1RCYA

Rusticyanin (rc) from thiobacillus ferrooxidans
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
TTWKEATLPQVKAMLEKDDGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple wavelength anomalous diffraction (MAD) crystal structure of rusticyanin: a highly oxidizing cupredoxin with extreme acid stability.
pubmed doi rcsb
source organism Acidithiobacillus ferrooxidans
molecule tags Metalloprotein
molecule keywords RUSTICYANIN
total genus 35
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 1996-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1rcyA00
3WKQA 2EIKB 3ABLB 4BWTA 2CCWA 5I6OA 3IBOA 4A2FA 5AKRA 2XWZA 4AI7A 3PAUA 3OMIB 2UX6A 3FPYA 4UF7C 3T6XA 1E5ZA 1VLXA 1JVOA 3TASA 2EIJB 4E9WA 2VM4A 3QPKA 1OE3A 2XLLA 4FAAB 3NJFA 1W6LA 3OD3A 1J9TA 4KO6A 1J9QA 1NZRA 1TEFA 1HAWA 1PZAA 2UXVA 4HZ1A 1SNRA 1KDJA 3ABKB 4W9ZA 1BQKA 1BEXA 4HCGA 2QPDB 2YAMA 2DYSB 4YSAA 1ET7A 3CDZB 1JZEA 2W8CA 3NJMA 3UACA 1PLAA 1E30A 5D4HA 2JKWA 2PPAA 4E9QA 1PNDA 4PCYA 2Q5BA 3UAEA 4YSTA 5PAZA 3WG7B 2N0MA 3AY2A 1GW0A 2J56A 3FSWA 3EH4B 3T6ZA 2IDSA 2FQFA 2CAKA 1GS6X 3MBWB 2A3TA 1WS8A 3JTBA 2EILB 4JKNA 1RKRA 4ENZA 3FSVA 4F2EA 5I6MA 1SFHA 2IDUA 4Q8BA 2DWSA 1RZPA 3KW8A 4GP4B 1NICA 4JHVA 4DP0X 3TU6A 4JHUA 2ZXWB 1A3ZA 3UAAA 6PAZA 2VN3A 4QLWA 3S3CB 2IH8A 4QKTA 2R7EB 2Q9OA 1AACA 2BWIA 2AZAA 2PPDA 1JVLA 3CDZA 4WTQA 3FU9A 2XU9A 4M4RB 3JT2A 2E86A 1HAUA 2IDTA 2YXVA 1BQ5A 1J9RA 2FQDA 2EINB 3ERXA 5B7FA 1X9RA 1YLBB 2GSMB 1NINA 1SJMA 2DYRB 2H3XC 4YSSA 1DZ0A 2WSDA 4MFHA 1AIZA 1AAJA 1CYXA 4BXSV 3T71A 1KYAA 2DY2A 3X1NA 4G70B 3CZUB 5I5MA 3QJTB 1N68A 1GS8A 2YXWA 3NJJA 1X9UA 1XMEB 1JZHA 1A8ZA 2YAFA 1BYPA 2YAOA 2FNWA 1XB3A 1V10A 3QJRB 4TXVB 2MTAA 4YSPA 2HRGA 4BWUA 1ZDQA 3X1EA 4E9VA 4HIPA 3QJSB 3PLYA 3X2QB 1ET5A 4BWWA 3WIAA 4K9JA 1AZCA 3ZDWA 1NIBA 1KCWA 1L9RA 2XXGA 3KW7A 3NSCA 3C75A 1IKOP 1TKWA 1NWOA 2BP8B 1NPJA 4DPBX 3CVBA 3N55A 4NAJA 3NP3A 2CBPA 1CYWA 2XX0A 4YVNA 4YVUA 1SHWA 1V55B 3T9WA 5B3SB 3FQYA 1JXDA 1ZDSA 2PP7A 2DWTA 3PPSA 2UXFA 3RYMA 1OOWA 4GYBA 4HALA 1GY1A 4E9TA 1PZBA 4F2FA 1EHKB 3H56A 2PP9A 3NJIA 1JZGA 1MZZA 2OJ1A 2PPCA 3FU7A 5B1AB 2VW4A 5B7EA 2GBAA 4WKXA 3CG8A 2BW5A 1SHXA 4CSZA 2UXGA 5A7EA 1W6WA 4FA7B 3NJLA 1ILUA 1M57B 1PLCA 2AANA 2BW4A 1AZBA 2BP0B 2BP8A 1NIEA 1L9QA 1SF3A 2IDQA 1IUZA 1IBZA 1SF5A 4AKQA 2GC4C 5I6LA 4YSDA 1BQRA 1EZLA 1IBYA 2W88A 3DTUB 5I26A 2VW6A 4KNUA 2IWFA 4AX3A 5TK4A 3IE9A 4DP4X 5B1JA 1KBWA 1XB8A 4W1TA 1ID2A 1GR7A 2B3IA 1GYCA 1CURA 1FFTB 4DP5X 3AG2B 3UADA 1MZYA 1BYOA 1WAEA 3FSZA 3NSYA 3QJUB 4N4YB 3ASOB 4DPAX 2QDVA 1L9TA 3OMNB 4E9XA 5I5JA 1MDAA 3NP4A 2I7SA 1AZUA 3FS9A 2YAEA 1N70A 3X1FA 2OCCB 2NRDA 1FA4A 2IAAC 1ZIAA 3NJGA 1ASPA 4N8UA 4M3HA 1WS7A 2J57A 1JZJA 3V9CA 1XB6A 3N2JA 2TSAA 2Y1AA 2FJSA 1GY2A 3HEIB 3QJQB 3FQ2A 4DP7X 4E9RA 2VSMB 4A2HA 4DP8X 1KV7A 1OV8A 1AS7A 2HZHA 1WA2X 1M56B 4GXFA 1CC3A 2AFNA 2HLEB 4GY4A 4KNSA 4KOCA 4AZUA 1J9SA 1JOIA 7PAZA 3HB3B 2Y69B 2H47C 1NIDA 2QPEB 4HHWA 3FU8A 1L9PA 5E9NA 1ETJA 3GDCA 1ET8A 2PCYA 5F7BA 3EHBB 2PCFA 3EH3B 3S3DB 5LDUA 2XYBA 2H5UA 1A4BA 2J55A 1RZQA 2HXAA 2HX9A 2PP8A 1F56A 2WO2B 2XV3A 4BDVB 2IWKA 1QNIA 1AG0A 3ASNB 1PY0A 3MX0B 4X4KA 2PLTA 2CJ3A 2GI0A 3PXLA 1PCSA 2XXFA 2GB2A 2B08A 1NIFA 1TEGA 2PPEA 4YSRA 4E9SA 3PCYA 2J5WA 2BHFA 1IC0A 2DV6A 2YAQA 3TBBA 9PCYA 5B7MA 1PLBA 2FQEA 2XUWA 1L9SA 3FT0A 2X87A 3ABMB 4E9YA 4DP1X 1PNCA 1PMYA 2YAHA 4KOBA 1ADWA 1R1CA 1URIA 1GS7A 3WNIA 3NJKA 3QJVB 2AZUA 2IWEA 4Q89A 3OM3B 3ZBMA 2PPFA 5I6KA 3H4HA 3WKPA 4G7QB 2HX8A 1ZIBA 2GIMA 1ZPUA 3BVDB 1KBVA 4YSEA 1JXGA 3SBRA 3FPXA 2XX1A 4BDVA 4KO9A 5B1JC 3BQVA 1JZFA 3D12B 3WI9A 2HX7A 3WNJA 4EF3A 2FT8A 1PZCA 4G7SB 1OCCB 4G7RB 4G71B 2UXTA 3EH5B 1SFDA 1AS6A 1MG2C 1OE2A 1NPNA 1V54B 4NERA 2VSKB 1J5DA 3AG3B 2ZOOA 4YSOA 4HCFA 3SBPA 1ASQA 3AG1B 3PAVA 1JZIA 5ANHA 1B3IA 1FWXA 4BXVA 3NSDA 2XVBA 4UAHA 2BZCA 3PAZA 2X88A 2IDFA 3V9EA 1T5KA 3G5WA 3CVCA 1TU2A 1OCRB 3CVDA 1OF0A 3NJHA 3NT0A 2FT7A 3FYEB 4DPCX 3FU7B 3GXUB 3S3BB 1AZRA 2YARA 1A65A 4A67A 3FYIB 2QDWA 1GSKA 2R7EA 1E65A 2VM3A 3ABGA 3IEAA 3SBQA 2I7OA 1BXVA 5B1BB 2WO3B 8PAZA 2BO0A 1AQ8A 4A2GA 1DYZA 5I6NA 4DP6X 3QQXA 2XV2A 3U25A 1OCOB 2BP0A 1OCZB 1PAZA 2LLNA 4UANA 2P80D 4YL4A 5TK2A 5D4JA 5PCYA 4HAKA 1E5YA 4A66A 4AKOA 1KCBA 4HCIA 1NIAA 3ZIYA 3SQRA 2FT6A 2VW7A 2GHZA 1A4AA 2ZONA 4ZK8A 2HRHA 4KO5A 4DP2X 6PCYA 4G72B 2JFCA 2ZWNA 3OQRA 4A68A 3DIVA 1AG6A 3L45A 2I85A 1E67A 3UGEA 3NYKA 4CSPA 4A2EA 1OE1A 3AW5A 4YSCA 4YSQA 5B1KA 4HHGA 1BXAA 3EF4A 5I5IA 1SDDA 5EHFA 3TA4D 1AANA 2MRYA 1KGYE 2FWLB 4KO7A 1UATA 3T6WA 3IN2A 1ASOA 1JERA 2IH9A 2EIMB 1NTDA 2AVFA 2YAPA 2FQGA 3AG4B 1WA1X 3FQ1A 2CUAA 3IN0A 4P5SA 3DKHA 1BXUA 2TSBA 2VMJA 3NJNA 1AZNA 4KNTA 2BZ7A 1L9OA 1W8EA 1AOZA 1BAWA 3AZUA 2RACA 2QT6A 3S8GB 4PAZA 3S8FB 1NWPA 1ILSA 4NB7A 2BWDA 1M9WA 1PF3A 3TBCA 3NSFA 4GP5B 3T6VA 1AS8A 1MG3C 2GC7C 5I28A 1J5CA 1WA0X 3X1GA 3FSAA 3OMAB 4F7KA 1QHQA 1NDTA 3H4FA 5FC9A 5D4IA 4GP8B 2CALA 2P80A 5AZUA 4AKPA 2JXMA 4RH4A 1KDIA 1ZV2A 4A2DA 2XV0A 3UABA 7PCYA 1SDDB 1JXFA 1CUOA 5AFAA 4YSUA 4BK5C 1A4CA 3GYRA 4DP9X 2OV0A 5F7AA 3X1BA 4L0PB 1RCYA 5I6PA 1AR1B 1QLEB 3ZX1A 4P5RA 2FTAA 1HFUA 2YQBA 1I53A 5IY5B 2UX7A
chains in the Genus database with same CATH superfamily
3M17B 2JJTC 4NM4H 3VD3A 2KDGA 5DRXB 3VXSE 2X1WL 3CHOA 4QYOB 2FAUA 4QGTA 3SPHA 5T3XH 3OMIB 1S9VB 2QFRA 2QGCA 3WE6A 2YC1B 3OKOA 5D7EA 1O9ZA 1YMHA 4WU5A 1QASA 4GJTB 3GXDA 4DKFL 3O45A 2ZUYA 5JPMA 3I6LE 4H13C 2O93L 5C9JA 1S9WA 3EO1B 3OLEA 3P9MB 4EE2A 2WK2A 4WWKD 1NZRA 4Y4FD 4AYID 2CHDA 4X9GA 4HVBA 3EYUL 2BNQD 4BSWA 2JXMB 4MA7H 5JXEC 3NIGE 4QRAA 3I3EA 3F7RA 3ESMA 4XMTA 2R0KH 1SBSH 3PP3K 1G7QA 1I9RL 2WKLA 1YEIH 1S7RA 4O02B 3UJIH 1A6WL 1MKFA 3MLZL 4L23A 2EADA 2BX5A 4G9DA 3KGSA 4NQUA 4P9HL 5F88B 1SXNA 3NMEA 2R23B 4RGOH 5DZJA 4Y2OA 1T5XB 2O30A 2Q8BH 4AUJA 1RD6A 2NXYC 3X3GL 4XX5A 4ZSOE 1X9LA 5HGDA 3OWEA 1F2XK 3QO0B 3GT6A 4P9MH 1FFNB 3F2LA 3HHMA 1U91A 3VD1A 1OTSD 3P4MA 2EDEA 3KPLB 3N9GH 4YHKL 2O5YH 2AV1A 3ZT7A 1RU9H 1PYWA 3N3EA 1QD0A 4O2CB 3KXFD 3EJTA 2EKJA 4N20A 3MV8E 4L4TB 2HCZX 4Z18A 1DBBH 3H3KA 4JO2L 3SQOL 4E5XA 4JHVA 4HUCA 1HHKA 2DQFB 1SEQH 3MXVH 4L9LC 4PJFB 2XWRA 4YWGL 5T3ZD 4NPYA 1G9EA 4LPUA 3KWWB 1CCZA 5IJVA 1EDQA 2VN7A 4GQRA 5C0DB 1MJ8H 1DLFH 3TN0D 4QRPD 4E2OA 2E7LA 4Q6IB 1G9MC 2HT3C 2DM3A 2NY0D 2ZIDA 3KL5A 2J73A 4KVCL 1BD2A 1NEPA 2F7OA 5B7FA 1T03H 2H3XC 1JHKH 2PN5A 4S10A 4JAMB 2I9TB 3AGVA 3K4AA 2XA3A 2VMCA 2W81C 1BV8A 1U58B 1NBCA 3DOIA 3KS0J 1IAKB 1U6AH 2HG5B 2WW8A 2DQEH 2UZPA 3S35X 3D08A 4RAVB 3U9UA 4N8CH 1OL0A 2E5EA 3HMWL 2F5AL 1VFBA 4Y19D 1X9UA 2YJLA 1MH5A 4IU3A 2A9MH 4R4FL 5F7YC 1A8ZA 4IBTA 3BHBA 1BYPA 4NWTL 3L1OL 5GRUL 5GGQH 3LIZA 3U9PL 4Z23A 1E5CA 5CIPH 1KXVA 5I74B 2X2JA 4ELMB 4DTGH 4URKA 2HTLC 4PRIE 4PVLA 3F7QA 5I82A 4G6ML 1F0LA 1ET5A 2ESVA 3WIAA 4AH2A 4UYPA 3QI9C 5HBBA 1S5HA 3MRPB 4FNRA 2E7HA 4GBXC 1FSKB 2WVVB 3REVA 4OCLC 7FABH 4KQ3H 1IM3A 3M1BA 3V6ZA 1RUKH 1I8LC 5TE4L 4H0IA 3Q06A 3RNQB 3LS4H 3X13B 1LO3L 1IC7L 4N8PA 4PBVC 1AYRA 4XB7A 4RCAA 5J1AA 3KWXA 2BFGA 1E0OB 1NL0L 5LJYH 3W0WE 4P4RB 1H6TA 1VAHA 4JB9H 3N04A 1T1WB 5ALCL 5GS0C 2W65B 3DDFA 1HKFA 1QBAA 5CD5D 4JRWA 2CIKA 4JREB 4HUUB 5EU6A 2PPCA 2IAMA 4TOYL 3ZL1A 2R29L 2OR9H 2J88H 4MNGB 5A7EA 3V7MA 2FH6A 2PW1B 5IHBA 2M83A 4MXVF 3QUYD 2UWEB 4AYGA 4MA3B 4WFHD 3J7HA 3APCA 1EZLA 4Y9FA 4Y9EA 5EO0A 3L3IB 3H9ZA 3B2UC 3L3HA 4FQLH 5CJ5A 2HT2C 3FTUA 1P6WA 2Q86B 4I89A 1CLCA 5EO9B 3B9AA 2X9ZA 3BKCH 3R0NA 4U31A 3L3OC 4DP4X 3HFMH 4FNQA 4JFUA 3HG3A 5DUPH 3MI6A 2AABL 4X7SH 1K85A 1GR7A 2WXFA 4IIZA 5T1KB 2V2WA 3ULUC 1MZYA 1WAEA 3DYPA 3QJUB 2C8NA 2VXVH 5B4MC 2BIMA 5DK3A 3UZEA 5JHDB 2Q8AL 1MFCH 2PYFA 1B6DA 3IXAB 4PJBE 2YPLD 4M62H 5J12B 4UDTB 1FA4A 1IC4L 2IAAC 4W9EC 1QFUL 2Y7QB 5DI8B 4WFFD 3HHRB 3DOHA 3KG5A 4PV8A 4QY8A 1VDGA 3V9CA 3BEVB 3LCYA 3WXVH 2A83A 4PRNB 1INDL 3UBXG 5B21A 4AZ8B 4B95C 5K9JH 3AM8C 4RFEB 4KQ0A 4P2OD 3R1GL 3VX0A 5JHLH 5BV7H 1MJ7H 5CF3A 3RFZC 2PETA 4QXGH 3VVWA 4GXFA 1CC3A 3X17A 4AZUA 3VI4A 1VPOL 3VG9B 1DBJH 5EV7A 5AW5B 3WBDA 2ICEA 3D09A 5HTSA 4FEMA 2WQRA 4LCWA 3SKMA 4RQQA 3AWGA 4AYBA 4HLZG 3ZUNC 5D96B 3DX8A 3WU1A 3QDHA 2AXGA 2NTSP 1O75A 2NZ9C 5IGXL 2BSED 4Y2DB 4LLMA 1Q94B 3KLLA 4Q97A 3K74B 1UCBL 1KFGA 3QXDA 5IHUH 5EUOA 5LWYL 3ENEA 5FO8B 1WCBA 3ZMRA 2G2RB 2X4SB 3WHE0 5KG9B 1G0XA 1VGEH 2PCPA 1U4EA 2XZAH 3D0LB 2WXKA 1BIIB 3V8CA 5SWSB 4Q0XL 2F19L 3V0EA 1A6UH 3FF8A 3KPRA 4WW2A 4GKSA 4Y88A 3IBEA 3F85A 3GSXB 1JE6A 5J06A 2VDOL 3AMLA 3G08B 3KBHE 4EI5B 3OGCA 3QZOA 3W0WD 5C09D 2OCJA 1NBYB 3PWPA 1KTDA 5DR5H 2E27H 2DQDL 2QPUA 3WN5B 1A7BA 1OAXL 3C2AH 3H9SA 1PNCA 2E7BA 3B9KC 3ZW3A 1Z9SB 2H45A 1MCDA 2A77H 5K1JA 3QUZB 5CGBA 4XNXL 3S96A 4NKIH 2DIEA 2B59A 2IPKA 3VW3L 1T3FA 1D5BB 2VWEC 2BNRD 2PPFA 4NSKB 5BZWA 3KHQA 1XR9B 5J11B 4MS6A 2XPZA 5EWIL 4XCNB 3WL9B 2A6IB 3JWDL 1CLYL 4Z7OF 3EO0B 5HVGB 1R3KA 4M6OH 1OPGH 2J88L 4KKBD 4YNYA 1BQHA 1JPTH 8FABB 4F2ME 1NFDF 4HH9B 2OXGA 3FQXA 4BCZA 4P2QA 4RAUA 3FUEA 1HXKA 5GISH 3MV8D 5DCCA 2F08A 2FHFA 4FS0A 4G7SB 3RIFF 3SDXF 3UCRA 4DERA 4G7RB 5ALCH 3AQDA 1TTUA 5DWUH 4JRYB 4JLRA 1DQLL 3WLBB 4EDXA 1MHPH 4FKKA 2VIRA 2A9NH 4U1IA 2LE9A 2ZOOA 4H25B 4RZCA 5EEVA 3N50A 3ARGC 3CHRA 1ZV5A 1L3NA 3SBPA 4MQ7A 4HPYL 2CHXA 4N25A 2ZCHH 4JVUA 1L6ZA 5E5MA 2WNGA 3O0RH 4P46B 4LPVA 1ZT7B 1A7PH 2P7TA 3QXUA 4N2NA 3RB5A 2P4AB 4WJKB 4YMPA 4ZUSA 1AGFB 2A9CA 4KY1L 4PRHA 4M7ZC 2EABA 3FKUS 1UM5L 1TU2A 5C0GB 4G82A 4WWKA 4NQCA 1OF0A 4JPWH 4MQXC 4QYAA 5TDNB 3FYEB 3F6LA 5DS1A 4IBQA 3IU3B 4EIGB 1A65A 3MMEB 4A7GF 2C7UB 3U9PH 2XIBA 5CR1A 2P5WE 1AR1D 8PAZA 1KBPA 1BQLH 4YGAB 5A2IH 1F90L 4M93B 5BQ7A 1IVTA 1IFHL 2XV2A 2CUIA 1CVRA 3MAWA 1N6QL 5KVFL 4FKEA 1Y6MR 2LLNA 4XO9A 4ABWA 4HBQA 2GJZB 2BS8A 1OK8A 3O3BA 1UB6B 3QI9A 2DJ4A 5AW8B 5CFHA 1A4KB 3QUMA 4L1LA 2EUZA 5HVHC 5MEOB 1T7ZA 2UY7A 2MOGA 4RRPG 4PV9A 4ZO6A 1CLOL 4LHUG 2I9LA 4KKNA 1A3LH 1NGPH 5DHVB 2KPWA 4ODHL 1KXTB 1T4KA 4H20H 3QIBA 2HRHA 4LEBA 2ZKMX 1I1AB 3HAEA 3KYMB 3MLZH 3SDDA 1YMME 1WZKA 3DIVA 3L45A 4WI0B 1MCOL 3F65A 3NOIA 4CN6A 3UAFA 1F6AA 1O0VA 2MPVA 1IBBA 3BUYA 2LFEA 5FYKD 2XKNB 4H1LB 4DO5A 3MJ7A 2NTFA 1OAZL 2VT0A 1KBGH 1AANA 4CMHB 1KGYE 1K8DA 3HE6C 4HWNA 5KVDE 1ETA1 2XQ0A 5LBSL 5C08A 3W38A 1JWUA 2CUAA 3CPUA 4RMUA 3JV6B 1J1PH 1KGUA 5DD1H 5J1TC 3SDCB 3T77B 3U82B 4AV5A 1C16B 2AJZA 1FN4B 4AT6B 4PLJD 4XT1C 5H8DA 4P5TC 5LGHL 4P9ML 4UQ9A 4YC2C 1P9MA 4LVEA 2GY5A 5GZNA 4XNDA 5CN2A 1NCWL 4OJFL 4Z3TA 4NC1C 1JRHH 4AGPA 2JSFA 1MG3C 3T2PA 1EZUA 1H6EA 1OSPL 1E27A 3WDJA 5IOKA 4W9IC 2VAJA 4RX4D 4TTGA 2DYPD 3MJ9L 2WZ5A 1USQA 3RDJA 3ZO0A 5IT2L 1RUPL 5EFIB 2EAEA 3UJIL 1QI4A 2YPLE 3D25A 3WIHA 2V33A 2AJYH 1Q0YH 2AXFB 1CR9L 2N7BA 4JRXE 1NLBH 5TGBB 4HP5A 1HXMB 4FF9A 4JRLA 5CEYB 1CE1L 3MBXL 4X83A 2APSA 5E95B 3LZOA 4E68A 5KWYC 1G7IA 1Z9LA 3MLYH 1DHKA 3GHEL 2WWKT 3RTQA 4BSVB 1BQUA 4BWTA 5HHQB 3QZMA 3FTGA 1TZIB 2X4QA 4WFFE 3QNYB 3L8QA 4IRJA 2XWZA 1QOKA 2VQ4A 4RESB 5EC2A 3AU1B 1QW9A 5DTFA 3MKKA 1A1MA 3VWKC 5J6HB 4NM4L 2HJFB 3B9EA 4N8VG 5LNEA 2P52A 3CXFA 2DM4A 1KXQE 5FOBA 1KN2H 2E9JA 2XWTA 3EAKA 5A3IC 2OMTA 5AAPA 4XBEL 4MGXA 2XZCL 4Z78B 2W9DL 1MRCL 1RJYA 4PG2A 3U0PA 5SWQA 2K6WA 3TO4B 4X6BB 1NEZA 3BE1L 4AQZA 4PJHF 1EANA 4M5ZL 4I77H 3UC2A 3QO1A 1R5IB 2G3ZA 5F3HB 2ATKA 3GSVA 3ZK0A 4X6DF 3HMXH 1ZVSB 3CXHK 1N59B 1ET7A 2C9SA 1J0JA 1SXAA 1RUAH 1ZSHA 2X9XA 1INEH 3LXAA 4PRPE 2OYLA 4PCYA 4MNQD 4HWZA 4XPTH 4CILA 4ZMYA 4JFQB 1N5AB 1Y6NR 5IB1A 4HIIB 4WNQA 3CZFA 3M7OA 5FX3A 4XOAA 1KLGB 1RLWA 3BQUA 1TVBB 2G75B 1A4JB 2Y2YA 4YPGB 5E9DB 4UQ2B 2B14A 3WUWA 3B1TA 1EV2E 4LOUC 4NQED 1TLKA 5CBEA 3V4UH 1OCWH 4FLRA 3KW8A 1P84J 5C7XL 3K6NA 2UUDK 3HUJA 1U8MA 3JWOH 5D7IA 3HRZA 3PP4H 4HJGB 1BJ1J 1GC1H 1YN7B 4GQ9L 4AVIA 4DQOL 5HYJA 3UERA 4UQCA 2BWIA 2AZAA 4HS3A 4HKBB 5E6IA 5L2JA 3BP6B 4JPKL 4ZTPL 4ZBJA 4PJXE 2JIXD 2TRHA 2EO1A 4KHTL 4JFOB 3E2HB 2EINB 4P2OA 4UV7H 1MWAB 2XN9D 4GAGH 4U1NB 3WD5L 1LK3H 3Q8FA 4LRIA 4MFHA 1CR9H 4XR8C 1RJCA 2AJVH 1KIUB 1HU8A 3ME0A 5JO5A 2AEQH 5KVDH 1U8QB 2ITFA 4X6EB 3LKQB 3QUXB 3G6JE 1MHEB 4XE0A 3V4VH 1ZGLM 1BG1A 2G3NA 3DUUB 4M6MH 3QJTB 2A4CA 4CVXA 2BSRB 4C56A 2H32A 3CZSA 2W9LA 3UTSE 2O5XL 4DQOH 4N86A 3WGUB 4HOMA 2IH3A 4PRIB 3RTQC 2JCCE 1H9DA 2RTTA 1BFVL 2WWMD 5J3HD 1FGVH 1HCYA 2G5BA 4DCQA 1M42A 2DMCA 1R19A 3CZKA 1JTTA 1U2HA 3EDFA 3ARXA 3K1DA 3NCXA 1GMIA 2EDKA 4R5TA 4ZUUA 4WI9A 3OXRB 3NSCA 3H42H 2WLIA 1BIHA 5DJXB 2E9IA 3LKOA 4FFZL 4OB5H 4OLUH 4M5TA 1LMIA 1IJNA 1KEGH 4PWKA 2JVUA 1VZGA 3U6XA 3T9WA 5LXGL 5DD3L 4X7TA 2YLKA 1CXFA 1FYTB 1IB5A 1O6VA 2RJMA 4FN0A 5KYWA 3I2CL 4PRDB 5I8CA 5D2LE 1HC1A 4LLUA 3L3GA 3FRPB 3H56A 2YA0A 5JLZB 2VUKA 1A3LL 1MRFH 1NGPL 4EDWH 1MZZA 1WYJA 4JL2A 4NCC1 1T21B 3P4OB 3ISYA 3L3DB 1AR1C 1ZGLB 5AENA 2IALB 4UTAH 4CW1B 3QG6B 3CFKB 4G8AC 4MZRA 4FEIA 2H2PD 4X9HA 3VFMB 4CSZA 4QHNB 3FDWA 1J8HB 3DJSA 1RSYA 1KWGA 4JM2B 1M1XA 2YN3A 3NEEA 3JBG7 4M43H 5FUCE 1A2YA 4XC3H 2WXIA 2LT9A 5AYQA 5BXFB 4PJHE 4XPFL 5I6LA 3EFDH 3L3KB 4FL4B 3QIWD 2J8UB 4ICWA 5DQDH 5D71H 3T1FA 4ZD3H 4YGVB 4ZMAT 1MRDH 1UOVA 5JQIB 1Q90A 5E8OA 2FJHB 3BLKA 1LDPL 3QXAB 3CN3A 1FE8H 1JCKA 3WKYA 3GSOB 1WBYA 3C8HA 1KBWA 1KIRA 2H6UA 3U7YH 4YHYB 5I73C 4X4YB 4BA8A 5IV2B 1G6RA 2XRAL 1GYCA 1PG7L 3MR9B 4LSSH 3VTAA 1EGJL 2E74C 2YUVA 5D6CB 1BBJB 3RI5F 3ARGB 2I24N 3NSYA 5ACLA 1A7PL 3IMRA 3ASOB 3J8F7 3D5OF 1Q0YL 2DL9A 3IJYB 3TBYA 3F62A 2J21A 3NP4A 2NXYD 4ZPVB 4L29A 3TXAA 1ZS2A 4UNVA 2IPTH 1CDBA 4W4OA 3MJWA 4WU7B 2NRDA 4B9KC 1ZSDA 4PP2A 3FRPG 2B9AA 4WW2C 2P3YA 2BJMH 2E9BA 3GRBA 4MJIA 5KSBA 3CUPA 1HI6A 3PGFL 3ZIMA 2WHVA 3SJVB 4WV1B 4HPOH 4JPIA 3ETTA 2VLJA 3PQYA 3PDOA 1UJ3B 2H9GA 2PTTA 3GUTB 1X7QB 1P9MC 3EJRA 4LLQA 5I1AA 1OW0A 1HH6B 3IDIA 2A0LC 5LGHH 5EZJB 5HDBB 1MFAL 3VJ6A 5G55A 3VXME 1MF2L 4V33A 1AXSA 4HH8A 1QATA 1CDIA 3B2VH 4PJAA 3WOVA 2PXYB 1FZOB 2EXWC 4P5KA 3FT3B 5DLLA 1CFNB 1QUNA 1I8KA 5DD0L 1H8NA 4L0ZA 1NEZG 2WYIA 2I25N 5KJ4A 1QLRA 4PJXB 4F3FA 4ICXA 3AADB 3ML8A 3ZE1E 1MCOH 2A77L 2BVUA 3EFFA 3MRLB 5HD8C 3F64A 2XTSA 1BM3H 4LEOA 1F00I 1PY0A 2Z93A 2DKSA 2VUYA 2V6HA 2ZWKA 4BZ2A 4I87A 2QSCL 2B1OA 1GYWA 2WKOF 2Y1VA 3NIFE 4MCYB 1GCFA 3T3MB 3V5HA 4PRPD 3FU0A 2J5WA 1Q1JH 2NX5B 3EZ8A 3Q3GA 4PJFF 3HW7A 3EYFB 3OC8A 5IBUG 4X80H 4BFEA 3KM2A 3WTUA 4P07A 4V11A 1KYOK 2L7QA 4LOVA 4GXVH 4DAGH 1VGEL 3PWUA 1JTPA 3QWRA 1V3MA 1FVEA 5F0MB 2NNAB 3BCFA 1XSIA 5TQ2L 1URIA 3A5VA 5KVFH 2QQLL 4OCSL 4Y16A 5T1MB 3NDZE 1UCBH 2VQ1B 3TFBA 3NJKA 3FMGH 4PJDB 2J43A 1CZ8L 3HUJE 3VRLE 3FQUA 4KUCD 3RFRA 5LXVA 4ZFFA 5I6KA 4QHPA 4I1RA 2EDDA 1N3NA 4ONHB 3HE6B 4G1MA 4G6FB 4DO6A 4F93B 3DI2B 1ZIBA 4KQ4H 2Z31B 4DKEL 4JHAL 4S2SA 4IBVA 3BVVA 3OHMB 3FB6A 2C4FU 4U3SB 1S7TA 1Z5HA 2Y07L 3F7YA 3WI9A 5FECA 1T7VA 3BKJH 1HZKA 3PIQB 4JDEB 2EE0A 3S2CA 4G71B 5GS1C 2NNCA 1KTLB 5LGKA 3FUNA 4OIBA 1KCLA 2NNRA 4TULL 1AR2A 4F8OA 3TA3D 1XCTA 5I1HL 2AQNA 4EN3A 1JRHI 1JVKA 5DFAA 3UTTA 4NUJB 4X6FA 4LQ1A 4EOWL 5SX5H 5HGHB 4PTUB 2RMNA 5GGSA 1OP9A 1ZLUK 4B0MB 3BWSA 1RIUH 4K2UL 4ZUWA 2HRLA 5AVXB 1OCRB 4NN5B 2UZYB 4MAYB 5JIKA 3TO2A 2WLLA 2VDKH 3K1KC 3HC4L 1SXBA 3F58H 4KZ0A 2JI3A 4U1KB 4QHMB 3JWDH 3ZE2B 4ORGA 1DQJB 3TIEB 5DSCB 4AQAB 3Q8AA 3OAUH 3ABGA 1Y6KR 3QQDA 4RDQG 3SBQA 3GSNH 3TV8A 5FYLH 2CO4A 5JW3H 1CI3M 4OZIE 3SDAB 1EBPA 4HG4K 1KCVL 43C9A 2NY4D 1H19A 3GZQA 3DGCR 4PGEA 4N0YH 4UTCA 2VLRA 1B3JA 1BQHG 2FWUA 3MCKB 4A1RA 1PD6A 2YO3A 3TX4A 1J1OL 2E3VA 3PAYA 4FHBD 3BCDA 4K5LA 4Z7WA 2A6JB 4ELDA 3S34H 3QAQA 1TDQA 3BKYH 4WF7A 3MLRH 5HPMB 2V5SA 3K71A 5ACZB 1KCBA 2WWMC 3LX9A 4I18A 5E70A 2FT6A 4LHJB 1BEYH 5DVOA 4S1SL 2FATL 4GRLD 4NQEA 3TFKC 4PR5A 4ZAKC 4I0PD 5D5MA 5D1QB 1NKOA 2NDFA 3MGTA 1HHJA 1JFHA 4AGOA 3QISA 2ITDB 3ARUA 4HHGA 4UNUA 3TYFA 1VSCA 2ZNXA 2BNQE 4YDLC 1XX9C 1YUKB 2NYZA 1N8OE 1S9XA 1WBZB 1RJZB 1NTDA 3AABA 4FTVA 3LSOA 3BKJL 4X6DE 4LLVA 1F02I 3Q2CA 3GDBA 3NN8A 5CN3A 4IHBA 4X0KB 3GO1L 1WFMA 1DBJL 5JIPA 4HWBA 2ZXBA 1B90A 2JNZA 1BAWA 5F96H 4HZLB 1NCIA 1XDTT 2BNQA 3MRQA 4PP1D 4YHOL 2XBTA 4KQ4L 2BOBA 3RPBA 2H32H 1IM9B 3FOLA 5D1XC 1FZKB 3RZCC 3SDCC 3DPBA 3B8YA 4WI5A 3L1OH 2GUOB 1INQA 4NKOB 5GRUH 4CADA 1DDHA 3TESA 3QIUB 3TBSB 5CXPA 1DQDL 3NAAL 4KKAC 4MB1A 1LGVA 1N64H 1U8LB 3D34A 3PP3H 4NEHB 4OKDA 4IK6A 4J4PC 4M7LT 3VCLB 3NFPB 2FCBA 4AJ0A 1MCKA 2VLLB 3QR0A 1XL4A 1GH7A 2IANA 2OKMA 4G43B 4HX1A 5F0LB 2E4FA 2EDOA 3GI9H 3AXLA 3VFRA 4A2DA 2NW3A 3GMLA 3ARBD 5EBWA 1IFRA 1KFAL 5AVWB 3GSNB 1WTGT 4WHCA 2ENJA 3GPSA 3BAEH 3VXNA 5E51A 1RCYA 3DUSA 1IGYB 1ZOXA 1I8MB 2EIBA 1XH3B 2MHAA 3RX5A 2BRQA 5DMKB 2XPGA 5EZOH 5AOZA 4OCYH 1PAMA 3UC0L 4KX9A 2ZD0A 4N0UA 2V9RA 1IEBA 5IY5B 2QHRH 4JEGB 1HX0A 2EIKB 4APQD 2E9WA 1OTUC 4HK3N 3OJ2C 4AQEA 2EECA 4UINL 5AKRA 5BUGA 1C5BL 1JK9B 4GT0A 3IWUA 2XG5B 5IB3B 4QXVA 3FZUD 1S5IH 3UTSD 2F53B 4JFFB 4PJ7F 5A6LA 1E5ZA 1WH0A 4E9WA 3O41A 4XXCA 4ALAL 3O3DB 3DVGB 2OMYA 4FAAB 3TN0A 5DJ6B 4Y7MA 3LNEA 5C0AD 3T4YB 4EMZA 4S1RL 2OR9L 3VGBA 1PZAA 4OCMC 5CZXD 4HZ1A 3ABKB 4GKZB 1B0IA 4HF5L 1Z5LA 2HP4A 5ID0A 5GS2H 1U8IA 2XETA 4ZFOL 3NFNB 4FQXD 4PEEA 5CLXA 1EQWA 3TBVB 3NJVA 2XXMB 4X6CB 5DRWB 3GM8A 5JHBA 4RBPK 2PPAA 5KTEH 1IC7H 1I9RH 2C3VB 3E9UA 3L3OB 2N0MA 3D52A 5ICYA 3EH2A 1S9VA 1YY9D 5CNHA 2QGEA 3EH4B 3EYUH 3U1SL 2P5WB 3M1OA 4JKLA 4WTWA 3S4SB 3WEOA 5F7KC 5C0CB 3WJJC 1QSFB 5KOVC 4PJBF 2DWSA 4AQ8A 5E6SB 1B4RA 2BHZA 3GMQA 4HIEA 3C60B 5DZNA 5F7WC 4ZJ9A 5KYXB 3RDTD 3D9AH 5DD6A 3B37A 1DVFA 4XVSL 1G7QB 1WGOA 5IEKB 5JW4R 1YC8A 1AZVA 4MB4A 4XC3L 4GS7B 1ZLDA 2VMDA 3AB0C 4LRNH 4JFEE 2F5BL 5E2VH 2Q6WA 4UYQA 3S5YA 2KT6A 2DQEL 5DYFA 3SPGA 2AQQA 5FWRA 3GMPB 2ITCB 4LSUH 3ECBA 3FN9A 5LBSA 4UQ3B 1YLBB 4QHKJ 2IAMD 4JM2F 4IJTA 3ZZ1A 1GJIA 4BUHA 4Z7VA 4MAYC 1FFNA 1ADQL 4YZWA 4LLDA 4NZTH 5KYNA 1K5NB 4K3DL 1SVZA 1BX2B 2AV1B 5LBGA 4YZFE 1JWSA 1X5MA 1EERB 1HQRA 1TR7A 4TKWA 4WI3A 1A7RL 2E47A 4S11A 4MZIA 1R3JB 4J39A 4UILL 2YAFA 5C0NC 1ZCRA 2FNWA 1HHKB 2DQFA 5ERWA 1AE6L 2MTAA 4CDGC 4PJFA 4JO2H 3ZRFC 2O61B 3MBEC 4OY9A 1TJGH 2WINB 1WT5A 3LOWA 4IK7A 4P5MB 4DFIA 1JV2B 2QKIC 4NQDE 3VFGL 1NC4B 1UFGA 4H5SB 4L9LA 1M2VA 3Q7JA 1B2WL 1RZGB 1NFDE 5ENWA 5I2IB 1XF2B 4AQ1B 3E1ZA 4GW5B 4PJFE 2DICA 1AI1H 1O7DE 4Y9CA 5MHSD 1RZKC 2IVFC 5DZOA 4HUVB 4F33A 4NAQA 3CVIL 2MQ3A 4R0LA 1KV3A 1B0WA 1LYQA 3VWJD 1OXYA 3MRGA 3MRJA 3D51A 2IMMA 3DVFA 3I3BA 1I1RA 3MLPA 3BSZL 3V6FB 4AV0A 2IXQA 1I7RB 2P1YA 1M6UA 1UZ8A 2O5XH 1G0DA 4RAVA 5F71A 3VFSB 2WYZA 5C0FA 1YPZE 3HE7C 1RJLB 2CZNA 1A6WH 2E9GA 3L6FA 1YEIL 2Z1KA 5KBMA 1JYVA 4YDIH 3INOA 3ZL2A 2OSYA 4YQXL 4HKZA 5T3ZE 2XWBA 4NZDA 4G5ZL 4C83B 3MRNA 1CFBA 2GBAA 1WK0A 1VFAA 2LHAA 3LPGA 4OGXH 1SHXA 2ADIA 3O3UN 1DQML 1R0AH 4LDOB 1T1XA 4U3HA 5FYJE 1FVCA 2ESVB 3MLXH 2ZXGA 3NIFF 2VAAB 1TYRA 3MRPA 5C8JB 4JNXA 4ODVL 1FPTL 2RCSH 3CSBA 3GRWL 4ZRGA 1IM3B 4L1TA 2X53A 5EEZA 4L37B 4E42B 3JWOL 2PTUA 4AITA 2R1WA 3BPNB 1VEPA 4YX2H 4E41D 3GHBH 4CU7A 3TFKD 2PF6A 5B1JA 3ZQWA 3CHPA 1A9EA 4PJBB 4ZAKD 4K5NA 2CD0A 2OL3H 1D2PA 3HI1A 4GG6F 1CURA 2HTKD 4OZFA 1X3DA 5GIRA 2PWHA 1N0LA 4GB9A 2R8SH 4GAJH 1Z6JT 1D6EA 4DPAX 2OTUA 3CN1A 3GKWL 3K0WA 3QCTH 3MNZB 5T1DL 4F7EB 3RVTC 2BY1A 2R56H 4CN1A 4JFXA 3C6LC 3H9SD 3FS9A 3EGSB 3ALXA 5F9JB 5A40E 1AQDB 1VKXB 2VC2B 1QQDA 5I8EB 2ZUQC 2PW1A 1E4KC 4JY5L 1JYNA 4U6HA 4MA3A 1MVUA 5HJGA 2VTFA 2UYLB 2XIDA 3WYRA 3EJCA 3K91A 4IKIA 4LOUD 5C0CE 2XSKA 5EEYA 4GBXA 1HZHL 3C5ZD 4NFCA 4Y5XB 3GIVB 4PJGF 4MXVE 1AS7A 1WA2X 2DWDA 4I2XE 3WE1A 3GMMB 1PU0A 5AKTA 3G6DH 1T04B 3JTSB 3QWQB 4YBHA 3QZWA 1EJFA 5ANMB 4AEHH 3S97C 4IKNA 4PRBB 5I23A 3THMH 2AMGA 3UGXA 2XNAA 3TNNB 5BRQA 2LABA 3H7BA 2F7IA 3KEHA 5LDUA 1XIWA 1CMOA 3T3PF 1U3HC 5I0DA 3TZVC 1HL8A 5L4IA 4N0RA 1A4BA 1FIGL 4G6KL 2P42B 1ZAGA 3DXAD 2WB1A 1ZK5A 3IGUA 4X5RA 4X4KA 3MLYL 5E94B 1XGTA 1HNFA 4XVUC 1OTUD 2A83B 3ZHFA 2DV6A 4UT7H 5CCJA 4AL8C 1GTNA 4IOFD 2VZ3A 2NY3D 4RFEA 4R97C 5DUML 1L4IA 3F7VB 5DMJB 1PVHA 1IZKA 4K7PH 3U6RA 2QADC 5F3BB 1ADWA 2PR4L 2XVLA 5IT2H 3K72A 3PE9A 5C6TH 4G8EB 2X2YA 4LVNB 2CKBA 4XO4A 2CHZA 1IAOB 5E6RB 2VO8A 5FM5M 5L6YH 2IMNA 2GG1A 4OJYA 4TVUA 4ZMLA 3NESA 1NCWH 3MACL 5J7CC 5CO1A 3EZJB 2GIMA 5CZRA 2YPVA 3E80A 4LHUA 3RX7A 1G7LB 1HH9B 1ZVHA 1CF8H 1OB1A 3MV9D 4QIRA 2PCPB 5B1JC 3VFVB 3DGDA 2ZSWA 3DMMC 4IGBB 1MFMA 5GZOA 3WAKA 2DQJL 3GB7B 3KYNA 3G08A 2UXTA 4M48L 4EI5A 5BUPA 4X5WB 5GGVH 1I1FB 1MG2C 4KKLC 2FGZA 2QKIA 3U0TB 2COVD 1JF6A 3AG3B 3DSNB 1XH2A 3QEHB 4OZHB 1EZVX 1ASQA 1O7VA 1BFOA 1AMYA 3GMOA 3HA0A 4R26L 5DZLA 1L0QA 1Z7JA 1ZHKB 2YSSB 3G5YB 4NFBA 4MNQE 3BESR 4JUTA 3GSRA 4ODHH 5ITBH 1IRAY 2KLSA 4JN2B 1N8ZB 5A16B 5I8KH 5MERA 4GAFB 1T6WA 1XXDC 4TV3A 3TF4A 1QX1A 3WL9A 4YX2L 5E6IC 2J8UE 3DHJA 3QDJD 4KTDH 1ZA6B 1QI5A 4AEIL 3HE7A 4FA6A 3QULA 4YNYB 3IMVA 1B4TA 3T09A 1S2EA 2NQ3A 4FG4A 4HUWB 4LCWE 4FQXA 1F4YH 3C9NA 3L4TA 4UZGA 1NCDH 2BO0A 1RULH 3L7EA 3QDMB 4LMQI 5I18H 3QQXA 5CEZL 4U1GB 2ATPB 1UT1A 3EF7A 1W15A 2W1NA 2VDQL 1T0MA 2Y06H 4DKDC 1HJCA 4GG6E 5HGAA 3LYRA 5HDOA 1WZLA 4MS8D 1ZT4B 1FP5A 4HW6A 5FB8A 2ZAIA 3QPQD 1AOHA 1BZEA 1XAUA 1XR8B 1K72A 1YMMB 4NNXA 1G7JB 4YQXH 1KF9B 3Q5TA 3RURA 1RXLA 1SVCP 3QCUH 3EGDA 2DM2A 3ROOB 5EF1A 3LQZA 2OSLB 3C8DA 1RH8A 4HIHA 2V0AA 1GKEA 2W95A 3IDNA 5D93C 4NQCB 1T20A 3ZO9A 5T1JA 1OANA 5TDNA 4LCCA 3UH8A 4LDCA 5IW6B 4L2LA 4OQTA 4XCCH 2A1WH 1MCWM 1WFTA 4N5ED 1XH0A 2A9NL 3ZTNH 5B3JE 4IMKA 3I3DA 1FNGB 1EAPB 4PCKA 1TZGL 4RZKA 1KXHA 1FL3A 1OIOA 1JXKA 2X89A 2A6DB 1ASOA 2NR6C 3E1F1 4N22A 1AZZC 2OTPA 2V2XA 1MCLA 4MCZB 5TD4A 3X11B 4AW7A 5CCGE 2AQTA 4P5SA 3RWHA 5JIIA 4KNTA 1S7QB 2JKJA 2CG9X 1UWXH 2BZ7A 1JNHA 2GJZA 4HCRA 1CICB 4JFED 1ZS8A 3VFPA 1JNNH 4M6OL 4FLHA 1A4KA 3QUMB 2UUDH 5EU3A 5FK9B 4JFWA 2CRIA 2ALAA 4NUMA 4XHJC 4DGVH 3EGXA 3UYOD 1K3IA 2IQAB 1U8JB 5LCVH 5DQJA 4FYQA 4MDJA 4LAQL 2C1OA 5HJ3B 3ESNA 4N28A 4NN6B 5FYKH 1QHOA 4M8VA 3KYMA 5F6HI 3H4FA 4Y8AA 1P4BL 1D5IH 5ABDE 3R8BB 2CNZA 2JELL 3C8KA 1A66A 2MWCA 4WWNA 1M3IA 4PGDB 2WTPA 1I85A 2XIIA 3UO1H 3VI3F 2KYIA 4F58H 2EIZB 1UKSA 1SPDA 3D39D 1K8DB 1UB5A 2NZ9D 3Q1SL 5C08B 3LZPA 2NUTB 5DJCA 2ZKHL 4NQDD 2K3HA 2FX7H 4N3TA 4MD5B 3EADA 3STZB 2UX7A 1ZTXE 4DGIH 5D70H 3O9WB 4IMKC 1OGAE 4OJCA 2XQBL 1T83C 4DHLA 1ERNA 3K2IA 3IBOA 3K4ZA 1KJ2L 2HTKC 5DHYA 3MRHB 4A2FA 4JUSA 4P48A 4YHNB 3PABB 2B16A 3VFTB 3EJYD 3QDAA 5CLWA 3FPYA 4L05A 2XACC 2AJUH 2HVKA 2AK4A 4LGSB 1XL6A 2WBJA 1QWHA 1E9PA 4JQIA 4L8CB 2ZT9C 4X9IA 3GNMH 4OJAA 3DK2A 5IK3B 3ZYZA 4ETYA 2ZJSH 1TEFA 4ODXB 1NJ9B 4CMMB 3GLAA 5JYLA 2VITB 1TT6A 2VRQA 4YO0B 3RILA 1BVZA 5HHOB 2BMKA 4H8UA 3QH3B 2QPDB 1INDH 1T1YA 2YAMA 2X70A 5DJYA 3RFZA 2X7LA 3SGJA 3UX9B 5DUBA 2OI9C 4AQ1C 1G7IB 1WZ1H 3AM8A 5DJ8A 5EG6C 3GZPA 5F1IB 3RGVD 2YIHA 3CNKA 1NOAA 1P7QA 4O00A 2IOIA 4O02L 1MFCL 4IMLA 5FO9A 3G5ZB 4JDZB 4ZI8A 1DEDA 3KJ4B 1N12A 1E3ZA 3SE4C 4OH2A 1PKQB 2X3BA 4ZAKA 5EO1A 4UU9A 4RFOH 4OZIB 4HUNB 1C08A 2QZ5A 5D2NC 5EOCL 3L2NA 4JFZH 2OMTB 4RRPA 1X4YA 2FWOB 3COOA 3ZHNA 5L0QB 2X40A 4QHUB 4U6XB 1RJYB 2DMHA 1T6VN 3RJQB 5I16A 3MLTA 4U1JB 4QJ5B 2MNJB 6PAZA 5DJ2B 3QBTB 3WIIL 5JOPE 5F3HA 3U46A 1B6UA 1LM8V 1ZLEA 4JN1L 1DJZA 1F4WL 1AIFA 3BFOA 3Q13A 1J9RA 4U4IA 4NO3A 4XNQA 1XEUA 4NC1E 4UQBA 3WFEL 1X9RA 1SJMA 5FGBA 4ZQKA 3EG9B 4KHXL 4LKXA 5I76A 4FZ8H 1ZLSH 5IB1B 4ODUB 3MUGB 5A3ID 4PW3A 4Q9RL 5AYUL 1KYAA 2DY2A 1BVNP 3X1NA 3C08L 3MV11 2OMUA 3CH8A 1EXHA 4NZUH 2D0GA 3CBRA 3PGCA 2CRZA 4PW9A 3SODB 5I30L 2NY1D 1SJHB 3CCHA 3VE0B 1QSZA 2WXNA 3NJJA 3ULSB 1JZHA 2EE3A 3MA7A 5JW4N 2H3NA 1LO3H 1LXMA 2OP4L 3ATEA 3ESUF 4TXVB 4Q9CA 1I8LA 1U93B 4JGUA 1R24B 5HYJB 4LL9A 3EDJA 4F37K 3QJSB 3UZVA 1BVOA 2R2BB 5EZLB 3LD8B 4LF3B 3LH2H 1IV8A 3QJOA 3TEWA 2EQDA 4HV8A 4Y1SA 4ZFOA 4Z77A 1KCWA 2DLFL 3KW7A 4PYGA 4MA8H 2CRYA 5FDWA 1O9WA 4JHWH 2BP8B 1RZIB 2JKSA 1A6VL 3IPBA 2OMWA 5D2LB 5ICUA 3UP1A 3V4PL 3VXRB 2VR7A 1YNTB 1RHHB 2VLKD 3WIFB 4D3CH 3KDPB 4LSPH 5JIDA 3STLA 1OY3B 4R4FH 1RFDH 5J11C 2X4OA 1MHEA 1PX8A 4YHLL 3DUUA 1QLFA 2LLGA 3DHPA 3QEQA 3VNYA 1RPUA 2A7BA 4XC1L 2JQMA 4C56B 3HOGA 4CNIB 4GSDL 4FG6C 4Z7QE 2IH3B 2WNKA 3EUUA 4N8VB 5BZZA 5E99H 1C8PA 2Y2TA 1JZGA 2X4NB 5B38A 2CJUL 1Z2KA 4KJPD 3QEUA 5KBKA 5CEZD 5B1AB 4KZDL 3RUGF 3BH8A 5J89A 3G5VA 3CXHJ 1PX3A 2YSTA 1E28B 1R34A 1U8NB 3I85A 2WBJC 3IYLW 1ILUA 2GI7A 5JW3L 4M8RA 2P9RA 2Z35B 2BNUB 1OOAA 4RMVA 1H3PL 2AEPH 2QHLA 4NRZB 4WUUA 5DK2A 5CCKL 4JPQA 3ZUCA 2ZCZA 1H3WM 1NDGB 4MJJA 1PDKB 2VDKL 4LEEA 5C0BB 1UQSB 2FLRT 5DEZA 2V4LA 1FYTA 3ATBA 3GIZL 3P73B 2HFTA 3PF2A 3ULVC 1J0YA 1CBVL 4OT1L 4K2UH 4PVBA 4ZMTA 3DROA 1HEZA 2BFVH 4R8WH 1U95A 3T0VA 2Y3AA 3FO1A 2XWEA 2DQUL 4HWEL 1BYOA 1MQKL 5HYEA 4YE4H 1F3JA 4GW4A 1TVHB 3QUKA 4B41A 5IF0A 3P4OA 4DEPB 1JTOA 4HWBL 1AGCA 2M1KA 4LVHB 4M61B 1RIVH 4PJDF 4E9XA 3Q6GH 3UPRA 2EDWA 1QWNA 3ZDXB 3X1FA 3VFMA 5EN2A 1BMGA 1YEGL 2OCCB 2JB6A 3UOAB 3ZLQC 3QQ4B 3L9RA 2GIYA 3VSVA 4R4ND 2AJ3B 4JG1L 1PLGH 1A1NA 1TCRA 1U8OA 1Z9MA 1BLIA 3C09C 5T5FL 4PMEA 5DVPA 3IDJB 3AAZA 4OI8A 4ZXBA 1SBSL 1J1XH 3QRGH 3HEIB 5TF1H 5IVZA 1QBBA 2E76C 5J12C 3UTPE 3JVFC 3KPNB 1J8HE 1EFXD 2BINA 2A74A 5DHDA 5E8OB 2R2EA 2HZHA 3RG1C 1JHTB 1JAEA 4R7DB 2AFNA 4F37F 3OGOE 4DF9A 1JOIA 1WO2A 3DVNA 1HT6A 4F8TA 3LN5B 4HHWA 1J1XL 5AW0B 2JQZA 3VVVA 2XWXA 3PWVB 5D6CA 2PCYA 3A22A 1I7TA 2X4PA 3FFCA 4MKTA 1JV5A 1QZ1A 2Y3NA 3S3DB 1XH1A 2H6PB 4J3OG 3OR7A 3SYPA 2DEXX 3OJVC 1FL5A 2HLFD 1TQUA 3ASWA 2J55A 4WO4D 4XWGH 3BAWA 4WU7A 3I9PA 4QXTA 1RZ8A 2V3DA 1AG0A 5J9PA 1TEGA 2VLKE 1FYTE 3SJVA 1KGJA 1OP3K 5EEUA 2VLJB 1MCPL 4JM0A 3EYSH 3N44F 4FGMA 4ZNCD 3V4PA 2XUWA 2IG2L 1X7QA 4P57B 5E6YA 4OT1H 4R26H 4M7ZB 5HJDA 1HH6A 3SB3A 3L9EA 1BZ7A 3VXUB 1NCOA 1T2QL 5GS0D 4WAFA 3D1MC 2DDQL 4IRJC 4QYOA 2VMEA 3FQTB 2GABA 3WFHA 2H41A 5ISZE 2YMTA 1S7XB 4PJAB 2N56A 1TQTA 2ED9A 3OKOB 3MGAA 3MNVA 1FZOA 4JCLA 2HRPL 3L81A 4KJQD 4UB0H 4AQ8C 1L7IH 2VJ8A 2IFFL 3AT8A 4PG9B 1O7DC 1S9WB 35C8H 3DSFL 4PJAF 2K1MA 2DD8L 4BSWB 4NX0A 2NY3C 1LO2H 4I88A 5JORB 3US9A 1QRNE 4YSEA 5DEFB 4FCAA 2ITEA 3D39A 5LVEA 2UV3A 2F7PA 4JFDA 1JGVH 2ZUQB 3IU4L 4POUB 3Q3GB 2ZWZA 3KLAA 4ONOA 2RALA 4PJ8D 1LE9B 2V7NB 2GTZA 2LAAA 5FYLD 5I1GH 4OTXL 3VSUA 5F0PB 2VR5A 3QAZC 4QUOA 5E4EC 1ETZA 4D0DB 4V1DD 4N2KA 4GSRA 1U91B 5I66A 1ZTMA 4XMLL 5K9KA 4TSBH 4PJDA 3II2A 4JK0D 1I9EA 2X88A 4FOMA 1PYWB 2DS4A 3DETD 4JHWL 1Y1UA 2R39A 3VD4A 4RWHA 4L4TA 4QRTB 4YXKL 2ICCA 1KNOB 2EVJA 3PWPD 1CWVA 2HT3D 3P69A 4N0UE 4BH7A 5IQ7H 4JFSA 3K6SB 3LTVA 3IKCA 2EH7H 2VM9A 4XPFH 2EACA 4P2OC 3RY6A 4N6QA 5E00B 4M43L 3GXNA 2HT4D 4MJ6B 4EIZC 5I6NA 2QBWA 2AK4E 1F1GA 1O5DT 5ECGA 2GJJA 1HN1A 4LSVH 4PS3A 4DN4H 2FHCA 3SHSA 1PAZA 1T0NB 4TLSA 4PI0A 1BD2B 1JUFA 4LSTH 4HIJA 2Y36L 4UANA 4D8PA 4X99B 2R15A 3PJSA 1UA7A 3PL6C 1VEOA 4LCUB 2I9TA 4Z9KB 4GFXA 4EN3B 3GSUA 4MAZA 5D4JA 2J20A 4NDMA 1ACZA 1SJXA 1ZHNB 5I0ZA 2N1TE 4FFVD 5GGSB 4WI8A 3DIFB 2WM0A 1X44A 3CFUA 3KEDA 3ZIYA 2YR3A 4B9JA 1MH5B 4IU3B 5C97A 5DD3H 2KLTA 2O72A 3ETBF 3U48A 4IBSA 1EA9C 4ORGB 3GJFA 4A2EA 1HNGA 1PZ5A 3KYOA 5AVYB 1RK7A 4OB5L 5FUZH 3NK4A 5F7MC 5BW7A 4G7VH 2LVEA 4KUZH 3SDAA 3P9LA 1XGRA 4AH2B 1JGDB 1JERA 4FI8A 4TRPL 1AHKA 1WA1X 4TSAL 2V3EA 4PJ8C 4LPCA 3IDXH 2R1XA 3ARQA 4XNZC 3KWUA 1K4DA 1TENA 1U3HD 4PSPA 4QMEA 4YLQT 3ZTJH 1UWEL 5T3XD 2ZTBA 3S8GB 5IG7A 2XTJB 1IC5L 2AMUA 1BBDH 3HNVH 4U1HA 3ULAB 3ARWA 1DQQB 1MCIA 3U6XS 3VFOB 3RWGA 1HDMA 1I75A 3ULVF 4LFHD 1DVYA 3HC3H 4PGCA 1WBXA 5DMYA 1H0DB 5ID1B 3PWJA 3O8XB 4I18C 3VRIB 4GT7A 4BQ6A 4L3EB 4DT2A 2VQUA 3DX7B 5FO7A 4BFJA 5I73B 4P8QA 1DP0A 1NA8A 5F70A 3SE8L 4AV4A 4JY6A 1S7SA 3DBXB 4OLVH 4X42A 3ULUE 4BK5C 1FL6A 2HT4C 4M7LL 3GYRA 1WBZA 2A6KA 1EXGA 5C3LD 1RJZA 4FTVB 3VWKB 4PJ9D 3T08A 5I6PA 3VXSB 5I19L 4YHZH 2DB8A 1RVFL 3LNGA 5DJAA 1BYNA 1I1YA 1T22A 3IFNL 5EUOE 2R27A 4AVJA 3EW3B 1TUPA 3BD4A 2BNQB 3MRQB 4E41E 1A7NH 4BFFA 3GSWA 4DZ8B 4F24A 5I6OA 4Y1AB 3RDTA 1I3RA 5DJZB 1WF5A 5J5EA 3C2SA 1INQB 4NKOA 1DN0A 4DGIL 1UM4L 4J7RA 2Y5QA 3V9FA 3HR5A 3T6XA 3U0WH 2N59A 5T1KA 2FX7L 4M56A 4GI6A 5ILTL 2XQYK 4G42A 5DJDB 2CLRA 4HLJA 4PWIA 1S9YB 3VCLA 3R06A 2GJ6D 1DUYB 2XC8A 3N85H 5E9AA 2G4EA 2UXVA 1A5FL 3D85D 4FFZA 3IXAA 4X6CE 4ZOCA 4AXWB 3IDUA 6FABL 5JQHC 2NW3B 5F44A 5DVKA 4Z3IA 4IRSD 4XTRC 1E9OB 3CC5B 3RZWA 2DYSB 3FCSA 1CG9B 5E8DL 1IGYA 5E5UB 1JZEA 3MLVL 1IGIL 4WK4B 1IX2A 1XH3A 2DQCH 2MHAB 2PTVA 4R90H 4B96A 1A02N 1VJSA 4XPBL 5LGJA 2B1AH 1IEBB 1IIKA 4WUUD 3B2DC 2XYCA 4PD4K 5E8DH 3WUWG 2WQSA 3W9EA 5AOJA 3UAEA 1M9SA 1WWBX 1HL5A 1OGAA 4YSTA 2CQVA 1X5AA 1IGCL 1UENA 3ILPA 2MKWA 2W9DH 3K8KA 2XG5A 1FYTD 4MZ2A 5DT1H 5EU5B 1WEJH 3LMJL 3Q44A 4QWWD 3T6ZA 3UBGA 4LCWB 4LQFL 3SKMB 1GS6X 3SO3B 3VXOA 2F0CA 1KB9K 1WIUA 3O41B 1W9XA 4FMKA 4GSXA 4AOFA 2HMID 1GGCL 2M26A 4PTTA 3TN0B 2E4TA 4M1GH 5BS0A 3BPCA 1Q94A 3QYMA 3IFOB 4PY8I 1BF2A 2FLBT 4EUPG 4JGNA 1X5GA 3MYJA 3D9AL 5FV2A 1NICA 3BDYH 3RGVC 5FO8A 1UZ6F 1KEML 1FJ1A 4GW1B 3ZTNL 5KG9A 1MOEA 5LUMA 3WKML 2IOMA 3EJZC 5K1VA 4N6RA 3CBKB 5GRJL 5SWSA 3LHPL 3KDMB 4XPGL 1YEDB 1BQ5A 3U1SH 4N2BA 4MD0A 3P0VL 4YFEA 2ZQKA 5T8IA 1TCMA 3ERXA 1NC2B 1KIQB 1KJMB 1NINA 2EC9T 1H3TA 4XN4A 5IMKB 3TJHD 4JHZA 1QFHA 3ISRA 3TLRA 1YY8B 3FO9B 3QUZA 2B1HL 1UXSB 2J8OA 4J3OD 2WXMA 4P5TD 4PJGE 3CZUB 4LIQE 5HP5A 2FB4L 3G6JF 4HJ0C 4M1DH 3S4SA 3T8VA 3VXMA 1OHZA 1FQ9C 2BSEA 3Q2VA 2HVJA 2PO6B 4P4KD 3MLSH 3E6HB 4ZX6A 3SIKA 5FF6A 5KYYB 1R3KB 3M8OL 2HRGA 4BGLA 2F54E 2CKBL 4ADIA 5FM4A 4S1RH 1D5ZA 1LO5A 1J1PL 5DD1L 2XFXA 1XGPB 2GJPA 2RIKA 3DO4A 3R7RA 2FX9H 1KGIA 4KI5D 4YH6A 3SJVD 5C1MB 2ZOTA 4R2GB 5D7HA 3SDYH 3IDXL 1CICC 4OV5B 3ECBB 4NAJA 1UD6A 1QEWB 4APXB 1JDAA 3HFFA 1H8LA 1D5XB 3GK8L 2F58H 2XX0A 3BVXA 2YK1H 4H25A 4D0CB 4GG6B 1C1EL 1LP9B 5F0JB 4E9LA 4GSQA 1SMDA 1CBJA 4LCVA 4NPKA 2OL3B 3NABH 1F6FB 3QGVA 1L7TH 1OO2A 3F01A 4W68A 1NGQH 3PHOA 4YHIA 5CMAB 1BX2A 2VN5A 1TQVA 3KPMA 3K6IA 2O5ZL 1HINL 5D1XA 1G7PB 1HQRB 3RZCA 2I5YH 1OOWA 2P7TB 3OPZL 4XP5H 5E6ID 5DO2C 3KNBB 1SRDA 5F7DA 2DLTA 3ELAT 2CBQA 4P4KC 4K3JH 4RGMB 6CGTA 4OZ4A 2OJ1A 1Z5YD 3NCJL 1P6AB 4RSVA 2F1EA 1D7DA 2WN2A 5TDPA 4Y9GA 4QOKB 5HHPA 2VDML 2O61A 5AAWC 4D0BA 2YFNA 3PV6B 3EO9H 4P5MA 4Y4KD 3MODL 3LH8A 2MCPH 5C07D 2KH2B 1CGVA 4AL8L 2NSQA 4OLXH 4KXCA 4A7TA 3PNWB 3V5DA 3B9KB 5L6YL 5I6XB 1LEKB 1OB0A 3EJUA 5C6WH 3WNLA 2Q0ZX 3OJMB 2WLZA 3MUHL 1BQRA 3O6FC 2X4TB 1WISA 1PIGA 1OK0A 2D7MA 4Z7NB 1NFDB 5GZOC 5MEOA 3WNPA 2K8MA 3RHWK 1I7RA 3MRBB 3VFSA 1IU1A 1XB8A 4UT6A 1NBVL 4FFWD 3WE6B 3HRPA 5JHDE 1YMHB 3FQRA 3Q43A 4ZMZA 1OAKL 5INDB 2J2ZA 5JPMB 3HC2A 3GKZA 3FSZA 5JQ6L 1W72L 1Y0LB 3EO1A 3MRNB 3VDBA 3NZ8B 3KWVA 1DQVA 3OKEA 3BUYB 5L2KD 4CGTA 1DQLH 2VQTA 1EJOL 2XKNA 5FCSH 4KVPA 4NUGH 4OLWH 5GSRB 3MUUA 4PW4A 4Y4HB 3DX9B 1JZ8A 4QRPB 5FGCB 3UYPB 1T6BX 3MQIA 4FQQA 4G8IB 4H2AA 3SDCA 3FJTA 3IU4H 2APFA 2PWGA 3GJEA 1GY2A 5DEJA 4CMHC 4LOFA 4E9RA 4L37A 4K94H 3S34L 3UYRH 3FB7B 4WW1A 1H6UA 4WZ9A 1CLYH 2OMXB 2R1WB 1OF2A 2FZ3B 4F15C 1R17A 1R47A 3EBIA 4HEMA 1WAPA 4LOEA 1P4IH 4FULA 3VQLA 3Q5OA 1AKPA 1Y07A 4YJZL 4J8RA 4NIKB 4XOBA 4EO5A 4LNRA 1R4XA 5F7BA 4N1HB 2NY2B 1BJ8A 3EHBB 2ED6A 1N5YH 1D6EB 4V1DE 4NZRL 3MNZA 3W9DA 1U8KB 4MB3A 4UM9A 3RBSA 4DGYH 4XPAL 2OZNA 4IU2B 4JFXB 4E5XB 3P2TA 2GHWB 3C6SB 3JWOC 1NFKA 5FYLE 1QQDB 5I8EA 2RD0A 3M46A 4NPYB 1QZNA 1WVZA 3CSFA 1EO7A 4J23A 3PXLA 2GI0A 5CEYA 5IJVB 2XKSA 2GB2A 2B08A 4J8QA 1RIUL 2UYLA 3TEZA 1IC0A 1THAA 5IUSA 4G6JL 4Q6IA 4BUQA 3CMOL 3GIVA 3PWLB 3KR3L 4X2UA 3O2DA 5I1HH 3B43A 3FTGB 1TZIA 4BKLA 4ZDHB 1IT9H 5EC2B 5L4MA 1HHIB 4ELME 1Z3GL 3WSQH 3PL6A 2XJLA 1M4KA 5LG1A 3TPKA 5HDBE 3VFUA 4FFYH 3H7BB 4JRYD 1QTYT 1S6NA 3FW6A 4WEBH 2CU9A 2EICA 4K9EL 2R69L 4KXZI 3ZR5A 1R0AL 1OAYH 5AZ2L 4WEMB 5HVWA 4FQHB 5E8NB 5GGRB 3FPXA 3N43F 3TZVA 1FRGL 1NAKL 1MCCA 1ZWIB 1YEFH 3MBEA 2J5LC 5FM5O 2YPVH 3CZGA 3FBKA 3OSVA 5EA0L 5KS9B 2QQLH 4OCSH 4RMQA 1GOGA 1YEEL 2WVVA 2BHYA 1L0PA 4M62L 4HWZB 3EIFA 4XPHL 3ILEA 3V6ZB 3BH9B 4GUQA 1MXDA 3QXWA 3RNQA 5F3BA 4LESA 3X13A 3AG1B 2IFGA 4MQSB 2CGYA 3TYGL 5GHWH 4YK4C 2R9HC 1HIML 2EXYD 4XVTL 3CVIH 3C6LB 3LRGA 3VNZA 2C1PB 4AY0A 4UQ2A 3D0VA 4P4RA 4JKKA 1JYXA 2O1AA 2ZOKA 1T66D 1T1WA 5BRZD 3NIDE 2UZIL 5DURD 3BDXA 4KJYB 1UVQA 2WY3B 3NJHA 4N0FB 3HUJB 4N9OB 3L5WB 1H3VA 4S0HA 4LHUB 4GEIA 4ERSH 3BIAX 5I71C 2NYKA 3KH4A 5CJBA 4JW3A 5F9WB 1MWAH 4A38A 1PX4A 2F18A 4Y8DC 5EOCJ 2WXGA 1U2CA 1YN6B 2NNFA 5GRVL 4ES9A 4KRNA 1H3PH 1YUHB 2B2XL 5KVEE 4A2GA 3QPXL 4NN5C 3MRIA 4KK9D 4G9FA 2FVNA 2VZVA 4JDVA 2EO9A 1SMAA 4LZKA 3VD9A 3S5LA 3BZEA 3F84A 5GXBB 1O5PA 4NZTL 1MIEH 3RB7A 5EO0B 3O4OB 2L04A 3CFQA 2AK1H 3P3TA 4OZHA 2CDEA 4QRSB 4XMWA 4YL4A 5AUMB 3ARRA 3TURA 1KIUA 3ME0B 3KWTA 1OAQH 2AEOA 4IOSD 3LKQA 4XBMA 4ZX4A 3EDKA 3SY0B 3BQUD 2JWYA 4UMSA 4CVXB 1FG9C 3SOTA 2DL2A 2G4GA 2H32B 1NL0H 3LNHA 1DSYA 3PQYE 4G8GD 5KUKA 2G9KA 4AC4A 5EB9A 4B0MM 4DUWA 3HE7B 4A6YH 4MA1B 3UJTH 2PYFB 1GGUA 4UT9L 3AXIA 3N1QC 4KWUA 3N41B 5I5IA 4ZUTA 1KPVB 1CGUA 1Y1DA 2EIMB 2BIOA 3QDMA 4NQSA 1QTPA 5I1JL 3FQ1A 3BFWA 4AC2A 4BCYA 5IKCB 3LKOB 5A2AA 4NO0A 4ZO8A 3WO4C 1J7VR 4A04A 1I9JL 2XT1B 3FTXA 4PAZA 5C7ZA 4AQOA 3S8FB 4NWTH 2AS5M 1NCBH 2G30A 3CHXA 5DQDL 3OAZK 4H8VA 4NNPH 4MDIB 5ELIA 2OXHB 1ZKAA 3NSFA 4GP5B 4FG6D 5AEAA 3UMTA 2ISDA 3EGDB 1VADA 2GC7C 3MOAH 2GT9A 3HZKA 4RQQB 4HIHB 2MPAH 4LLUB 5K59E 1GL4B 3L1GA 1FGNL 2W5PA 4OF3A 1U6AL 3MFGB 3CSPA 3NCYS 2R0LL 3NCBB 1W8NA 2BNRA 3Q1EA 4LCCB 3UTPD 1YG9A 1DFBH 2PCFB 4FHKA 3WDIA 1NGYA 3X14A 2L3BA 3ZKXB 4JFVA 1T03L 2ZOUA 4F1SA 3CFKA 5IB4B 1FNGA 2G2RA 5IVXE 3ZQ9A 1WCQA 4H26B 1EEUA 1SEBA 1MIEL 2EH8H 1T0OA 4YFLI 4PS4L 4JM2A 1G7MB 2OV0A 2UY6A 2H1PH 1CN4A 2WYHA 3CX5K 3PXJA 4AK2A 3MDJA 1R3HB 3IWVA 4GRLA 4ODTH 3ZDZF 3I9GL 5ICXB 1ESOA 3GSXA 4XHQA 2J3SA 4EZJA 3OMZA 4X6DB 3KLQA 4XNUL 5GRZA 1KTDB 4Z0XB 3FU5A 5AW9B 3WN5A 3QXAA 1KB5A 2JJVA 3DRQB 3G7TA 1PY9A 5I24A 2BC4B 4FX5A 4X5QA 3SO5A 4R96A 3X3FH 1U8JA 2AJSH 1JIBA 1LO0L 3CFTA 1OD9A 4D9LH 1DSFH 3ZDXF 2EIJB 2WXJA 1MCBA 1DCEA 4JFZL 2IPKB 1KC5H 2D7NA 5BZWB 3LV3A 4JG0H 5T33L 5F7NC 3H2PA 1DVFC 25C8H 3NEXA 1UT2A 1CIUA 2A6IA 3EOTL 4MXWH 1FGVL 3EO0A 3CPLB 1D5MA 1NQBA 4HIXH 4PJCE 4JY4B 5T1LB 3L2LA 1YJDL 3LD8C 4MJHA 2X5PA 4Z0BL 4MJIB 2CMRL 2VYRE 4NENB 2YD9A 3TT1L 2NUTA 1T2JA 4Q2ZB 2C4FT 1FSKC 1NGWA 1JNJA 3CFJA 4M4RA 4B9FA 1E30A 3LEXA 4MD5A 4HCRL 2X38A 5KVDL 2EC8A 4LLQB 1KTCA 2MKLC 3V0FA 4OZIF 2NY4C 1FRGH 1NAKH 1QBMH 1B4JH 3UDWC 3VJ6B 2NT1A 3ARBA 1AXSB 3VXPB 4YFLF 4OCXL 2IOOA 3Q8EA 3VFNA 2WKGA 3Q2LA 4I0CC 4L8CA 2LV4A 2YUZA 1EHNA 2VABA 4OQTL 4JKNA 5L2KE 4PJXA 4UT6H 4PRHB 3RWFB 1GC1L 3PGDB 4I5BA 3GLDA 4GLRI 5TE6H 1IGFH 2ZUUA 1M6OB 4OLYL 1JYWA 1FH5H 1RUQL 1LTXA 5DZVA 4DWHA 2J6EL 4C47A 1E2WA 4HJJH 2R7EB 2X70B 4KFZC 2C7UA 1NMBH 2V5YA 4F8QA 2A4ZA 4NM8L 2EP6A 2MH4A 3HG0A 2W0FA 2IDTA 4ABVA 4DN3L 2HMIC 2H3KA 3EJYC 2FGWL 5F1IA 3SKOB 4DFHA 4KX8A 3Q1SH 5FPIA 5EU6D 1KCSH 2VNCA 2XVKA 1WC7B 3MLRL 4XNMA 4JDZA 3AREB 3BKYL 3QJFB 3BO8A 4UOQA 1VF5C 4Y1TA 3KLHC 1TQSA 1A1OB 3CZEA 3QDGD 4Y16B 1EAJA 5D7JD 5T1MA 4OZIA 3TVMB 3ILQD 3BRDA 3EUDA 5IHZA 4XCYA 5L4JA 2Y9RT 1I1CA 5ADOL 3T0EA 3RWJA 4JZJA 5CGTA 5FYKL 3QZLA 2H8PA 4U1SB 5EUKA 2Q3XA 3HE6A 3E3QE 4G1MB 3HAEB 2OSWA 3BE1H 2CXKA 2X09A 5FYLL 1DDTA 4DGUA 1H5BA 3IJHA 4RISL 4TMPA 4WI0A 1MRCH 3D2UB 2W60B 1F97A 2GTQA 1ORQB 1CFVL 4NQEE 4X98B 4NRYA 4XP4L 2WQVA 4FQ2H 3PLYA 3X2QB 2LQRA 3K81A 4LLYB 2YEQA 3D69B 3V79C 2XXGA 4U7KA 1Q9WA 3G04A 4B53A 5HGBB 1P84K 4NO3B 3WMSA 3JV6A 3NP3A 4R83A 1CYWA 2EIEA 4YVUA 2CJSA 4OLWL 5EIVA 4HLZH 4EQ3A 1G43A 1QW8A 3BJLA 3H85A 3BN9D 4ODUA 4JHBA 2WVSA 4ZTEA 4FCHA 3CIQA 1J8HD 2OMUB 3L4CA 3PGCB 3VG0H 1H8SA 1E9QB 4Y19B 1KT2B 3STBA 2WXQA 1JZDC 2ZKXA 1F11B 4RMSA 2CO6B 3DV4A 3ZRCC 5IM7A 3OLGA 2LU4A 3LVEA 1RV6X 3P30H 2HA1A 5EFIA 3D6GA 1U93A 4JO1L 5MENB 3AT0A 4WKXA 2CPUA 1A9BB 4DKEH 4LPXA 4LF3A 1HCZA 3QZNA 4JRXA 3OSKA 3JTTA 3RNKB 4RGNE 5MHSE 1M57B 2BP3A 4PGEB 3TH3T 1HYSC 2BP0B 5F9WC 1OSPH 1P2CA 1WV7T 1CZ8H 1IUZA 4DZBB 3FMGL 1IBGH 4EJ1C 3T6QC 4HBCL 5GSVA 5EU7E 1F4YL 4GRMB 1DTUA 3QIBC 1RHHA 2H2PC 1MCRA 2XZZA 1EBAA 3ARFB 3QHTC 4KNUA 2AHIA 2X4QB 4H4NA 3QNYA 3TCTA 3Q05A 1MCFA 2WQ8A 3ZY7A 5HPMA 2DIJA 2Q76B 3MJGX 3WS6A 4X80L 1ID2A 2HJFA 5I75C 4K3JL 2KZBA 4HSQA 1Q1JL 2QVKA 4UUJB 5MEQB 1JWMA 5I15H 4EAEA 1WSST 4Q56A 3CVHH 3ZPDA 2R59A 3PFUA 1GAFL 2NXZB 2QSCH 2QDVA 1Q9OA 5SX5K 4W9KC 1NUDA 1NDMA 5GGTL 2BP5M 1MLCB 5BV7B 4Y5XC 1N70A 4ZMVA 1PBYA 4CJ1A 5FLVA 4JFPB 4C4UA 4O4YL 5DO8A 5AW4B 1ZIAA 1PQZB 2YD1A 1G0YR 4JGJA 1GAFH 1QHPA 1ZVSA 3LSOB 4O58L 3QJZA 4PREB 1NM4A 4XOCA 2DQJH 2EDFA 1CLOH 3N2JA 4K0OA 1F4XH 2Y1AA 4BZ2H 5B39B 2JIXA 3B2VL 5ABZA 1OV8A 2WLYA 4XBGA 1AKJD 2Y1YA 2CBOA 1K5WA 2CKBH 3B34A 5L88H 2LVCA 4QRRD 3ZZSA 2FO4B 5C2BL 4HIIA 1DDHB 1UOKA 1N6QH 1ACCA 2YS4A 4OM0H 4P2QD 5F8RC 1U95B 1KLGA 4TSCL 4UDUA 4Y4FC 2QL1A 2DWYA 3RKDC 5IBUB 3QA3A 1O6SA 1VCBC 2EC9U 2BJML 4WI2A 4G43A 8CGTA 4M61A 4PLKC 2E6JA 2C9XA 3KD4A 2YGQA 1DEEB 3QJXA 3AXLB 3VFRB 5BPPA 2RH0A 1U8MB 4N2HA 3AQZA 1A22B 3UROR 4E41A 3HRZB 2EDYA 2IWKA 4WEUD 3L4ZA 1Z32X 2AJ3A 1FNEB 4KY1H 2XXFA 5DUMH 5KJRL 3ATAA 3VGDA 4CU8A 4M6NL 2VXQL 2NPLX 4HS3B 4PJAE 4ISVB 3VFWB 4YHMH 5E2TL 1THCA 3H0TA 4W9JC 1A8JH 2FQEA 3WS3B 3RE0A 4F5CA 3KPNA 2XICA 1CXKA 4P2OB 3VMPA 2EVFA 3SYOA 3SKUD 1FFPB 1CO1A 2VH5H 1D7CA 3HG5A 3D0AA 1Z9NA 5BZXA 4LE8A 1R1CA 1GS7A 1CD0A 5DWUL 4JFFA 4I3RL 3MUJA 1YPZF 3QUXA 1U3ZA 3QUML 4QTHB 5MEPA 3O3DA 1ID5I 3PWVA 1BZDA 2BSRA 5C2BH 5B4MD 3KJ6H 1VENA 4F15B 2H6PA 2IAND 3DHUA 5CD3B 4PUBH 4NQVB 2G5BB 4A2LA 3MRCA 1CS6A 2GKIA 3RVWC 3T0EC 1ZMYA 4KO9A 3NCMA 4K3GA 3NFNA 3L9BA 2VJXA 4TQPA 1HZHH 2NMSA 3SQBB 1LP9F 2WLIB 5DJXA 5DU7A 3HZMB 4DKAA 1IGIH 4Z6AT 1AO7A 4R4BA 3SDDD 4WV1C 3LKPB 4KTEL 4APQA 4PY7B 2VSKB 4NIYE 2MJWA 1YEKH 5FM8A 5D9SA 1A5FH 3WY2A 2K45A 1IBHA 1AXTH 4XWOD 4UAHA 1YCSA 4XMPL 1PCXA 5D7LB 4X4ME 1KEGL 4PJGB 2Y5TB 4M5SA 2YGOA 3QQ3A 2DWEA 2WUCH 5J13C 3FRPA 5C0AA 2V5RA 3BX7C 3U0WL 2BRRH 4YDNA 2GSIA 4NM8H 4GMTH 4OIIL 3TO4C 4ZQTA 3GQFA 3OKLB 3O6FB 3KL3A 3U7AA 5DD6B 2NZ1A 3FYIB 1NCUA 2DBJA 15C8H 1E65A 2X42A 4UAOC 3JV5A 4OLYH 1EO5A 1OW0C 4QHNA 1MHCB 4Z7WE 4NBYB 2EO7A 2Q6WB 4B6ZA 5AB9A 4DP6X 1PG7X 2ITCA 1A2YB 4A2MA 2V7NA 2YRZA 1U41A 1HKLH 4M6ML 2A99A 1CL7H 3V4VL 2CO7A 2LOEA 5IB5A 3ULVE 1JS4A 4WCYH 3FUDA 1AFVL 1DQMH 2WPGA 3V0IA 3L2MA 4OW6A 4PBXA 2FJHA 2A5UA 1G84A 4WFGE 4GAGL 4QNPE 1VFUA 4QRQA 1ZE3C 4MMXC 4C54A 1CDGA 4JANA 2JFCA 5AB0A 4QRTA 1IC4H 1CFQA 3NRQA 3R8QA 4BA0A 2I85A 3OKDA 5JMRA 1QYGH 3IJYA 4F2MA 3K6SA 1CXEA 5GRYA 2E46A 4GRWF 4P0DA 4KKZA 1UTDA 3HG1E 3KPTA 1RPQA 3BUDA 4F57L 3EOTH 4MXWL 1NC4A 1F6LL 2B4CH 1MW0A 4LCIH 4MJ6A 2FWLB 4ODSH 3PWNA 5ENWB 5I2IA 2AVFA 4AQ1A 1HI6B 2NUPA 4HKJA 3KCWA 5DUPL 2FEEL 3BPLB 4XO5A 1KOAA 4HIJB 3GUTA 1W8EA 32C2A 2XG4B 4LCUA 5IFHL 3M17A 3BRFA 3X3FL 3NTCH 4HFWB 3IDIB 3HLKA 3WEXA 3CU7A 1M9WA 3QNXA 3V6FA 5DO2D 4HG4J 2IXQB 4GO6B 2WLJA 3JQOB 3FN0L 1TNMA 4P5KB 4EI6A 3L6FB 1AHMA 2HTLD 1JGUH 1CFNA 1QUNB 5LDSA 1FORL 1JG9A 5D4IA 5ALBL 4GEJA 3VMNA 2ZNWA 1UEYA 3BVNA 1U92B 3O4LE 3GJFB 4I77L 2JXMA 3TVMC 1VFAB 2D9QB 2YGNA 1IC1A 4OGYH 1T1XB 4H8HA 4LEOB 2JB5L 3HI6L 1KPUA 3RY6C 2XZCH 4O02A 1DFBL 2VAAA 1U3JA 2KBGA 2P45B 4KXZH 1UFUA 2FJFA 4IEFB 3LB6C 3IMTA 4NOBA 5D96C 2DZEA 4X4ZA 4EZKA 2YQBA 4HJJL 5KYUB 2AJXH 1G1CA 1AY1L 2BIPA 2X9YA 5IG7B 4KKCC 3PHQA 3PPEA 1T5XA 1XTLA 3W1ZA 1EIBA 3PS6A 4MKMA 2E7CA 1IGTB 4JZOB 5EH1A 1XHHA 3LIZH 4HMEA 1FNSL 4UT6L 3VFOA 2NNAA 1A9EB 4OQTH 1HDMB 2FDBP 4ZO9A 4N26A 2VC2L 5JA8B 1BVLB 1WBXB 1Q8MA 3TV3L 2XLLA 3HKZA 2CK0L 4TPRH 4O2CA 3FUHA 2VRAA 2OTUB 2DH3A 4DTGL 1B4JL 1XIWC 4Y4HC 3UGUA 2IBBA 4PJIF 4K7PX 4W9ZA 1BEXA 4UT9H 3EBGA 4HOXA 4TQEH 2XA8H 4S2SB 2BVPA 4HCRH 3QDJE 4U3SA 2OR8A 4MAUL 4PWFA 3HMWH 3V52L 4LASH 4FFTA 5C0DA 5E03A 5DJAB 3MJ9H 2EE9A 4FJZA 3O2DH 3QWNA 2EXTA 4D8OA 1YJDH 2GQHA 1GIGL 4POYA 5AAMA 4AMXA 1PNDA 1IZJA 5CSGA 2Y6TE 4LT7A 3AY4C 3FUFA 1I3RB 1Q9LB 2ARJA 1NGZA 1E6OL 3HNSH 2FEDD 1KELH 4FNUA 3FSWA 2XN2A 3SYCA 4PJ5B 3MBWB 4PTUA 1YNKL 4PCTA 4ECNA 2OULB 3DK0A 2J5LB 4RAHA 5CWSA 5LBSH 4CN4A 1HXYB 1AJ7H 5I6XC 3RWEB 2V8MA 2HRPH 4UB0L 1QFOA 1MAML 1V7NL 4GXUM 3TO2B 5I1DA 4YWGH 3BHBB 4MASA 4XCFH 1RURH 5BO1L 2JKNA 5CGYC 5LKNA 1N67A 2PR9A 3FONA 4Y5VA 1A3ZA 3SY6A 5L9DL 2VN3A 4QLWA 1V5JA 2XBDA 3MCYA 5E94A 5EN3A 1E4WL 1HOCA 2K3TA 1AJ7L 3FCSB 1V7MH 1YNTF 2ZP0T 3ZSSA 2H1PL 5DJ0A 3C60C 3IRCA 3WCYA 1CFMA 1WP6A 1MFVA 2DLEA 1A6AA 2Y7NA 4C4BA 5JXAH 3B4NA 2GSMB 4XVTH 2LR4A 2ADJA 2KLRA 2WSDA 5DEGA 3D3VE 2JCCB 1JCVA 5EU5A 1N9PA 1GYVA 2A9AA 2H26A 4F80A 1UEMA 1G6VK 2UVEA 4NJAL 2J44A 1SQ2N 4XPHH 4G8EA 3UO8B 5BS0B 4P3CH 5HHXL 4FLQA 4NQEB 5JHDD 3LIUA 5JOPD 5D1QA 4NQCE 3QR2A 4HHAB 1HH9A 3SYAA 4DIXA 5B1CA 4OF5A 5E9DE 2AQSA 3UTZB 5EULV 5J8OA 5JHLA 4KV5F 2ITDA 1LP9E 4O51A 3WFCL 4RIRA 2CK0H 3MYZA 2J1ZA 5CN1A 3GZOA 1OQOA 2G0LA 1YEDA 1P4LB 4LLVB 3KPSD 4X5WA 3VU1A 3N55A 3L4XA 4KDVA 3O0RL 5T3XL 1NC2A 5HYQA 2KKQA 2WWKO 3O4LB 3K5SA 5B3SB 3IB4A 2Q86A 2GYSA 1IM9A 1EHAA 1TG8A 3FOLB 3G5YA 3H6JA 2UXFA 3J07A 1OP3H 3L16A 1WLHA 3QHFL 1MQKH 4G6JH 3QIUA 4GYBA 3T8MA 3V52H 2WIMA 2F8VA 2K7QA 3L08A 5CIPB 3SDCD 5MERB 4ELMF 4Z7UF 1DL7H 1CDJA 4HQQH 3NFSH 1FNAA 1CBVH 3NFPA 4HU2A 5G5DA 1RL1A 4WGVB 5E6ZA 1I9IH 4I0PC 2L4OA 2QMKA 4LVNC 1LO5B 5E8EA 2XFXB 1G6RL 3GMLB 5EBWB 1OT2A 5JPMC 1QKZH 5SX4I 5H4YA 3GSNA 5DI8A 2ZYHA 5FA3A 5KVMC 1BOYA 2D3NA 1AMXA 4PV8B 4QY8B 2IDCA 4OV5A 3BZFB 2WJ7A 4NP9A 1IQDB 3W39B 3DYMA 4XXCC 2Y1ZA 2X0WA 4N0UB 3MHZA 4NHUB 1XF4A 1XR8A 2YEZB 3QFJD 2FIKB 5IFHH 3IAPA 2ZICA 3VI4B 3IE9A 5CMAA 5D1XB 3RZCB