KN4C 4MN3A 3KLSX 3A8IE 1G291 1SNMA 2N55A 2F0PA 1R9TB 1SYEA 3FEWX 1DJRD 1SYCA 2FINB 2SDFA 5DNFA 1T5EA 3PUZA 3WDNA 3I4MB 1KDBA 4A3EB 1GHJA 1QWYA 2O5JC 2O5IC 5LL6X 1EQTA 4QB4A 2EY1A 3DMUA 1TS2A 1TR5A 3LX0A 2HUGA 3P20A 4IFDJ 4BY1B 4IFDG 5I2YA 2DY8A 1ET6A 1F2MA 5EQ0A 3TZUA 3PMFA 4KI0A 1BCPD 2IPKD 5ELDA 1ENCA 1H9SA 4FXDA 3D31A 3W2DA 3AB9A 2MJ8A 1ENFA 2F0DA 1JORA 2JXMB 3S9WA 2OT2A 4A3IB 3T16A 3VYUA 5CBAE 5CV6A 3DWQA 2ZXOA 2LFNA 5EKLA 1IW7D 1AP0A 4LJZC 4MIUA 3DXJC 1I6VC 2F0TA 5JEAJ 1V8QA 4NDXA 2F0HA 1EY6A 2RDFA 5LHY1 4EVOA 5FO8B 1AZQA 1GUNA 1Z7TA 1CK1A 2NVTB 1STHA 1UNSA 2A6HD 3J81E 3D4DA 1NR2A 3G6JB 2NZ1D 1EEFD 3PO3B 3V05A 3FRPB 2R92B 4DAVA 5T1IA 2F0QA 4G7ZC 3SEBA 4H44C 2C9OA 1Y69U 2D9UA 5J1ZA 2RBMA 1CHQD 4HCEA 3K6OA 3MA2B 2AWOA 2H4OA 1SYFA 2RVLA 1OXSC 1SSOA 3R93A 2Z8LA 1DXMA 4RFBA 5EKIA 5ELEA 5E4XA 5IGEA 2QCPX 4C2MB 3D6WA 2AQ1B 2B2YA 1Y1VB 1EZ8A 2B2TC 2EYHA 4S3SA 3IL8A 3X3MA 1JWUD 1Z47A 3HS0C 3S1RB 1I4XA 2IJ0A 1Q8IA 4FNFA 1EWCA 2JP1A 1L0XB 4KY5A 4KN7C 1PTOD 4RCNA 2RDHA 3P75A 1ZYRC 3U9OA 2A6EC 3M7NA 1X3PA 4XIGS 3Q22A 2QEJC 3SK8A 4QCLA 4IUTA 5FO9B 1UUPA 1NAPA 3QWNA 1CI3M 1E0BA 3OIPA 5C3XA 1Y8NB 3OOCA 3GTLB 1SBBB 2B2WC 3MZ5A 4FXGC 3AMUA 3BYTB 1SAPA 3MWYW 3U9SA 3DEOA 1JWMD 4KD4A 1I4GA 4FF2A 3V96A 4C1NI 4FF3A 3ZYYX 2E74C 5LL6S 1A2UA 3CQZB 4KD3A 2MUYA 5HURA 3C1EA 4ILWA 3HGBA 2QDBA 1BNZA 1ZXTA 1PFBA 4L6TB 5E3FA 1VCIA 3K58A 1TT2A 2F0JA 2JSOA 5EBDA 3K5LA 2QF7A 2K6AA 3AU7A 3H6MA 2XNAC 4DN4M 5M5XB 3NQTA 5KYLA 4I7ZC 2B2VA 2E75C 2J4XA 3OMCA 5J22A 3GV6A 4LMQD 3NTKA 4KKUA 4C1NK 3V2TA 3OHXC 1G2TA 4WFN3 3OSOA 2WIIB 4KHVA 4ABNA 5KYIA 4A3BB 4C3JG 1BQQT 1NR4A 2XSCA 1AN8A 4KJNA 5G3LF 3VR6A 1F9RA 3BDCA 5CYUA 5I9PA 1VF5C 2F0WA 3KLRA 3P1HA 1TIID 1PRTD 1V1OA 3ND9A 4FF1A 2SNSA 1MSHA 4QMGA 2XVSA 2A69C 2O2LD 5M9OA 1FNUA 1KABA 3ONAB 2HQEA 1V43A 1QE6A 1WTWA 2F0GA 5I6WA 2RSOA 4U68A 3NHHA 1O7ZA 1CTMA 2PMZB 3A56A 5CV4A 3PUVA 4BWGB 3BDOA 3QOJA 4RGMA 4BA2I 1QJOA 1F9PA 4BBRB 1ESRA 2IX0A 1D5ZC 5DM63 4M1UB 1IL8A 2BA1A 3GO5A 5I4DA 1RJTA 1XTCD 2IWHA 2KCCA 3TP6A 3DWAA 2EJFC 3KK7A 3KUPA 1TWGB 3A7LA 1JQYD 4HSPA 2H1EA 5IGDA 1WTOA 1HCZA 4E6IA 2K03A 4V190 1C48A 3HEJA 4R9WA 4EQNA 2NVYB 3QG1A 3SDZA 2F0IA 4IQZA 5CBEE 2ZT9C 3I3CA 4OIKA 4K8JA 3NTIA 4J6HA 5EGTA 2K1BA 4EQOA 3T51B 4R8NA 1JICA 3OWFA 4RHRA 3NK9A 3MAQA 3K0YA 3GTPB 4H13C 5C3WA 1SE2A 2F0VA 3RMHA 1JB3A 2A68C 1R4QB 3S16B 3NUCA 3R3OA 1JE4A 4G7OC 4C3JB 1C4QA 2WB1B 1B1ZA 1EY9A 2VNUD 2K04A 2A6ED 2X69A 1IHZA 3QB3A 3CHBD 4RKBA 1S4ZA 1TS3A 4CGYB 1S5DD 4AYBB 4GZYC 4OO1I 1BXTA 1HA6A 1M8AA 2DY7A 5M3MB 1H9SB 1T5XD 1SMYC 4KHZA 4A3JB 1KLGD 1IYUA 3TBIB 1ENAA 3J7YW 1XYIA 2CHBD 4XT3B 5C0XI 4XYQA 5I2XA 5F2DA 1FNVA 3QOLA 2JA8B 1LTBD 1JOQA 5CV5A 4IUVA 3PUYA 3D6CA 1TKWB 3K5NA 1EYCA 1PZJD 2XN9C 5IGBA 3GV3A 4FP5D 1EWHA 2AUKA 4A3GB 1CQFA 4RA8A 5IGCA 1YNNC 2LKVA 1WTRA 1KNEA 4RCOA 1TWFB 2L5TA 1STBA 1B44D 1I6HB 1NSNS 2F0NA 4Q5VA 2K5QA 2F0LA 3JAML 2FHTA 1CM9A 3MFGA 3VA7A 1J9OA 2KOLA 2OF1A 2WAQB 3SK5A 4DU9A 4BY7B 4BBSB 1BDOA 5IOCA 5BN4A 2PZUA 1TWAB 1KAAA 5FLXE 3BVZA 5C0XH 3IKJA 3D4WA 1PMRA 1LLRD 5CC4A 5EPLA 4HTHA 3TSSA 1O7LA 2PCFB 4IALA 2JA6B 1C8CA 2EYPA 4KMUC 5FKAC 1LT4D 3SE0A 1EU4A 2VXWA 1UAPA 2RDGA 4FF4A 1PDQA 3A8JE 3HG9A 5C6AA 5M5WB 5D3IB 4BA1I 1SNOA 3ITPA 3CU7A 4KTAA 2BDOA 1BOSA 2KEDA 3E0JA 4IUQA 3T53B 5C4XB 2LY7A 5DM73 3KBGA 3N6RA 1F2LA 4JK1C 3GTQB 1EY5A 2F0KA 5A2QE 2F3WA 2XWBB 3NXWA 1X32A 3F2UA 1TS4A 2LS01 2K05A 4O42A 5IODA 1CT1D 2EYOA 2EZVA 5EBCA 4M8AA 1LTGD 2B2TA 3TP8A 4OGQC 2JA7B 3DHQA 4I65A 1II3A 5CR3A 1D1KA 4C3HB 1Q12A 1STNA 1PYWD 1K8OA 3SHLA 2IL8A 5D3DA 4B9WA 2D5DA 3PUWA 4WRDA 2JEAI 5COYA 2A73B 1PRTF 1MI2A 2JE6I 4HAEA 4YIJA 4RHSA 4UAIA 1TS5A 4OO1G 1GUTA 2R3ZA 3C2PA 1PZKD 2L11A 3N52A 4K14A 2A74C 1I4HA 2NVQB 4QIWB 1TWHB 2L0CA 1EY8A 3A8KE 2WV6D 4BS9A 1M4VA 1LTRD 3S2DB 1A2TA 1K83B 4DA2A 5C0XG 4CJ1B 3K7AB 4X3UA 1CZWA 2A68D 1G2SA 1RHPA 2B2WA 2B39A 2K5WA 3NTHA 1MBYA 4DAPA 3QIAA 1I4RA 1ILQA 4MHEA 5NUCA 3EROA 1D5XC 4XXEA 3DEPA 3PV0A 1KDAA 3PIO3 1STAA 2J0TD 4CJ2C 4K5VA 1G6ZA 4QUCA 3ND8A 4B08A 2NVXB 3OIQA 1FR3A 1H9JA 5I6YA 3K5OA 4XQNA 1W6KA 4ZAIA 1EU3A 2B2YC 3IFDA 3D4RA 1SMYD 1S5ED 2R7ZB 2R6GA 5TSSA 5JJZA 1D5MC 1LT5D 3TZDA 3RUZA 4ZYSA 3I90A 1SJED 2BE5C 1O7YA 1LTID 4QF4A 1R4PB 2K7VA 1GOZA 4Z9CB 5IIFA 1U9RA 4HCSA 3SVMA 4L8JA 1G91A 2PO4A 1A3VA 3I8ZA 5AFWA 3VA5A 2EDGA 1B9MA 4ULLA 1YNND 1S5BD 1JC7A 4K8IA 5J39A 3OW7A 1SDFA 3PIP3 4LAAA 1HQRD 3GTKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTB D;  1EEF D;  1HA5 A;  5D3I B;  1AN8 A;  1D6E C;  3V05 A;  1UUP A;  3MC0 B;  1STE A;  1JR0 D;  1DJR D;  1LTA D;  1V1P B;  2SEB D;  3BZD B;  5ELC A;  1S5F D;  2ICI A;  1L0Y B;  1I4R A;  1PZJ D;  2XRS D;  1PTO C;  3BVG A;  2XN9 C;  1EFI D;  1PRT D;  1V1O A;  1SBB B;  3EA6 A;  1D5X C;  3SEB A;  3R2I A;  1ET9 A;  3BYT B;  4DXF A;  4RGN A;  2O2L D;  2AQ3 B;  1LT3 D;  4RHR A;  1JWM D;  3OWE B;  4DXG A;  1FNU A;  1PRT C;  1BCP B;  1CHQ D;  1I4G A;  1LTT D;  1RD9 D;  1AW7 A;  3O13 A;  1KTK A;  4RCO A;  1RF2 D;  1BCP F;  4O1N A;  1RCV D;  4OHJ A;  1SE4 A;  1TY0 A;  1SE2 A;  1TS2 A;  1G8Z D;  1TS4 A;  1EU3 A;  1LO5 D;  1B44 D;  4K6L A;  3BVM A;  2Z8L A;  1CHP D;  1DYQ A;  1S5E D;  2QIL A;  5ELB A;  1CT1 D;  4RFB A;  5ELE A;  1ET6 A;  1LTG D;  4L6T B;  5TSS A;  1JCK B;  3MFG A;  1LTS D;  2NTT A;  1S5C D;  2AQ1 B;  5FK9 C;  1D5M C;  1LT5 D;  4BWG B;  4ZYS A;  1PTO B;  1SJE D;  3URY A;  1BCP D;  1QIL A;  1B1Z A;  4RGM A;  2IPK D;  1LTI D;  5ELD A;  1PTO F;  1PYW D;  1LT6 D;  1JWU D;  2XNA C;  3GP7 A;  3EFX D;  5D3D A;  5ELF A;  3CHB D;  3W2D A;  2XRQ D;  1I4X A;  2IJ0 A;  1TS3 A;  1XXG A;  1FNW A;  3DWP A;  1GOZ A;  1S5D D;  1PRT B;  2G9H D;  4Z9C B;  4TSS A;  1SEB D;  1ENF A;  3BVZ A;  2R61 A;  3BYY B;  1EWC A;  1L0X B;  1HXY D;  1PRT F;  1I4Q A;  1LLR D;  1RDP D;  1FD7 D;  1BXT A;  1D5Z C;  1FGB D;  1I4P A;  4RHS A;  3KLS X;  3TSS A;  4C56 C;  1PZI D;  3DWQ A;  1HTL D;  1TS5 A;  1EEI D;  1SE3 A;  1ESF A;  1PTO D;  1T5X D;  4RGT A;  2J4X A;  5I4D A;  1XTC D;  4RH6 A;  1PZK D;  1F77 A;  3DWA A;  1SXT A;  1I4H A;  1KLG D;  1JQY D;  1MD2 D;  4RGO S;  2AQ2 B;  1KLU D;  1SJH D;  5FKA C;  3R8B A;  1LT4 D;  2TSS A;  1EU4 A;  1S5B D;  1V1P A;  2RDH A;  1BCP C;  2CHB D;  1JWS D;  2WV6 D;  4L63 B;  1M4V A;  1LTR D;  2RDG A;  1CK1 A;  1PTO H;  1UNS A;  3R2T A;  4UDU C;  1FNV A;  1TY2 A;  1HQR D;  2NTS A;  1CQV A;  2QEJ C; 
#chains in the Genus database with same CATH topology
 1MGS A;  5FLX c;  2A5H A;  1F9S A;  2HCI A;  4DK0 A;  5D14 A;  1WOC A;  4RAU C;  1AFP A;  4A3M B;  4TKO B;  3J7A 5;  2M00 A;  1HUN A;  1N34 L;  1HPC A;  2ICI A;  3BZK A;  1KQS A;  4CDE C;  3HKZ B;  4DUZ L;  3MEH A;  1QZG A;  4JV5 L;  2X6G A;  4DUY L;  2JA6 H;  2FMC A;  4DV7 L;  5ELN A;  4LF8 Q;  2AQ3 B;  3NWS A;  2Q8I B;  3J81 j;  1HNZ L;  4X62 L;  4IZ8 A;  1BVS A;  1GUO A;  3MXG A;  3VYS A;  5CV8 A;  4A3L G;  1EQV A;  1VS0 A;  2N88 A;  1D8L A;  3L2P A;  1CHP D;  1DYQ A;  3A5Z B;  4JI1 Q;  2GA4 B;  2UXD Q;  4IUN A;  4J8Q A;  2WKD A;  3FMC A;  2VL6 A;  1SNC A;  4AYB G;  5JPN C;  1IYJ B;  5M5W H;  3CCR A;  2ZTC A;  2ZM6 Q;  4HJ8 A;  2I5M X;  1UEB A;  4FO2 A;  5FK9 C;  2EY5 A;  3S17 B;  5M3M G;  4B3R Q;  3RZD B;  2B2V C;  1SRU A;  2KCM A;  1A15 A;  3K8A A;  4FDB A;  5C4X H;  2Z6B A;  4A3J G;  2Q8T A;  1NE3 A;  3I72 A;  5K5P A;  3DWP A;  3J81 c;  4F87 A;  5C4H A;  1VDZ A;  2AWN A;  1DOL A;  3L9A X;  1MIU A;  5COR A;  1C9O A;  1SNQ A;  1YJW A;  4NXN Q;  1I3Q B;  1M90 C;  1IBK L;  2MPM A;  1SND A;  3SR1 A;  1HTL D;  4ZQ3 A;  3T13 A;  4KKT A;  2NB0 A;  3GD7 A;  2JA8 G;  1RKN A;  5CMD A;  4LF7 L;  4RKL A;  4K2L A;  5EPJ A;  3I70 A;  1WTQ A;  1SFO B;  3QO2 A;  1HH2 P;  4HJ9 A;  4RGO S;  1G6P A;  5IT9 E;  3S24 A;  1HJP A;  2MO1 A;  1OXV A;  4XQJ A;  2JA7 H;  2Z4H A;  2TMP A;  4KY7 A;  2RA4 A;  3H94 A;  4LF4 Q;  4C3H H;  3HFZ B;  1X3Q A;  3F2C A;  1XNQ L;  4DV5 L;  2EVB A;  3EJI A;  1HA5 A;  5IYB G;  3RN5 A;  4P75 A;  3KLS A;  3RLF A;  4GOP A;  1STG A;  1WD0 A;  3CC2 A;  2EYF A;  3MC0 B;  1STE A;  4POF A;  1E1T A;  4YCU A;  4TQU S;  2B63 G;  3LGJ A;  3BZD B;  5KND A;  4IFD I;  3HZX A;  1BUV T;  1VMC A;  4PMC A;  4N8X 1;  1PH2 A;  4FVM A;  1MJE A;  5C44 B;  1TU2 B;  3GTG B;  2XRS D;  3NP8 A;  5J3B A;  1IBM Q;  3EQL C;  5GQO A;  1FYC A;  3K5M A;  1XMO Q;  2YV5 A;  3UDI A;  4HJA A;  2PPB C;  5JPM C;  1L2F A;  2VQF L;  1QB5 D;  4Y7N B;  1B4O A;  3KYH C;  3UDX A;  3C46 A;  5IP7 H;  2LXK A;  2WAQ G;  2NVQ H;  3J80 L;  1DD2 A;  4LNQ A;  3FKI B;  1TWH H;  4BY7 G;  4OEM B;  1RF2 D;  1BCP F;  3HOX B;  4BBS G;  4O1N A;  1RCV D;  4CKC A;  4DFA A;  4OL7 A;  4IOC A;  1AE3 A;  4DV0 Q;  1JB7 A;  3BVM A;  2KEC A;  3W1G A;  2CW0 C;  3F1Z A;  1TXY A;  3S2D H;  1ZKO A;  4XDX A;  1S3O A;  3FPU B;  1VQC A;  1HUM A;  3NBI A;  5M5Y B;  2L4N A;  1VQE A;  2EXZ A;  4N8F A;  4GLV B;  5CV9 A;  4QY7 A;  5KNB A;  2P5Z X;  4GS3 A;  1A3T A;  4YHH L;  5HGQ A;  2IX3 A;  2JA6 G;  3I4L A;  3EBE A;  4KHP L;  4ZKC B;  5DEH A;  1YNJ C;  3S1M B;  1XXG A;  1AEX A;  4A3K B;  2NBF A;  1PRT B;  2G9H D;  4A3F B;  4B3M Q;  1ICW A;  1W3S A;  1I4Q A;  3T1Y L;  2I07 B;  1I50 B;  1WJJ A;  4JI6 L;  3MXN A;  4LFB Q;  2FMM A;  4NXM Q;  4LW1 A;  3PO2 B;  2NVX H;  5C3E H;  1JE5 A;  1EEI D;  3CCU A;  2F4V Q;  4IUU A;  4RGT A;  2AKW B;  4KKS A;  1K8M A;  2ICE C;  1ZYR D;  3W3A A;  2N78 A;  4HR7 B;  2R7Z H;  1MD2 D;  1V1P A;  2F3V A;  3VYT A;  2E2J B;  4IN3 A;  2NYZ D;  3ERQ A;  5C4X G;  2DUD A;  4RMF A;  2JQO A;  1EFW A;  3I73 A;  3S1Q B;  3R2T A;  4F7X A;  4UDU C;  2NZH A;  4WJW A;  3HOY B;  1CQV A;  4NKL A;  2B2U C;  2UUA L;  1E2V A;  5I9O A;  3FVQ A;  4X3T A;  1CA6 A;  3S14 B;  3T4A C;  4DV4 Q;  3HP3 A;  2SEB D;  2PQA A;  2Z6K C;  4P71 A;  1HZC A;  5JVG 3;  4ODG A;  2F0O A;  1CA5 A;  1IBL L;  1PYB A;  2DJG C;  2E2D C;  2BE5 D;  4DR1 L;  2KA7 A;  4NP5 A;  4O0A A;  1NJI C;  3LWU A;  1E2W A;  3I55 A;  3H3V I;  3TS0 A;  2UXB Q;  2OXP A;  4KJO A;  2F0S A;  1N32 L;  1YIT A;  2JA7 G;  4LFC Q;  4GKK L;  5JEA H;  2HD3 A;  2VUM H;  5ISR A;  1PXU A;  4C3H G;  1KTK A;  1WVL A;  2CFM A;  4PMW A;  4ID6 A;  4OHJ A;  2E8G A;  4GNX B;  1SE4 A;  4LK1 C;  1K28 A;  1QNU A;  5FJ8 H;  1X56 A;  2HT1 A;  1E2Z A;  4JOI A;  2BCO A;  3K0X A;  3VR5 A;  2QIL A;  2K5D A;  1EIG A;  1WCM B;  1CZG A;  4ZUI A;  5DAU A;  1LTS D;  3G7L A;  4JBJ A;  3L7Z C;  3KF8 A;  3T56 B;  1YJ9 A;  4CHT B;  3ER0 A;  4KV6 A;  3MXU A;  1EY4 A;  1PH5 A;  4JG2 A;  4IUR A;  1PTO F;  2I46 A;  1O78 A;  1O80 A;  5IP7 G;  1ZEQ X;  1XX8 A;  2B63 B;  3EVQ A;  2CQA A;  1HXY D;  4R4C A;  4OO1 H;  5GAH C;  5KRU A;  1U4R A;  3TP5 A;  5IE8 A;  3ULP A;  2EY6 A;  4C56 C;  1CFM A;  3RZO B;  1GVP A;  2KQ3 A;  1SYG A;  4ZKB B;  4X6A H;  2DGY A;  1Y1W B;  3A54 A;  2JYO A;  4RH6 A;  3LWE A;  2KCN A;  4RWS C;  2UUB Q;  4HIM A;  4X64 Q;  4LF9 Q;  5E4W C;  2AQ2 B;  5EAY A;  4P73 A;  4DV2 L;  1VQ4 A;  3H3V H;  5E1F A;  1Y8P B;  1YBY A;  2Y0S B;  2F03 A;  3S17 H;  3NSW A;  1H9K A;  5EPK A;  3K57 A;  2EE1 A;  3RZD H;  2L12 A;  4H02 A;  1DON A;  3MXP A;  3TRZ A;  4CBV A;  1PLF A;  3D0F A;  5C3E G;  3HOW B;  1JR0 D;  3GTJ B;  1HHV A;  2RHQ B;  4R1J A;  1B2T A;  1EYD A;  3FDT A;  1L0Y B;  2A69 D;  3IAY A;  4DAY A;  2K14 A;  1I3Q H;  1QOH A;  4HED A;  4ZK9 B;  1NCV A;  2OQK A;  2WP8 J;  3EA6 A;  2R7Z G;  1MHW C;  2SOB A;  2WAC A;  2G5D A;  4JI7 Q;  1Y8O B;  4U67 3;  1GUW A;  4DV3 Q;  1UEA B;  5IT9 c;  2M9V A;  1EOT A;  1PRT C;  1SFO H;  5GRO A;  1AW7 A;  4R4T A;  2ZXP A;  3AEV A;  1ROD A;  3CCV A;  5EKK A;  1LO5 D;  1Q1B A;  2E2I B;  2PW7 A;  4LF6 Q;  1CKM A;  2IT1 A;  3TME A;  4YCW A;  5K36 H;  1I5F A;  1N36 L;  4DR6 L;  3J7A F;  1KRS A;  1YEZ A;  4DR7 Q;  2R93 B;  5GAE C;  3J7Z C;  5DLQ E;  2HHH L;  1LUZ A;  3TQY A;  2AUJ D;  2DN8 A;  1B7Y B;  3J7A V;  4FYD A;  4JYA L;  5C44 H;  4LUZ A;  1JOO A;  3GTG H;  2YTX A;  3J80 i;  3GP7 A;  3EFX D;  2ID0 A;  5JEA G;  4YY3 Q;  4R8I A;  3BZC A;  3SXH A;  2VUM G;  4N9T A;  1FNW A;  1PFM A;  3CCL A;  1B3A A;  3VYR A;  2L9H A;  1L1O B;  2NN6 I;  4Y7N H;  5KIX A;  3BG3 A;  2E2H H;  5FJ8 G;  4A3D B;  3S15 B;  1I4P A;  3CW2 C;  3FKI H;  1PZI D;  3HOX H;  5FLX L;  1ESF A;  3OMG A;  4FXK C;  1H9M A;  1F77 A;  4ME5 A;  2G9D A;  1NY4 A;  1STY A;  4J1M A;  2FXQ A;  4OX9 L;  1KLU D;  2NWG A;  3AFP A;  5M5Y H;  4JI0 Q;  2TSS A;  1JMC A;  4K5X A;  2ZTD A;  3L3O C;  3HKZ G;  3VR4 A;  3SK6 A;  3NWT A;  4GNX C;  4JBW A;  2KEE A;  1Q86 C;  1D1I A;  2UU9 Q;  3CRK C;  3Q23 A;  4DNT B;  2NTS A;  2CW0 D;  1XWE A;  4PZ8 A;  4DR3 Q;  5FO7 B;  2KHJ A;  1ASY A;  4JI3 Q;  2KHS A;  4OWT B;  4B3S L;  1VQL A;  3GTO B;  1D6E C;  2KVM A;  3S1M H;  4EQP A;  3KDF B;  4JI8 Q;  3X3N A;  4A3K H;  4X3K A;  2GVA A;  4A3F H;  1X9N A;  5ELC A;  4X65 Q;  2IW3 A;  3G4S A;  5T1G A;  3I4N H;  4PG3 A;  4WOR A;  1EFI D;  2JA5 H;  1JJ2 A;  3PO2 H;  3P7J A;  2JEB I;  5C0X J;  1YNJ D;  1E3P A;  3TEH B;  3M4O B;  3Q0A A;  2PI2 E;  1Z6H A;  5IP9 H;  1BCP B;  1LTT D;  3CKI B;  2K5H A;  2F1M A;  1EYA A;  2OCE A;  3F8T A;  4K0K Q;  1X55 A;  3BDL A;  3QJY A;  4PZ7 A;  2FFK B;  1EY7 A;  4HJ5 A;  5A2Q L;  3J81 L;  3MFY A;  3S1Q H;  3TN2 A;  1IXR A;  2C35 B;  2DNC A;  1GO3 E;  2NN6 H;  2PI2 A;  5JOB A;  4R4Q A;  5CGK A;  1VF7 A;  3HOY H;  2O4X A;  2RHS B;  4DF7 A;  3G48 A;  1PH7 A;  3S14 H;  5JAV A;  4GLX A;  2AMC B;  3KOJ A;  3D3R A;  5JVH 3;  4DR4 Q;  4PV1 C;  4UY8 C;  5M3F B;  2E76 C;  5C5L A;  4B9X A;  4OIJ A;  1EIH A;  5C3E B;  5LMU L;  5C4J B;  1MJC A;  1VQA A;  1A63 A;  1A8V A;  1PVO A;  4TSS A;  1HZB A;  2R61 A;  1ONL A;  4LWC A;  3ICE A;  1FGB D;  3HOV B;  1GD7 A;  2K50 A;  1PH9 A;  2EYM A;  5K36 G;  4X3S A;  4JI4 Q;  1WD1 A;  2RKS A;  2PZW A;  2UXC Q;  1RTN A;  4V0B A;  1VQB A;  4CJ0 B;  5D65 A;  1QCB D;  3IRB A;  2MGS A;  1WCM H;  2Q8R E;  3CAM A;  3H09 A;  4EGV A;  2JJQ A;  4DV1 L;  4C3I H;  1J8I A;  1Q90 A;  4G57 A;  2ZTE A;  4B3T L;  3I91 A;  2OWO A;  1IKL A;  1ML0 D;  4DUZ Q;  3JAM i;  1K0R A;  1X3E A;  1PA6 A;  4H7B A;  1GUG A;  2PW5 A;  4DV7 Q;  1KIX A;  1TQO A;  1NNX A;  4JI2 Q;  3WOF A;  2CWA A;  1MKH A;  1QZH A;  3GDE A;  4X62 Q;  3FKI G;  1HNZ Q;  2MP1 A;  3HOX G;  4DR5 L;  1U5K A;  2EOT A;  1X3F A;  1HQM C;  2VUM B;  2HDL A;  2RF4 A;  3BVG A;  2Z1C A;  4K5W A;  1LAC A;  4LF5 L;  1KAW A;  4OWW B;  3E6Z X;  1QUQ A;  1BBX C;  3R2I A;  3MHB A;  4MTN A;  1QVF A;  1U4L A;  1K9M C;  1Y1W H;  4ZRZ A;  1VQ5 A;  4RGN A;  4NW2 A;  4QIW E;  1LT3 D;  4A93 B;  1TVX A;  3DM1 A;  4KY6 A;  1B50 A;  2K01 A;  2X6L A;  1HFG A;  4R4O A;  1L1O C;  1RD9 D;  4G7H C;  1EZ6 A;  1RTO A;  1X3G A;  2EPB A;  2EY2 A;  4A3E H;  4XQQ A;  3H91 A;  4IJL A;  4A3K G;  3LNN A;  5BN3 A;  1EQQ A;  2EYJ A;  1VQN A;  2ZXR A;  2HDM A;  5HGT A;  4A3F G;  2IHE A;  2B29 A;  1JCK B;  2BDN A;  1A3U A;  3I4N G;  4OEL B;  1IYV A;  2K28 A;  3MVV A;  2JA5 G;  4I7A A;  2K4K A;  1GJX A;  3RD4 A;  3PO2 G;  4WJ3 M;  1PTO B;  3HOW H;  3D8G A;  3GTJ H;  1IBK Q;  1QIL A;  4A3C H;  1KXL A;  3M7G A;  5BN5 A;  4BY1 H;  2C5C A;  2A19 A;  3OYY A;  1Q1E A;  1F2Y A;  1Q3L A;  2D0O A;  3E0E A;  2XIW A;  5IP9 G;  1LV9 A;  2PQE A;  4LF7 Q;  1WTP A;  2K32 A;  5IGG A;  3TDQ A;  2PZT A;  3BYY B;  2RSN A;  5IGF A;  1RDP D;  2V4D A;  2F4I A;  3KJO A;  2NN6 G;  2F0U A;  4G4K A;  2KUM A;  1DZ1 A;  1I94 L;  1GHK A;  1GXD C;  3HOY G;  3A55 A;  1EY0 A;  3M85 A;  2UUC L;  4YWK A;  4F88 A;  3CCM A;  1DCZ A;  2E2I H;  1SXT A;  4DV5 Q;  5IWA Q;  1UE6 A;  2KBN A;  5HY6 A;  4NMZ A;  3PUX A;  1SJH D;  3Q6S A;  3R8B A;  3NEN A;  4ALP A;  2R93 H;  1BCP C;  2BOS A;  1JWS D;  4ZLT F;  3J80 E;  4CKE A;  3HOZ B;  4H0L C;  3MEF A;  4IUP A;  3CRL C;  1JOK A;  1VQH A;  2R7F A;  3S1N B;  2XGT A;  1DOK A;  3U4V A;  2CH4 W;  3M3Y B;  5CV7 A;  3KFU A;  1XJV A;  4XT1 B;  4K6D A;  2L1B A;  5ELO A;  1VQK A;  4QQB X;  1HR0 W;  2J7Z A;  1E1O A;  5KGU A;  1LTA D;  1V1P B;  2VB2 X;  1H9R A;  1IKM A;  1IW7 C;  4A3D H;  3S15 H;  1A6X A;  1NMG A;  1BO0 A;  1U4P A;  1QNK A;  4UHV A;  2Z4I A;  4DXF A;  1K3B C;  1WCM G;  2VB3 X;  1MSG A;  4AQY L;  1N9W A;  4C3I G;  4Q0F A;  2YU9 B;  3VR2 A;  4DK1 A;  3HOU B;  2Q2U A;  2AHO B;  3CP0 A;  2D62 A;  3O13 A;  3STB C;  2UXD L;  4YHH Q;  2HCC A;  2NUC A;  4P74 A;  1QVC A;  3PQI A;  2A6H C;  3C1F A;  1OXX K;  4K6L A;  4KHP Q;  1OTC A;  2ZM6 L;  1UE7 A;  3E5S A;  1E22 A;  3NE5 B;  1HFN A;  1PFN A;  4P72 A;  3PSI A;  2WIN B;  1EL0 A;  2CH4 A;  1B9N A;  1BR9 A;  2NTT A;  3GTO H;  2MNA A;  3T1Y Q;  1B53 A;  1AH9 A;  2I5H A;  2E2H B;  4CKB A;  3URY A;  2N8N A;  2VY3 A;  5KEE A;  3H0G B;  4GKJ L;  1HRJ A;  4OON A;  1Y1W G;  4AH6 A;  1PH8 A;  3DUZ A;  2F0F A;  1GKH A;  3HKZ E;  1LT6 D;  3Q24 A;  1ILP A;  3NPP A;  3A7A B;  5ELF A;  2XRQ D;  1SEB D;  3J81 i;  3M4O H;  4PMB A;  2PNR C;  2B8F A;  2K33 A;  1W6J A;  3KJP A;  4CDD C;  1FD7 D;  4A3E G;  2Y0S G;  3NQI A;  4HN7 A;  5C5M A;  4XTC S;  1NUC A;  1HTP A;  4K2K A;  4DNR B;  4ME3 A;  1C7Y A;  2XWJ B;  1XNR L;  4QUF A;  2D2C C;  1OO9 B;  2UUA Q;  2F0M A;  1VQ8 A;  1JJG A;  3TP7 A;  3HOW G;  2EJM A;  4A3C G;  1M1K C;  4LF4 L;  4XYO A;  4BY1 G;  2IX1 A;  1F2Z A;  4L63 B;  2B2U A;  1WTX A;  5FLM H;  1K8G A;  1DOM A;  2EJG C;  2CWP A;  4DR1 Q;  2HQL A;  4P2C B;  5M3F H;  3I4N B;  1VQD A;  2ENB A;  2JA5 B;  3CC4 A;  5IT9 L;  3FPP A;  2Z6K A;  1SN8 A;  3KBX A;  1VQF A;  3VR3 A;  1EYG A;  5C4J H;  1UWV A;  1OXT A;  1OXU A;  1AZP A;  4GKK Q;  4GN5 A;  1IBM L;  4IFD H;  1SNP A;  1FJG L;  1S5F D;  3IFT A;  2EYL A;  5EJW A;  3HOV H;  1PTO C;  4GLA C;  1F9Q A;  4N9P A;  4PNY A;  1QG7 A;  3S2H B;  3WOE A;  5KNC A;  2RCN A;  1ET9 A;  4IPH A;  1D2B A;  2R93 G;  3BS1 A;  1HR0 L;  3A74 A;  4Y52 H;  3UDG A;  2GVB A;  3OWE B;  4DXG A;  4HID A;  1DM0 B;  1KDC A;  2SNM A;  3CPW A;  3M4Y A;  2KJX A;  3GTM B;  1N33 L;  3C3L A;  3JAM E;  1TY0 A;  4DAY B;  1G8Z D;  1BBW A;  2B8G A;  3H3V C;  2DNE A;  3K59 A;  3T1H L;  4GN3 B;  5ELB A;  1YJN A;  1RL2 A;  4A3D G;  1U4M A;  4ZUJ A;  1S5C D;  2F3I A;  2YYZ A;  1KNA A;  3OTO L;  5G3L D;  5FOB B;  1SYD A;  3MTS A;  4B3M L;  3HRZ C;  4F8M A;  2M2L A;  1PH1 A;  1YHA A;  2WKC A;  4LFB L;  2LMC B;  2RQX A;  4DGZ A;  2I5L X;  4MTK A;  4PQX A;  2OEO A;  4A93 H;  1LAB A;  1VMP A;  2F0E A;  4HSV A;  3UI2 A;  3NBH A;  4HMI A;  4TRD A;  4DV2 Q;  1HZA A;  2PYK A;  3SK4 A;  3I2Z A;  4JI5 L;  2L55 A;  3OPO A;  1BF4 A;  1EQR A;  2BA0 A;  4C3I B;  2CVR A;  1SE3 A;  2QKI C;  2FJ2 A;  4HMJ A;  4KK7 A;  1SLJ A;  1SYB A;  1D7Q A;  2MHV A;  2ZJP A;  1GUS A;  1CSP A;  1HNW Q;  5A35 A;  5C4Z A;  1PTO H;  2I0Q A;  1TY2 A;  1WTV A;  1TWC B;  3GQB A;  4KN4 C;  4MN3 A;  4DV4 L;  1JT8 A;  3KLS X;  3A8I E;  1G29 1;  1SNM A;  2N55 A;  5IY0 A;  2F0P A;  4X66 L;  2VS1 A;  1R9T B;  1PV4 A;  1SYE A;  2EQS A;  3FEW X;  1DJR D;  1SYC A;  2FIN B;  1YI2 A;  3ULJ A;  2SDF A;  5DNF A;  1T5E A;  4JPB W;  3PUZ A;  3WDN A;  3I4M B;  1KDB A;  2EXD A;  4A3E B;  4LUV A;  1Y14 B;  1GHJ A;  1QWY A;  4DR6 Q;  2O5J C;  2O5I C;  5FLM G;  3CCS A;  3UDF A;  5LL6 X;  2HHH Q;  5M3F G;  1EQT A;  4QB4 A;  2EY1 A;  3DMU A;  5AJ3 L;  1TS2 A;  3A5U A;  1GM5 A;  3HOZ H;  1TR5 A;  3LX0 A;  2HUG A;  3P20 A;  4IFD J;  4BY1 B;  5GAG C;  4IFD G;  3S1N H;  5I2Y A;  2DY8 A;  3PF5 A;  1ET6 A;  3M3Y H;  3HOV G;  1F2M A;  5EQ0 A;  4TVA B;  4JW0 A;  3TZU A;  4IPC A;  1Z9F A;  3PMF A;  4KI0 A;  1BCP D;  3I7F A;  2IPK D;  5ELD A;  1K3R A;  1ENC A;  1H9S A;  2K52 A;  2BH8 A;  2KEN A;  3H15 A;  4FXD A;  3D31 A;  3W2D A;  3AB9 A;  2MJ8 A;  1Q7Y C;  2KCT A;  1ENF A;  2F0D A;  4EQ5 A;  1JOR A;  2YU9 H;  2JXM B;  3S9W A;  2OT2 A;  4A3I B;  3T16 A;  3HOU H;  3M4P A;  1FL0 A;  3RLO A;  3VYU A;  5CBA E;  5CV6 A;  3DWQ A;  3Q8D A;  2ZXO A;  2LFN A;  2UUB L;  5EKL A;  1IW7 D;  1AP0 A;  4LJZ C;  4MIU A;  3DXJ C;  1I6V C;  2F0T A;  5JEA J;  3UE1 A;  1V8Q A;  4NDX A;  3CCJ A;  4B3S Q;  2F0H A;  1EY6 A;  2A8V A;  2RDF A;  5LHY 1;  4EVO A;  5FO8 B;  1AZQ A;  1GUN A;  1Z7T A;  1EWI A;  1Q46 A;  3STB D;  1CK1 A;  1YHQ A;  2NVT B;  1STH A;  4UP7 A;  1UNS A;  1XMQ Q;  1EIY B;  3H0G H;  2A6H D;  4DV6 L;  3J81 E;  3D4D A;  4A93 G;  1TWG H;  3RNU A;  4BXX H;  1NR2 A;  3G6J B;  2NZ1 D;  1EEF D;  2D0P A;  2ASB A;  4IOA A;  3PO3 B;  3V05 A;  3FRP B;  2R92 B;  2LSS A;  1WFQ A;  4NPS A;  4DAV A;  2YTY A;  5T1I A;  2F0Q A;  3G6E A;  1PH3 A;  4DV3 L;  1PYS B;  4G7Z C;  2VQE L;  3SEB A;  4H44 C;  3FP9 A;  2C9O A;  1Y69 U;  2D9U A;  5J1Z A;  1CUK A;  2RBM A;  3DLL A;  1CHQ D;  4HCE A;  3K6O A;  3MA2 B;  2AWO A;  2H4O A;  1X65 A;  1SYF A;  1SR3 A;  2RVL A;  2Y0S E;  1OXS C;  1SSO A;  3R93 A;  4DR7 L;  2Z8L A;  5LMU Q;  1QUQ B;  4IPG A;  1DXM A;  3QR8 A;  4RFB A;  5EKI A;  5ELE A;  2HIV A;  3BU2 A;  5E4X A;  5IGE A;  2QCP X;  4C2M B;  2ES2 A;  5LMN W;  3D6W A;  2AQ1 B;  4DR2 Q;  2B2Y A;  1Y1V B;  1EZ8 A;  2B2T C;  2QEX A;  2F52 A;  2MFI A;  2EYH A;  4S3S A;  3IL8 A;  4DK3 C;  3X3M A;  1JWU D;  1Z47 A;  3HS0 C;  3S1R B;  1I4X A;  2IJ0 A;  3S2H H;  3U58 A;  1KHI A;  1Q8I A;  4FNF A;  1EWC A;  2JP1 A;  1L0X B;  4C3J H;  4KY5 A;  3HOZ G;  3JAM c;  4KN7 C;  4DV1 Q;  3GTM H;  1PTO D;  3U50 C;  2BH2 A;  4RCN A;  2OQ0 A;  2NZO A;  2RDH A;  3P75 A;  1ZYR C;  3U9O A;  2UU9 L;  2A6E C;  2OTL A;  2Q2I A;  3M7N A;  1X3P A;  4JI3 L;  4XIG S;  2A1A A;  3Q22 A;  1W2B A;  1J5E L;  1ICF B;  2QEJ C;  3SK8 A;  4QCL A;  2E5L L;  4IUT A;  3HOU G;  5FO9 B;  1UUP A;  1NAP A;  3G71 A;  3QWN A;  1CI3 M;  4JC0 A;  3OIP A;  1E0B A;  5C3X A;  1Y8N B;  4BBR G;  3OOC A;  3GTL B;  1SBB B;  1YNX A;  2B2W C;  3MZ5 A;  1N34 Q;  1L1O A;  2QW7 A;  4FXG C;  3AMU A;  4LFA L;  3BYT B;  1SAP A;  3MWY W;  3U9S A;  3DEO A;  1JWM D;  4KD4 A;  4JV5 Q;  4HIK A;  1I4G A;  4DUY Q;  4FF2 A;  3V96 A;  4C1N I;  4FF3 A;  3ZYY X;  3H0G G;  4DPG A;  2E74 C;  5LL6 S;  4BXX G;  4A3G H;  1A2U A;  3CQZ B;  1HNX L;  4KD3 A;  2MUY A;  4A4I A;  3C1E A;  4L5Q A;  4ILW A;  3HGB A;  4DK6 C;  5HUR A;  1TWC H;  2QDB A;  1BNZ A;  2EIF A;  1ZXT A;  1PFB A;  4L6T B;  5E3F A;  1XPU A;  3EIV A;  2OTJ A;  2CCZ A;  1PFS A;  1VCI A;  3K58 A;  1TT2 A;  2F0J A;  2JSO A;  2YTV A;  5EBD A;  3K5L A;  1R9T H;  1LM0 A;  2QF7 A;  1X6O A;  4GOP B;  4JBM A;  2K6A A;  3ZJY C;  3AU7 A;  3H6M A;  1I94 Q;  1H95 A;  2XNA C;  3I4M H;  1C0A A;  2UUC Q;  4DN4 M;  1A0I A;  5M5X B;  5LMN L;  4NB3 A;  3NQT A;  3OW2 A;  5KYL A;  4I7Z C;  4CDF C;  3KF6 A;  4JI4 L;  2B2V A;  2UXC L;  4QJF A;  3RN2 A;  2E75 C;  2J4X A;  3AQQ A;  1VQG A;  3OMC A;  1G51 A;  1TWA H;  3GV6 A;  5J22 A;  4LMQ D;  1KL9 A;  3BJU A;  1KD1 C;  1L0W A;  3NTK A;  1V9P A;  4KKU A;  4C1N K;  3V2T A;  3OHX C;  4L5S A;  1G2T A;  4WFN 3;  3OSO A;  2WII B;  3AFQ A;  1Q8K A;  1BKB A;  3W1B A;  4KHV A;  2IHF A;  4ABN A;  4JI2 L;  5KYI A;  3B6Y A;  4A3B B;  2WFW A;  4C3J G;  1BQQ T;  1NR4 A;  2WB1 G;  2XSC A;  4AQY Q;  1AN8 A;  4KJN A;  2GN5 A;  3DM3 A;  5L37 A;  5G3L F;  1XNQ Q;  3VR6 A;  4WJ4 A;  1K0S A;  1F9R A;  3BDC A;  5CYU A;  4JVZ A;  5I9P A;  5BR8 L;  1VF5 C;  2F0W A;  3P1H A;  3KLR A;  4A3I H;  1TII D;  1YVC A;  1CKN A;  1FVI A;  1PRT D;  1V1O A;  3ND9 A;  4FF1 A;  3MXN B;  2SNS A;  1MSH A;  4HJ7 A;  1Q81 C;  4QMG A;  2XVS A;  2Z0S A;  3ULL A;  2A69 C;  2O2L D;  1AE2 A;  5M9O A;  1X54 A;  1FNU A;  1PHJ A;  1YHB A;  1KAB A;  4QL5 A;  1XPO A;  2VQF Q;  3ONA B;  1IL2 A;  2RCF A;  3CD6 A;  4GKJ Q;  2HQE A;  1V43 A;  1QE6 A;  1WTW A;  2F0G A;  5I6W A;  2NVT H;  2RSO A;  1YZ6 A;  3GTQ H;  2K5V A;  4U68 A;  3NHH A;  2H5X A;  1O7Z A;  4LF8 L;  1CTM A;  2PMZ B;  4EX5 A;  3A56 A;  5CV4 A;  3PO3 H;  3PUV A;  4BWG B;  3BDO A;  2R92 H;  3QOJ A;  4RGM A;  4BA2 I;  2KHI A;  1QJO A;  2PQA B;  4JI1 L;  4UP9 A;  3ERS X;  1F9P A;  4BBR B;  1XNR Q;  1ESR A;  1LYL A;  2IX0 A;  4O2D A;  3K80 C;  3I56 A;  4A3G G;  1D5Z C;  5DM6 3;  4B3R L;  4M1U B;  1B3Q A;  1IL8 A;  5IWA L;  2BA1 A;  3GO5 A;  5IYC H;  4JI6 Q;  5I4D A;  1RJT A;  1XTC D;  2IWH A;  2KCC A;  3TP6 A;  2R7D A;  3DWA A;  2EJF C;  2VW9 A;  3KK7 A;  3KUP A;  1TWG B;  3A7L A;  1JQY D;  4HSP A;  2H1E A;  1IZ6 A;  5IGD A;  4NXN L;  3CPF A;  3NBH B;  1WTO A;  1ASZ A;  4C2M H;  1FJG Q;  3SGI A;  1BBU A;  1HCZ A;  4E6I A;  3I4M G;  2K03 A;  3K81 C;  4V19 0;  3PCO B;  4GN4 B;  1C48 A;  3KF8 B;  1Y1V H;  3HEJ A;  2ZJQ A;  1VQJ A;  4R9W A;  4EQN A;  2NVY B;  3S1R H;  1HR0 Q;  3EN2 A;  3QG1 A;  3SDZ A;  1PH4 A;  2F0I A;  1SE8 A;  1N33 Q;  4IQZ A;  5CBE E;  2ZT9 C;  3I3C A;  4J15 A;  4OIK A;  1K83 H;  4ZCK A;  4K8J A;  3NTI A;  4J6H A;  4GOP C;  2L15 A;  3K7A H;  5EGT A;  2K1B A;  5GAD C;  4EQO A;  3T51 B;  4R8N A;  1IBL Q;  3T1H Q;  1JIC A;  3OWF A;  4RHR A;  3NK9 A;  3E3X A;  3MAQ A;  3K0Y A;  3GTP B;  4CDC C;  4H13 C;  5C3W A;  1N32 Q;  1P8L A;  1SE2 A;  3OTO Q;  2F0V A;  1VQ6 A;  3RMH A;  1JB3 A;  1XMO L;  2A68 C;  1R4Q B;  1DGS A;  4A3I G;  1VQ9 A;  4JBK A;  3S16 B;  3NUC A;  3R3O A;  1JE4 A;  4G7O C;  4C3J B;  1C4Q A;  1VQ7 A;  2JN4 A;  2WB1 B;  4JI5 Q;  1B1Z A;  1EY9 A;  2VNU D;  2K04 A;  2A6E D;  4DV0 L;  1NMF A;  2PMZ E;  2X69 A;  1IHZ A;  3QB3 A;  3GTL H;  3CHB D;  2LXJ A;  4RKB A;  1S4Z A;  1TS3 A;  4CGY B;  1S5D D;  3VDY A;  1T9H A;  4AYB B;  4GZY C;  3AYH B;  4OO1 I;  1PH6 A;  1BXT A;  1HA6 A;  1M8A A;  1SMX A;  2DY7 A;  3A0J A;  5M3M B;  4OWX B;  1H9S B;  1T5X D;  1SMY C;  3E9I A;  5JJK A;  3CQZ H;  3PO3 G;  3NEM A;  4KHZ A;  2DJF C;  4A3J B;  1KLG D;  4X66 Q;  2R92 G;  3TS2 A;  1IYU A;  3TBI B;  1ENA A;  3J7Y W;  1XYI A;  4L5T A;  2CHB D;  4XT3 B;  4NXM L;  5C0X I;  3U4Z A;  3HKS A;  4XYQ A;  1Q82 C;  1VQI A;  2F4V L;  5I2X A;  5F2D A;  1FNV A;  3UE0 A;  3QOL A;  2JA8 B;  1LTB D;  3PIO A;  1JOQ A;  5CV5 A;  4IUV A;  3PUY A;  4IO9 A;  5M5X H;  3CMA A;  3D6C A;  1TKW B;  2B3G A;  5IYC G;  3K5N A;  1EYC A;  1PZJ D;  2XN9 C;  5IGB A;  5AJ3 Q;  3GV3 A;  4FP5 D;  3GTK H;  1EWH A;  2AUK A;  4A3G B;  1SRO A;  1CQF A;  4RA8 A;  5IGC A;  3F2B A;  1N8R C;  3TRE A;  4A3M H;  1LTL A;  1YNN C;  4KLK A;  2LKV A;  2K5N A;  1Y1V G;  1WTR A;  1KNE A;  4RCO A;  4A76 A;  1CSQ A;  1TWF B;  2L5T A;  1STB A;  1B44 D;  1I6H B;  1NSN S;  3CXC A;  2F0N A;  2UXB L;  4Q5V A;  2K5Q A;  4DAM A;  2F0L A;  4A3B H;  4YWL A;  3JAM L;  4LFC L;  2FHT A;  1A62 A;  1CM9 A;  3MFG A;  3VA7 A;  1J9O A;  2KOL A;  4JOI C;  3NEL A;  1EIF A;  2OF1 A;  2WAQ B;  1N36 Q;  3SK5 A;  4DU9 A;  4BY7 B;  4BBS B;  1BDO A;  3J80 c;  1FGU A;  5IOC A;  2VZA A;  5BN4 A;  2PZU A;  4POG A;  4JYA Q;  1TWA B;  1KAA A;  4QGU A;  1NBW A;  5FLX E;  2WB1 E;  3BVZ A;  5C0X H;  3CCQ A;  3IKJ A;  3D4W A;  1PMR A;  1LLR D;  1B70 B;  5CC4 A;  3JC6 6;  5EPL A;  4HTH A;  1VQO A;  3PGZ A;  2HIX A;  1O7L A;  3TSS A;  2PCF B;  4IAL A;  3PIP A;  2JA6 B;  3W5O A;  1C8C A;  4AYB E;  4DV6 Q;  4JCV E;  2MO0 A;  1HNW L;  5JJI A;  3CCE A;  2EYP A;  5E7N A;  1B8A A;  4KMU C;  5FKA C;  1LT4 D;  3SE0 A;  1EU4 A;  2XTI A;  2VXW A;  4DKA C;  1UAP A;  2RDG A;  4FF4 A;  4OX9 Q;  1PDQ A;  3A8J E;  3HG9 A;  2VQE Q;  4RG1 A;  4YCV A;  1E24 A;  5C6A A;  1J6Q A;  5M5W B;  4X64 L;  1WI5 A;  3WWV A;  4LF9 L;  1WYD A;  5D3I B;  4BBR H;  4BA1 I;  1UE1 A;  1SNO A;  3F2D A;  3ITP A;  3RLN A;  3CU7 A;  4KTA A;  2BDO A;  5IYD H;  1BOS A;  2KED A;  3E0J A;  4IUQ A;  4GNX A;  3T53 B;  5C4X B;  2LY7 A;  5DM7 3;  4MZ9 A;  3I4O A;  3KBG A;  3N6R A;  2QDL A;  1F2L A;  2ATW A;  4JK1 C;  3GTQ B;  1EY5 A;  2F0K A;  5A2Q E;  2F3W A;  2XWB B;  3NXW A;  1X32 A;  3F2U A;  1TS4 A;  2LS0 1;  2K05 A;  4O42 A;  2QA4 A;  4JI7 L;  5IOD A;  1XPR A;  1CT1 D;  2EYO A;  1XTD A;  2EZV A;  5EBC A;  4M8A A;  1LTG D;  2B2T A;  3TP8 A;  4OGQ C;  1QVG A;  2NVY H;  2JA7 B;  3DHQ A;  1CKO A;  4I65 A;  1E7Z A;  4IPD A;  1II3 A;  5CR3 A;  1D1K A;  1JJC B;  4C3H B;  1Q12 A;  1STN A;  1PYW D;  1K8O A;  2JK8 A;  4A3M G;  1YIJ A;  4LF6 L;  3SHL A;  2IL8 A;  5D3D A;  4HIO A;  4MNO A;  1S40 A;  4B9W A;  2D5D A;  2WAQ E;  3PUW A;  4WRD A;  2JEA I;  3KLW A;  5COY A;  2A73 B;  1PRT F;  1MI2 A;  2ALY B;  2JE6 I;  4HAE A;  4YIJ A;  3GTP H;  4DNI A;  2PNH A;  4RHS A;  4UAI A;  1S72 A;  1TS5 A;  1V1Q A;  4OO1 G;  1GUT A;  4PZ6 A;  4A3B G;  1NTG A;  2R3Z A;  3C2P A;  4YY3 L;  1J5E Q;  1PZK D;  2L11 A;  1RIP A;  3N52 A;  4K14 A;  2A74 C;  1I4H A;  2E5L Q;  2NVQ B;  4QIW B;  4YWM A;  1I50 H;  1TWH B;  2L0C A;  1EY8 A;  3A8K E;  1XMQ L;  3KF6 B;  2WV6 D;  4BS9 A;  1M4V A;  3S16 H;  1LTR D;  5JJL A;  4A75 A;  3S2D B;  1A2T A;  2CQO A;  1K83 B;  4DA2 A;  5C0X G;  4CJ1 B;  3K7A B;  4X3U A;  1CZW A;  4LFA Q;  1KC8 C;  2A68 D;  4B3T Q;  2K75 A;  4A3L H;  1G2S A;  1RHP A;  2N3S A;  4JI0 L;  2E2J H;  2B2W A;  1EUJ A;  2B39 A;  2K5W A;  3NTH A;  1MBY A;  4DAP A;  3M4Q A;  3QIA A;  1I4R A;  4IJH A;  1ILQ A;  3L0O A;  1VQM A;  4MHE A;  5NUC A;  4DR5 Q;  3ERO A;  1D5X C;  4XXE A;  3DEP A;  5M3M H;  1HNX Q;  3PV0 A;  4DR3 L;  1KDA A;  3PIO 3;  1STA A;  4LF5 Q;  1HZ9 A;  2J0T D;  2Z9H A;  4CJ2 C;  4JI8 L;  2CKZ B;  4K5V A;  4A3J H;  5H1S E;  1G6Z A;  2MQH A;  4QUC A;  2N49 A;  1KRT A;  3ND8 A;  4B08 A;  4X65 L;  2NVX B;  3OIQ A;  2IY5 B;  1FR3 A;  1EOV A;  1H9J A;  2Q2T A;  5I6Y A;  3K5O A;  4XQN A;  1W6K A;  1CKN B;  1EU3 A;  2B2Y C;  4ZAI A;  3CME A;  1VQP A;  3IFD A;  3D4R A;  1SMY D;  1S5E D;  2R7Z B;  2JA8 H;  2R6G A;  1K73 C;  5IYD G;  1O7I A;  5TSS A;  5LMN Q;  4DR2 L;  3PF4 A;  5JJZ A;  3FHW A;  4K0K L;  1D5M C;  1LT5 D;  3TZD A;  3RUZ A;  4ZYS A;  3I90 A;  4OXP A;  1SJE D;  2BE5 C;  1O7Y A;  1LTI D;  4QF4 A;  4AIM A;  2ZJR A;  1R4P B;  3K7U C;  2JA9 A;  3M9B A;  2K7V A;  1GOZ A;  5C44 G;  4UP8 A;  1K8A C;  4Z9C B;  5IIF A;  1U9R A;  4HCS A;  4DR4 L;  5IYB H;  3SVM A;  1UE5 A;  4UPA A;  4R4I A;  2B63 H;  4L8J A;  1G91 A;  1TWF H;  2PO4 A;  1A3V A;  3I8Z A;  2Q2H A;  1I6H H;  5AFW A;  3VA5 A;  2EDG A;  1B9M A;  3E9H A;  3KDF A;  4ULL A;  1YNN D;  4LUO A;  1S5B D;  3RZO H;  3CC7 A;  1JC7 A;  3RR5 A;  5BR8 Q;  4K8I A;  3CF5 A;  5J39 A;  3OW7 A;  1SDF A;  2QGQ A;  2V1C C;  1WTH A;  4L5R C;  3PIP 3;  4BY7 H;  1P16 A;  4APV A;  4LAA A;  4BBS H;  1U0L A;  1HQR D;  3GTK B; 
#chains in the Genus database with same CATH homology
 1MGS A;  2A5H A;  1F9S A;  2HCI A;  4DK0 A;  5D14 A;  4RAU C;  1AFP A;  4A3M B;  4TKO B;  2M00 A;  1HUN A;  1HPC A;  2ICI A;  3HKZ B;  3MEH A;  2X6G A;  2FMC A;  2AQ3 B;  3NWS A;  2Q8I B;  4IZ8 A;  1GUO A;  3MXG A;  3VYS A;  5CV8 A;  1EQV A;  2N88 A;  1CHP D;  1DYQ A;  2GA4 B;  4IUN A;  4J8Q A;  2WKD A;  3FMC A;  1SNC A;  5JPN C;  4FO2 A;  5FK9 C;  2EY5 A;  3S17 B;  3RZD B;  2B2V C;  1A15 A;  2Q8T A;  3I72 A;  5K5P A;  3DWP A;  4F87 A;  5C4H A;  1VDZ A;  2AWN A;  1DOL A;  3L9A X;  5COR A;  1SNQ A;  1I3Q B;  2MPM A;  1SND A;  3SR1 A;  1HTL D;  4ZQ3 A;  3T13 A;  4KKT A;  2NB0 A;  3GD7 A;  1RKN A;  5CMD A;  4RKL A;  4K2L A;  5EPJ A;  3I70 A;  1WTQ A;  1SFO B;  3QO2 A;  4RGO S;  5IT9 E;  1OXV A;  4XQJ A;  2Z4H A;  2TMP A;  4KY7 A;  2RA4 A;  3H94 A;  1X3Q A;  2EVB A;  3EJI A;  1HA5 A;  3KLS A;  3RLF A;  1WD0 A;  1STG A;  2EYF A;  3MC0 B;  1STE A;  4IFD I;  4TQU S;  5KND A;  3BZD B;  3HZX A;  1BUV T;  1VMC A;  4PMC A;  4FVM A;  5C44 B;  1TU2 B;  3GTG B;  2XRS D;  3NP8 A;  3EQL C;  3K5M A;  1FYC A;  2PPB C;  5JPM C;  1QB5 D;  4Y7N B;  1B4O A;  3C46 A;  3J80 L;  1DD2 A;  3FKI B;  1RF2 D;  1BCP F;  3HOX B;  4O1N A;  1RCV D;  4CKC A;  4DFA A;  4OL7 A;  3BVM A;  2KEC A;  2CW0 C;  1ZKO A;  4XDX A;  3FPU B;  1HUM A;  3NBI A;  5M5Y B;  2L4N A;  2EXZ A;  5CV9 A;  5KNB A;  1A3T A;  2IX3 A;  3I4L A;  4ZKC B;  5DEH A;  1YNJ C;  3S1M B;  1XXG A;  1AEX A;  4A3K B;  2NBF A;  1PRT B;  2G9H D;  4A3F B;  1ICW A;  1I4Q A;  2I07 B;  1I50 B;  3MXN A;  2FMM A;  3PO2 B;  1EEI D;  4IUU A;  4RGT A;  4KKS A;  1K8M A;  2ICE C;  1ZYR D;  3W3A A;  4HR7 B;  1MD2 D;  1V1P A;  2F3V A;  3VYT A;  2E2J B;  4IN3 A;  2NYZ D;  3ERQ A;  3I73 A;  3S1Q B;  3R2T A;  4F7X A;  4UDU C;  4WJW A;  3HOY B;  1CQV A;  4NKL A;  2B2U C;  1E2V A;  5I9O A;  3FVQ A;  4X3T A;  1CA6 A;  3S14 B;  3T4A C;  3HP3 A;  2SEB D;  5JVG 3;  4ODG A;  2F0O A;  1CA5 A;  2E2D C;  2BE5 D;  2KA7 A;  4NP5 A;  3LWU A;  1E2W A;  2OXP A;  4KJO A;  2F0S A;  5JEA H;  5ISR A;  1PXU A;  4C3H G;  1KTK A;  1WVL A;  4PMW A;  4ID6 A;  4OHJ A;  1SE4 A;  4LK1 C;  1QNU A;  1E2Z A;  2BCO A;  3VR5 A;  2QIL A;  2K5D A;  1EIG A;  1WCM B;  1CZG A;  4ZUI A;  5DAU A;  1LTS D;  3G7L A;  3L7Z C;  3KF8 A;  3T56 B;  4CHT B;  4KV6 A;  3MXU A;  1EY4 A;  4IUR A;  1PTO F;  2I46 A;  1O78 A;  1O80 A;  1ZEQ X;  1XX8 A;  2B63 B;  3EVQ A;  2CQA A;  1HXY D;  4OO1 H;  5KRU A;  1U4R A;  3TP5 A;  2EY6 A;  4C56 C;  1CFM A;  3RZO B;  2KQ3 A;  1SYG A;  4ZKB B;  1Y1W B;  3A54 A;  2JYO A;  4RH6 A;  3LWE A;  2KCN A;  4RWS C;  5E4W C;  2AQ2 B;  5E1F A;  1Y8P B;  2Y0S B;  2F03 A;  3NSW A;  1H9K A;  5EPK A;  3K57 A;  2EE1 A;  2L12 A;  1DON A;  3MXP A;  4CBV A;  1PLF A;  3HOW B;  1JR0 D;  3GTJ B;  1HHV A;  1B2T A;  1EYD A;  3FDT A;  1L0Y B;  2A69 D;  3IAY A;  4DAY A;  1QOH A;  4HED A;  4ZK9 B;  1NCV A;  2WP8 J;  3EA6 A;  2SOB A;  2WAC A;  1Y8O B;  4U67 3;  1GUW A;  1UEA B;  2M9V A;  1EOT A;  1PRT C;  1AW7 A;  2ZXP A;  1ROD A;  5EKK A;  1LO5 D;  1Q1B A;  2E2I B;  2PW7 A;  2IT1 A;  3TME A;  5K36 H;  3J7A F;  2R93 B;  2AUJ D;  2DN8 A;  3J7A V;  4FYD A;  1JOO A;  3GP7 A;  3EFX D;  2ID0 A;  5JEA G;  4R8I A;  3SXH A;  4N9T A;  1FNW A;  1PFM A;  1B3A A;  3VYR A;  2L9H A;  2NN6 I;  5KIX A;  3BG3 A;  4A3D B;  3S15 B;  1I4P A;  1PZI D;  5FLX L;  1ESF A;  3OMG A;  4FXK C;  1H9M A;  1F77 A;  4ME5 A;  2G9D A;  4J1M A;  1STY A;  1KLU D;  2NWG A;  2TSS A;  4K5X A;  3L3O C;  3VR4 A;  3SK6 A;  3NWT A;  4JBW A;  2KEE A;  1D1I A;  3CRK C;  3Q23 A;  4DNT B;  2NTS A;  2CW0 D;  1XWE A;  5FO7 B;  2KHS A;  3GTO B;  1D6E C;  2KVM A;  4EQP A;  3X3N A;  4X3K A;  5ELC A;  2IW3 A;  5T1G A;  4WOR A;  1EFI D;  3P7J A;  2JEB I;  5C0X J;  1YNJ D;  3M4O B;  3Q0A A;  1Z6H A;  1BCP B;  1LTT D;  3CKI B;  2F1M A;  1EYA A;  3BDL A;  3QJY A;  2FFK B;  1EY7 A;  5A2Q L;  3J81 L;  3MFY A;  3TN2 A;  2DNC A;  2NN6 H;  5JOB A;  5CGK A;  1VF7 A;  2O4X A;  4DF7 A;  5JAV A;  3D3R A;  5JVH 3;  4PV1 C;  5M3F B;  2E76 C;  5C5L A;  4B9X A;  4OIJ A;  1EIH A;  5C3E B;  5C4J B;  4TSS A;  2R61 A;  1ONL A;  1FGB D;  3HOV B;  2EYM A;  5K36 G;  4X3S A;  1WD1 A;  2RKS A;  2PZW A;  1RTN A;  4V0B A;  4CJ0 B;  5D65 A;  1QCB D;  2MGS A;  2Q8R E;  4EGV A;  3H09 A;  1J8I A;  1Q90 A;  4G57 A;  3I91 A;  1IKL A;  1ML0 D;  4H7B A;  1GUG A;  2PW5 A;  1TQO A;  3WOF A;  2MP1 A;  2EOT A;  1HQM C;  2VUM B;  2HDL A;  3BVG A;  2Z1C A;  4K5W A;  1LAC A;  3E6Z X;  1BBX C;  3R2I A;  3MHB A;  1U4L A;  4ZRZ A;  4RGN A;  4NW2 A;  1LT3 D;  4A93 B;  1TVX A;  3DM1 A;  4KY6 A;  1B50 A;  2K01 A;  2X6L A;  1HFG A;  1RD9 D;  4G7H C;  1EZ6 A;  1RTO A;  2EPB A;  2EY2 A;  4XQQ A;  3H91 A;  3LNN A;  5BN3 A;  2EYJ A;  2ZXR A;  2HDM A;  5HGT A;  1JCK B;  2BDN A;  1A3U A;  1IYV A;  2K28 A;  3MVV A;  1GJX A;  3RD4 A;  1PTO B;  3D8G A;  1QIL A;  3M7G A;  5BN5 A;  2C5C A;  1Q1E A;  1F2Y A;  1Q3L A;  2XIW A;  1LV9 A;  2PQE A;  1WTP A;  2K32 A;  5IGG A;  3TDQ A;  2PZT A;  3BYY B;  2RSN A;  5IGF A;  1RDP D;  2V4D A;  2F4I A;  2NN6 G;  2F0U A;  4G4K A;  2KUM A;  1DZ1 A;  1GHK A;  1GXD C;  3A55 A;  1EY0 A;  3M85 A;  4F88 A;  1DCZ A;  1SXT A;  4NMZ A;  3PUX A;  1SJH D;  3Q6S A;  3R8B A;  1BCP C;  2BOS A;  1JWS D;  4ZLT F;  3J80 E;  4CKE A;  3HOZ B;  4H0L C;  4IUP A;  3CRL C;  1JOK A;  3S1N B;  1DOK A;  3M3Y B;  5CV7 A;  4XT1 B;  4K6D A;  2L1B A;  2J7Z A;  5KGU A;  1LTA D;  1V1P B;  2VB2 X;  1H9R A;  1IKM A;  1IW7 C;  1A6X A;  1BO0 A;  1U4P A;  1QNK A;  2Z4I A;  4DXF A;  2VB3 X;  1MSG A;  4C3I G;  4Q0F A;  2YU9 B;  3VR2 A;  4DK1 A;  3HOU B;  2D62 A;  3O13 A;  2HCC A;  2NUC A;  2A6H C;  3C1F A;  1OXX K;  4K6L A;  3E5S A;  3NE5 B;  1HFN A;  1PFN A;  2WIN B;  1EL0 A;  1B9N A;  1BR9 A;  2NTT A;  1B53 A;  2E2H B;  4CKB A;  3URY A;  5KEE A;  3H0G B;  1HRJ A;  2F0F A;  3DUZ A;  3Q24 A;  1LT6 D;  1ILP A;  3NPP A;  3A7A B;  5ELF A;  2XRQ D;  1SEB D;  4PMB A;  2PNR C;  2B8F A;  2K33 A;  1W6J A;  1FD7 D;  4HN7 A;  3NQI A;  5C5M A;  4XTC S;  1NUC A;  1HTP A;  4K2K A;  4DNR B;  2XWJ B;  4QUF A;  2D2C C;  1OO9 B;  2F0M A;  3TP7 A;  2EJM A;  4XYO A;  2IX1 A;  1F2Z A;  4L63 B;  2B2U A;  1WTX A;  1DOM A;  2EJG C;  4P2C B;  3I4N B;  2ENB A;  2JA5 B;  5IT9 L;  3FPP A;  3KBX A;  3VR3 A;  1OXT A;  1OXU A;  1AZP A;  4IFD H;  1SNP A;  1S5F D;  3IFT A;  2EYL A;  5EJW A;  1PTO C;  1F9Q A;  4N9P A;  4PNY A;  1QG7 A;  3S2H B;  3WOE A;  5KNC A;  1ET9 A;  1D2B A;  3BS1 A;  3OWE B;  4DXG A;  1DM0 B;  1KDC A;  2SNM A;  3M4Y A;  2KJX A;  3GTM B;  3C3L A;  3JAM E;  1TY0 A;  1G8Z D;  2B8G A;  3H3V C;  2DNE A;  3K59 A;  5ELB A;  1U4M A;  4ZUJ A;  1S5C D;  2YYZ A;  1KNA A;  5G3L D;  5FOB B;  1SYD A;  3MTS A;  3HRZ C;  4F8M A;  2M2L A;  2WKC A;  2LMC B;  2RQX A;  4DGZ A;  4PQX A;  2OEO A;  1LAB A;  1VMP A;  2F0E A;  4HSV A;  3UI2 A;  3NBH A;  4HMI A;  4TRD A;  2PYK A;  3SK4 A;  2L55 A;  3OPO A;  1BF4 A;  2BA0 A;  4C3I B;  2CVR A;  1SE3 A;  2QKI C;  2FJ2 A;  4HMJ A;  4KK7 A;  1SYB A;  2MHV A;  1GUS A;  5A35 A;  5C4Z A;  1PTO H;  1TY2 A;  1WTV A;  1TWC B;  3GQB A;  4KN4 C;  4MN3 A;  3KLS X;  3A8I E;  1G29 1;  1SNM A;  2N55 A;  2F0P A;  1R9T B;  1SYE A;  3FEW X;  1DJR D;  1SYC A;  2FIN B;  2SDF A;  5DNF A;  1T5E A;  3PUZ A;  3WDN A;  3I4M B;  1KDB A;  4A3E B;  1GHJ A;  1QWY A;  2O5J C;  2O5I C;  5LL6 X;  1EQT A;  4QB4 A;  2EY1 A;  3DMU A;  1TS2 A;  1TR5 A;  3LX0 A;  2HUG A;  3P20 A;  4IFD J;  4BY1 B;  4IFD G;  5I2Y A;  2DY8 A;  1ET6 A;  1F2M A;  5EQ0 A;  3TZU A;  3PMF A;  4KI0 A;  1BCP D;  2IPK D;  5ELD A;  1ENC A;  1H9S A;  4FXD A;  3D31 A;  3W2D A;  3AB9 A;  2MJ8 A;  1ENF A;  2F0D A;  1JOR A;  2JXM B;  3S9W A;  2OT2 A;  4A3I B;  3T16 A;  3VYU A;  5CBA E;  5CV6 A;  3DWQ A;  2ZXO A;  2LFN A;  5EKL A;  1IW7 D;  1AP0 A;  4LJZ C;  4MIU A;  3DXJ C;  1I6V C;  2F0T A;  5JEA J;  1V8Q A;  4NDX A;  2F0H A;  1EY6 A;  2RDF A;  5LHY 1;  4EVO A;  5FO8 B;  1AZQ A;  1GUN A;  1Z7T A;  1CK1 A;  2NVT B;  1STH A;  1UNS A;  2A6H D;  3J81 E;  3D4D A;  1NR2 A;  3G6J B;  2NZ1 D;  1EEF D;  3PO3 B;  3V05 A;  3FRP B;  2R92 B;  4DAV A;  5T1I A;  2F0Q A;  4G7Z C;  3SEB A;  4H44 C;  2C9O A;  1Y69 U;  2D9U A;  5J1Z A;  2RBM A;  1CHQ D;  4HCE A;  3K6O A;  3MA2 B;  2AWO A;  2H4O A;  1SYF A;  2RVL A;  1OXS C;  1SSO A;  3R93 A;  2Z8L A;  1DXM A;  4RFB A;  5EKI A;  5ELE A;  5E4X A;  5IGE A;  2QCP X;  4C2M B;  3D6W A;  2AQ1 B;  2B2Y A;  1Y1V B;  1EZ8 A;  2B2T C;  2EYH A;  4S3S A;  3IL8 A;  3X3M A;  1JWU D;  1Z47 A;  3HS0 C;  3S1R B;  1I4X A;  2IJ0 A;  1Q8I A;  4FNF A;  1EWC A;  2JP1 A;  1L0X B;  4KY5 A;  4KN7 C;  1PTO D;  4RCN A;  2RDH A;  3P75 A;  1ZYR C;  3U9O A;  2A6E C;  3M7N A;  1X3P A;  4XIG S;  3Q22 A;  2QEJ C;  3SK8 A;  4QCL A;  4IUT A;  5FO9 B;  1UUP A;  1NAP A;  3QWN A;  1CI3 M;  1E0B A;  3OIP A;  5C3X A;  1Y8N B;  3OOC A;  3GTL B;  1SBB B;  2B2W C;  3MZ5 A;  4FXG C;  3AMU A;  3BYT B;  1SAP A;  3MWY W;  3U9S A;  3DEO A;  1JWM D;  4KD4 A;  1I4G A;  4FF2 A;  3V96 A;  4C1N I;  4FF3 A;  3ZYY X;  2E74 C;  5LL6 S;  1A2U A;  3CQZ B;  4KD3 A;  2MUY A;  5HUR A;  3C1E A;  4ILW A;  3HGB A;  2QDB A;  1BNZ A;  1ZXT A;  1PFB A;  4L6T B;  5E3F A;  1VCI A;  3K58 A;  1TT2 A;  2F0J A;  2JSO A;  5EBD A;  3K5L A;  2QF7 A;  2K6A A;  3AU7 A;  3H6M A;  2XNA C;  4DN4 M;  5M5X B;  3NQT A;  5KYL A;  4I7Z C;  2B2V A;  2E75 C;  2J4X A;  3OMC A;  5J22 A;  3GV6 A;  4LMQ D;  3NTK A;  4KKU A;  4C1N K;  3V2T A;  3OHX C;  1G2T A;  4WFN 3;  3OSO A;  2WII B;  4KHV A;  4ABN A;  5KYI A;  4A3B B;  4C3J G;  1BQQ T;  1NR4 A;  2XSC A;  1AN8 A;  4KJN A;  5G3L F;  3VR6 A;  1F9R A;  3BDC A;  5CYU A;  5I9P A;  1VF5 C;  2F0W A;  3KLR A;  3P1H A;  1TII D;  1PRT D;  1V1O A;  3ND9 A;  4FF1 A;  2SNS A;  1MSH A;  4QMG A;  2XVS A;  2A69 C;  2O2L D;  5M9O A;  1FNU A;  1KAB A;  3ONA B;  2HQE A;  1V43 A;  1QE6 A;  1WTW A;  2F0G A;  5I6W A;  2RSO A;  4U68 A;  3NHH A;  1O7Z A;  1CTM A;  2PMZ B;  3A56 A;  5CV4 A;  3PUV A;  4BWG B;  3BDO A;  3QOJ A;  4RGM A;  4BA2 I;  1QJO A;  1F9P A;  4BBR B;  1ESR A;  2IX0 A;  1D5Z C;  5DM6 3;  4M1U B;  1IL8 A;  2BA1 A;  3GO5 A;  5I4D A;  1RJT A;  1XTC D;  2IWH A;  2KCC A;  3TP6 A;  3DWA A;  2EJF C;  3KK7 A;  3KUP A;  1TWG B;  3A7L A;  1JQY D;  4HSP A;  2H1E A;  5IGD A;  1WTO A;  1HCZ A;  4E6I A;  2K03 A;  4V19 0;  1C48 A;  3HEJ A;  4R9W A;  4EQN A;  2NVY B;  3QG1 A;  3SDZ A;  2F0I A;  4IQZ A;  5CBE E;  2ZT9 C;  3I3C A;  4OIK A;  4K8J A;  3NTI A;  4J6H A;  5EGT A;  2K1B A;  4EQO A;  3T51 B;  4R8N A;  1JIC A;  3OWF A;  4RHR A;  3NK9 A;  3MAQ A;  3K0Y A;  3GTP B;  4H13 C;  5C3W A;  1SE2 A;  2F0V A;  3RMH A;  1JB3 A;  2A68 C;  1R4Q B;  3S16 B;  3NUC A;  3R3O A;  1JE4 A;  4G7O C;  4C3J B;  1C4Q A;  2WB1 B;  1B1Z A;  1EY9 A;  2VNU D;  2K04 A;  2A6E D;  2X69 A;  1IHZ A;  3QB3 A;  3CHB D;  4RKB A;  1S4Z A;  1TS3 A;  4CGY B;  1S5D D;  4AYB B;  4GZY C;  4OO1 I;  1BXT A;  1HA6 A;  1M8A A;  2DY7 A;  5M3M B;  1H9S B;  1T5X D;  1SMY C;  4KHZ A;  4A3J B;  1KLG D;  1IYU A;  3TBI B;  1ENA A;  3J7Y W;  1XYI A;  2CHB D;  4XT3 B;  5C0X I;  4XYQ A;  5I2X A;  5F2D A;  1FNV A;  3QOL A;  2JA8 B;  1LTB D;  1JOQ A;  5CV5 A;  4IUV A;  3PUY A;  3D6C A;  1TKW B;  3K5N A;  1EYC A;  1PZJ D;  2XN9 C;  5IGB A;  3GV3 A;  4FP5 D;  1EWH A;  2AUK A;  4A3G B;  1CQF A;  4RA8 A;  5IGC A;  1YNN C;  2LKV A;  1WTR A;  1KNE A;  4RCO A;  1TWF B;  2L5T A;  1STB A;  1B44 D;  1I6H B;  1NSN S;  2F0N A;  4Q5V A;  2K5Q A;  2F0L A;  3JAM L;  2FHT A;  1CM9 A;  3MFG A;  3VA7 A;  1J9O A;  2KOL A;  2OF1 A;  2WAQ B;  3SK5 A;  4DU9 A;  4BY7 B;  4BBS B;  1BDO A;  5IOC A;  5BN4 A;  2PZU A;  1TWA B;  1KAA A;  5FLX E;  3BVZ A;  5C0X H;  3IKJ A;  3D4W A;  1PMR A;  1LLR D;  5CC4 A;  5EPL A;  4HTH A;  3TSS A;  1O7L A;  2PCF B;  4IAL A;  2JA6 B;  1C8C A;  2EYP A;  4KMU C;  5FKA C;  1LT4 D;  3SE0 A;  1EU4 A;  2VXW A;  1UAP A;  2RDG A;  4FF4 A;  1PDQ A;  3A8J E;  3HG9 A;  5C6A A;  5M5W B;  5D3I B;  4BA1 I;  1SNO A;  3ITP A;  3CU7 A;  4KTA A;  2BDO A;  1BOS A;  2KED A;  3E0J A;  4IUQ A;  3T53 B;  5C4X B;  2LY7 A;  5DM7 3;  3KBG A;  3N6R A;  1F2L A;  4JK1 C;  3GTQ B;  1EY5 A;  2F0K A;  5A2Q E;  2F3W A;  2XWB B;  3NXW A;  1X32 A;  3F2U A;  1TS4 A;  2LS0 1;  2K05 A;  4O42 A;  5IOD A;  1CT1 D;  2EYO A;  2EZV A;  5EBC A;  4M8A A;  1LTG D;  2B2T A;  3TP8 A;  4OGQ C;  2JA7 B;  3DHQ A;  4I65 A;  1II3 A;  5CR3 A;  1D1K A;  4C3H B;  1Q12 A;  1STN A;  1PYW D;  1K8O A;  3SHL A;  2IL8 A;  5D3D A;  4B9W A;  2D5D A;  3PUW A;  4WRD A;  2JEA I;  5COY A;  2A73 B;  1PRT F;  1MI2 A;  2JE6 I;  4HAE A;  4YIJ A;  4RHS A;  4UAI A;  1TS5 A;  4OO1 G;  1GUT A;  2R3Z A;  3C2P A;  1PZK D;  2L11 A;  3N52 A;  4K14 A;  2A74 C;  1I4H A;  2NVQ B;  4QIW B;  1TWH B;  2L0C A;  1EY8 A;  3A8K E;  2WV6 D;  4BS9 A;  1M4V A;  1LTR D;  3S2D B;  1A2T A;  1K83 B;  4DA2 A;  5C0X G;  4CJ1 B;  3K7A B;  4X3U A;  1CZW A;  2A68 D;  1G2S A;  1RHP A;  2B2W A;  2B39 A;  2K5W A;  3NTH A;  1MBY A;  4DAP A;  3QIA A;  1I4R A;  1ILQ A;  4MHE A;  5NUC A;  3ERO A;  1D5X C;  4XXE A;  3DEP A;  3PV0 A;  1KDA A;  3PIO 3;  1STA A;  2J0T D;  4CJ2 C;  4K5V A;  1G6Z A;  4QUC A;  3ND8 A;  4B08 A;  2NVX B;  3OIQ A;  1FR3 A;  1H9J A;  5I6Y A;  3K5O A;  4XQN A;  1W6K A;  4ZAI A;  1EU3 A;  2B2Y C;  3IFD A;  3D4R A;  1SMY D;  1S5E D;  2R7Z B;  2R6G A;  5TSS A;  5JJZ A;  1D5M C;  1LT5 D;  3TZD A;  3RUZ A;  4ZYS A;  3I90 A;  1SJE D;  2BE5 C;  1O7Y A;  1LTI D;  4QF4 A;  1R4P B;  2K7V A;  1GOZ A;  4Z9C B;  5IIF A;  1U9R A;  4HCS A;  3SVM A;  4L8J A;  1G91 A;  2PO4 A;  1A3V A;  3I8Z A;  5AFW A;  3VA5 A;  2EDG A;  1B9M A;  4ULL A;  1YNN D;  1S5B D;  1JC7 A;  4K8I A;  5J39 A;  3OW7 A;  1SDF A;  3PIP 3;  4LAA A;  1HQR D;  3GTK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...