1RCYA

Rusticyanin (rc) from thiobacillus ferrooxidans
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
b'TTWKEATLPQVKAMLEKDDGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUSTICYANIN
molecule tags Metalloprotein
source organism Acidithiobacillus ferrooxidans
publication title Multiple wavelength anomalous diffraction (MAD) crystal structure of rusticyanin: a highly oxidizing cupredoxin with extreme acid stability.
pubmed doi rcsb
total genus 35
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 1996-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1rcyA00
3ABMB 1SHXA 2HX9A 2EIKB 3JTBA 1PZBA 3QJVB 2IWFA 3ZDWA 4KO7A 3CVDA 3TA4D 2GBAA 2UX7A 1OOWA 2GSMB 3PAUA 4YSTA 3TU6A 4G7RB 5B7FA 2PLTA 2BZCA 1NICA 3NSFA 2XV3A 1M56B 4CSZA 4M4RB 5D4JA 3HEIB 1ETJA 4X4KA 4AKOA 3T71A 2VW4A 1AAJA 3AG2B 1JXDA 2WO2B 1OCCB 2BP8B 1WA0X 1E5ZA 2DY2A 1JZEA 4A68A 1KBVA 2UX6A 3DTUB 3MBWB 5I26A 5I28A 2FNWA 4YSOA 4RH4A 3EH5B 1RZQA 2GIMA 2AANA 3AG4B 3UAEA 1JZGA 2VM3A 1AANA 1IBYA 2X88A 4NB7A 5F7AA 2J56A 3OD3A 3QJUB 5B1KA 3AZUA 3TBCA 2J55A 1UATA 2LLNA 6PAZA 3OMAB 2DYSB 5TK2A 4E9SA 5B7MA 3H4HA 1V54B 3NJGA 5D4HA 5IY5B 4MFHA 1ILSA 2PPFA 2EIMB 2BWDA 2H3XC 3NJIA 1MZYA 2OJ1A 2XV0A 3C75A 1J9RA 3T6WA 2FJSA 5I5IA 1N70A 4BK5C 4JHVA 4DP6X 2PP9A 5I6OA 1ILUA 2IDUA 1GS7A 4HCFA 1L9PA 2XXGA 4YVUA 1KDJA 3NJKA 1ZDSA 4GYBA 3GYRA 3X1BA 4DP4X 3IN0A 3CVBA 1A4CA 1SNRA 2BHFA 3QJTB 2ZOOA 3SBQA 1JXFA 2EINB 1MG2C 1KDIA 2PPDA 3WI9A 1OE3A 4E9QA 2QPEB 4KO5A 3T6ZA 3H4FA 1EZLA 3ASNB 4DP0X 3FU7B 3QJQB 4QLWA 4WTQA 3NJHA 4DP7X 3NSCA 4A66A 4N8UA 4KNTA 1DZ0A 2QPDB 4YSAA 1AZNA 3T9WA 2I85A 2YQBA 4FAAB 2Y1AA 3FU9A 5F7BA 2Y69B 1AZUA 4DP2X 2GC4C 2AVFA 1WA1X 2IAAC 4BXSV 2BWIA 2UXTA 1E30A 1YLBB 2XX1A 1W6LA 3KW7A 1GS6X 3RYMA 2VSKB 2RACA 1AG6A 5LDUA 3FSWA 1KV7A 3AW5A 4GY4A 1PZAA 4P5SA 4EF3A 3FT0A 1KCWA 3UGEA 4DP1X 2CALA 1KGYE 1SFHA 3NJLA 1NTDA 2XWZA 4YVNA 1OE2A 3BVDB 1L9TA 3NT0A 1CUOA 4AX3A 2BP0A 1ZIAA 2YAPA 3FU7A 4K9JA 5PAZA 1MDAA 4JKNA 1NPNA 3MX0B 4KO9A 5EHFA 1AS7A 1JZIA 1GY2A 3L45A 2BP8A 3ERXA 2YAFA 4HIPA 3WKPA 8PAZA 1PLCA 4KNUA 1NPJA 2VW7A 1X9UA 1KCBA 4W1TA 3V9CA 2N0MA 3HB3B 1J9TA 2YAOA 1M57B 1IC0A 3GXUB 4A2HA 2HZHA 3DIVA 2MTAA 2DV6A 1JERA 1L9RA 4G70B 1FWXA 3FSZA 3H56A 3CG8A 3WNIA 3QPKA 2JKWA 3WIAA 5FC9A 1GYCA 1F56A 3FSVA 1XB8A 1MZZA 5TK4A 5I6MA 1GR7A 4YSDA 3N2JA 4F2EA 3NJJA 3DKHA 1B3IA 4BDVA 2PP8A 2VSMB 5B1BB 1TU2A 3CVCA 2XX0A 2IDSA 4KOCA 1XMEB 3EH3B 3X1EA 2Q5BA 5B1JC 2AZAA 2IH9A 3UACA 3AG3B 4E9VA 2VM4A 5B3SB 2A3TA 2IDQA 3UADA 2WO3B 1J5DA 1W6WA 2FQDA 3KW8A 4HAKA 1MG3C 7PAZA 2UXGA 1ET5A 2HRGA 4YSUA 2XVBA 2TSBA 3IBOA 2UXVA 2W88A 1BQ5A 1JVOA 4GP4B 4JHUA 3JT2A 2ZWNA 3T6XA 4HCGA 2R7EA 1PNDA 2XV2A 2CUAA 2PCYA 3PPSA 4G7SB 3SBPA 1GW0A 2H47C 2ZONA 2JFCA 3CDZB 3FU8A 2YXWA 1IKOP 2PPEA 2MRYA 1BYPA 5I5MA 2XYBA 4BDVB 3IEAA 1TEFA 2CAKA 3S8FB 1NIFA 5I6LA 2Q9OA 1AR1B 1JZHA 4KNSA 4G71B 3T6VA 4AKPA 5AFAA 3S3DB 4KOBA 1GY1A 2OCCB 4A2DA 1AQ8A 1NIBA 3EF4A 1BYOA 3QQXA 3D12B 4FA7B 1ZPUA 1ET8A 4DP9X 1BAWA 2AFNA 2P80A 4HALA 1AG0A 1AACA 1N68A 2NRDA 4G72B 3U25A 3FQYA 5D4IA 1FFTB 1NINA 3FPYA 2IWKA 2HX8A 4UAHA 4GP5B 4CSPA 1AZCA 1QHQA 2CCWA 1ASPA 1IUZA 1ASOA 1T5KA 2XUWA 2YXVA 3FPXA 1NIAA 1L9OA 1GS8A 4BWTA 1AZBA 1RCYA 2BW4A 2GI0A 2XU9A 4N4YB 1JZJA 3QJRB 4A67A 4HZ1A 3BQVA 3CDZA 3TBBA 3FQ1A 4ZK8A 3ABKB 3ZIYA 4AKQA 3ZX1A 4HHGA 1BXUA 2J5WA 4W9ZA 5I5JA 4BWWA 4QKTA 2YAEA 4YSRA 4DP5X 3SBRA 3WG7B 2EILB 1SDDA 4M3HA 1OCRB 3FYEB 3NJNA 4GP8B 1AOZA 1SJMA 3FYIB 1V10A 3V9EA 5AKRA 3PAVA 1ADWA 1PF3A 1VLXA 1RKRA 2BP0B 4KO6A 1E5YA 1HAWA 2QDVA 4L0PB 2UXFA 1PCSA 3NYKA 2HLEB 3X2QB 2B08A 1QLEB 3SQRA 1FA4A 4NAJA 3EH4B 3GDCA 1WA2X 3PLYA 1ET7A 1SHWA 4F2FA 2AZUA 1L9QA 2FQEA 2FT7A 4A2GA 1BQRA 2YAHA 1I53A 3ASOB 1NWOA 5E9NA 4P5RA 3S8GB 4WKXA 3S3CB 1BXVA 3NSDA 3TASA 2WSDA 1PLBA 4HHWA 1J9SA 2FWLB 1XB6A 5B1AB 1URIA 1WS8A 5I6PA 3OQRA 2FQGA 4F7KA 1ASQA 1SF5A 1GSKA 5I6KA 1SF3A 2TSAA 1EHKB 1SDDB 4E9TA 2XXFA 2QT6A 1AZRA 2IWEA 2H5UA 3WNJA 5I6NA 2HRHA 3X1FA 4A2FA 1AS8A 4E9XA 1OF0A 1PNCA 2I7OA 1CC3A 1IBZA 3UAAA 4DPBX 4G7QB 1PAZA 4YSCA 3NSYA 4NERA 4ENZA 1PZCA 2QDWA 2VMJA 2B3IA 2ZXWB 4A2EA 4E9YA 4AZUA 1OV8A 1HAUA 4YSEA 1KBWA 3X1NA 3UABA 2FTAA 3G5WA 2HXAA 4UANA 1SFDA 2IDTA 1NIEA 2X87A 1A4AA 2BW5A 2GC7C 4DPAX 3AG1B 3PCYA 1PMYA 1KYAA 1W8EA 1PLAA 1WAEA 1ZIBA 1J9QA 5B1JA 1X9RA 4AI7A 1TEGA 3FS9A 1AIZA 3NJMA 4YSQA 1BXAA 2DWSA 2R7EB 2YAMA 3EHBB 1E65A 1JZFA 2FT8A 2DWTA 4PAZA 3OM3B 5ANHA 1BQKA 3QJSB 5B7EA 2P80D 2JXMA 3OMIB 1NIDA 1OE1A 2XLLA 4HCIA 1OCZB 1DYZA 2VW6A 4YSPA 1CURA 7PCYA 1A4BA 4E9WA 3PXLA 4BXVA 1OCOB 2J57A 2BZ7A 2CJ3A 1ZDQA 4DP8X 4BWUA 2OV0A 2BO0A 1NDTA 5A7EA 3ABGA 1TKWA 3WKQA 3ZBMA 1A8ZA 1BEXA 1JOIA 2CBPA 1NWPA 3N55A 2FQFA 4E9RA 6PCYA 3IE9A 2PPAA 2PP7A 4GXFA 1WS7A 2YAQA 2FT6A 1HFUA 9PCYA 2VN3A 4Q89A 1M9WA 2GB2A 1AS6A 1RZPA 3PAZA 5AZUA 1JVLA 3AY2A 1CYXA 2W8CA 4YL4A 2EIJB 2DYRB 4Q8BA 3CZUB 2IDFA 4YSSA 3X1GA 4TXVB 4UF7C 3S3BB 2PCFA 2PPCA 2IH8A 2GHZA 2I7SA 3FSAA 5PCYA 1A3ZA 3FQ2A 1CYWA 3NP3A 3ABLB 2YARA 3IN2A 2HX7A 1R1CA 1A65A 4PCYA 3NJFA 1V55B 2E86A 1ZV2A 4DPCX 1PY0A 1E67A 1NZRA 1QNIA 3OMNB 1XB3A 3NP4A 1J5CA 1JXGA 1L9SA 1ID2A
chains in the Genus database with same CATH superfamily
4LB8A 1QPXA 1D6VL 5GGQH 1YEJL 4C56B 1RUKL 1E9PA 1TDQA 2YBRA 4NYLA 1MVYA 5GS3A 4Y89A 1Q0XH 1RP9A 1HSBA 2CNYA 1MCBA 2FUTA 2PLTA 4K7PL 1FH2A 2NNCA 5C0NC 3BKCH 3IM1A 4H25A 5D8JH 4KC3B 2EYTB 3ZYOA 3T1WA 2WQWA 4BV1A 3S5LG 1JXDA 5BMFH 1WA0X 3CX5K 4QF1A 1WV7T 3UMNA 4TM9A 2V2WA 4D7PA 1JNNL 2VWEE 4DHLA 3S96B 3P40A 3WDHA 5IIEB 4FQIH 4MB1A 4ZXBD 3VCLA 3ZYIA 2VXSL 1KY6A 5DD0L 4HPOH 2IALA 5HYJD 1JZGA 3G5XA 2VM3A 3MRIA 1FUNA 3HB3C 4ODUA 2CMRL 4TNFA 1X7SA 5I8EA 3FTUA 1NGZB 2WXRA 2E5EA 1LMIA 4KKCC 4P23D 2OMTA 3FT3B 1CR9H 3TH2T 1BA9A 4M00A 5I1KL 5F96H 4N0CC 3CXDH 4KVCH 1YDPA 4BZ1L 1FZMA 2W07B 3HUJE 2G5UA 3C75A 1MIMH 2JELH 1XGPB 4G1MB 3RGVB 3T6WA 4O5LH 3D0LA 3OKEB 4JO3L 4RAUA 1FSKB 3NVQA 1ILUA 1JRHH 3HBQA 1MQ8A 2XXGA 5BJTB 5IUSA 5I18H 5EFIB 4ZMZA 1IQDB 2EDXA 2H32H 1D7CA 1NM4A 3ESNA 5BQ7A 2MH4A 3HC3L 5DRNB 3GDBA 2NY1C 1LO0L 4QXVA 1TUPA 1T7ZA 4TOYH 5F0JB 4S0SD 5FYJH 1J1OL 1QHPA 2VDMB 3SBWC 2A1WL 1OE3A 2OQJA 1ERNA 4NNYB 4PJDF 5TQ2L 5IFJB 2AF2A 4U1IB 5CZKA 1BFSA 1EZLA 2X41A 4BQ6A 3EYSH 2FEEI 5L2KD 4JFPB 3ORJA 2AQSA 1HNYA 5D1QD 1DSWA 1BMGA 4LXFA 3WJJA 5F3HB 4KDVA 4XC3L 1FL5B 4ZUUA 1MCHA 3TBSB 1A4JA 3BESR 5IJBC 2XWTA 2HJKB 2Y69B 4BEIA 4G6ML 2UWEF 4PMEA 5L4IA 4LLYA 4LLQA 3T0EB 3T8XA 2M2DA 3BP6A 4XNQB 2X4SA 4E5XG 4ZOBA 5I16B 1O0VA 2NW2B 3RDTA 4ZFFB 4WKZB 2VUYA 2YFNA 4XNUL 1C12A 1ZLVH 2LFGA 1LYQA 2OPCA 3FTWA 4I4WB 1P1VA 1VPOH 1ZHNB 5LDUA 3OF6A 3HKZA 3JXAA 4XMTA 3DTDA 4NUQA 1W0VB 3UIYA 4MNQE 5L2JA 2DQHL 4DP1X 2YWZA 1ZK9A 1MJ8L 1R5VB 4O2CB 4AX3A 2ZJSH 3L1OL 1HXYB 4ODWB 4BRVA 3TV3H 4GO6B 3QUHA 3GHBH 4FABH 4NDMB 4UILH 5IVNA 2R2BB 5K59E 1BVZA 2FNBA 1F8TH 3NIDE 2YPLB 2AXGB 2G3ZA 4KROB 4I85A 3MDJA 3SYAA 4ZXBB 5TDOB 5SX4H 3UJJH 4BD4A 1XCXA 3LD8B 4KQ4H 5L9DL 1SXZA 3GNML 3C6SA 1NKGA 4FCHA 4NO0B 2WINA 4P2QA 2EIZB 1NC2A 1H5BA 4OIIH 3PHQA 4GQ9L 4EI6A 5C0BB 3CG8A 1DBBH 1RK0B 2DQCH 2ZWZA 5D1QC 3PABB 5GIRB 3ULUL 2ATKB 4TNVF 5JR1L 1J0YA 1F56A 3FSVA 3IMBA 3CXDL 4KVCL 5CJ8A 3WO4C 3BFWA 4RMTA 3IJEA 4HZLA 3KLLA 5BRQA 4RDBA 4ZS6C 4CJ0A 3BPNB 1D2OA 1G43A 4MVBD 1H3XA 4MJ5B 3PHAA 3D4ZA 5H37H 2MCMA 2ESVB 4FMFA 2AEWA 3ZZQA 2R4RL 4WJKB 4XX5A 1RVFL 4I9WE 1CN4A 3QI9B 4LCVA 4ZT1A 5HVHC 4OZFA 2DH2A 5KBMA 1F6AB 3EH3B 3V5HB 4MASA 2EDNA 4JO2H 1RY7B 2JCCF 5DZAA 3CN3A 4QY8A 1SN2A 3QNZB 4JM2B 1T1ZB 5FYJL 4FADA 5D2NB 3VXSA 4XMPL 4DW2H 4TRPL 4JG0L 4IRSB 1A6WL 4M9OA 3GMOB 3QHZH 4ZAKB 1W72H 1WZ1L 3QDGE 4JQXA 1FRGL 5CEZH 3O4OB 2R1WA 2ALAA 3A5VA 2BVEA 4M7JH 3VXMD 4Z7OE 5GGRB 4NQVB 2G2PA 4KQ0A 2OXHA 2NY5C 1YPZA 4MNGB 3K4AA 1RIHH 4JG1H 5JIDA 1KELH 2O6EA 1TCRB 1XF4A 4LOUD 4Z7WF 1C16B 1PNDA 4G3YH 2PWFA 3PPSA 5DS2A 4EI5D 3FU8A 3G9VA 4M8QA 1II4E 1ZSHA 2MRYA 2ZKXA 3C2SA 5IVXF 4ZSOA 4PLOB 3RL1A 1CTOA 5E6IC 3WDJA 2G2NA 3OZ9L 3CX5J 4HWZB 1CFSA 3NA4A 1AR1B 3MXWH 4PMFA 2KQMA 3ARFA 3MNZA 1GAFH 2WWMC 4WU5A 5F7YC 4M1CC 4URKA 3L6FA 5CZRA 2R1XB 5F44A 3GMLB 4ZW3A 1JJUA 1O9ZA 1JPTH 4AXWA 3C60B 2VH5H 1FL6A 4ZO6A 2G60H 4G72B 2ITEA 4U1NA 2FX9L 3MJ9H 4GKNA 2A9AA 1QPPA 2NXYB 4CSPA 1P6FA 1IKNC 1ZT7A 1OTUC 5KS9F 2Q7AA 2YXVA 1I1YB 1ZVHA 2Q87A 4KKAD 1TENA 3SDAB 3AXIA 4AEHH 5IGXH 3QZWG 2AJXH 3TN0D 2Q86B 1S8DB 4QKXB 3ZIYA 2XN9A 3ABKB 4F7CA 2D2OA 4HMEA 4PJ5E 1DJHA 3BXNA 4L4VD 3C9NB 5M7QA 1WEJH 5TF0A 3VGBA 4GAJL 4LKCB 4G8EA 4I3SH 4RFOL 3MBXH 4S1DC 3JWNC 3TPUA 2OZ4A 3VD0A 5IG7A 4ZTOH 1QSZA 4P2OD 3V5DB 3WAKA 4HJ0D 4NN6B 2WXGA 4UYQA 1P5UC 1UENA 1EZUA 1RZFL 2K6YA 3QDGB 2J5LC 3M1BB 1MNUL 3UJJL 2IBZX 1QLEB 3FFDB 3LSOA 3SQRA 4PJ7F 1WAPA 2FECI 2OKMA 3RVXC 1H9VA 3MV9E 3GDCA 4GG6B 3LN5B 5J9PB 3KEDA 5EMYA 1PZ5A 2AZUA 2WAQA 3MMEA 1INQB 1A6VL 4LCWE 2C7UB 5EZOL 4IRJD 3TNNB 5AW4B 3S3CB 2VC2B 4HS8H 4L1BA 3MN8A 4PHXA 5LNGA 1FFPB 1A4KB 2R56L 3GI8H 4RWYH 5BS0E 5KJRL 3RGHA 1ASQA 4QRTB 3KPOB 5MEND 4KKAC 3TA3A 5IOPA 1WCBA 3FOMB 4ZNEA 5F3FA 4LPVA 3RWEA 2VLME 1UZ8A 5ESVA 2VDPL 4XPHL 1RXLA 2JJSA 4AOFA 1GTFA 2P5WB 1Q9KB 5CZXC 1OP9A 4DT2A 4NQEA 3VXUD 1PNCA 5DEZA 4S0HA 4GI8A 5TH2A 3RA7H 3EYVA 1AXSA 3E8UH 4YSCA 1P7QA 2WQ8A 1WG3A 1PFOA 2QDWA 4DPRA 2DMBA 1PEWA 3H3KA 4PJCE 4E9YA 5C09B 1HAUA 5E6YA 1JYWA 4Y4HA 3MV11 3CLWA 1H6EA 5KUMA 3UABA 1IC5L 4W4OC 1HNGA 3P11H 4E41E 2HVJB 3ROLA 2VXTL 5HTSA 1KMGA 3HMXH 3LRGA 4XAWH 4FQ2H 4UCFA 3OC8A 4PTUB 4XAKE 1P7KB 4W70A 1PLAA 3LY6A 2IAMD 3PGCA 3AGVA 3VUAA 2BY1A 1TEGA 4AEHL 3VMNA 3G5XB 3HNVH 5DD6A 3HAEA 5C08A 4DTGH 1TF4A 2HVBA 3LQAL 1UT9A 1WLHA 4MJJA 4PYGA 4KHTL 4P59L 1WT5C 1YNTF 2LU7A 5FHBL 5IHWA 4M7LT 1BBDH 1G9NL 3I6SA 4IRJC 5EF1A 1N6QL 5G2NA 1YDPB 1DVSA 3PDDA 4I3SL 4RFOH 1T2QH 2W07A 5IVXB 1NCJA 1ND0B 4IMLA 5ADOH 2ZZUT 4XAKD 1JK8B 1QZNA 3CH1B 4JUSA 4BUHA 1JPFA 4RGOH 1OCOB 2J57A 3VH8A 4ANWA 1XH2A 3WYRA 3UPRB 3MGOB 5BJTA 2VLKB 5FYLH 3S3SA 1DDHB 4OJAA 1X5YA 4OKVB 1K3ZA 1IM9B 4UZSA 5BZWB 1RUPH 1IGJB 4FGMA 1B4LA 5T5FH 5DRNA 1G7LB 2Y24A 3TEXA 3QJFA 4NQEE 4RMWA 2GSGB 1TETL 4CC0A 4DQOH 3JVGA 4FOMA 4MZIA 2H6PB 1HILA 4L5FL 9PCYA 1WGOA 1GZQA 3ARYA 2ENPA 3J8F7 1CYXA 3QDHA 1G0XA 5IB5B 2AEQH 4LVHB 1RIHL 4JG1L 4JFPA 5JW5A 2EXYC 1U95A 4XX1E 4D0CA 3HI5L 2PCFA 2X1QA 5I66A 2PNDA 3TBSA 4N8PA 5DD5L 2CO6A 1CFQB 3BFOA 4LRIC 1JZ6A 2EUZA 4KAQH 4KTDL 2XWTB 4H2CA 4QXTA 1F18A 2KZKA 2Z9TA 2Z93A 5EZIH 3MVSA 4DUVA 1UWGL 3HKFA 3MXWL 4QCIB 5D7KE 2BHZA 2QQNL 4G6JH 2P5PA 3ML8A 1U93A 4U6XA 2NW2A 3RDTB 2BVQA 1HQ4A 1PY0A 4Z7UA 1K5NB 4NBZB 2AQPA 1ROCA 4OLUH 4HKXB 1XB3A 2C1OB 1SLWA 4I4WA 2F53B 1CFTA 3LN9A 3HG3A 4N0RA 3FU0A 4GB9A 4R26H 4AYGA 2EIKB 4ZQKA 3MV01 3HFFA 4QO1B 5FGCE 2H45A 3KPLA 1R5VA 3LH9A 4GXUN 2EDYA 2LVCA 3P4NA 1WCQA 3BVTA 4G6AD 3MV9D 4P4RA 3RVWD 4KX8A 2FJGB 2X5PA 4JQVA 3PL6A 3SD2A 4Z7NE 1N5YL 2NX5A 1M56B 3FC8A 1FO0H 1ETJA 4NQCB 1DL7L 5E0QA 3Q0HA 4AGPA 1IGCH 1P9MC 4PJGB 1AGFB 2CJTA 1MHCA 4OIBA 3OR7A 5E7BA 1NCCL 2BIOA 1SVZA 1T83A 1KYUA 3EH5B 4L2LA 3WHE1 2GIMA 3DYOA 1OL0A 3AG4B 1T7VA 2IEPA 4MZRA 3VGEA 3ZGIA 1GGUA 3MNMA 4GKZB 2X88A 1JGVH 3C87A 4C83B 1IGFH 5KYNA 4KI5C 1QEWA 3QG6B 2JQZA 3BCFA 4IKKA 3M86A 3QULA 2C26A 3ES6B 3O8XB 3QIBD 3VFMB 6PAZA 4TNWF 2VL5B 2HFGL 2NY4C 4U0RC 2C1PA 3HLAA 3HE6B 5D4HA 4BUQA 2F74A 3IJEB 5IY5B 1OSZB 4N2MA 3KYMA 5FYKE 3RWIB 5ILTH 3PNRB 2DQDL 3SYQA 1MZYA 4CA4A 3BKML 2X05A 3QH3A 4NFDA 3V6ZB 4YXHH 3V0IA 2H2SC 4BK5C 3MNWA 4P46C 3ARZA 5I2IB 2A2QT 1T22B 2P5WE 1EPFA 3GNMH 1W0WB 3GYRA 1IBDA 1NDMA 4DP4X 2NCEA 2A6DB 3QNZA 4PJAF 1T1ZA 4QHKI 4JQXC 4WNQA 5SWZB 5HHNA 1B4RA 1MW2A 4Y1AE 4DKEL 2W9DH 4KPHL 3LKSB 3ARDD 3S97C 4KJWD 2R56H 3GI8L 2MOQA 3NDZE 2OMWA 1NANI 3TTSA 1I7UB 3F85A 5DYOB 4GAGL 3VD7A 1KF9B 3CN2A 1NCBH 4CSSA 1KJ2H 1KJVB 2ZOKA 3SE4A 4J39A 4JLRB 5DLMH 1PPIA 1FZKA 3R06B 1HHKA 4B9KC 3B7YA 4NO2B 3MI6A 4Y19A 3AY4C 1ZCRA 5ADOL 4OSUH 2W9LA 1XX9C 4I3RH 2HVKB 3BWZA 3VXME 2YQ2A 4G7YH 1N9PA 4FLSA 4FQCH 3DOHA 2YD7A 2P42B 3SJVD 1E30A 3QDGD 1D5XB 3IE4A 4WV1C 4CMHB 1KC5L 1I9RL 2NY7L 3UBXG 1N0XH 1TQUA 2QSCH 4J1UA 1YEGL 2WD0A 4HU8A 1I7TB 1ZTXE 1YNTA 3IFOA 3NUKA 4GMSH 5IW1A 4YO0A 2CPUA 1KV7A 1DJXA 3AT8A 4PPTA 4U49A 4MWFA 5DZVA 4LSQL 4WI2A 3KPPB 1C08B 1U3HA 2N7SA 5DHEA 3H6AA 1RK1A 4OLVH 4OCWL 4C4KT 4NZJA 32C2B 3CZNA 3KVQA 3NT0A 3EO9L 2BIPA 1HJCA 1Q72H 2PN5A 1ID5I 1AD0A 1K8IA 1U4FA 1T4KB 4F3FB 3L45A 5DFTA 3GTTA 3JWDL 4B27A 3O2VH 4Z18A 2N7AA 1VZHA 2IBBA 3AITA 4P2QE 1CD9B 1UKQA 1IC4L 2DMCA 2PR4L 1A9EA 1U92A 5HHOE 3CSTA 4MJIA 4FJZA 4B9ZA 2GITA 4K3DL 5E6UB 3T1FA 2F54D 2DV6A 1BZDA 1JERA 2H8PB 5C0CE 2OAAA 3IMUA 2WNXA 3PQYE 5TK4A 3UP6A 3DRTB 5FF6A 3K2KA 3V5DA 4JKKA 2ID5A 4Q0XH 3WNKA 5CILL 1NBVL 2A9NH 2CHDA 3QQ9C 5E6IB 3VA2C 3RWFA 3CK0L 4O51B 2VQUA 1YJDC 4UT7H 4WHYG 2CBQA 3S4SA 1TLMA 1MJ7L 2FUQA 4WTWA 3QEQA 3WJJC 1UWEL 2VXUH 3KYOB 4UQ9A 2J7LA 2HKHH 2R1YB 2GSIB 2J6EA 4UM8A 5KN5A 1P69B 1MWAB 2EKJA 3ULUC 4TF4A 2NW3B 4L37B 5E5MA 2DI8A 1INQA 3ZYZA 4JPWH 1B4JH 4Z95L 5D96B 3UAJA 1DQQA 2WQVA 1S7UA 3GHEL 5G5DB 1W80A 4AUJA 1O7DE 5KYYB 5F89B 3B3BA 1CF8H 4ONGL 4GEIA 3NQKA 5DK3A 4Q9CA 4D8PA 1NL0H 4FFYL 3TXAA 2VXQA 2GBUA 2EE3A 3ZE1E 3HHSA 4K71B 4JZNA 4MBRA 3AMKA 3D8MA 1T4WA 5CZVH 3MLVL 4PRPE 3ZHNA 5IBUB 4BSWA 1N10A 2YXWA 5AB2A 4NCC2 2IH1A 4UUJA 3S35L 1RUQL 2YXFA 5DVPA 2VRAA 3BSZA 1MCNA 3C6LD 5TH2B 4DK6A 3B9VA 4R0LC 1NMBH 5JHDB 1IMHC 4WENB 3TNMA 4ZYKA 5ISZE 2UY6A 4I2XA 3NIGE 4XXDA 3ZJAA 4RIRB 5C3IA 3GPSA 4HLEA 2FR4A 1QWHA 1BYOA 4AYMC 4X2UA 4PVMA 3DUSB 1RURH 1PW3A 2COVD 4JY5H 1NCCH 4DUXA 2CSPA 3O2WL 3SDDC 2ZYHA 2HRPL 3HG1E 5T1KB 1AG0A 1V7NH 2G4GA 2QHRL 4EZLA 4MRCA 1Z7JA 1FFTB 1NANH 2V33A 1U8KB 5GSRB 2VISB 5D5MA 3CFJA 3MV8E 2JH2A 3P77A 4KK6D 2Y25A 2CCWA 3RJDA 2QQLL 1QVOA 1JPEA 1BD2B 3CX2A 1HZHL 3CNKA 3TEUA 2DMHA 1I85A 5ID0B 1NIAA 3FCSB 3E6FA 5C08B 5CHNB 4FXGC 5C0EB 4ZUVB 3Q3GB 3MR9B 3GUTA 2PKDA 3AU0A 2XU9A 1JF5A 1CLOH 2MQCA 1X7TA 3LS5L 1SY6A 2WC7A 1M05A 3N91A 1F3DH 4LLMB 1LO3L 1U8CA 1F00I 3N1GC 3MJWA 4K9EC 3ZKXB 4ODVH 2VO8A 1Q1PA 2VLKD 4OIAA 4XP5H 1IC5H 2KDGA 4A55A 3WS6C 5ID1B 5C86A 4FHJA 4PJXF 4U1SB 1YUHB 4X0KB 2HPTA 5HYSB 2HWZH 2VLKA 4O58H 2XCMC 3LQMA 4WO4C 4Z7NF 3TEZA 2DM2A 4N5ED 4TS6A 2IPTL 3B1UA 4PQXA 1KPRB 1PF3A 1Q0YH 2VR9A 1QTSA 2GKIA 5MP6H 3F5WB 3ZMRA 4NJAH 3L4VA 1R3IL 3T8MA 2XBZA 2H6PA 3C6LC 3HC0A 2F58H 2HN7B 4HKBA 5F7HA 1TZAA 1YJDL 3BD4A 3JWDH 3MBXL 4KXAA 5EC2A 5IQ9A 1MCEA 2MNWA 3MJ8B 3EH4B 4JANA 5KBKA 5AW6B 1L6PA 4V11A 3DVGB 1XMWA 5FCSH 5GHWH 3KYKL 3S36H 5IEKB 3VXUA 4PJDA 3KWTA 4KX9A 2YMOA 4BIKA 2ZPKL 1U33A 4XN5A 4WJ5A 4AV4A 5FYLL 4J3XA 3PXJA 3K8MA 1OEZW 3S2AA 4RGOL 4F7KA 4AEFA 1P9MA 3LAFA 4XXWC 1SDDB 4MYPA 3OHXB 2BVQB 2ZWYA 2XXFA 2FL5B 2EEXA 2E76C 5DRWA 2QZ5A 4IW4C 3W2DH 5JXED 5IHUL 3AVEA 1YEFH 1VACA 2ZX9A 1RZKL 2H5UA 3FUNA 3RJOA 2HRHA 3X1FA 3ARRA 4B9CA 1TZHA 3C5ZB 4QO1A 5DZPA 4A2LA 1TZGL 4G7QB 5I1EH 2JJVA 4P4RB 1BREA 3UTTE 1PZCA 3ZHKA 2Z4QA 2ZOLB 2D3VA 3NEXA 4CVXB 5JZ7D 4HMCA 3WFEH 5D1XE 3AABA 2IGFH 4HA1A 4LP8A 4MA3A 3RY4A 2NY2C 5H35B 1FFRA 3MLUL 2WTPA 2W81C 5GRUL 5JW3H 1CS6A 2VDOL 3DK0A 3K6FA 4PJGA 2KQNA 1A4AA 2H32A 3V2AR 2GC7C 2QJDA 3N42B 4DPAX 4ZW6A 2ENYA 3PCYA 4J3OG 3ZDXF 2J20A 1ZA6B 4H44C 2X4UA 2Y7OA 2NY1D 3D3VA 2VT0A 4FJ6A 4KGLA 2NQCA 4UAOB 5EOCH 1J48A 4C56D 4ZW5A 3CN4A 3HE7B 4HH9A 3ILPB 3UDWA 5IMMA 2XZCL 1QEWB 3QG6A 3UERA 3LPOA 3QQ3A 1T0MB 3QULB 4HSCX 3MFFB 2P80D 3QEGL 3P3TA 2CDEA 1ECYA 1MCRA 3SYOA 1S9YB 1KPUB 1JXKA 3O4LB 3QUKA 4HEPG 1UWYA 4UTBA 1GGCL 3UBXI 3G5ZB 3CJJA 4XP5L 5J3HD 1QKZH 2WSPA 2R69L 7PCYA 3V6ZA 5C0JA 5FFGA 2YQGA 2WBWB 1ZOXA 5E1IA 3VFGL 3BUYB 3S5LA 1KLGB 2OMVA 4G80B 3TYGH 3MOBH 4NCC1 3KLDA 1UXSB 2DIAA 2Z35A 3MLTB 1G7HA 3KPSA 5D93C 5EEXA 3SGJC 4A04A 1BX2B 5HHPB 1C5BL 6PCYA 3RZWA 4JDEB 4WNQB 4HOMA 2YAQA 3E6HA 2YBRB 2FATH 2XZZA 4K23L 3X11A 4NYLB 1M9WA 43C9B 2QQLH 3ZTJH 2G4EA 4FCAA 4OY9A 4BHUA 2IFFH 1JGUH 15C8L 3FMGH 4LLDA 5E5UB 3WD5L 4H2AA 4ZOCA 4ODXA 3I6LE 3NZ8B 2VMCA 5F9OL 3S3BB 3QNFA 3WIHA 4GS7C 1MREL 3TLRA 5IIEA 1U21A 1T6WA 3QHZL 3HIZA 1S7QA 1SGKA 3HS9A 4JHWH 4H8PA 4DF9A 3TZVC 3N40F 1FQ9C 4IGBB 5DU7A 3MREB 3KNBB 3H6JA 2RALA 1MPAH 4JJOA 1WF5A 1I7TA 3NJXA 3OMNB 2OTUB 3B7SA 3G7TA 1L9SA 5IW1B 5I0DA 4YO0B 3V0JA 4CGTA 1XCTA 3D48R 3U1QA 2K9UA 3GLDA 3KPPA 4XO4A 3K80A 3BKJH 1NAKH 4KQ3H 4ZMAT 4HH8A 5AG9A 3ZDWA 4JK0D 4IKLA 4KO7A 4QAWA 4QYOA 2NT0A 2GBAA 2UX7A 2ZCHL 4FNUA 4G1MA 1MFVA 4QI3A 4TPRL 3RGVA 5L8JB 3U7WH 4RISL 3OKEA 4UQIM 3BKYL 4JFFA 3VFSB 4DVRH 3VXNB 2AP2A 3HVDA 2JK5B 3EFOB 3PJLA 5J13B 5BO1L 4NQDB 3O2DH 1OQXA 5I74C 1U41A 2C3WA 4RRPA 5JMOC 3TP4A 4A68A 2XZCH 5F9WC 3CSBA 4LOFA 2NY6B 2Q0ZX 2OQJB 1NGXB 2EH8H 4YDZA 5HDRA 4X5WB 1KIUA 2A99A 4J3OH 4N85A 3LEVL 3D39E 3ZGHA 3WENA 4PJDE 3HMWL 5F3HA 5AAWC 1J5OL 4H1LB 4ODTL 1ZLVK 5IM7A 1HHJA 1UZ6E 5D5MF 1R6VA 1D7FA 5HVFB 1UACH 5GRVK 4DKEH 1NDGA 5L6YH 5FA4B 4MFHA 5DMJB 3IKKA 3QS2A 2NOYA 4TLSA 2XV0A 3T8XB 3GBMH 3IWUA 4Y2DC 5EU3B 4BFNA 3H9SA 3LMJL 4OGXH 4H26A 3QCTH 2FIKA 3WUWB 1XDTT 3EYQC 2PP9A 3FTZA 4WKZA 2XN1A 4L3FA 4P5KA 4XOCA 3V4PL 2IDUA 3ELAT 1EEUA 4I77L 3I3BA 4RFNB 4YVUA 1A21A 1AGEB 5FYLD 2UZIH 3JZ7A 1AYRA 2XQBL 2YUZA 4MXWL 3S2CA 1A4CA 4FFVD 3O9WD 3V0GA 3F62A 1HEHC 2WWMD 5GZOC 4NC1E 4RNRB 2C3VA 2PPDA 2E27H 3V4VH 1S5HB 2Q3AA 5CGYD 3IDNB 2HA1A 1Z9NA 1ZKAA 3QQ4A 3WIFB 2JJTC 4AEEA 3F7RA 1D9KA 1EDHA 5MENB 1I82A 1KUMA 4OCWH 1VADA 3UTTA 1Y18A 5FEBA 4KNTA 5GGUB 4PJAA 1NBVH 2I85A 5AEAA 2DM4A 5F0LB 1G7QB 1TTCA 1PGRB 3OB0K 4OUOA 3VJ6B 4AT6A 2GC4C 4BSWB 1WSST 4DQAA 1KIRA 1OY3B 4EDXA 2E7LC 5CEXA 4NO0A 1FLRH 2WINB 1RPKA 1DVZA 1J05A 4XNYL 2F8OA 4G8GD 2J6EL 2HJLB 2EIZA 5DZJA 4JFHD 1I4FA 4LDLB 1KTBA 3BKCL 4NRXA 3WTWA 4DCQB 3PABA 4N28A 1OHQA 3BMWA 2O5XL 3GKWH 4QRRD 5F6IB 4APXB 4NPJA 1SXAA 1UYWH 2P52A 3QXWA 4EF3A 4XNXH 3QA3A 3UGEA 1SY6H 5C0RH 1XCQA 1L7TH 3BLKA 1KGWA 1OE2A 1IGMH 2I60H 5D96C 1WFMA 3EYFA 2BH0A 1U8KA 4PY8J 1EV2E 1ZIAA 2EAEA 3VGGA 1DVYA 4YHML 5GSRA 3BEVA 4HEME 3WEXA 2X2HA 4FS0A 3R19A 3LZNA 3CFBB 4JN2A 3O0RL 1GYAA 1KULA 4O2FA 2Q7YA 5CHNA 4GIOA 4GS7B 5HDBE 4HUNB 3WEAA 5D1ZA 3QEHB 5F1IA 1QR1B 2GJRA 5BUPA 1AHKA 1B88A 4G42A 5CJXA 3EADA 3GMOA 5C0CD 4ZAKA 1I7RA 4W1TA 4NP4L 1ZJBA 2DQFB 1SLUA 1JPSL 5DHDA 3VTAA 3B4NA 4DGIL 2F53D 4A2HA 1CGSH 2Y7LA 4FEMA 1MIML 2JELL 2V17L 1V3LA 2DS4A 5FC9A 3WY4A 4ZMYA 1DCLA 1JWMA 4X4ME 1XHHA 5B38G 4G43A 4QTFA 4BE5A 5B39B 4XMKL 5L6YL 2IQAA 1BJ1H 2I24N 3CLFH 5EDSA 5CLYA 4B50A 1DE4B 3AM8C 3FK3A 3IBEA 2YPVL 1UA6H 1Q0EA 1T03L 2J8HA 2AGJH 3QUML 4JL1A 1L6ZA 4GRMB 4LDCA 4AJ0A 2EEAA 3SY0B 3L3IB 2UZXA 5CZXD 1KOAA 4AQ1B 3GHPA 4CDHA 4EO5A 5EC2B 4K7PX 3BH4A 5IQ9B 4P9HH 4U3HA 4UWQB 5D5ME 5DD3H 1MRFL 2G75A 3DVGA 4MZ3A 4AXWB 4K5LA 5AOKA 4YOKA 1F3JB 3RRQA 3MBEC 5IEKA 3BCDA 4PJDB 5CD5C 2ICEB 3L3KA 5K9OA 1NA8A 3VXUE 1I3RA 3L5HA 2ZCKL 3C8KB 4KH9A 1U3YA 1F4HA 4DTGL 25C8L 4V2CB 3POCA 3PWLA 3KPRD 3VRJB 3K2MC 3M1CA 2IAMC 2WXPA 2R7EA 4QHUB 1SHSA 1L7IL 2NY2B 2ZONA 2JFCA 4FE9A 1D9KD 2XQ0A 2V6HA 3LDBB 2RCSH 3DO3A 4P99A 5MHSE 2VQ1A 1TEFA 2CCLA 1R34A 3C5ZA 1NBYA 1TU2B 4HS3A 2WK2A 3SGKA 4LCWD 1ZANH 5ALBL 1CLOL 5FDWB 4G8EB 1AQDB 3TPUB 4FFYH 2OCCB 4XNXL 5CGTA 1J87A 1SHMA 2ADJA 4NNPH 4MA3B 1EMTL 2EZ0D 5I9QB 4ETYA 2CO2A 2D03H 2D9CA 5AVVB 4J3OC 4Z7VF 2Q8BL 2ZT9C 3V4UL 2YPKB 1GOGA 2XRAH 3TBWA 4YNYB 5L8LB 3PJSA 3GRWA 1MAML 1PFCA 2DEXX 3CSYB 2YD6A 2X4UB 4QPEA 1XIWA 4TUJA 4HK0B 3EXJA 2XUWA 4IHBA 3A23A 9CGTA 3EJZD 1GS8A 2CR6A 3ILPA 1QFWI 2VYRE 1GHFH 3GBEA 5CSZA 3SCMD 4UDTB 1T0MA 1YQVH 4MQ7B 3QPQC 4FJYA 4JHAL 1NFDF 3MHZA 3NIFB 4P4KC 4TTDD 3FOLA 2YZ8A 3ZQ9A 1Z3GH 1N4XH 5F3BA 4OTXH 4R90L 2AKRA 2DJSA 2CLZA 4DAGL 1DZBA 2CO7A 4U0RB 4PCTA 4DP5X 2L4OA 5GRZA 4S1SL 2OTWB 2CM6A 4QRTA 4M3HA 3BUYA 3S5LB 2VE6A 4KDTA 4TV3A 1J5HA 4FERA 2XWDA 3ILDA 1JHTA 2F7OA 1BX2A 3RIKA 2P5WA 4LOEA 1Q9KA 5E9DD 1EAPA 2NX5D 1R33A 3BT0A 4PS8A 3HRZC 3IGUA 1EVUA 4LLVA 4ZPTB 5E99L 3W11D 3G04A 1KB5B 3UJIL 4EUPA 3VQLA 2B0SL 1ZGLM 1KG0A 1GVIA 4YBHA 5F93C 3ZDZE 5INCA 2BK8A 4UTAA 4TTGA 4FQ1H 3U2SB 1H3TA 2C7FA 3CC5A 3J07A 4UV4L 4WHDA 4Y4HB 5KVEL 1ET7A 2ADFL 5FLUA 4AC2A 5IB4B 5IBUG 2R23A 4DJMA 3B2UD 3VGAB 1FFNA 4XVUD 4KI1A 1MHEB 1AI1L 3PQYB 1MWAL 1DO5A 1CXKA 4D9QD 5KS9B 2BSED 4YHYC 2OMBA 4IMKA 1AJ7L 4JB9H 3AT9A 4P5TB 3VXSD 1KV3A 3N40P 3CLEH 1URIA 2P7TA 4OLXL 3RGVD 3DA0A 5I8KH 3SKMB 5CF3A 4AGNA 5DCCA 2LABA 4HFUH 5T1LB 2EXWC 4WFHE 1CBVL 1F90L 4P8QA 4Y8AA 3VXRB 2UVEA 1AY1H 1XCTB 5IVOA 3MROB 1AS8A 4PP2A 4HJEA 3QAZB 3KR3H 4TUKH 4NNXA 4OSUL 2JMRA 2D03L 4X7TB 1BP3B 2XBTA 4DPBX 3QIBC 4NLHA 5I73B 1N12A 3QCVL 3KL0A 4I8DA 3TC9A 4DO4A 1JS4A 2EDDA 3KPMB 4HV8A 1D5BB 1E4WL 4JM2D 2ZXWB 4X4XA 3E3QE 5DQDL 2WZPD 4ATTA 4CSTA 1OXYA 2I32A 4FXTA 4UANA 4WEUD 1WTLA 2B1HH 3R0NA 4ALAH 3TFBA 5CGBA 2WLMA 5CO1A 3W56A 3GXMA 2P24B 3TESA 4FTDA 2A9CA 5I8CA 3QJFB 4Y2NA 3QORD 5TJWK 1UCBL 2AJXL 2R0KL 5K33A 2DQUH 2FSDA 4L9LC 2XWJB 5A3ID 4LE8A 3GLAA 4RZKA 2MSPA 1IIIA 4YJZL 3DSNA 5K9JH 5I18L 5HYFA 4YEFA 4BJLA 4Y1TA 3BPOC 1T1XA 4PJ9C 3W5NA 2D7TL 3B2UC 5I66B 2V3EA 5ANHA 2F08A 4FZ8L 1BM3H 1OALA 3DIDA 3QAQA 5ALCL 2ZUXA 2CO6B 5C08D 1NCTA 4JEGB 4ANVA 3QDME 4XMXA 15C8H 3ME0A 1NDGB 3VTMA 1CFMA 1KBGH 1S7RA 4RWHA 5EU3A 3CUPB 4QCIA 1A7PH 1E6OH 1YNKL 2V0AA 4PWHA 4Q74A 1HYSD 4NI3A 4U6XB 4HX1A 3UEQA 2AXWA 4JR9H 3AWGA 4XC3H 4C54A 3CZLA 4A6YA 1NDTA 2EXWD 4KXBA 2OK0H 5KVDE 2Q76B 4DZ8B 3K6DA 3DROA 5JXEA 4JRWA 3IXAB 3IE9A 3LYRA 3ETBF 3T3MB 4M5ZL 4N2BA 2C3VB 1QKZL 4N1EA 3T2OA 4AW7A 4ATWA 3D7PA 3G6JB 3TVMD 4M6NL 3NIFE 1NGQH 5JOPE 3QQ4B 4LGSB 2DLFL 1F4XH 4RGNC 5JPNA 2F7IA 4P59H 2YWYA 5E7FA 3RVVC 3L08A 4PJAB 1E2ZA 1JRHL 4RCAA 5F9DC 2GHZA 3TH4T 1UM6L 3ZDXB 3FSAA 4N2NA 4EN3B 1PJWA 2N1TE 4YBLC 1CYWA 4X9HA 3RZCC 5DRZA 5F70A 3V4PA 4F27A 1J10A 3D85D 2HX7A 5ALBH 1BQHG 1MKFA 4OD2A 3FBKA 3KE0A 5E94A 1HL9A 1IGIH 3QRGL 4UILL 1C1EH 4XODA 3BZ4A 4JGJA 4C83A 4PG2A 4HIXL 2DQIL 2AI0H 3QI9D 2BSEA 1LNUB 2JIXB 4R4ND 2WP3O 4QRPE 5GGSA 1RUPL 5AW5B 3V7MA 2CZNA 3O8XA 1M42A 2BNUA 1RSYA 4R0LB 2FEJA 4APQB 2C1PB 5I0XA 3HE6A 1NPUA 1H6TA 2WBJD 3VFUB 3W57A 4R8WL 5JMRA 4R2GC 2WB7A 2IWFA 3SKJH 1IVLA 4WWKA 5FO7A 4HUWB 1XWVA 3BMVA 5T3ZH 1M1XB 3VFPA 1HYSC 3B9EA 1H3PH 3JWNE 1KB9K 3MNWB 4G6KH 5A2CA 3HOGA 1QPKA 3CHSA 1Y6KR 1DP0A 1T22A 5D4JA 3DHMA 1MCJA 3WEXB 1B2WH 4ZD3H 2D7PA 5J0BA 3HN3A 3KPSE 1E5ZA 2A6DA 5CJBA 2JCWA 4YDKH 3CHXA 3EJUA 5FKPA 5FCUL 3SE8L 1KBVA 3U9WA 3KXFE 2M1KA 3ATEA 3QEHA 1BVLA 4OKDA 4Y0GA 4G8IB 3LKSA 1I3GH 1MLBA 4OZFH 3V95A 3ATBA 1HC1A 1RQ5A 4F58L 1F4WH 1TJXA 5KSUB 1XO8A 1KEML 5TE4H 7TAAA 3OD3A 1M7XA 1M6UA 2AJYH 2ZOKB 5AW9B 5E9DA 3L13A 5EG6C 1NKOA 1OK8A 2HTLD 1BAFL 2ICES 4YHNA 2IXQB 1UXLA 4H4NA 4GNKB 1YC8A 1X5AA 4Y19B 1H9DA 3W9DA 4V1DE 1HOEA 2YGVA 5JHAA 1I9JH 3QRBA 2B0SH 5DQDH 1UOKA 1J9RA 1EHXA 2YN3A 3FNKA 3QJXA 4DP6X 2IVFC 1QASA 1UURA 3I9PA 4PJ9A 5IW3A 3RIFK 5I6OA 4JREC 2WUCL 2R8SL 3KPQA 2WYIA 2FDBP 2R2HB 5EF2A 2IPKA 2GTWA 2WOBA 2L8AA 1LMKA 4Z3TA 4WQOA 1UOLA 1CT8A 3AROA 4GLRH 1UCBH 2R0KH 4B5ZA 1JXFA 4QR7A 2EINB 1CG9B 2CDFB 2VDPB 4HPHA 2ICEA 4RVBA 1UGKA 1WITA 3NZHH 4IU2B 3CLEL 4YE0A 3VFOA 4G5ZL 3RJQB 3WUWG 4PRHD 1ZMYA 2VJ0A 4QLWA 4NQCE 5IMKA 4Q9RL 2ZUTA 4WCYH 4IK6A 2H26A 1AE6H 4TNEA 2BY2A 4OZIA 3UAFA 2V9UA 5IB1B 4RDQG 1IM3A 1PG7W 3MUZ1 4A66A 2EXSA 3VE0B 4JZJB 1N0LA 5GHWL 2BFGA 5F7EL 3H3PH 1Q1JL 1XZWA 4MAUH 2AVFA 4ZS7H 1WA1X 1HDMB 1YYMH 2CHNA 1LK2A 4MJIB 5GJTH 3BYYA 2WXHA 3T1FB 5HHVL 1R3KA 3R1GL 2F15A 5KYWA 4OZIE 1W6LA 1H15B 2CDGB 3BPCA 3EO0B 4FG4A 3VDAA 5IFAH 3ZT7A 5FDWA 5GS0C 2A6IA 3IGAA 3PWPD 4GXUM 2OFQA 3U4EA 4LPUA 4N3UA 1FNHA 4MA7L 1WQVT 5HY9B 3DV4A 1F58L 2ZWLT 3FT0A 4O58L 4Q14A 4Y1SA 4AV5A 4LFHD 3MRLA 5EIIA 4JFEE 2DQUL 2O6CA 4O51A 4PJCB 1A7QH 2QLYA 5GZND 1J86A 4BZ1A 1QRND 4ZSOE 3W3BA 5IQLA 5EHFA 4JKNA 1NPNA 4QGYA 2J88L 3QEQB 3GSOB 3QUZC 2V3FA 3KYOA 3QO1B 3U9UA 3X3FH 3ATDA 4JE4B 4IBYA 3QE5A 4UM8B 2ERJC 5EPMB 3NN8B 2G3XA 5DZ9A 5AOLA 2QSTA 4UDTA 1YPZE 2MEJB 1EO8H 4J8RA 2BS8A 1PY9A 4XN8A 3PWPE 5EA0H 4FMVA 3CCHB 2MPVA 2VDNL 4TNWK 3A6CL 4QOKE 1FF5A 1U4EA 4Z6AT 2FBJL 2Z91A 2WVTA 5F89A 4G70B 1FWXA 3IT8D 3F7VA 4QHNA 5FAAA 1I9JL 2JXMB 4IM8A 4PJIE 1E6JH 1PZ3A 5LXGL 2EQDA 5IHBA 2VITA 1H3PL 1QSVA 3ARGA 4G6KL 2BNQE 1GIGL 3WGVB 5HDLA 3KXFA 2HFEB 5GGRY 3UEZA 1XF1A 1YEKL 4UNIA 5L88L 1IJNA 1OTSC 1MJ7H 1EAPB 4HIHA 3DJZA 4TYUA 4Q58C 5AUMB 5I1HL 3BP4B 3E9UA 1CLCA 3QFDB 4NHUA 3C8DA 1RUAL 4XMVA 3PV6B 4BKTC 5GS1B 3IYLW 1T1YA 1D6EB 3ZUNC 4KK8D 4LPXA 2X6AA 1TXKA 4K71C 4Q9QH 5INCB 3ASWA 3CC5B 3CPLB 4ANXA 1UGNA 2PXYB 3FHAA 1OSPH 4HKJA 1YRKA 2IC2A 2O5NA 1DQMH 3W0WE 4KITB 8FABB 5ETUA 5BMFL 4XN9A 1QA9B 1WIOA 35C8H 3EJTA 2JSFA 3U0WH 1WGVA 5IREA 4Z0XA 5KVGL 3RB5A 4ONGH 4IGBC 4PJ7B 3OKLB 1UM5L 3VVWA 1BW8A 4HCRH 1JI2A 4JPVL 1IM9D 5C7XH 2HRGA 1OWWA 4P5TA 3OKDB 1QVOB 3BWAB 3HPJA 1MCPH 1XH1A 2P7TB 3IDJB 3FCSA 3P4MA 5CR1A 3F8UB 5T1LA 4E42B 4B0MM 2XG4A 3VGFA 2XV2A 2PCYA 4G7SB 3PG2A 4WNSA 5C9JB 1LO2L 4LL4A 1OARL 2H9GB 4ZOAA 3ZK0A 1CFNB 3GSNL 5AVWB 2OMUB 3ECUA 4PLKC 3LZFL 5FV2A 3FDWA 1PIGA 3P2BA 4X7TA 2PO6A 2ZKHL 5E5LA 3ZL4H 4GRLC 4GG8A 5ID1A 1HHHB 1NIBA 1TZOA 2EDQA 4MNQA 2J8UB 4OM1L 1Q90A 1HH6B 3BH9B 3KHQA 1A8JH 3WFDH 3MZTA 4ERSH 5F8QC 1ET8A 3SGDH 4XNDA 1J0KA 3O6KH 4WWNA 3QEQE 2HT3C 2I9LA 2VDLH 1XSIA 4GRWF 1RHHB 2CO3A 4Z3IA 4JPWL 5F7FA 3FPYA 3VQMA 3ZZLA 3ARBA 4ZOEA 2NXYC 5MERA 3TBVA 2HN7A 2WZ0A 1XR8A 4TVPD 1ZJAA 4OGZA 5HHQB 4QGTA 3OAYH 2XWBA 2XZAL 4YIQB 3MACH 3H42H 3DSNB 1BZ7B 1MCKA 2W60B 4NNPL 1AZBA 3GQFA 2CIKB 4P23C 3FB5B 1EBAA 2VLJE 4M93C 1UB5B 4MA8H 2D2CC 4D9QE 4ABUA 5LBSH 4HEPA 1D5MA 3CFEB 1VRSA 3QAZC 1WAAE 4K3EH 4LRNH 3ARBC 4U3XA 3ZX1A 4Z9KB 4LDOB 1S7RB 5EBMB 2ZSVB 1A7NH 1R3LA 2VSDA 4FQ1L 2EDJA 4S2SA 1IT9L 2XPGA 5HYJE 4IBWA 3NCYS 4OGYH 1SDDA 5CN2A 5BUGA 3K7UA 4Z77A 3AUWB 4UT9L 5A16A 5J57B 1KCUL 1X5IA 3Q5OA 3DV6A 5D2NE 2ICWB 4A6YB 2EVHA 2Q10A 1PX3A 5EO0B 2LQRA 2VR6A 1CI5A 5EU7E 2VL4A 1P7HL 4WGWB 3QG7H 1D2PA 1MJJA 2UXFA 3K91A 4OGXL 1E5CA 4CVZB 3LB6D 1ETZA 1HQRA 5T1MB 5JHLL 2Z4QB 2ZOLA 4CVXA 1YG9A 3Q48A 2Z3FA 1A7OH 4RBPH 1U8IB 3F3HA 4QOKB 3JVFC 1S3RA 1ES0B 5JPNB 2MMXA 1ZE3H 3N1MC 3DMMB 2QTEA 1YMMA 3NDYE 3L1OH 4JDTH 3MV7B 4PRHB 4YHMH 3LHPH 4PJHA 4ZJ9A 5T8IA 5C07A 5GS0H 2JWYA 1MHHA 2TRYA 1TNMA 3GF8A 4DEPB 5JW4M 4YX2H 2Y6TE 4EN3A 1UWXH 2VZTA 4ZBJA 4QXGL 4WI4A 3V4PB 2ATPA 3D3VB 4KZCA 1GGTA 3GXTA 4Y19E 5HBBA 1F2XK 4UV4H 1UD6A 3HR6A 4F91B 3C5ZC 3DTXB 3VD4A 3HN5A 2IWEA 1G0DA 1DVFA 4Z7VB 2HKFH 3VWJB 2GK0B 3DDGA 5IW6A 2QHRH 5FO8B 4E9LA 4ETQB 3QUKB 2DICA 4I88A 5EC1A 1NCOA 1HKFA 3RWDA 2YD0A 5C6TH 2KKQA 1U8QB 2A9DA 5A2BA 1TO4A 3D18B 1M1XA 1DEEA 3ESOA 4JS7A 1OV8A 2BM3A 2G30A 2OMVB 2JJSC 3PGDB 3X1NA 2BS71 1KYOJ 1LO5A 1SLVA 3HZKA 4J4PA 2YD8A 4XH2B 4YHZH 5F7LB 5GS2D 4DGWC 1G7HB 2H1LM 3DO4A 4OCNC 1TTBA 5HHMD 5FB8A 5CCHE 5AZ2L 3E6HB 4YE4H 1UA3A 2XKUA 1FGNH 1ML0A 4G8IA 4OD3L 5GZOA 1XH3A 4LARH 2Y36L 5DD1H 2FLBT 2Y7SA 1IGYA 1X9RA 1N64H 5GZOD 1RP8A 4LLDB 5KWYC 5D7JA 1A6PA 3EHBB 4B9PA 2K0RA 2P5EE 2PW2A 3OGCB 3NZ8A 4CVWA 3DX9B 4AITA 5I30H 4PAZA 2ZX5A 5HVGB 5ACMA 3CZKA 4R96A 3L3JA 4NM4L 1N3NA 4ZQTA 2YHGA 4B3EA 5I1AA 4JJHA 5HDWA 3W0WA 1N26A 4I18C 2DKUA 2LLLA 4HIEB 4JCWA 4O2EA 1U91B 1HHIB 3NCJL 4XBEH 1J8HD 6FABH 5KYXA 4LASH 3HG2A 4Q9QL 4BXVA 1K4CA 4JRYE 1F11A 3CMOH 3BUIA 2DQEH 5H4YA 3S37X 1M6OB 2PTVA 3RFZB 1CFVH 3KPQB 1YY8B 1M53A 3ZBMA 1F4WL 2BWQA 5M95B 1RJLB 2FE0A 3ZIMA 3W38A 5D1ZC 3FJTA 2PP7A 2XIIA 4X5PA 3ZQWA 3GZQA 1CG9A 2CDFA 2ORBH 4S0TD 1FNAA 1AS6A 1F1AA 3VX0A 5E2TL 3AB0C 4PJFF 4TSAH 3ETTA 2QSVA 2NZIA 2RJMA 3MJ9L 7FABH 3NA9H 2E56A 1TTRA 3OF6D 1H8NA 1QSEE 1QSFE 1LWHA 4DH2A 1IM3B 1BGXL 4MS6A 4D94A 1JK9A 2VZ1A 3VE0A 1MFNA 3US0A 3GS7A 3L2NA 1FC1A 4IDJL 5SWSE 3RLSA 4M3KB 1WK0A 3D3VE 3A0OA 4KY2A 3C12A 1RPQA 4A7TA 4MCZA 5DQJB 1OGAA 1G9MH 3FF7A 5A6LA 4Z7AA 1H6FA 3ZL4L 2NDGA 1IT9H 3C60C 3MRRB 4DKAA 4P07A 2HJFA 3RBGA 3X3GL 4HF5L 2VJXA 2I25N 2X0UA 3FONB 1G7IA 4XWOC 4OJDH 3QHFH 1N4XL 3NP4A 5J4MA 2O26U 3C6LB 1CO1A 5HYEA 2ZYRA 1UJTA 2WMPB 5DGQA 5BVJB 4HLZH 4Y5XB 3CC1A 2EO9A 1MCWM 3ECWA 1SHXA 5JHDE 2XXCB 3MRLB 3BN9D 5TF1H 1L0XA 4H8VA 4BZ2A 3FU6A 4CU7A 3RA7L 2BZCA 2O6DA 2K6ZA 1N0XL 5T1KD 2X2UA 4JKMA 4X4KA 5TQ0L 2VW4A 1TQVA 2WO2B 2XIBA 1OCCB 2YS4A 4FEIA 5E4IA 4JY4A 3H9SD 2WWNA 2FEEL 3D07A 5TDNA 1LXMA 2NY3C 1UD8A 4IYKA 4MAUL 2AXFB 4IU3A 3Q6FA 2AEPL 3ZLQC 4MNGE 1IKFL 5H2BA 1PY4A 1OP4A 1SXSA 2UYLB 1O5DT 5E08H 2NQ3A 3IDNA 2VTFA 1VA9A 1EGJH 4N0YL 4HLJA 3SPJA 5EEWA 1YN7B 1GOFA 2DDQL 2IO5A 4QHNB 3AZUA 1VADB 1UATA 2G0LA 1J8KA 1MPAL 2QADD 3OMAB 1M1SA 4WHTA 3RHWF 3FXIC 1A7QL 3I9GH 1AMYA 3NAAH 4ONOA 4EDXB 5J7CC 2H3NB 4AW4A 2KI6A 5F9JA 4H8QA 4EJ1C 2Y2YA 1PG7L 1AC0A 2EDWA 4D7BA 1DN0B 4OF0A 1BFOB 4B3VA 1KCVL 4IRZL 4NHUB 4NRXB 1GS7A 2WYTA 5B8CC 1QSFA 1VZGA 3OWRA 2B4CL 3MU3A 1UASA 3BOVA 4PREA 3CPLA 4EI5A 5I19L 1E4KA 3WD5H 2PXYA 3IPFA 2BHFA 3NA9L 4ACTA 1OAJA 5DHVA 4LVNC 4OGAD 2ZOOA 4HC1L 3RL2A 3VRLE 4AYID 4B53A 2J4WL 4S10A 4JFOA 1XCQB 2EDHA 3CU1A 3D09A 5E2TH 3L4UA 4ZODA 3SE9L 5E5RB 3EGXA 4LSSL 1NAMA 3DX0A 3K3QA 3HZYB 3F7LA 3U9PH 1QI4A 4OLWH 1UADC 2B1HL 2ZUUA 3ULSB 1CXIA 4NHCH 3KCWA 4G9FD 4EZJA 2YSSB 4UT6H 1V3KA 3BH8A 4JHZA 5C0CB 1YQVL 4EKJA 4NZUH 3KWVA 4BKLA 3B3IB 4JQIH 5HJDA 3ZYJA 1USZA 4FQXD 2A9BA 5F1IB 3UZQA 4YXLL 3O41B 1QR1A 1VPOL 2ZNWA 3QT2A 2DWDB 1CTMA 2FYYB 3CDCA 5E24E 1ONQA 3KWWB 4WSKA 4BXSV 1CFNA 3HE6D 1GYWA 5DO2C 3KYAA 4X5LA 1VERA 2ZIDA 2OX5A 3CWGA 4WV1B 4CMHC 4QRUB 4FQLH 4MXWH 2XFXA 5CJOL 4OV5A 5BRZB 4GG8B 3DETD 4B7LA 4K3DH 1C9SA 4LMQI 3VWJD 4GY4A 4A2MA 1KXTA 2K3HA 4N0UB 5E0FA 4Z0BH 4PY7A 1KCKA 5ISZA 2VLJB 4YVNA 1FO0A 1I7ZB 4X6FB 3WFBH 3ZTNL 5K9QI 2QPUA 3FCTA 4HIJB 3FU7A 3ARBB 2WCPA 5MERB 1QI3A 5C0DB 1JZIA 2H6UA 5MHSD 4Z7UE 4ALAL 3SO3B 4AQ1A 2F9BT 2O5YL 2WLLA 2WO4A 4X6CE 1E8ZA 4JPQA 4HZAA 3FRUA 3PWJB 4YIQA 1JPGA 2GJPA 3N41F 4N0YH 3WTSA 1AXTH 3NFNB 4MMXA 5EZPA 2FJFA 3WUZA 1F3JA 1CU4L 4GSRA 4NUGH 3R8BB 4AQEA 5DD5H 5FO9A 3MJGX 5MEPB 5K9OB 1J9TA 3CFEA 3KPRB 2G5BB 2OL3L 3EOAB 4GQRA 2BY3A 2HZHA 3C8KA 2PWGA 4G8GE 1IGTB 5D7LB 5F0MB 2J6EH 2GG1A 3EGDA 3WIAA 4OQTA 4NWUL 5CJQL 5LQBH 3U6RB 4FQXC 4GMTH 5E2UH 3RGVC 4C8XA 4LAJH 1KTDB 2QPFA 1WBZB 5EO0A 3KBHE 1OAUH 3MLYH 5J11B 4N24A 3C2AH 5DO2D 1B4TA 1TU2A 3QCUH 2XX0A 4AYEC 4NIYE 4RGNB 2CHWA 3DX3A 5T1MA 2Z8VC 4J5VA 2UY7B 3IJYB 3N1PC 4FXKB 4HT1H 3N85H 2F2HA 1OARH 2CO1A 2CKBB 2ADJB 3M7OA 3N43F 3OVUB 3PL6D 3JV0A 2EUXA 4OBSA 3CV5A 3SE9H 4PB9L 1IC7L 1V3MA 2A3TA 4L3CA 1NCHA 4R97C 3MV7A 1KELL 2NMSA 3N0PB 4QJ3B 2YPKA 4NIKB 5EZJA 3FB6A 4HWEH 3EYOA 5FOJA 1W6WA 3TBWB 3UCRA 4M9PA 4NJAL 5DMYA 1JZ8A 3D2UA 1D7DA 1MG3C 4GUOA 4KXZI 4ERSL 3HI5H 5KJ7E 2OA9A 3I02A 3SE3A 1XIWB 4TUJB 1UB6A 2TSBA 2XWCA 1I8MB 3LDBC 1XZ0B 2GTZB 1JL8A 5I1DA 2EDRA 1DQML 2L7QA 3QNXA 1G6RH 5LNEA 4DN3H 4MXVE 3VWJA 5FECB 1J9CT 1BXXA 3EJRA 2WBKA 3VI3E 4WFFD 3FOLB 1FVDB 3UGXA 5A43C 1UJ3A 5F3BB 3WAJA 5D7IF 5EC1B 1BYPA 1C1EL 4BDVB 5TPWH 3BUTA 1ORSA 3QEUB 4QDGA 5DJ2B 3TO4D 4KNSA 3HI1A 4I0PC 5HYQB 4KZEH 2Q8AL 3BN3B 4XCYB 4I5BA 3KLAB 2BOLA 2FX7H 3PGDA 4LFHG 5F88A 3LKRB 4PG9A 3S4SG 3OZKA 1ZK5A 3I50H 1BAGA 3A24A 4AGLA 1P2CB 2GJZB 3G3LA 4UQDA 3VD1A 3Q13A 3FHEA 4F5CA 4LLVB 5FB8B 4N6RA 4EUPB 1B2WL 1CGSL 1VJSA 3JYCA 3ABZA 2OR7A 1KG0B 4TTDC 5JIHA 2ZX8A 1ASOA 3UDWC 1YEWA 2ESVD 2EDKA 3WFCL 4YDIH 2Z0BA 3ATFA 3PL6C 4OM1H 3OGCA 5DMGC 3QUMB 1DBKL 3TWCL 5IB4A 3S5ZA 1OAZL 4G8FB 4L4TA 1SZNA 3U6XS 1BQLL 4M1DH 3VDCA 4A67A 4HZ1A 3CDZA 4MXQC 2DLGA 1AGBA 4AZ8A 2OZNA 5HPMB 5KS9A 5E2WL 4DKFH 1KLUA 5EUOA 4POZC 3NGBB 3TONA 1MFBH 2B5IB 4TN9A 5KYXB 1U8JB 4NZDA 2DIEA 3SKMA 1HHGA 2M83A 1FNGA 2AXHA 5SX5H 4AE0A 4NKDB 4GW1B 4NUPA 2LFEA 1GGBH 2VXQL 3QIBA 2XWEA 1K8DA 4YHYB 3MROA 4PP2B 3RIFF 5KS9E 3QI9C 3MX0A 4ZUSB 2QDVA 1WIUA 4GEJA 1T21B 1AXTL 4XWGL 1FA4A 2MPAH 2RIKA 1NCWH 3PNWB 5BOZG 5JW4Q 1P4BH 1SN0A 1JGEB 3REWA 3AAZB 1FAIL 4HDIA 3ZMNA 3WXVH 4HWUA 4HS8L 1Z3GL 4I1NB 3NK4A 2B77A 1AJ7H 3V6OC 2P24A 3SDDA 4OCMC 3IS1X 2X6UA 5E9NA 3CVHL 5I8CB 4AL8L 3ZKMC 3TASA 1BXVA 4PIBA 5TGBA 4MCZB 4LLUB 1CDCA 1WC7B 2R2CA 1WHOA 1R0AH 1J9SA 4ZMOA 3MRQB 1QLRA 4HOZA 4RGMB 5I6PA 3T2NL 3OQRA 1MFMA 5I76B 2A1WH 3FT2B 1T1XB 1G7IB 3SDCB 3AC0A 1T5XB 5KBPA 4FQXB 1CL7H 4A7UA 1YEIL 3C6LA 2OSLA 1JNHA 3QUXB 4W9GC 2VERA 5DEGA 1X4ZA 2JCCA 1OIOA 3DX6A 1CC3A 4HIIA 1NBQA 1WZAA 5JQ6H 3D6GA 2NNXA 1DQJB 3Q8CA 4UIMA 3FTXA 3O0LA 4I1RA 2W0FA 3L1GA 1IEBA 2I27N 5D70H 1IBHA 3M45A 4XBGB 5SWQA 4TVUA 4K5OA 5TDNB 2X87A 3D50A 3RKDD 3DYPA 2APFA 4G8AC 4L8DA 5JUEL 1ZV5A 2FB4H 3ROOB 1MLCA 5IF0A 1ZTMA 1WAEA 1CFBA 5DFVD 3STZB 4QRRB 1I8LC 4YHOL 4J3SA 4W9CC 3FQWA 3A4EA 5KOMC 3FQRA 3MRGA 4YQXL 1CF8L 1Y0LA 1U8NA 3QWRD 4ANUA 4EEEA 2VUOA 1I9IH 3AU1A 2DWTA 3TH3T 4QJ5B 2B2XL 4O02H 3BIBX 4BZ2L 4FI6A 3KLQA 1UZGA 1SDYA 1GZHC 3M7FB 5AB1A 3VM5A 4JN1H 1FBIL 4TULH 1DEDA 2XQYA 4PLJC 1AH1A 4W9IC 4C59B 2J44A 4J28A 4OD2B 2A4CA 3HRZA 1A4BA 3N85L 1AZVA 4FLOA 1TPXC 2CM5A 1BFOA 1H5BC 5AG8A 3V79C 3QWOB 5JIMA 3NPZB 4TVSa 4FHKA 1QUPA 1XL6A 3SY6A 1EGJL 2BNUB 1E5UI 4R0LA 4K0OA 4XMUA 4QHLB 5EIVA 2OYLA 3ZDXE 2FQFA 4FHBD 2V2TB 5EU7C 3S36X 3RL2B 3BGAA 1JE6A 1NGWA 2E0PA 2VAAB 3H53A 5IJDC 1INDL 5FIEA 4WEBL 5EOTB 3VI3A 3HZYA 3ETSA 3OJDB 4P9ML 3DVNB 1BJ8A 4X5XB 3G6AB 1W91A 3WJMA 1OF2A 3BWSA 1X5LA 3PV7A 3DIFA 5GZNC 5JXAL 5GGTH 2ICCA 4ADJA 3LXAA 3ULVH 4BKLB 4N9GA 4NQQA 3RWJA 3V4PH 3VRLF 1GJWA 5AVQB 2BDNH 1BLNB 4B6ZA 5I0YA 2YD9A 1BVLB 5EDXA 1X5KA 5IUCA 3CFNA 4IRZA 5DFVC 1QO3B 3QZWB 1FH5H 4KZDL 3B7RL 4HMDA 3TGXA 5KSUA 3ZZ1A 4EMZA 4R2GD 4LPCA 5JIPA 2WCGA 1Z5YD 4JFXB 3PHOB 4PUBH 3U0PB 2F8XC 3UTSA 1QBML 5HGBA 2FWOB 4RFEB 5DC2A 5AYUL 2JKSA 3WDIA 2IXQA 1P1ZB 4P57B 5H94B 1K9TA 3P3RA 4HSAC 4KK9D 2OJZH 3W9DB 5KBLA 4M6MH 3JTTB 4LF3B 2DN7A 1ADQL 4MJ6A 3CVDA 5J12B 1FO0B 1I7ZA 3PAUA 4X6FA 3ARXA 1JZDC 4LCIL 4PJ9B 1MCIA 4TSCL 1VFMA 3EJYC 3HEIB 5C0DA 2C9QA 2OLDA 2R69A 3T77A 2EC8A 4C4KO 5CLWA 4OD1H 2DLFH 3L5WA 5DI8B 3SPIA 2X6VA 4FZ8H 1KTKE 2GTWB 1EK3A 2VWEC 4P2RD 1YMMD 1KJMA 3CBKB 4WW2F 4NO5A 3VXOA 3DURA 4XMLL 4BBWA 1KWKA 4M7LL 5AAMA 3GO1L 4IU2A 4KVPA 1GAFL 5HYIA 3PE9A 1MHPH 3SDXA 4F37F 1IBYA 2W9EH 4K3JH 5F7AA 3VYOA 1LEIB 1IGTA 3L1FA 2H26B 5B1KA 4NZ8A 3L3OC 5E8PB 1KCSH 1RU9L 4OZIB 3EGDB 4IGBD 3IKCB 1F02I 5CMAA 5FA3A 3MV9A 2AQ3A 1ACCA 2NR6C 2N0KA 3W39B 1UD3A 4NKQB 3NJGA 3LKQB 3QIUA 1QNZL 3WIHL 4HHAB 1NEZG 2ZSWA 3P73A 4YEEA 3NFPB 1FVCA 2RFXA 1OT1A 3H0TA 3VM7A 4WO4A 4NP9A 3OXRA 4HCFA 1Q0YL 2V7NA 4N22A 1SYSB 2CKBH 4MSWB 2EP6A 1QYGH 5AAMC 3MKGA 1T6VN 4LSRL 3R7QA 3TBYA 2CUMA 3B6SB 4UNUA 3DV4B 2Z64C 4AEIH 3JWNG 3GJFH 4ZMTA 1UOWA 1UC6A 2EACA 2R2EA 4E9QA 1WEJL 3WTVA 3IRCA 2Q1EA 4H1LG 3SO3C 5CINH 2DLTA 4Y4KC 2XN9E 5IBTL 3EOYG 1S78C 4LNRA 2AK4B 5BZXA 1AIFB 3I02B 4DEPC 3U9UB 2EUVA 4Y4HC 5EEZA 3MYZA 1OAUL 3MLYL 3VWKC 4DGVH 5LNDA 2QPDB 2VXSH 5DUMH 4FAAB 5BPPA 1A7BA 5DTFB 4GMSL 3IPBA 2ZXDA 3KJ4C 5C0BD 4X9YA 4UQ2B 3CFQA 1U2CA 2QSCL 4JX0A 5IFAL 1MAMH 2NLJA 1AQKL 1YEFL 4M7ZB 3F6LA 3QEGH 3B7TA 4NKMB 5DJ2A 5HYQA 2RACA 4K2UH 1JPSH 4Q2ZA 3TX4A 3V10A 4UOZA 3BAEH 3DARA 1S9XB 2GJ6A 3GKZA 3IDMB 4PH8A 1BVKA 1PZAA 3QIUD 1CU4H 4K94C 4OFIA 4BFEA 3BSHA 1G87A 2VNCA 3SOBH 3KXFB 5MEOB 3NCEB 4W9KC 5E6ZA 2X53A 1UD4A 4HIHB 4ICXA 4XVTL 1TVBA 1DANU 4XTRC 2BP0A 2JV6A 3RTQC 3X3FL 1LWJA 1JTOA 3DGGA 4F8LA 1RH8A 1THCA 5GS1A 5JW3L 2FJHB 4P4KB 3QARA 4F57H 3LIZA 3BQUB 5F1KC 3ARPA 8PAZA 1KZYA 2AQ2A 8FABA 3HRPA 2ITCB 3MOQA 3SQBB 1R75A 4UZUA 2CLRB 1AO7E 1VZIA 3MLPA 1SUHA 4FQIL 1YAIA 3VXRD 1SJHB 3IB4A 4AZ8B 5ACLA 3SN6N 2MCG1 1EHNA 4AYBA 2MTAA 2LU3A 3APFA 3HFMH 3HHRB 3OKDA 4GXVH 1L5GB 1OTSD 2VMEA 3EZ8A 3OB0H 1U8JA 2EDBA 4NPYA 2NY0C 3AREA 1RZJH 3RWGA 1JFQL 4U1LB 4XP6L 2IGTA 4E42A 2DQTL 2FAUA 4C56A 1AR1C 1E9PB 2AITA 3KBPA 3SZ6A 1WT5A 1A6TA 3FO2B 3ZDYE 1D6VH 1AZZC 2O72A 1GTNA 2OMUA 4BFFA 4UIKL 4Y2OA 3GM0A 5ESQB 2DMKA 4ZRGA 4KOCA 3F7KA 1TQBC 3OPZH 4ELMF 2MHAA 1SBSL 3E9TA 1JHLH 3AG3B 4UB0H 4PTTA 1CCZA 1HH6A 3BH9A 5CXPA 5B3SB 3ARSA 1JGEA 3FZUC 3REWB 4Q6IA 1WBXA 4HKZA 4YZFF 3KGUA 1IAII 5LCVL 4MB5A 2QPSA 3MXVH 1NFIA 2P49B 1FHNA 4IMKC 4AG4L 3KEHA 1LD9A 4LLUA 5JDJA 5EU5A 3LXUX 1N64L 3T0XA 4OCRH 1BZ7A 4W9DC 4YGAB 5A2FA 4JHUA 1JAEA 3H9HA 3SDCA 1T5XA 3SBPA 3WBDA 3HG1B 1CR9L 1XGPA 4L5FH 3LNHA 3D0LB 5DO8A 4RAUB 3EFFA 3S8FB 4OCXH 1ZVNA 3MRNA 3KLSA 4LBAA 2OM5A 4W68A 4BFOA 1R3LB 3VACA 1U3HC 5I73C 2KLRA 2EDMA 4XHJD 2H1PL 4S2SB 3T6VA 3S3DB 3EF4A 1NCGA 5A16B 4DO5A 3CVHA 3MRBB 4JDVB 4L8SB 4PD4J 4XBGA 1Z5LA 4L4VA 3GSRA 1T2JA 5IFJA 1WFOA 1G6RA 2F5BL 4U1IA 5KVGH 2HPOA 2JKNA 4ORZC 1IC1A 1GA2A 3NCYP 1RI8A 35C8L 3I6KB 7FABL 1MJJB 1NLDL 3MFGB 4N2IA 3ROOA 5L7XL 3CSGA 2KUTA 4KK5C 1ETZB 1HQRB 3BO8A 1IV8A 1FL5A 1KGIA 5DZNA 1KXVA 4N8VB 1TETH 4BGDA 4PWJA 5DGRA 4MMYA 1PZSA 2GFBB 4XPFL 5BS0D 4H7VA 4LLYB 1XSKA 3DX7B 2FH6A 1CDYA 4LLQB 4XE5B 2B3RA 1XIWC 1ACXA 4OZ4A 3NIGF 1FNEB 3IMRA 3WHE0 2FWUA 4HJGA 5EO1B 4YHLH 4HF5H 2CNZA 1CDHA 5E70A 3GBLA 4XO8A 3WG7B 3HRZB 3P54A 5DJCB 5INDB 4JFWA 1W0VA 4QXWA 1YHPA 3V9EA 3O9WC 2R9HC 2J8OA 1U6AH 2DL9A 3DBSA 4LIQE 5IT2L 1U8OA 3EJPA 3GMQB 2NY4D 1VLXA 2AABH 3OKNA 1F13A 1WAAA 4PRNB 3Q2NA 2IIJA 4E41A 2VAAA 1VHPA 1B0WA 5G55A 1P7BA 3GMRA 3PFUA 2AXGA 2BSDA 5IHHA 4G5AA 2WVUA 2XICA 3OWEA 5E1GA 5TDOA 2DM7A 4Q97A 4ZXBA 1JYNA 1UXMA 3S34L 2ICWJ 1X7QB 4NENB 4FKEA 5JHDD 3OJVC 2YAHA 1ITBB 3GGWB 1X6LA 3ASOB 1DQLH 2WGXA 2WUBL 1JV2B 3S8GB 3NCWA 4NHCL 4YN3A 1IQWL 5J8OA 3BSGA 5E08L 4WF7A 4B9GA 2R69H 4XP6H 1EGJA 2MPAL 3PQYD 4JFXA 4N86A 5DJDA 4HZLB 4PCSA 4BFIB 2YMTA 2VR3A 2I07B 2K4AA 1B9ZA 4WY7L 3NGBC 2YD3A 5D7SL 2AXJA 3WJLC 4A2FA 1U2YA 4FZEH 4KVNL 1LO4L 1OF0A 4P57A 5H94A 3QI9A 5I1AB 3LKOB 4KKQA 3RIAF 1IBZA 1F6AA 4PJIF 4O2EB 3V5HA 3QYMA 5E1HB 2DQJL 3PWNB 4NRYB 1R0AL 1BIHA 4QY8B 5E4OA 1IX2A 3O9WA 2RR3A 3CTTA 2APSA 4ZTOL 3S6CA 4YSEA 1BD2D 1BEYH 2E8ZA 2L7JA 1IFGA 5SX5K 4U1HA 4ZG1A 1T66C 4KTYA 4LGPB 1YY8A 1TEYA 3SD5A 5DMIH 2GBTA 2F5AL 3T0DA 3ZE2F 1J0JA 1OP3K 3KAAA 3OGOE 1PIFA 4MJID 4NO5B 2BW5A 3OLEA 3QQDA 1KJ3H 4IRJB 2K70A 3T65B 1Q94B 3VQ1C 5GGRA 4L48A 4NQVA 4OZGA 5CD3A 2P8MA 3ETBJ 4YAQB 2WNGA 4JKPH 1O9WA 2DWEA 2R59A 1QFPA 4XPFH 3EBAA 4F92B 4YSQA 3KPRE 3UZVB 1KWGA 2R8SH 1C16A 4HJTA 3T2QA 2WBXA 5KZCD 1E65A 1EZVY 5E8PA 3BD3A 1PYWA 1JK9B 1G7MA 2DZEA 3KG5A 4LCWB 3P0VH 3OMIB 4NUMA 4K5PA 2Q7NA 4OF7A 3D34A 1AP2B 3IDIA 1DYZA 4HHAA 4N2OA 1ZHBB 4ZAKD 2ZSWB 3J7HA 4HETA 2Y07H 3MRRA 3L6FB 5KJRH 4NS0A 2ZCHH 3GMLA 2BS9A 3W1ZA 4LVNB 3OXRB 1S46A 4H13C 2NY6D 4B9IA 3JWNH 1FL6B 1WUZA 3HE7C 2HG5B 3TT1H 3ZKXC 3OL2A 2CBPA 5F9AC 1NC2D 1NWPA 5C07E 1JGDA 5GS0L 2Y06L 5HHME 4Y5XA 2FJUB 2WQRA 1RULH 4LSDA 4Y8DC 3D30A 3UO1L 4D9RD 4PUBL 3NCXA 4HWBA 4JUTA 1W16A 3PAZA 1G4MA 2E6PA 1JF6A 2F18A 2VXVH 1UQSB 4YBLB 4Q8BA 5D2LB 1UHVA 1YMHA 3X1GA 1AIFA 3T3PE 3T4YB 3TO2A 4K3GA 3MYJA 1KXHA 2GW5A 3GBDA 5DQ9B 1S8DA 2APBA 3VFWA 3R4RA 3RB7A 4L3EB 2ZCKH 3ULUD 4QMEA 1D9KC 1TJGH 1XCWA 2K45A 4IU3B 4JFVA 5CEYB 3L17A 3FQ2A 2X12A 5H2BB 2YARA 2EH7L 4H8UA 4P5MB 5I9QC 2Q3XA 2NLJB 1F4AA 2WN3A 2X09A 4ZPVA 4KZ0A 1AXIB 3IU3B 3QHFL 3QR1A 4DPCX 2OMZB 4PJ5D 4PJCF 5I1IH 2DQGL 3BEWA 1EJOH 2WVVA 3LIUA 5E9AA 4EN3D 4IEFA 4JDZB 3QDGA 2WQXA 2VQ4A 1KEMH 4X8XA 3Q06A 1FCGA 3ELQA 3ABMB 2BVOA 2PW1A 4GRWE 3TJPA 4ZX6A 2IF7A 3LSOB 2GSMB 3H3BC 3QQNA 5FFLA 4N25A 4OM0H 1UEMA 5J9PA 3O6FC 5F9OH 1YEGH 4P2YA 3D87B 3OAYK 3MNVB 2FZ3B 3HE7D 1HE7A 4JFZL 4LCCA 1TIUA 2RD0A 1KB9J 2P8PA 4PB9H 2VZOA 4P3CL 4X7DC 1VGKB 1BYNA 2LOEA 3F01A 1OKEA 1WBYB 4JO5A 3WO3B 5J13C 2ZF8A 2LAAA 2CLRA 1TQCC 4HBQA 5B39G 1ADQH 3IU4L 5LHDA 1RZQA 4IRSD 2Y4SA 4X83A 5ENWA 2DLEA 4UQAA 3RUGF 5J6HB 3TA3B 5D1XB 5JIIA 4O4YH 2WNKA 5DC0A 1AI1H 5F1SA 3EDFA 5CP7B 1M71B 4AYFA 4Q6IC 1TQBB 1YEEH 1YYLH 4PGDB 4LCCC 2J55A 4ZXBC 1DTUA 4WW2A 4KWUA 1XL4A 4U1LA 1L0QA 4LEOB 1J1OH 2QQNH 3APCA 1WUNT 3DBXB 5I15L 3VG0L 3FW6A 2FYYA 3HC3H 5E8EA 5EZIL 1XEUA 4UQBA 1GW6A 2D0GA 4FKKA 5C09A 2FJSA 2YEVB 4NOFA 1W72A 2FBJH 3AQYA 2B4CH 2PMZA 1IAOB 5KSBB 3LIZL 1BFVL 4HEMA 4P2RE 1H3VA 4N8CL 5DHVH 5EA0L 1UM5H 3LPGA 2VXQH 3ROLB 3QORB 1ZGLA 4EN3C 3BDYL 1RK7A 2KZWA 1Q9LB 5HHVH 3LZQA 5AOIA 3S7GA 1GMIA 1P84K 4EUPH 4CADA 3JZYA 3QFJE 5A2IH 4PY7B 3PGCB 5ISZB 1K3IA 5CUSH 4JAMB 3AY4A 4L1LA 2BX5A 3TT3L 1FE8L 4F20A 3RE0A 4ISVB 4I9XA 3FU7B 4L4VE 3HMWH 1J5OH 2VXUL 2R15A 3FH5A 4OGQC 1QR4A 5FUOL 3VI4B 2Z8SA 1XGUA 1JPGB 4FP8H 1C7TA 4JZJC 3ZT6A 3EHBC 1MEXL 5CBEA 2FJFB 2NY5L 5IVXA 1HZHH 1ZV9A 3MUGA 3QUYA 3SBWA 4DP2X 4QXUH 3DI2B 3KPRA 2UZYB 3VH8B 1QSFD 3QXDB 4W6XB 3UPRA 1MNNA 2VDLL 1CGVA 3C09C 4H8WC 1YNLH 3KW7A 1X9LA 4YHKH 4JG5A 1BV8A 3U2JA 3F64A 4LP4A 2ZYSA 1SQMA 3CVHB 3MRBA 4JDVA 1Z5LB 3REVA 4R26L 4GKSB 4HUXA 3ZR6A 1G6RB 1ESOA 3NFSL 3R18A 2QGEA 4P2AA 1DJSA 3LZFH 5AVYB 5IV2B 4P2CG 4MGXA 3MO1A 2O5ZH 5D7LE 2NYYC 1A2YB 3U9PL 1OT2A 3HR5B 5JDSA 3RILA 3ECVA 3PP3H 5JZ7C 4X8JA 1ODUA 1ZD6A 3L9RA 4N8VA 1CFQA 5KSVB 2YGNA 4XBPB 2YUXA 4M7KL 4MMYB 3BZFA 2GFBA 3FUHA 1A5FH 5E8DH 1RZGB 4LHJB 5EZJB 3B9DA 2Q2EB 3EYOB 1KCBA 3V9CA 5I1EL 5H8DA 4XVSL 4Y4KA 3Q2VA 1IAIM 3UXFA 1LTXA 2F54A 4L1TA 3U48A 3V6FA 2WVSA 3CN1A 5EO1A 1JZ7A 5KVEE 4KMLB 1V7ML 3BW9A 3JSSA 4U6YB 1UB6B 3F7PC 2BVPB 4O00A 5DJCA 4XCEA 3T3MF 4XMPH 4DW2L 5I15H 3CXHJ 2XTJD 3KVPA 4YLBA 2HFGH 1SLXA 3KPLB 4FXLA 1EHLH 2MCPL 3GMQA 4FFZA 1TKWB 4P49A 3OKNB 5LBSL 4GAYB 2DBJA 4QRBA 4X7SH 4BDVA 5LGHL 5HHMB 4XPAH