1RCYA

Rusticyanin (rc) from thiobacillus ferrooxidans
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
TTWKEATLPQVKAMLEKDDGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUSTICYANIN
publication title Multiple wavelength anomalous diffraction (MAD) crystal structure of rusticyanin: a highly oxidizing cupredoxin with extreme acid stability.
pubmed doi rcsb
source organism Acidithiobacillus ferrooxidans
molecule tags Metalloprotein
total genus 35
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 1996-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1rcyA00
3FU8A 2YXVA 3SBPA 5I5MA 3QJQB 1CUOA 3NJHA 1CURA 2Y1AA 3GYRA 2Y69B 1ET5A 2OV0A 1ID2A 1AAJA 4YSDA 1NIAA 4KO5A 3CDZA 2W8CA 3X2QB 3CDZB 4HZ1A 2GHZA 2I7SA 1J5DA 1NIBA 3X1BA 5I6NA 4A67A 3NJIA 4M4RB 2J57A 3GXUB 5F7BA 2WO2B 1AR1B 1AANA 3MX0B 2FWLB 2AZUA 2FT8A 2HZHA 3NP4A 3NP3A 3WI9A 4W9ZA 3FS9A 2BWDA 1ILSA 4E9QA 4TXVB 5EHFA 2XLLA 1NIDA 2XV3A 1NPNA 1IC0A 2PPAA 1JZJA 3L45A 4X4KA 8PAZA 3UACA 4HCFA 2YAPA 3QQXA 3CVBA 3NSDA 1NINA 1OCCB 4BWUA 1W6WA 1GR7A 4JHUA 1JXDA 1TU2A 4JHVA 2FJSA 4YSEA 2VW7A 1PMYA 5B3SB 2H3XC 4N4YB 2HX9A 3FPXA 2Q9OA 1PNCA 2GI0A 3PAUA 2XXGA 2IWFA 5TK2A 2E86A 3ABMB 2BZCA 4DP8X 3KW8A 1A65A 1E5YA 5D4HA 1URIA 3AG1B 5ANHA 2EINB 3CVDA 1AG6A 2CJ3A 4E9VA 3ASOB 3H56A 1AOZA 3N2JA 3ZX1A 3QJVB 1IBZA 2VM4A 1SF3A 1GW0A 1ZIBA 2OJ1A 3PAZA 4YSTA 1WA2X 2GBAA 4HIPA 1ASPA 2IAAC 1BXVA 1MDAA 1XB6A 3FSZA 3QJSB 1RZQA 4Q89A 3TBBA 2YARA 4HCGA 2N0MA 2H47C 5AFAA 6PCYA 1OE2A 4K9JA 2IDFA 2XYBA 1AIZA 3FU7A 3NJFA 1VLXA 3CVCA 4DP6X 2HXAA 3FU7B 3X1FA 3FSWA 1QNIA 5D4IA 1BQKA 2FQEA 1JZEA 1JZGA 1PAZA 2XV0A 2YAQA 1M57B 3CG8A 3IEAA 2FQDA 4ZK8A 3NJKA 1OE1A 3N55A 4E9RA 1JOIA 1EHKB 3C75A 4F7KA 2I7OA 5I6PA 3X1GA 1XMEB 2HX8A 1PLCA 2VSMB 1ASQA 1KGYE 4L0PB 2XU9A 1ET7A 2P80D 2CAKA 3NJJA 5D4JA 2DWTA 1NPJA 5B1BB 4DP9X 2QPEB 1IBYA 2H5UA 3MBWB 1PNDA 3OMNB 4HAKA 1PLAA 1JVLA 2AZAA 4BDVB 1AS8A 3PLYA 2YAMA 4QKTA 2TSAA 1J9RA 5E9NA 1KBVA 2IDUA 1X9UA 3PCYA 3UADA 2MRYA 1A8ZA 2GC7C 1A4CA 1PF3A 4DP4X 2BP8A 5I6LA 2IH8A 3T6ZA 3PPSA 3H4HA 3WNIA 3ZIYA 2BP8B 9PCYA 4DPBX 4KNTA 2HX7A 4P5SA 4YSAA 4G7SB 1HAUA 2WSDA 1OOWA 4BXSV 4RH4A 1FFTB 3NJGA 3OQRA 3T6XA 3NJLA 3ABKB 4DP1X 1AZRA 4PAZA 2HLEB 1JZHA 2GB2A 3KW7A 2GIMA 5I28A 3HB3B 4P5RA 2MTAA 3S3DB 4KNUA 4BXVA 3S3BB 4CSZA 4MFHA 2FT7A 3G5WA 1NIEA 2UXVA 2EIMB 1TEFA 1SHWA 2BWIA 5PAZA 2PP8A 4KOBA 1BQRA 2CALA 2JKWA 5I6OA 2FTAA 2BZ7A 3DKHA 3OD3A 1N70A 1NZRA 4FAAB 2VMJA 1PZCA 1L9PA 2XWZA 1BYOA 1V10A 3FQ1A 4AKOA 4E9SA 5B7MA 3V9EA 2XUWA 4F2FA 1WAEA 1YLBB 2EIKB 4AKQA 2PPDA 1N68A 2XVBA 1NIFA 4DP0X 3AW5A 4DP2X 2JXMA 3EH3B 3NSFA 4BWTA 1BXUA 2A3TA 4WKXA 1MG3C 2AANA 1RKRA 4G7QB 2IWEA 3T6WA 1PLBA 3TASA 1M9WA 4G71B 3FSVA 2VN3A 4GP8B 1OF0A 4HHGA 3NSYA 1TEGA 1TKWA 3BVDB 1RZPA 3T6VA 1W6LA 5AZUA 4G70B 3FYIB 1OE3A 4WTQA 1ILUA 5B1AB 3X1NA 4QLWA 3ZDWA 5I5IA 3WIAA 2PPCA 4UANA 3X1EA 1AQ8A 4DP7X 3U25A 1SNRA 2DWSA 1ADWA 2X88A 3IN0A 4AKPA 2VM3A 3TBCA 4HCIA 5B1JC 4YSSA 2PLTA 1KDJA 2HRGA 3EHBB 1RCYA 1NWOA 2PP9A 4N8UA 1KCBA 1GSKA 5B7FA 2PCFA 2PPEA 1PZAA 3RYMA 1AZUA 2R7EA 3EF4A 4F2EA 1ZV2A 2ZXWB 1SHXA 2R7EB 1UATA 4AX3A 1AG0A 2GSMB 1J9QA 1T5KA 3NYKA 1J9SA 2QPDB 3S8FB 1WS8A 2W88A 1E65A 4A2FA 1SF5A 4YSOA 3FQ2A 1WA1X 2IWKA 1J5CA 2J5WA 2AVFA 1ZDQA 2JFCA 3QJTB 4E9YA 7PAZA 1ETJA 3ZBMA 5I26A 5FC9A 4AZUA 3S8GB 1QHQA 4YSPA 4YVNA 2GC4C 2UXFA 3S3CB 3WG7B 2BO0A 1JXFA 2LLNA 1FA4A 2AFNA 3CZUB 3ABGA 1AACA 4E9WA 2IDTA 1MZZA 2I85A 3EH4B 3T71A 2BP0A 2YAEA 3AG3B 3UABA 1E67A 1AZCA 3WKQA 3OMAB 3ABLB 2XX0A 7PCYA 2ZONA 1PCSA 1L9QA 2VSKB 1XB8A 5A7EA 1OCZB 3IE9A 2YAFA 4KNSA 1L9SA 1HFUA 1V54B 3IN2A 2J55A 3SBQA 4DPCX 2FQFA 1NDTA 5AKRA 4KO7A 1E5ZA 4JKNA 2Q5BA 3FSAA 1NTDA 4A2GA 3UAAA 4HALA 1IUZA 2TSBA 1GS7A 5B7EA 4AI7A 4A2EA 1GS8A 1L9RA 2UXGA 3HEIB 1NICA 2PPFA 3UGEA 5B1JA 2WO3B 1EZLA 2RACA 1PY0A 1XB3A 1SDDA 3ERXA 5I6MA 1GY2A 2J56A 3WKPA 4HHWA 1A4BA 1SDDB 3FPYA 1HAWA 1JZFA 1CC3A 3FYEB 5TK4A 3UAEA 4ENZA 5I6KA 1KCWA 3SBRA 3BQVA 4PCYA 1SFHA 2FT6A 3NJMA 1GYCA 3EH5B 4YSRA 1KV7A 2QDWA 3DTUB 2PP7A 2YAOA 1GS6X 4A68A 5B1KA 2FQGA 2IH9A 1ZPUA 2P80A 1R1CA 2XX1A 3NT0A 3NJNA 1OV8A 1SFDA 2IDSA 2UX7A 2HRHA 4GP5B 3DIVA 4YL4A 4KO9A 3JT2A 1F56A 5F7AA 3FU9A 4YVUA 2ZWNA 2VW6A 1L9TA 1JZIA 3QPKA 1ET8A 1ZDSA 2IDQA 3OMIB 4A2DA 1BYPA 3D12B 4E9TA 4YSCA 3FQYA 3AY2A 3ASNB 3QJUB 1BXAA 3NSCA 4YSUA 4Q8BA 1CYWA 1BQ5A 1BAWA 2DY2A 3H4FA 3SQRA 3IBOA 1QLEB 1AS6A 2EILB 2UX6A 1V55B 4EF3A 4YSQA 1DYZA 1ASOA 2CUAA 1IKOP 1SJMA 2B08A 1M56B 3AG4B 1A4AA 1FWXA 4DP5X 3AZUA 3WNJA 2YAHA 4FA7B 1JXGA 1OCOB 3QJRB 6PAZA 4BK5C 4E9XA 1E30A 2YXWA 5LDUA 2XV2A 1B3IA 1GY1A 1W8EA 1X9RA 1I53A 4G7RB 5I5JA 1OCRB 1PZBA 4A66A 3GDCA 4M3HA 2YQBA 1JERA 1ZIAA 1KDIA 4KOCA 2EIJB 3T9WA 1BEXA 2X87A 1A3ZA 4UF7C 4DPAX 2PCYA 4NERA 3PXLA 2QDVA 4UAHA 2NRDA 2BHFA 2CBPA 3FT0A 1WS7A 4BWWA 3TU6A 2FNWA 2OCCB 3JTBA 4G72B 4GY4A 4NB7A 3V9CA 3TA4D 1KYAA 2BW4A 1AZBA 2DV6A 2DYSB 1KBWA 1WA0X 2UXTA 2XXFA 4W1TA 5PCYA 1L9OA 3OM3B 2DYRB 4GXFA 4KO6A 1MZYA 1MG2C 1CYXA 2BP0B 2QT6A 1JVOA 4CSPA 2BW5A 1DZ0A 2B3IA 1NWPA 2CCWA 3PAVA 2ZOOA 4GP4B 4GYBA 4A2HA 1AZNA 1J9TA 1AS7A 2VW4A 3AG2B 4NAJA 4BDVA 5IY5B
chains in the Genus database with same CATH superfamily
5CNHA 3D2TA 1NLBH 3VD2A 1TZHA 5IMKB 1FLTX 2AQ2A 2OTUA 3RUGB 5I5MA 2A6DA 3GPSA 5IV2A 4BK4A 3GYRA 2CO7B 4WWKA 3IFLH 1IAIH 1W0YT 1BAFL 2AP2A 4WSKA 2GCYA 2HFGH 4WY7H 1KYDA 1XR9A 2R2CA 3TBYA 5C8JA 3BKYH 3TO4C 4D7PA 4ODTL 3WDJA 3E8VA 2DQUH 2NXYB 4JQIH 3T4YB 2CMRL 3SPGA 4UZUA 4HS8H 3M17A 3AWEA 1KN4L 1JYWA 4BSJA 8CGTA 2J5LB 4Y1TA 5F7BA 4N5EC 1M6OA 2DEYX 3SDDB 2AZUA 4KJYA 3WI9A 1KMGA 1TYJA 3VXRB 4JK0D 5ETUA 3DVNB 3LNEA 4WHYG 3HLKA 3SY0A 1LK3L 1LP9E 3AS0A 4H2CA 1N8OE 3NFSH 1KFAH 3MRDA 4U3SB 2CPCA 3ZYIA 2FUTA 4BE5A 5AOLA 4X9GA 1NINA 3PDOA 1Y1UA 3KPLA 3OR7B 3MV9A 1GOFA 3JZYA 5FUZH 4JHVA 5A2CA 1KWGA 3MUY1 5CLWA 5AAPA 1U91B 5EORL 1FP5A 2DTML 2R2BB 2PETA 1DJHA 5B3SB 3TJPA 4ETYA 1OD9A 1T5WA 5DK2B 3V4PA 4EDWL 2FBJH 2FWUA 3Q6FA 3FOLB 4ZUUA 1AGBA 1U92A 3S7GA 1C8QA 1UB5B 2E9IA 3HHMA 1VAHA 4J3UA 4MAYC 5ADOL 5CGMA 4BE6A 1T0OA 5DJ8B 1UENA 3IPEA 3PYCA 1WISA 5D4HA 1MIML 1AR2A 1UKSA 4P5TD 1LE5B 3MHZA 3HI1A 4TQPA 4PJ5A 1F97A 3UC2A 1KXTB 4KXDA 4BYHA 5CKGA 1ZLWH 3WSQL 2NY0D 4HFWB 1IBZA 3EFFB 1VADB 4JRYD 3W56A 1OAYL 4KROC 5DUBA 5E6UB 1KNOB 2Q7NA 1TJHL 3MV7A 2B1AH 5D7SL 1OD7A 2ZXDA 2F08A 2X4TA 3D0VA 1EFXD 1GGIH 1UH2A 4OZ4A 4LO9A 5D1QE 2O1AA 5FM5O 1WFTA 1HWHB 4K07A 5I1EH 3JXAA 3GSUA 4E42A 1ZHBB 1XF2A 1Z9PA 3CFIC 3MCG1 4L9LB 1YN6A 1ZHKB 3WLBA 1HZLA 1OF2A 3RU8L 5C07A 2XWXA 2NY1C 3BPNB 3WFBH 3HNTL 1IM3B 1T89A 4WWOA 2Y2YA 4IKKA 1KTBA 2A73B 4XMZA 2GJ6E 5KBDA 3QZLA 1RZ7H 4WHYH 1IVTA 1P2CB 1R5WA 3VQMA 5B1CA 4PJGF 4AG4L 2WXOA 1VFUA 2XQ0A 3ZE1B 1DBAL 1VHPA 5IF0B 1J0YA 4TS6A 5I1DB 2R69L 5FYJU 4MJ6B 3ATDA 4AM0B 1NLBL 3DHMA 2NY4D 5TQ0H 4OLWL 4PJEE 4PLNC 2XFGB 2W94A 3IFLL 2ENPA 2F54B 1PLAA 2HFGL 2Z92B 4WY7L 1P4IH 4L8SC 5I76B 2A9AA 3RGVC 4FG6C 4GKSB 3BKYL 4PGDB 1J0KA 4Y19D 2WBWB 4HVBA 2DQUL 1FC1A 4Z77A 4ZZFA 4JQIL 4NQCA 3K4DA 4JZJB 4J23A 5G4MA 5AAWC 3O4LB 5D7JB 2B16A 5D8JH 1MY5A 4H20H 2F68X 4NNYA 4YZFE 4K5MA 2HT4C 4JL2A 4X9YA 4X8JB 5I17B 4H1LG 4JFUA 4YSAA 3VGDA 1MCEA 4UI2A 5ISZB 4GW4B 4UDUA 3AXLA 4LQFH 1B6UA 3NFSL 1KFAL 3ABKB 4I4WA 4BBWA 1HX0A 2HB0A 2AXGA 3TXAA 4BK5A 1AZRA 2CR3A 3U79A 2Q86A 4KNQA 3CHQA 2K8QA 1QSZA 2GFBB 1Z9SB 4HIIB 5DHEA 4YFLI 5FUZL 3CHPA 3V0WH 4XWOD 1RMFH 4MXVE 3V5KB 4DGUA 2EO9A 4NQQA 2APBA 4X6DF 1QA9A 3KHQA 1KN2H 3U7WH 1D5IH 3KXFA 1EXHA 3DBXA 5MI0C 5I1CH 2FBJL 5L8KB 4OFIA 5IMLA 3W0WB 2XTJD 3BI9X 2H3NA 4NXKA 1SHMA 1OT2A 2KHAA 4OZGF 4XB7A 5IQNA 4M8UA 2DQCL 2DJUA 3EYQD 5F3FA 2D3LA 5EEWA 5CBAB 3ES6A 4HIEA 1BYOA 4RSYA 3V9EA 2AGJH 3FO2A 5CN1A 1Q9KB 1E3FA 5H35B 3EDJA 5K9KA 4QMEA 5E4AA 3SD2A 4JM2C 4WO4B 3JUYA 5EUKB 2B1AL 3VRIA 1MF2H 1BSIA 3NSFA 3PGDA 2JELL 1T7VA 5E8OB 3QUYB 3OKKA 1UT2A 4PV1C 5HJGA 1H3WM 2XN1A 2ZOKB 1OW0A 3JUZA 3KLAA 3QDJD 4U6HA 5DMKA 1QUPA 5LBGA 5HHPA 4WTWA 3VNYA 1CICA 5IFAH 2DLIA 4B0MB 2ADGA 2E75C 4LHUG 3CZGA 5CS7A 5KYUA 4Y16D 3WFBL 4QLWA 1JMXA 3OMZA 3PU7A 2FWSA 2Z93A 3WIAA 2PPCA 4UANA 3ZHDA 3HG1D 4H1LH 4EQ3A 2OULB 3TO4A 3ESNA 1BP3B 4HKJB 2E59A 4M61B 4TVSa 5D2NE 2J2ZA 1E0OB 2OK0H 1Q9OB 3CDYA 1F2QA 2JCWA 3H42L 3JVGA 4LLQB 4U6YA 5EULV 3EYVB 1C7TA 3ISYA 3MUHL 3UOAB 3WN5C 2HVBA 3T77A 4R4NC 1JPGB 3NPSC 1RUAH 5DZ9A 5DHXB 3P4NB 4FFVD 5TQ0L 1V3JA 2GABA 3L5XL 3OB8A 4HKZA 5C0EB 1K4CB 5B3JE 4FJYA 1B9KA 2W9DH 5DS8A 1P4IL 3TBSB 1KZQA 3MV01 5D93B 2CDGB 4U33A 4JN1H 4HOZA 3S88L 2X5PA 2YHGA 4LLMB 5DVPA 4J2XA 3R8QA 3DXAD 3PQYD 4MD5A 4DT2A 2WXJA 4N6RA 4E68A 3NZSA 5E4IA 4ZUSA 4WUUA 5D8JL 1F13A 3ECBA 4H20L 2VDRH 3WEXB 4MDRA 4CNIA 3VRLE 4IMKA 4GUPA 2HLAB 3CN0A 4K7FA 1KJ2B 2P42B 3EIFA 5INCB 3UC0L 2VUKA 4G7VH 4LQFL 2IDTA 2B1HH 3HZYB 2YAEA 1NH6A 3KH3A 5CGTA 3WD5H 3UJTH 5CEXB 2CUIA 1QOKA 2IV9A 3H9SD 3TPUB 2H2PD 2QVTA 4P2RB 3ARFA 3V0WL 2GTZA 1QPPA 3GXPA 3PAYA 3T0AA 1N2RA 5DK0B 4MMXB 4CRPA 2C9QA 2K8MA 2ILLA 4IS6B 1THCA 1KN2L 3EJYC 3U7WL 1D5IL 3PWNA 1G1OA 2VERA 4U31A 5A1AA 1I9EA 2WYIA 2FX8H 4OB5H 2WM0A 3FT2A 1KELL 4NKOB 4Z7VA 1YEDB 3WENA 2ZXBA 3BZEA 4OV6F 2QFPA 2PYEA 3P0YH 5E4EB 5HGAA 4QHMA 3C5ZD 3V4VL 4AGLA 5IUSA 4V1DB 3KPRD 5HY9A 4TNGA 2FH6A 3VSVA 3BAWA 4IIQC 4NFBA 3SE6A 2AGJL 4X5PA 1MFAH 1B4JH 2ZUYA 4NUGH 3QSKB 3RI5F 3W11C 1KCWA 5T1MB 2FT6A 4HS6B 1HOCA 2OMZB 1T04B 3DRQA 4QT5B 5F71A 1YHPA 2AV7B 4PJXA 2EACA 1DUYB 1IZKA 4W9LC 1NFDA 2C8NA 3O2DH 5E2TH 2B1OA 1ODAA 3BIKA 4JY6B 4PGEB 3IDIB 3D09A 1IAOB 1FZOA 2R29A 4NN7B 1C9SA 4PJ6A 1TYRA 3F85A 3DIVA 2X3AA 3V0GA 3BWAB 1ND0B 3VRJA 1I1AA 3CX5K 4KXZI 4J3OG 2IBZY 1WBZA 3VGAB 2I32A 3MTXA 3L4ZA 5KVMC 4Q2ZA 4UQAA 1FAIH 3QXTA 4OZGE 3AXHA 4KHTH 2L7JA 3JWOH 3QJUB 3EH1A 2ZSVA 5AAWA 1UGNA 4IHOA 2PNDA 2PYFA 2CO6A 3QFJB 2Z7UA 1SMDA 5IIEA 3IXAA 1QLEB 2FEEI 2YWYA 4RFEB 4BKLB 1JUFA 3DSNA 5EU6B 5DRXB 5FLUA 4PD4K 4TSCL 5HHXH 3VWKC 3T0WA 4Z78A 1IKOP 1L7TL 2ZF9A 1RUAL 3QAZB 1AQMA 2SEBA 3AG4B 4ZW8A 3B7YA 1FWXA 2X4PB 4QWWC 3WUWB 3N3EA 4JFEE 5MEPB 3GSWB 4L4VB 2W9DL 3WOVA 3Q9PA 2P3YA 5FYLL 2P24A 4S2SB 4P5KA 5AYQA 5HHNB 3M46A 4URTB 4A66A 1CT8A 3FU0A 3BEWB 4Q4EA 1JERA 4XWGL 1F0LA 1KDIA 3LV3A 3RIAF 2BS8A 2V9UA 2VDRL 1P84K 3EFOA 3ZYJA 4I0CC 4XX1G 5EPMB 1NC4B 3OHXC 4GSXA 4XB8A 3B2UC 4HUVA 3UYOD 4G7VL 4E41A 1Y7VA 1HI6A 1EAQA 4KVPA 2B1HL 4GY4A 5J6GB 3TESA 3WD5L 2BW4A 1X6LA 2EC9U 5AB2A 1CF8H 4KKCD 3BLKA 3QG7H 1VEOA 1X4ZA 3DLQR 2G9KA 4LFHD 3V6OA 2MPAH 2WKLA 4Y2OB 1V3LA 2WB1A 4EO5A 3NN8A 3FRUA 1SUJA 3CDFA 4IGBB 3NQKA 2BOBB 3MRPB 2BIPA 4BFKA 2IANB 2L7EA 4OB5L 5HHMB 1TXKA 5I8CB 1NMBH 4J3OH 3RWIB 1FVEB 4P4KC 4PS7A 1CXFA 1O6VA 3P0YL 3G9AB 4TQHA 4KKQA 3ROLB 1KC5L 5JHAA 5C71A 1S9YA 2YXVA 4QRTB 4AIXA 3D4CA 3MAWA 1NAMH 2ZD0A 3WXWH 2X6CA 1VFOA 5E1AB 5HVHB 5FUCE 4N2AA 4KUCD 3TBVA 5FB8B 1XF3A 1MFAL 1B4JL 1S5HB 1UOLA 1HNYA 2VXUH 1KB3A 4I3GA 3X2QB 3EHBD 1NBYA 1VESA 4G9DB 3VD1A 3NA4A 4AJ0A 2P43B 4PRPE 3T1FB 3V79C 3L7EA 3NJIA 3QO1A 5CZKA 4M4RB 4YDVB 2FZ3B 3VX1A 4U1SB 3GSVA 3MX0A 3CFQA 5JW3H 3PWPE 4Y7OC 3WN5A 4ZMQA 2R0LL 3O2DL 3BH9A 3MA7B 5E2TL 1QW9A 2V9RA 3FB5A 3EO1B 1ES0A 4YO0A 5D96C 4C56B 4JG1H 1SQMA 1HH9A 3JWNG 5F3BB 1A66A 5T1LB 2BDNH 2XV3A 1ETA1 3IS0X 4P05A 1KGJA 5C09B 3L45A 2JJSA 1UXWB 4XE0A 5F44A 1T03H 3S36H 5GRJL 3B2VH 3NSDA 1DHKA 2OMVA 2WJ5A 1E5AA 5KN5B 1MQ8A 2Y07H 1F6FB 4GRLC 5IHZA 3QNYA 3GZQA 3C87A 3JWOL 3H0TB 1LEGB 4KRLB 4IKJA 4ZOBA 3GMLA 2KQMA 3PS6A 3MRNA 1UXLA 1FJ1A 3AS1A 1R3HA 4M7LH 5CJXC 2L7QA 4ZOCA 5JIPA 3N06B 2IMNA 1QRND 4F15C 3H9ZA 4S0HA 2C3WA 1A6TA 5HI3C 1KJVA 4GKLA 1PKQE 1RPUA 4L5FE 4JFVA 3H56A 5MERB 4JUSA 3QA3B 3QIUD 4Y4HB 2ZSWB 4OI7A 4XNDA 4FNRA 3QJVB 4GB9A 4NENA 3C60C 4KZEL 2OSYA 3VFNB 1AKJD 2UZXB 3MRKA 1BX2A 1FNEA 1XGZA 2OM5A 2P5WA 2CE6A 3LKPB 3BAXA 1KXVC 3M7FB 5T33H 1MWAB 3DJRA 5DJDB 2H47C 2LHAA 4U0RC 4DKDC 2VKWA 1OKEA 4JY5L 4F7MB 1CF8L 1BQSA 1FZJA 3ARDD 3QG7L 3K7UA 5D7KE 1KGCE 2OZ4L 3F7VA 4FNPA 4PJIF 3NJFA 1JF1A 3F6JA 5BRPA 1PTZA 2CJUH 2MPAL 3HRPA 5KWYC 5KS9B 2W95A 1KT2A 2CUMA 3CSPA 1F11B 3L3OC 3MJ8B 3BUDA 5SX4I 5DQ9B 1ZLVH 3AREC 4IEFA 4FZ8H 3JWNH 4KXBA 1K2DA 4BZ1H 3U6RB 1IGJB 1VSCA 2IPUG 5EC1B 1NMBL 1I7UB 2YKLH 4NHUA 4Z7QF 1LTXA 4P2QE 4DO4A 1MW3A 1XMEB 1FFRA 3Q9QA 4L0PB 1KGYE 3LKNA 3MJWA 3W3BA 1D5MA 2CLRB 5JQ6H 4HCRH 3R0MA 4ABVA 2B8OT 4KVCH 4RFOH 1CFMA 3WXWL 4UAOC 3L9YA 2VZ3A 3GSOA 4P23C 3MR9A 1M1SA 3LKRB 3BPLC 3PP3K 3QORA 2VXUL 5G5DB 1X5MA 5I6XC 3UZVA 3LPWA 2ZOWA 1LP9B 1JXJA 2IQAA 2YPVH 1VERA 1L5GB 4EI6A 4GI8A 4K15A 3ALPA 3KPQA 4WAFA 3B5TA 2X1XR 3ZIYA 1CS6A 2JIXB 4MA3A 5JW3L 4BQ8A 4CBZA 1XFPA 2WB7A 1NEPA 3TF4A 2W59A 3JVFC 4NFCA 4JJ5B 4ZTPH 4RH4A 5DJYA 4AIZB 4JG1L 4F9PC 5JOPE 4NZRH 4EE2A 1KULA 2BDNL 5E6RB 3ROOB 3F12B 2BY3A 2UWEB 2PN5A 1D5XB 4PHZA 5FA4A 3FB6A 4OLXH 3S36L 5LGJA 3MRLB 1JNLH 2JCCA 3CVHA 3FQXB 2Y07L 3BHBA 2WXHA 3L6FB 4OGXH 2AJ3B 4HP5A 5D71H 2ICWJ 4EI5B 2BNRA 3G6JF 4MFHA 4ONOA 5C0DB 3POHA 1YEKH 5DS1A 3UTPE 2KZ1B 2G2RA 2BWIA 3D8MA 4FTVE 2ZAIA 1KIUB 2VL5B 1H3GA 3KH4A 4M7LL 1JNHA 4XNBA 1MH5B 4HJGB 2O93L 2ZOUA 3RNQA 4FMKA 5CZXC 4GI6A 2Q1EA 1W91A 1C7SA 4Y8DC 3F04A 1XTMA 5JHDA 2ZWKA 4OF8A 2F7QA 2BRRH 4GAJH 3GKZA 1T80A 3B43A 5IQOA 1LDSA 4JQVA 5EZIH 4JFFA 1AI1H 5IEKB 3C6LA 3BD4A 1I8AA 1P7KB 3VDAA 5CSBA 2EUXA 4LCWD 4DP2X 2WUCH 4JNXA 4P4KA 4H44C 3BKCL 4U6XB 3VWJD 5HYQA 2CIIB 5T33L 5C70A 2VN3A 2HMID 4FJ6A 2I9TA 1J88A 4FQXA 5EF1A 3WY2A 3RVUD 1TKWA 4FHJA 4AENA 1QBBA 4HKBA 3UYPB 3P3YA 2E47A 4G6AC 1QLRB 4YXLH 4G70B 3HMWH 4UM9A 4P0DA 4EBQH 3CZKA 3CZLA 1RJYB 1W72B 5KBPA 4MQSB 2VQ1A 3QXUA 4K7PY 5GGSY 5KVDL 1SNRA 4FZ8L 3T3PF 3ZUCA 2ICCA 3KYKH 4BZ1L 4PJAF 4PTUA 3HHSB 4PJEB 3BSZH 2YKLL 1BHGA 1HQRA 1I1YB 1RJZA 4FQ2H 4XXCC 2DKUA 3C8KA 2PCFA 4Y5XB 3GHEH 4ZAKB 4ZMTA 1HHHB 4DKTA 3O0RH 4QD2E 1DE4B 2N1KA 3PJLA 5JQ6L 1YNTB 1GTFA 1PGRB 5FFGA 2XACC 1AG0A 4RFOL 4ZZKA 4FQPA 2D7OA 3RY6A 1WHOA 2HG5B 3NCYS 1IARB 5DRNB 2EYRB 2NXZB 3L8QA 3FB8A 3MREA 1EIBA 4K9EH 2WQWA 3ATFA 2F61A 2WQAA 3SPHA 2ENQA 3H2PA 1NKGA 3Q7JA 4KK6C 5I74B 3FT3A 3GXMA 2EDXA 3AVEA 3QJTB 3SGDH 3BAKA 3RKPA 2P7TA 2NCMA 5CWSA 1G7MA 4WVRA 1U4FA 5DI8B 3KBFA 4ZTPL 3P9LB 4F20A 2R1YB 4ZDHB 1NCGA 4YEFA 3P9MB 3A4AA 2YZ1A 2ZICA 3MLRH 4N90E 4NZRL 3AB0B 4KKZA 2PW2B 2NY6B 4OLXL 3GMNB 1TETH 2JSFA 2V3FA 4RETB 1JNLL 5E1QA 4Z7QE 3RX9A 4X6FB 4EDXB 3EKCA 4HD5A 3GBDA 3FO1A 4OGXL 1E4XH 1OCZB 2DWDB 2YAFA 3EADA 5KSAC 3S97C 3SBQA 4JREB 2HTKC 4GQQA 4J28A 5DUML 5I1LB 3G5VB 5CFAA 4NZ8A 4I13B 3KL5A 3FSAA 3KVDD 3NSJA 3UH8A 3HZVA 1CDHA 2ERJB 4AEEA 4P3WA 1UADC 1U3HB 4APQD 2BP3A 3HS0A 3IDGB 1I7ZA 1QQDB 4QRQB 3QIBA 4RAUB 3ZXAC 2UXGA 3WN6A 5AENA 2ZP9A 1MAMH 1P7HL 3V7AG 2K7PA 4WEUD 4Z5RB 5FO7B 2QADB 5DJXA 2Q2EB 1XB3A 1DBJL 4UQDA 2BRRL 3VNZA 4Q14A 3TV3L 3GXNA 2MQGA 2R56H 3QISA 4EUPA 1DBMH 2UVEA 2M26A 4OCNC 3VFOB 1IU1A 3L3OA 5EZIL 4AQEA 4JPVH 3AREA 2ESVA 3D3VD 3EG9A 3RZCA 2J1WA 4WU7A 4UOW1 1F6LL 5JXEA 2K45A 4Y1AD 1B88A 2ITDB 4G43A 3VH8A 4DW2L 5FYLD 4FGMA 3LD8C 3LH9A 4UT6H 4RVBA 3ELQA 5EOTB 1HILA 3N85L 4U49A 2H26B 2Z8SA 3LXBA 1ZGLP 5E6YA 2QHLA 3Q8FA 5F7DA 1R1CA 1TOXA 3PHAA 4GO6B 2IDSA 1EEYA 1WIUA 1BWWA 2OTPA 4P23A 4WEMB 5K59E 3EBHA 4P5MB 3JT2A 4TQEH 4AEHL 3CD4A 3HN3A 2ZG2A 4EBQL 3VI4B 3KGUA 5JTWA 4C57C 4PI2A 2Z0BA 4FABH 3HBQA 4Y4FD 3OMIB 3T2OA 3U48A 3KYKL 1LO4H 4NSKB 1XT5A 1GYUA 2EEBA 3FQYA 5FXCH 3MUZ1 1R17A 1AJ7L 4XVUD 4GW5B 3BSZL 2N3JA 5D4QA 1MCFA 1CFNB 1U4EA 2CIKA 2DY2A 4FQ2L 2J1ZA 1JRHI 1U8MB 3O0RL 1V55B 3J8F7 4X5WB 5C6WH 3L7FA 4JDZB 4KK5D 4Z7OE 2HVKB 3MV9E 4OLEA 4YLQT 3OHMB 4NRXA 5ICXB 4L8BB 1M9SA 1ACCA 3II3A 3OX8B 4DTGH 1MRDH 4U1MB 1KLFA 4K9EL 4LOUC 4MZIA 1B3IA 4MCZB 3P3RA 4CAGA 1J5IA 3MODH 1AGEA 2VO5A 1AZVA 1H15A 3CBKB 3HZMB 4UNTA 2MOGA 1HQ4A 4UU9B 2WWMD 1OSPL 3F7YA 1SMOA 4PLJD 1Z7JA 3IVKB 1NMCB 4FHKA 2QDVA 5L6YH 1DL7H 2CK0H 4PJ5E 3TU6A 1YN7A 4I0KA 3COOA 1F4AA 3D5OF 4CC0A 1G6RB 1WIPA 3FF8A 2WSKA 3I6SA 1TETL 1MEXH 3K1DA 2NX5A 1EEUA 5BS0B 2H0FA 2K4WA 3EUDA 2UXTA 3MV7E 2DQGH 3L5IA 1KJ2H 3OKLB 4WGVB 4B27A 3UTTD 3KJ4C 2DYRB 1BECA 4FQQA 5CM1A 1J86A 2F6AA 3HLAB 3Q5OA 1JK8A 3TTSA 1KTDA 2WYTA 3PAVA 5CJOH 4ZMWA 2ZOOA 4GP4B 1F86A 1UB6B 5EBLB 1P4UA 3ARBB 5C07E 3S34H 2O6PA 5HDBB 3N42B 4WFEE 4K3EH 1BFSA 4LP5A 3GDBA 4OCRH 4Q97A 3U4KA 1OAQL 1XBRA 1XR8A 3WUWG 1CUOA 1UT1A 1V8HA 2R56L 3L9EA 5D6CB 5MHSE 1DBML 5JW4M 4JANB 4R90H 2L0DA 1TMQA 2EH8H 4JPVL 3NZUA 3KPNB 1JV5B 4FEMA 4R6UA 2WZPD 4OT1L 1BZDA 1PPIA 4UT6L 1NCBL 4JLRA 4LEEA 5GS1C 3IGLA 5KVGH 1TO5A 2WBJD 3Q44A 2V9TA 4EN3D 1XGQA 4LLYA 3VA6A 2CNZA 3US0A 4QTHA 1NEZB 5ENWA 4MD4A 1AIFA 4R4BB 1H5BA 1ED3B 1NCOA 2NW2A 4H40A 3LN5B 5HHOB 4LL1A 2E3VA 4XPHL 2EDOA 4B3VA 3E0GA 4NQCE 1FGVH 2OSLA 4A2MA 2J8OA 4JFPA 1JNNH 1XXFC 5DFVC 1LO5A 4FABL 1KB9J 4HV8A 5E2JA 3HA0A 4QRPD 1TCMA 1MW0A 2WXRA 4LQ1A 4IU3B 3BUQA 1LO4L 5L2JA 2BFGA 5GRUL 1XBDA 5FA3B 1QEWB 4AVJA 3RWGB 1T4KA 2Z9TA 4MDIB 5J4MA 3UBFA 3BH4A 4JFEB 4PCSA 2X70B 2NY2B 1EANA 1WCBB 4ZT1A 3LIZA 3HG5A 3E2HC 4PJXF 4M4PA 2J8UB 1NOFA 4HPYH 4D9LH 3FH8A 4JFZH 1W8NA 3MDJA 5DVLA 2GAZB 2E86A 3HTLX 3HHRB 4WFGD 1MI5A 4YK4C 5C0ND 3QUXC 4XC1H 5K9JL 4G59C 3SJVA 4AYBA 5I71B 1U93B 2QKIB 3KXFE 4ZX6A 1QLEH 1ZAGA 3EO9H 1ICTA 2YSSB 2WN2A 4LAJH 1ZHNA 2J6WA 4YHLH 5KSAA 5GZNA 3MRJA 3S6CA 1WITA 5EIIB 1ZA3A 2NT0A 2EDDA 4PWJA 5JW5B 4AQAA 1DQLH 2XXMB 4FFWC 2GI7A 2LW3A 3QO0B 3NVQA 4NLHA 5HDRA 3WLWD 1I82A 2X6VA 5L6YL 1DL7L 1U42A 3QG6B 3QIWB 2CK0L 3WTXA 1Q90A 1UC6A 5BOZG 1ZK9A 2FYYB 4X6EA 2ENJA 3KCPB 3LHPH 5E5MA 5MEQB 1MEXL 2VLRD 5GGRY 4KV5F 4PP1D 3TYFB 5C0JB 2DQGL 5E9DD 1OPOA 2FR4B 2R51A 5D1XC 1YEFH 5ECJE 5KYXB 4KI5E 2X6UA 4TUOB 3U7YH 4IKLA 2VCOA 3C09C 3SKNA 1QWNA 5CJOL 3U46B 1FFQA 4WWID 4AUYA 4YDJB 5AUMA 2EDRA 3BRGC 3S34L 2F1EA 2FH8A 4XNUH 2IGTA 4QKXB 4K3EL 2NUPA 1JHTB 2P80D 5AOZA 4OCRL 1BM7A 3WJMA 3MGAA 1HH6A 4N0RA 1TQTA 3CH1A 2WANA 4OLUH 2JH2A 3SEPA 3G5XB 3L5JA 4KGJA 3MJ9A 1PNDA 3SO5A 4PJ7F 2YN5A 3IWUA 4R90L 1PU0A 2DBJA 1Z0NA 3FOMA 1N26A 2FJUB 4O2FA 1OANA 2BWQA 5JPNA 4ZXBD 4GO9A 1OZUA 1SYSB 4LLWB 3UPAA 5MEND 3QS3A 4NQVA 4XI5C 1XEUA 4M7ZC 5KVGL 4I1PA 3L3IA 1HEZA 1OXYA 3GRBA 5DTFB 5E8NA 4OJCA 1CE6A 4HIQA 3BCDA 3MBEB 4HGKC 3T6XA 1FZKB 1BVLB 2OSXA 1FGVL 3RGHA 3WS3B 3VW3L 3MRHA 3ZIMA 4O2EA 4J3TA 4WUUE 2C3XA 1OLZA 5HPOA 4H7VA 1H3TA 3WIIH 1QFWM 1VJSA 3Q5YA 4MLIA 5IQ9B 3CQFA 2ODHA 4GKNB 3HOGA 4NN5B 4RMBA 4ZS6D 3G5WA 3VFVB 1PKQB 5FYKU 2CKBB 2YD7A 4HPYL 3D85A 3RL2B 3RDTB 4KOBA 1JN6A 2AQSA 4HZLA 1P1VA 1SDAB 4JFZL 4D9LL 2N59A 3IKKA 1HZHH 4IRSD 3KDMA 1JZ2A 4F33B 1KXHA 3OJMB 4XC1L 2BXZA 1L9PA 1IM9A 4ODUA 5L2KA 2X12A 3SPVA 3EO9L 4JZNB 2GIYA 2X0UA 4YHLL 2B77A 2X2JA 4D0BA 1NSNH 5DVOA 4Z7VE 5KYWB 1RU9H 4LPUA 4ELMA 2B59B 4NUQA 4WTZG 1DQLL 3E1ZA 2PYEE 5FDWB 5GPRA 5DA4A 5HYSB 2D0HA 2JXMB 3QEGH 4KKAC 1RHHA 4JFHE 3DIFB 4TF4A 4G71B 1XL4A 3DHPA 4L4JA 5KUMA 3RTQC 1JFQL 4PV9A 3QXDB 3LHPL 2XWTB 1HHIB 4HXBH 4N3TA 1E28B 1P6WA 5H94A 1HCZA 3QWNA 4RMWA 1T1WA 2Y3NA 5CBEB 4P2QB 4NPYB 3ULVH 4AYSA 5DMYA 5T1KD 4AQ1B 4YHNB 5GRYA 4PJXE 2XZCH 1YEFL 3U7YL 2X88A 1NFDE 3IN0A 5FFOA 2IAMC 2BOCB 2PLTA 3OGCB 5AYUH 4Y9FA 3RJOA 4N8UA 2V2TA 1FDLH 1T21B 3QXVA 3FNKA 4LOVA 3TVMD 5BJTA 5GS1A 2CBQA 3BQUB 5EUOA 1PZAA 4XNUL 5GGVH 2W80C 3US9A 1GZQB 3MLTA 5F1NB 2VMCA 4M7KH 4OLUL 1NPUA 2ATAA 5DEGA 4Y2DC 1QBLH 4UTAH 1U8JB 3DUUB 4ELKA 3HG3A 2A77L 3HNVH 4NQXA 5DO8A 3T3ME 4NGHH 1UGKA 5C3IA 3KLQA 5DEZA 4CVXA 1M2VA 4MZRA 3IJSB 4RA0C 4JDEA 4BKTC 2YEQA 3NCXA 5CFHA 3A4EA 5DLLA 4PJHF 4BFIA 3LCYA 3BPCA 1J8SA 2XZQH 3ASWA 4KV5E 2JQZA 3WG7B 1ZGLB 2EEXA 3LQZA 5FGBC 4GIOA 3OWRA 1JK9B 2AQNA 3U4BL 4DUWA 4DF9A 2XQYK 4MCYB 1IX2A 3ABLB 3QHZL 4FTVB 3P2BA 2YUZA 2DQIH 3AQZA 3LKSB 3QUGA 3VU1A 3WIIL 4YFDB 4NDMB 4FA6A 2J21A 3B8SA 3KEHA 3CN4A 1T20B 2AQQA 3MYJA 3VTAA 4E41E 1CFBA 1FL3B 3M1OA 3C6SA 4YHYB 4WRLA 3ML9A 1BBJB 3NJVA 4ZX4A 2CRYA 1AQDB 1U95B 2ZAGA 3LN4A 4FS0A 5C2BH 3MLPA 4A38A 1G94A 3V6OE 3QB7C 1HZHL 3UTSB 3RPIA 2F8VA 5ACMA 2NW3A 1XGPB 3VDBA 3DIDA 4W81A 2QPSA 4NRYB 2RACA 3GSXA 2B0SH 2LV4A 1MRCH 2K6ZA 1CPUA 1TG8A 4M1DH 2D2OA 5IMMA 1U6AH 4YLBA 3PWVB 4XN8A 1U8QB 2ED7A 3BVNB 1E27A 1FI8C 1RU9L 2VLKD 1I7RA 4H8UA 2H1PH 2QLYA 2D4FA 2WHVA 3L3JB 1KV7A 4MRCA 4DFHA 2QDWA 3IAPA 4PLKD 4ZW3A 2V6HA 5CP3H 2BC4A 3INOA 4S0TD 3ULUC 2P5EB 5FGCE 3Q48A 5HJ3A 3L9BA 1P53A 1W0WA 3M86A 1LMKA 3FBKA 2DTSA 4O9HH 1BFTA 3CNKA 4PBWD 1WP6A 3ULVL 2YUXA 4YPGA 5ADPH 2C1PA 3EJZD 4NC1E 4OFYA 2XZCL 5AW0B 3U6XA 1MHHB 1O5PA 2YLHA 5K1VA 2DD8L 2ZX7A 2XNAB 3VXOB 3DX8B 2IDQA 4IM8A 1BYPA 1YY9D 4D94A 4MZ2A 2YKKA 3FF7A 4JO4H 4Z8FH 4XNYL 2JKSA 2P44B 2VDQB 5DHVH 1MFVA 2CLVA 4NKMA 2YFOA 1QLFB 3ATEA 5GGVL 2F9BT 4WTXA 4DQOH 2CLZB 2EIDA 4Z7WA 4PY8I 3ZDZB 1CB4A 4M7KL 1KB5B 5EU4A 1NCCH 1ZE3H 4M1CD 4UT9A 1MFDH 2E56A 2V5SA 1QBLL 2BSEA 4XHQA 4UTAL 3SQBB 2ROXA 3HNVL 4YZWA 6PAZA 4NGHL 4HWZB 1YJDH 3IJYB 3D08A 1TZOA 2YN3A 5HGBA 1MCHA 4TNEA 2YQBA 4BQBA 4XPGL 2XZQL 5B39A 2BHYA 2F74B 3BISA 3ZE0F 2FNBA 5BRZD 3CCHA 4QJ4B 1XH1A 3KYNB 4KDTC 3UO1H 4IDLA 4QGTA 3W39A 5DS2A 3UZQA 2H32H 5JW4R 1J87A 4A6YH 4L8DB 5E8PA 5KJ4A 4HIHA 1T1ZA 3WXVL 2BVQB 2C3HA 3GF8A 4IRJC 4NZFA 4X4MA 3GJFA 3GIVB 3GTTA 2DQIL 4P46C 1K6QH 1RIHL 5BQ7A 3GSRA 4Z7NF 1VACA 2JKXA 4L3EA 2L04A 2P5WE 3PHOB 4EN2A 1SEBB 1RERA 5ANMB 4OVUA 3V5HB 3QNXB 3TCLB 4R5VA 5DJ2A 2WQUA 1KY7A 2X4RA 5FAAA 3VXSB 3QUYD 2CGRH 4GS7B 1XDTT 2J8HA 5C2BL 4PPTA 1OY3B 3VXPA 3T0EA 1XZ0B 1WFOA 5C7XH 3V0DA 2OYPA 1JS4A 1ACXA 3FUJA 3RTQA 3UBHA 2EZ0D 3SO3B 2K7QA 3P77B 2B0SL 3ALXA 1MRCL 2GKIA 4W68A 4AV5A 4M1DL 1TZHB 2OL3A 4UIMA 2OTUB 4KMLB 1U6AL 2IMMA 5IV2B 4WWKB 5E00A 5B8CA 2ZTBA 3UPRA 1IGYA 1HKFA 1Q9LA 2GCYB 2IOOA 2W8CA 5KSBB 2H1PL 5I0XA 4WUKH 3HJEA 5C8JB 1SY6H 1UURA 4PJCA 1XEDA 4A67A 1G1CA 3OKDA 4ODHH 3LRLA 1M1XA 3BN9C 1KBKA 2DAVA 3O9WC 4BSVA 1QBML 2FWLB 3NEEA 3R4RA 1M6OB 4W9IC 4GI9A 4LARH 5HGDA 3R19A 4KJYB 1N5YH 4O9HL 5ETUB 1JGUH 1OAKH 1OQOA 4LEXH 3SY0B 2PPAA 1DQKA 1DVXA 3PGCA 3MRDB 1M2OA 4CVUA 4W4OC 4U05A 4AW7A 1WTGT 1UYWH 4GBXB 4BH8A 1CWVA 4JFYA 2QLVB 1K3IA 4IBWA 4Z7OB 1QYGH 3KPLB 4A2LA 3MV9B 5HDQH 3JBG7 5GZOC 2I24N 4MQXC 4XNMA 4Z8FL 1PFCA 4MJIA 1R46A 4DEPC 2FSEA 4G1MA 1T5WB 3U36A 3GPEA 3V4PB 1OSYA 5GS0C 4YBLC 1XSKA 5FGBA 4WNQA 3Q6FB 4ZUUB 4DQOL 1AGBB 1U92B 4FD0A 1AKPA 4L3FA 2JCCE 2VUOA 1A65A 1NCCL 1QVOA 4BSWB 2BNRE 4LSQH 3ZE2E 5FHBH 4DO5A 1YJDL 4M3JA 4W9CC 5FHAH 3DK2A 3QULA 4RRPA 1NCAH 4XBPA 4UQIM 2CO1A 3KMDA 1XGTA 4YHMH 3TNMA 4PTTB 3MRBA 5FV1L 5DUBB 1VGKB 2NQ3A 5EN3A 3GLAA 5JHDE 2GYSA 5BUAA 1BXVA 3UO1L 3TBTA 2X4TB 3D0VB 1E9OA 1FUNA 1FFNB 1MFCL 2IC2A 2RR3A 1NEZG 1XQ4A 2FGWH 2P5PA 3HJ0A 3O2VH 3PHSA 2WLMA 4G6JH 4Z7UF 2NUTA 5JMOC 4UOQA 3GSUB 4JDTH 4E42B 2F0CA 1YQVL 1XF2B 1K6QL 3CVCA 1LEIA 1OF2B 5BOJA 4QHLB 1H6EA 2D31B 4Q9BA 2BY2A 2QFRA 4ODWA 1H8OA 1KTKE 5KJRH 1WF5A 3IEAA 2XTSA 3LYRA 3NIGE 3CIQA 5BV7C 1G6RH 2CGRL 4K8RC 1ZLUH 4PBVC 1R5WB 2DOCA 3HE6C 3P0VH 2R2EA 2D9CA 4F7KA 4L18A 2HVJB 5C7XL 3Q8EA 5E1GA 3M45A 4AJYV 3BW9A 4GUQA 2KLRA 5IKCB 3H3PL 1REIA 3S4SB 2F8XC 1RV6X 4PRHA 4DVBA 1IBDA 1N18A 3NCWA 4XNZC 2PW1B 4I0PD 5BZZA 5CIPH 4CW1A 2X40A 4BDVB 2F2HA 3AITA 5EV7A 1INEH 2A9DA 3GSNH 2YO3A 1S9VA 4PRBA 1E2ZA 4WUKL 1SY6L 5EIIG 1ORSA 1UM6H 1X4XA 3FFCD 3LPGA 3V10A 4Z77B 4ENED 1OSZA 2G5UA 4ODHL 5GGTL 1L6ZA 1XCTA 1M05A 5E5LA 4NNYB 1MIEH 4FI7A 4ONFH 3UEZA 4LARL 4D0DB 1N5YL 2HT3D 2RQ8A 1JGUL 2ARJQ 4ZG1A 4LEXL 4MQTB 4L4VD 4UDUB 3AXLB 5C0FA 1X4YA 2OJEA 4I4WB 4I48A 1P6FA 4LSTH 3FZUD 1HJBC 4L37A 3OAZK 43CAA 3KGSA 3ARXA 1FAKT 3UZEA 1QYGL 3AT9A 5I28A 4PJFA 1KV3A 4A04A 5AVRB 5HDQL 5I23A 2EEFA 2B9AA 3OSVA 1NC4D 5FYJE 1QA9B 1CFSA 2DWXA 2VN6A 1V7NH 3ESUF 2UXVA 4X9BA 3KXFB 5BW7C 2JJWA 3DBXB 4PJDF 2EXWD 1NM4A 2AKRA 5PAZA 2VZOA 2JQAA 5IMLB 2CALA 2JKWA 2LGNA 2H3NB 5LDSA 3R4DA 1T1XB 3UG5A 3N41B 4XVSH 1IC4H 4OM0L 4YWGH 4IRJA 2Y6SC 4LSQL 2XVLA 4B9GA 3OGOE 3ES6B 5FHBL 3TEWA 1XSOA 5FHAL 4HIEB 1K9TA 1NCAL 2GJJA 3T1WA 3FO2B 4M93B 4YN3A 2RIKA 1EHAA 3ARUA 4YHML 3RIAK 5DGRA 2NY7H 2XJLA 3RX7A 4GW1A 4P5TC 4OIAA 4AMKH 3O41A 1CGUA 3VRIB 3TA3D 3CFKB 4ABQA 4KAQH 2Q20A 1X7TA 4G7QB 2YRLA 3PGDB 2YR3A 4U1IA 1Q8MA 3OKKB 5AVTB 1WZ1H 1NCWH 2FGWL 2M8XA 3O2VL 4N87A 4NYLA 5ALCH 4G6JL 5DMKB 2BHZA 2W0FA 2NY0C 4YGVB 4BFGA 2ESVE 1SOSA 4AMXA 4JDTL 4OQTA 4YNYB 4RZCA 1CI5A 1OTSD 4CJ1A 4BGLA 3X1NA 2ADGB 5KYUB 2DM3A 4LGPB 1QR1A 2Z93B 4FKKA 1FRGH 5KJRL 4G2AA 1BEYL 5B1JC 2X10A 2WVSA 3TO4B 1G84A 4W9HC 4XTRD 2ZPKL 3N40P 1BLNA 2E8ZA 5EZLB 1RCYA 1MJJA 2J2ZB 1CLOH 3Q8BA 2BNQD 1H0DA 1JTPA 1QP1A 1MCDA 1AP2A 3KVQA 1B3JA 4QTIH 4U6YB 1DQJA 2GTWA 2NZ9D 3RYMA 4F57H 4ZQTA 4TOYL 5JPMC 1SHXA 4GAGH 5GIRA 5FWQA 3T77B 2GSMB 3LS4L 4N1HB 4QRRA 3AABA 4W4OA 5IHBA 2WK2A 1M4KA 4M48L 2Y7QB 4HKZB 2YQGA 5EEVA 3G5ZB 4R83A 1INEL 4FQHA 5DS8B 3GSNL 1KZYA 2X3CA 3HFMH 3NABL 4F7TB 4K71C 5GZOA 1UM6L 4F7CA 3RFRA 3HE7D 1ZDQA 4MD5B 4AGQA 2I07A 3ZVVA 2Z31A 2NY4C 4F93B 3ZBMA 5I26A 2E27H 1JE6A 4ZUSB 4WUUB 5TF1H 3ECBB 1JYNA 5HYSG 4ONFL 4PREA 4P2CG 1KCVH 3ABGA 2QQNL 5I0VA 5IHWA 4N2OA 1T2XA 2D0GA 3DYMA 3M1CA 2XN9A 4U1KB 4F8OA 1Z5HA 4D3CH 2D7PA 3OMAB 2VR7A 2JKIS 4LSTL 1GMEA 1BQHA 3VD0A 4CU7A 2CBMA 2G3XA 3I2CH 5TE4H 4NWTH 2FEDD 4TPRH 3D4GA 1ERNA 4A7TA 3TX4A 2GTZB 5J6HA 3F00A 1PD1A 1N2RB 3ULVD 2FQFA 2W0LA 4KO7A 2BX5A 4KROB 1V7NL 3RUGA 3BIAX 3B3IB 3B2DC 1FIGH 2A1WH 1PD6A 3O11A 2G5RA 3FT2B 1DBKH 2NX5E 3RWCB 4Z7VB 2QQQA 1L9RA 2NQCA 4XVSL 1CTNA 1IC4L 2PYEB 5HGAB 4YWGL 4QHMB 2QQKH 2AAAA 5I6MA 2VSDA 5HY9B 1I1FA 5LJYH 3QUML 1JPSH 4MJ4A 2NY1B 2CKBH 4MYPA 3VUAA 2XTJC 3SDDA 2L7UA 3KCWA 3DVNA 1FYTB 2NY7L 3EYQC 1IC1A 2AK4D 2VR5A 2GHWB 3HE6A 1HOCB 4AMKL 3DRQB 4DN3H 3H9HA 4ZS7H 2VC2B 4KAQL 1E3XA 4AC2A 4HK0B 1S8DA 3FQTA 1JHKH 5EG6C 1NM9A 3ZKQD 1WZ1L 1NCWL 1NFDB 3FU3A 5ALCL 3P3TA 2R2BA 3BIKB 5JHLA 4IJ3C 3EGXB 4L2YA 3WY4A 5EO0A 4HWEH 1TZGH 3ECWA 3QJFA 2ZWYA 3UTOA 1XX9C 4JN2A 4MNHA 1A4KB 5DJAB 5FKPB 3VXMA 1MJ8H 2CCVA 2V8MA 2VW6A 1JZ7A 4PR5A 4GEJA 4L8SB 1N9PA 1FRGL 1GJIA 2N0KA 1XCXA 1ET8A 3CZEA 4OUOA 4Q2ZB 4FYQA 1SXNA 2NTFA 5DJ8A 4ELMF 1FYHB 5FW7A 2F15A 5E23A 1CLOL 3ZT5A 3T3MB 4P99A 4ANXA 4IHOB 4KU1A 3QZMA 3Q43A 3KM2A 5IIEB 4QTIL 3FTYA 2YJLA 3BSHA 3IXAB 4Y16C 1JUFB 4F57L 3CBJB 4NS0A 4GAGL 3ZTNL 3EFFA 1M56B 3N43F 1KNOA 2DICA 3QR2A 4Z78B 1U3NA 2SEBB 4W9JC 3ZYOA 2ZNWA 1SQ2N 1I8LC 3EAKA 4U1JA 4AV4A 3VI3F 3FQ4A 4CADB 1AXTH 3N1QC 4I2XA 2KMWA 1JWSB 4BFFA 5IB3A 4J1UB 3HFML 2H0EA 1HEHC 1ONQA 2NYYD 2P24B 4P5KB 4X8GA 2BVTA 1AQKL 3FTVA 1MI5E 4A55A 4ERSH 4FFVC 2E27L 5BW7A 1BEXA 2X87A 3LV3B 4PRID 4WFFE 5MI0B 5TF1L 5IB1A 2Q87A 3SJVE 2XZAH 2BHFA 4L48A 5EUOF 1SXAA 1WS7A 2A73A 4NBYB 4H13C 3SN6N 4HUVB 4E41B 2ZOLA 1ULVA 2CD0A 1BG1A 2G5BA 5AVXB 1DJZA 4D3CL 3NH7H 1YYMH 1DVFC 1Z6JT 4MXQD 4K5LA 2AS5M 2NY3C 2R0WL 5D1QD 4LB8A 7CGTA 3I2CL 5TE4L 5DRWA 4NWTL 1CD0A 4TPRL 2FO1A 4GQZA 3ILDA 4MJ6A 3OJVC 4KTEH 1S3KH 4GXFA 4M8RA 3U2SA 4XPFH 2VWEC 3MLXL 2DEWX 4MKMA 5TJWK 3NN8B 5JIHA 2BP0B 3TH3T 4JM2B 1RH8A 3ZDXB 3ZL1A 4P5TA 3HPJB 3L3DA 4LCVA 1FIGL 4R7NB 2GJ6D 4EIZC 4TSBH 2H2PC 1NCIA 1DBKL 2FJHA 4F7PA 5DEJA 1YYLH 5C86A 2APVA 4JRYA 4YH6A 5LKNA 1S9YB 1WTLA 2GBVA 4LU5H 1C5CH 1JPSL 1ET5A 1EFXA 5FGCB 5I17A 3TBVB 1XF3B 1IC7H 4KO5A 5EO9A 4XNXH 2JK5B 4FZEH 1NBYB 3C5ZC 1NIBA 4WEEA 1NC2B 4DN3L 3UBXG 4ZS7L 2GITA 3L4UA 5IROD 3QO1B 5SX5H 4NKDA 3VU2A 4CA4A 1KBPA 1JHKL 1QFWH 2GFBA 3GSVB 3MX0B 4W4NA 5JW4Q 3WN5B 2Y1YA 5JPMA 3FB5B 4UV7H 3CFJA 1ES0B 1UWFA 3NPSB 3L5WA 1TZGL 3FTZA 4HISA 1O9VA 3K4ZA 8PAZA 4M8QB 1CDGA 3NK4A 3QQDA 3W0WA 2Y3AA 1MJ8L 1C16A 2OMVB 4Y4KD 4NBZB 5GS2H 1NAKH 1S78D 1F90H 1CN4A 4JDVA 1PMYA 4HGWA 3V4UL 4K23H 1WFMA 1JYVA 3FPXA 5DEFA 2GI0A 3VFUB 1FVDA 5DMIH 4GXVL 3TF7C 3D4ZA 3LKOB 4JFDD 2EAEA 4LPXA 1E9PB 1JZ4A 1Q9KA 2CDEA 4LL9A 1FJ1B 4NKIL 1R3HB 3RWHA 4Y19A 1WZAA 2PR9A 3S96B 4FLHA 4WO4A 4UYQA 5I9QC 5HSFA 4NZTH 5TGBA 4MA1C 1B0RA 1AXTL 2VDQH 4LL4A 3VGFA 5A6LA 1FE8L 1KJVB 1VRSA 4OD1H 2XI9A 2ZUTA 3MACH 5CJQH 4GNKB 2ZOKA 3D18B 2ZUQC 4K3JL 2ZNXA 3WO4C 4NENB 1R5IB 3BKMH 4ERSL 4M6MH 5F89A 3UYRL 3CVIH 2VB5A 2CWRA 2XZAL 3MRKB 1K5WA 4NUJB 2W91A 1FNEB 4J3BA 5L2KE 1CYGA 2WD0A 1V05A 3QJSB 2P5WB 4CDHA 4HCGA 2QADD 4HKJA 3FH7A 1YUKB 4J6IA 4M61A 3K5RA 5D70L 1FO0A 3F6LA 3MLUH 2QSQA 4ELME 5DXWA 2X4UA 1FZJB 3EZJB 3F7VB 4IIQB 1E6JH 1L6XA 5CP7B 4B41A 5I16A 2QGEA 4KTEL 1S3KL 3V6FA 1TQVA 3SYAA 4ODBD 1KT2B 2F5BL 1RK1A 5E2WL 1FNFA 2WZAA 2DQEH 2FQDA 3P4NA 1XD1A 5KANI 1TQSA 1ETZB 4BHUA 4KKCC 5DURB 1VB9A 2X4SB 5C0EA 5J8OA 2VDMB 3LEYH 1KY6A 4WW2C 1FZMA 3O3EB 1ZEAH 2DLGA 4TSBL 3TBSA 3PNWB 3P3SA 1TVBA 4NHUB 2Q3AA 3QQ3B 1XHHA 1YYLL 3NUKA 4UCFA 3LAFA 1WQVT 1ZOXA 5BZDA 2E4TA 1IE4A 5D4JA 4AYID 4IMLB 4BELD 5B1BB 2EH7H 4QNPF 1D5MB 3WAKA 4LU5L 1C5CL 1YMMB 3EJRA 4WCYH 2H5UA 3PFUA 4R2GC 3VD7A 5JA9A 5IM7A 1IAMA 2WXPA 1DQQB 3HI6H 2QELA 4PIBA 2W0KA 1IC7L 1AS8A 1PBYA 5INCA 5F70A 4XP5H 5EUOE 5EIVA 5GGUA 3E9UA 4FZEL 4M7LT 3HZYA 3RY5A 3WNPA 5T3ZH 3UZVB 1IBGH 4Z76A 5HPMB 2IQAB 3MCKB 5T1DL 3I6GA 4EI6B 3HNSL 2ICES 3QWRD 3H4HA 4Y16A 4WDIA 3BT0A 1QFWL 3MPCA 4OIFA 4F9LC 4WZ9A 4MA3B 5IESL 2WSDA 3MNMA 4FP8H 2N1TE 4PWKA 4RIRA 4IS6A 3CX5J 4UV7L 2PO6D 2W07B 4BV1A 4OZIF 4UNIA 3I3EA 5KG9A 5HI5C 3VACA 3DOHA 2IJ0C 3WTTA 1TJGL 4UQ2B 1CDJA 1I8LA 5CJ5A 1D5BB 1MREH 5FA4B 1LJMA 3QDGD 5E6ID 1NGYA 3MOAL 4XC3H 1JZHA 3UGXA 2JCCB 2VITB 3CVHB 3KW7A 4P59H 4YOKA 1NAKL 3BHBB 5E03A 2Z65C 4BRJA 4M5YH 3HMXA 3HR5A 1R3LA 4V1DA 4LLVB 5E2UH 2BNRB 3SE9H 2VH5L 3UCQA 4FI8A 3ZE2B 4N86A 2HKHH 4H0IA 4KKBC 5DMIL 4PJCF 4FXKC 4KQ0A 2MCG1 2YBRA 5DC0A 1BQRA 3UJIL 3VJ6A 4MD0A 4DGIH 2FTAA 4MGXA 1ADQH 3LZPA 2WMPA 4LNVA 3DVIA 3PQYA 4HQQL 4M62L 5T1MA 1DVFA 1ZLDA 4QT5A 3RNQB 4NZTL 4W9GC 2XWZA 3X3FH 1YEEH 4NXSA 4OD1L 1Y6MR 3MACL 5CJQL 5D72H 3UGUA 5KVFH 1P84J 4AKQA 2L4OA 4Y0GA 4A39A 2WJ7A 4JFFB 2ZIDA 4CC4C 3BKML 1IGCH 2FATL 2IH1A 4M6ML 4U3CA 2WQVA 4EAEA 2I60H 3CVIL 1B9ZA 3BE1H 3X12B 1ND0A 1J11A 3WTWA 1HSAA 4AK2A 4P4KB 5C0BD 3QIUC 3WYRA 1DEEA 1I8IA 5CLXA 5HYQB 2ATKA 2J1YA 3NIGB 1CFQB 3MLUL 4PWGA 2I9TB 3QFJA 1TKWB 4AENB 4G8GD 3LZLA 4HH8A 4RFEA 4BKLA 3LMJL 2F1BA 4PP2B 1E6JL 4KX9A 2W0PA 2ZXGA 5IOPB 1SMAA 2SODB 2ZF8A 5AVVB 4PJBA 3PHQA 3CFMA 5F7EH 3GEFA 3MN8A 5ICYA 4FFYH 4PJGB 5F7HA 2OR9H 3ARDC 4Y5VC 2YPKA 3LEYL 5MEPA 5EC2A 1ZEAL 5DHYB 2EYSB 1O7DC 2AQRA 5IOKA 1HQRB 1CU4H 5DSCB 4S2SA 3C8KB 2PCFB 3RWFB 2R7EA 1RK0A 5HHNA 4F2EA 2R2HA 2W60A 3KD4A 5J56B 3HCVA 1UATA 3BEWA 5D96B 3MRGA 2R0KH 4WCYL 2GBUA 3I50H 3CXHK 1Y6KR 4JO1H 3W38A 4LSSH 1D7CA 3HI6L 2WPGA 5ABZA 1Q1JH 3MREB 2FO4B 3FB8B 4JE4B 4XP5L 4DO6A 3TJEH 5T3ZL 3CFTA 4JFED 1IBGL 2DQHH 1F3DH 4PJ8D 4Z7WE 1CXIA 1QSFD 2Y72A 3FT3B 7PAZA 5AVSB 5FC9A 5CWSB 1MUJA 2VXTH 4R84A 4Y2OA 1G7MB 3K3QA 2LLNA 4N2BA 4FP8L 4GT0A 5E7BA 3HI5H 2MJWA 1NBVH 4LSRH 5I0DA 3EH4B 2MKLC 5E8EA 4IGBA 1A7NH 4L4TB 5F1OB 2FJFA 4F15B 3QE5A 1MCOH 2X2UA 3MRPA 1MREL 4BFEA 5I8CA 3MLWH 2ARWA 4ZI8A 4XC3L 3JTSA 5GQBA 5GXBB 2ZONA 4X6DB 1J18A 3DETC 4ZUWB 4ANVA 4LVNC 5A7EA 2YD3A 4URKA 3FO1B 4KNSA 4M5YL 4XXWC 5E2UL 3C60B 5FM5M 1CD8A 4MYWB 3A24A 2VYRE 5I5RA 1LO0L 3DARA 1ZV5A 1GS7A 2V5MA 4X4ME 4J3OF 3KAAA 1HIMH 4DGIL 4UILH 4QXTA 1ADQL 3V0FA 2YMTA 1AGFA 1RSFA 3HEIB 4L3EE 4U0RB 1I7ZB 4KRPC 5E0FA 2H9GA 1BD2B 3S2AA 1QFOA 4N0UB 5JO5A 3MLVH 2NR6D 1HOEA 4M4RA 4YDVA 1YEEL 4X2UA 5DJXB 3X3FL 3APCA 4M9OA 1DEDA 4EUPB 5D72L 3IT8D 5B38A 5KVFL 2VRKA 3TN0D 3T0EE 4JJOA 3DV6A 3QARA 2CRMA 3L3OB 5DJ6B 1ZJBA 4AQEB 5T1LA 3RJQB 3AREB 2ESVB 3EG9B 4TTGA 4KZDH 1L0XA 5C09A 2I60L 3EH5B 3BE1L 5FCSH 1NKRA 1Z0MA 4WW2A 2VLJD 3L16A 4G43B 3TBWA 3VH8B 1F02I 1GS6X 3K91A 1I85C 1NL0H 1EA9C 12E8H 1HILB 4JG5A 4PRPD 1GC1L 1HDMA 3EF7A 1MN4A 4UIKL 1B0WA 1QFUH 1WDAA 5IVXF 4C58B 5ILTH 3H0TA 1LEGA 4U1HB 3NCCB 3PWPD 5F7DB 5C6TH 2CHNA 3GINA 2A7BA 1XIWA 1U8OB 1W16A 5AVWB 4UAOB 4P23B 4PJCE 1BAGA 4YVUA 3CSFA 5AVYB 2QPFA 3KE0A 3BPLB 5LBSA 2P1YA 4HSAC 3E1F1 3VWJC 1GRWA 4CMHC 2HMIC 1CCZA 5I6XB 4FFYL 3RGBA 3RVUC 1ZS8B 5JIQA 4YSUA 2OR9L 3APDA 3IDNB 1QFHA 1SOXA 4RGOH 3WHXB 2FLRT 4EXKA 1CU4L 2I9LB 2CIKB 4NUMA 2FBRA 4F9LA 1R5VA 5MERA 2H1XA 3WKNA 4PGBB 3APFA 1JI1A 2CUAA 3CZFA 4FLSA 1DQDL 3IETB 2R0KL 3MUGA 3VFNA 3I50L 2UZXA 3KGTA 4JO1L 4NRXB 2IIJA 4LSSL 5D1ZD 4MJIE 5EBGA 1BYNA 2QZQA 1Q1JL 2VDLB 2YGNA 3S37L 4PWIA 1TQUA 1FNAA 5DJDA 2WVTA 2J6EA 3E3QC 43C9A 3MRMA 1AGEB 3J7HA 3TJEL 2ISDA 4GLRH 3WGUB 1ZWIA 1M7DA 4FXKA 1HQ4B 2IFGA 3GI9L 2PCYA 5KS9A 5E7FA 3HI5L 1NBVL 3K6NA 4LIQE 4LSRL 4G72B 5SWSD 1XO8A 1ZT1A 1FIEA 1YECH 1YN7B 3Q2NA 4CSSA 3B9DA 3S35H 3U6RA 3ZR6A 1MCOL 3ISWA 4U3HA 4XMLH 5EC1A 4YIQA 2JKNA 3MLWL 1OT4A 2H6UA 1CDBA 2NX5B 3N1GC 1H3PH 5D7KD 1KGCD 3FN3A 2VISB 1MG2C 3PJNA 2C9PA 2DN7A 4CC4A 4FQQB 2XRAH 4CSPA 4YDIH 1A1NB 1JK8B 1ZS2A 2R69A 4XO8A 1S9KC 1ETB1 1G9NH 1HIML 4UILL 4K55A 3KYOB 3UDWC 1SPDA 2DLFH 3QIUA 5DFTA 5G5DA 5C97A 4PS4H 4WTZA 3FU8A 4F1ZA 4P2QD 3VFWA 3MLVL 2G2NA 3B7RL 3OTTA 4DEUA 4TV3A 1XR8B 3L4YA 3PG2A 1WZLA 2JIXA 3CMGA 3UJJL 3ZW3A 4B9IA 3LNFA 1M7UA 3GMOA 4G5AA 3ULUE 2AJVH 4APQC 1IAIM 5LB1A 4ZTOH 4AIZA 4IRZH 2BVYA 4NQED 1IGTA 3ROOA 5ESAA 1S7QA 2WAHA 2UWEA 4WK0B 1D5XA 5F7YC 4PRHE 1E2WA 4MBRA 2IGLA 3MRLA 4JBSA 1NL0L 1MCJA 5DZOA 1NOAA 3MRFA 4JLRB 4F1SA 12E8L 3HUJA 4YMPA 1II4E 1ZV9A 3HC0A 3L6FA 3NP4A 1XGQB 2AJ3A 3KBPA 1QFUL 1R6VA 5CHNA 4EI5A 4GQ9L 5ILTL 4QTHB 1H3XA 3ZL2A 5C6TL 4MD4B 4NNXA 1Q72H 1A7PH 4P48A 3M1BA 4HEPA 3IK2A 4DJMA 2ROYA 5JOPD 2FIKA 1F6AA 1W6WA 2DQ6A 2A9CA 4JFPB 5MEOB 4JHUA 1MH5A 1LO5B 4S1SH 3ILEA 5DVMA 4F5CA 4I77L 1CXEA 3RILA 4U7MA 2HWZH 2NCEA 4KUZH 4RGOL 4WFHE 2R29H 5AKTA 3UEQA 1F3DJ 1ZTXH 4FF9A 1HCVA 4DP8X 1QACA 4IKNA 1EDYA 4Y4FC 4QYOB 1QW8A 1MI5B 1P7KA 4PJFE 2CHWA 4XVUC 2OJZL 2DM2A 1EJ6A 3CVDA 3PIQB 1IL1A 2E74C 1N7MH 1I1CA 2BSBA 2NSXA 2BK8A 4PGJA 4QOKB 3HVDA 4XP9H 1VCBC 1ZHNB 5D6DA 2RCSH 5KSAB 3MRJB 2ZJSH 1WD8A 3H55A 1E8WA 2AJXH 4AQAB 3ZHKA 1B90A 2YUWA 3IDXL 2WCGA 1FG2A 1RJYA 3F2LA 1QSVA 1W72A 2EC8A 4HBQA 2NNAA 1J1XH 3T08A 4L3AA 1YECL 3S35L 3KS0J 4PRNA 4HETA 1IGFH 1ML0A 1OE2A 1E3ZA 4XMLL 4X6EB 3L4TA 3UIZA 2WWMC 4X7DC 1OGAB 4XOEA 5E5MB 4Y5XA 1TSRA 1TTAA 2R59A 1W15A 3X1FA 2ED6A 4PLJC 3SDXF 1HZKA 1H3PL 1KPUB 2M1KA 5DYOB 3JT0A 5IW3A 3VG9C 1YNTA 2F19H 4RESB 3CG8A 2OMXA 4YDIL 3N55A 1JOIA 3AAZB 4UV4H 4JFQB 4KTYA 5GS2D 1G9NL 6CGTA 3LD8B 1NQBA 4KKRA 4WO0A 2HA1A 2YJQA 2DLFL 2XTLA 5AUMB 1RUMH 1EVUA 3AC0A 4PS4L 3VFSB 4HPOH 5LXVA 2WXFA 1RHFA 2NUPB 3IDJA 5ID0A 5HYFA 1JFHA 2O72A 3RWEB 1G7LA 3WJMB 1HH6B 3CH1B 1L9NA 1EEQA 3O3BA 5HVWA 1OP3K 3VXUD 2KKQA 4J4PD 5DI8A 2X05A 2AJVL 3JWOC 3ZE1F 3VWJA 2WTRB 4ZTOL 1WZMA 4IRZL 3P9MA 3LEVL 3L08A 1Y0LA 4O2FB 4P07A 2IDUA 1LNUA 1X9UA 4Q4IA 1MPAH 1UJTA 1TQWA 3BP6A 5JPNB 1U8PA 4RX4D 4X7SH 4JPQA 1GAFL 3GMNA 5AB9A 4X98B 4PRDB 4M1GH 5C0IA 4NQVB 3R06A 4QRRE 4X6FA 4CU6A 1IGMH 4FFZL 4BH7A 2DYPD 1HEZB 3L3IB 4G7SB 5E8NB 1GJWA 1CE6B 1NFIA 4DKEH 4HT1L 3IKCA 1AO7B 1Q72L 1R24A 1A7PL 5E94B 2FVNA 1MHCA 1BREA 4QR7A 1HYSD 1U33A 1MLCB 4N90D 2WBJC 3MRHB 4EN3C 2AC0A 4O2EB 4KFMA 5DUPH 2DMHA 2H0PA 2X09A 4RAUA 2ZCLH 4S1SL 3IF1B 1TNNA 2FT7A 2HWZL 3F5WB 4KUZL 2XN9E 2R29L 3KL0A 4R97C 1GGYA 5L8LB 3O8XD 1ZTXL 3WIHL 1SXCA 3V4VA 1KTRL 1UFUA 3D85B 3E9TA 1JN6B 4HUCA 3OD3A 2GPZA 5LN4A 4OAWB 1G0XA 2G60H 2IPKA 1FHGA 3KDMB 4M43H 4XO5A 4FAAB 5IHUH 4MJ5A 2C9AA 2WLNA 4Z3GA 1CZ8H 2UUDH 1N7ML 5IB5A 3RUGE 2A74C 5EOTA 4ALAH 4ODUB 4JKPH 1YA5A 2ZP0T 3L1GA 5H2BA 1JJUA 3EYOB 3SPVB 4XP9L 5LCVL 2QR0B 3KJ4B 3NA9H 1N68A 2ZJSL 1TPXC 1SZNA 3RWDA 5C0NC 2AJXL 3QUZA 1UJ3C 4P4RB 3EH3B 4P5MA 3VI4A 3UDWA 5T3ZD 3HBGA 1G7IA 1GA2A 1J1XL 2Z8WC 5CZVH 1RHHB 3DMMD 4WNJA 1OF0A 5C08D 1CL7H 3VGGA 1TEGA 1IGFL 1T0NA 3DOIA 1G5GA 1EJFA 4PV9B 2P52A 1TTCA 1UD4A 3UIYA 3LPFA 3OXSA 1HEJC 3GHBH 3WLWC 1OE3A 1ILUA 1WAAA 4JG0L 4X5WA 1YMHA 3U25A 4V2BA 4ECNA 5FYKE 4B5ZA 3BWSA 3DPBB 4YSSA 3ECVA 3HC4H 1N12A 4OI8A 5ICXA 4OUUA 1OGPA 2WAQA 1KIRB 4U1MA 1XSJA 4PP1C 4DERA 1NFKA 2OCJA 5GS1B 3O6LH 1NUGA 1RUML 4HPOL 3D0LA 3VXME 3P0GB 2JKTM 1UWEL 1CFVH 3HAEB 1MAJA 4X0KB 4AT6B 4ACPA 4ETQB 5CAYB 3GUFA 3O4OC 3SYQA 1A6WH 4NQXB 3MV9D 4W6WB 4CVXB 1M2VB 4HIXH 3QWOB 3C5JB 4JDEB 3M8OH 5F7KC 3VXNA 5J1SC 3L17A 4OCYH 1CLYL 1FQ9C 1MOEA 1OLLA 4KHXH 1AY1H 4M1GL 3MLZH 4KQ4H 2A4CA 5BS0A 4K3DH 4YSPA 1IGML 3MJ7A 3E2HB 3LQZB 4Y4FA 3TEZA 3EYUL 4I2XE 4NT6A 5DD6A 4DKEL 4E9WA 4EQ2A 3HLAA 4ZXBC 4YK4B 4UQ3A 5HDOA 4PJ5D 2YPLD 2XX0A 2ZKHH 3QCTH 2XFXA 1NBQA 3N04A 3QEQB 4N3UA 2X38A 5DUPL 3N44B 4G42A 4YEEA 2ZCLL 3BVUA 5HHQA 3IMTA 1L9SA 5J12B 1SEQL 5I18H 3MV7D 4FADA 3BVTA 1AHWA 4UB0H 3C6SB 3GMPA 4B95C 5D6CA 1IUZA 1MFUA 1A02N 3LN4B 3GI8H 3ZE1E 3D52A 4OCXL 5CEZH 4A7GF 1UVQB 1JV5A 5B21A 3BFOA 3RPIB 1NICA 2G60L 4M43L 1M71A 2ADIA 2NW3B 5IHUL 5CJBA 4WK2B 4GKOA 1T1YA 1CZ8L 3LRKA 2WLIB 4W6XB 3GSXB 4ZS6C 2J56A 3Q1SL 1O5DT 5C07D 4WFED 5TH2A 3WEAA 3WKPA 1UH3A 4ALAL 4JKPL 1NDMA 3TPKA 5L9DH 1WWBX 5TK4A 5IMMB 3LQAH 3NA9L 1Z9LA 4JPWH 1NEZA 1UCTA 4IRSC 4MJJA 5D1XB 5MHSD 5J1TC 4R4BA 1E27B 1MSPA 5HHOA 4H8VA 3C09B 3NJMA 4ATWA 5TFSH 4JRYE 5DYFA 5I1GH 2P9RA 1OB1A 3QQ4B 5JW4N 2QPUA 2BC4B 4NZDA 4HLJA 5CZVL 5GRXG 3S3SA 3UTTA 4J3SA 2FQGA 4C8XA 1HHGA 1W0WB 4JY4B 4X4XA 1QEWA 3NJNA 4UZSA 2WCSA 4N2FA 2YGVA 2YRBA 3QJHB 2XWBA 2C4XA 3QXAA 3QYMA 3DJSA 3GHBL 1G0YR 3DX2A 4Z3JA 5CCKH 3MJGX 5T3XH 1WHPA 2J8UA 4TQ8A 1Q0YH 1F2XK 2YA2A 2C1PB 2GAZA 4K7PH 4NJAH 5F6HJ 2WC7A 4NQCD 3HC4L 4B50A 2CM5A 5DF0A 4PVNA 3ARRA 4RRPM 5TD4A 3D34A 4QHKI 4YHPB 3LVTA 2IEPA 4M7ZB 3O6LL 3BWUF 4DIXA 2CLVB 5EOCH 4NKMB 3W0WE 1GZHC 4TSAH 4PG2A 3WHE0 4Z7WB 5JW5A 2J44A 3FUMA 4U0QB 4HDIB 5EU4B 2BZDA 4RBPH 4HOMA 1NCDL 3AFLA 4FA7B 1D6EB 4MLSA 1A6WL 2P28B 2PABA 3TVMC 3C5SB 3QG6A 4EN3A 4CDGC 4EUPG 4HIXL 4DNLA 4OKVA 5JXAL 4Q6IC 3SDCD 4OCYL 4I3SL 3ZT6A 4HUKB 4X80H 1GKEA 1T66D 3KCPA 4Y19E 4D9QD 3JQOB 1AY1L 4KHXL 5MEQA 3IFNH 4Y7MA 3LKQB 3W37A 4U1LB 3VH8G 3U2JA 5C0JA 5JYLA 1CLVA 4D9RE 2HRPH 2FR4A 5KYXA 4QRPA 3RP1A 2OZ4A 3Q2LA 3O2WH 2MKWA 1NANH 1P7QA 4FMVA 1KYAA 3UZQB 3W39B 4ODVL 4AL8H 4AUUA 4LP4A 4MB5A 3U46A 5E8PB 2JF1A 2X42A 3NIDE 5ES4B 2E6PA 2ZKHL 3QCTL 1WA0X 4OLZH 4F27A 5IVNA 2X89A 2XXFA 4LPYA 4OFVA 1L9OA 1TMCB 2VZVA 3GSRB 1J0JA 1VACB 1INDH 4LDEB 1IEAA 4TL4A 1EH9A 4GJTB 3DV4B 5I18L 5AEAA 3UAJA 1CQKA 2ED8A 3EJQA 4UB0L 2W9LA 5FYJH 2X4RB 3NEXA 1U2HA 3GI8L 2ZXCA 4JRFA 3VXPB 4FL4C 4BCYA 3BH8A 5LNEA 5CEZL 5LNDA 4PJ9D 1CICD 2DMGA 4Z95H 3RTQB 4P8QA 1DANU 2HFTA 4LLWA 4U3XA 2EADA 4ZMPA 2OL3B 2OV0A 5DTFA 4UIMB 1SJHA 3U82B 3LQAL 4JPWL 5E00B 2LABA 5B8CB 3CN2A 3UPRB 1IGYB 2VIRA 4H88H 1FZKA 4TLUA 3RVWC 2IAMB 4L9LC 4G6FD 2AMGA 1J5DA 5TFSL 1ITCA 4P3DA 1DBBH 3WS3A 2OQJA 3TT1H 4LT7A 5M94B 1M1XB 1OALA 2Y2WA 5J6SA 4BSVB 1HXKA 1F1AA 1ILSA 4TXVB 4ILDA 5T5FL 5HGDB 4H5SB 3LZFH 4K9EC 4X4KA 5BPPA 3FONB 4QXGH 4Y2DB 5CCKL 4PLKC 4F37K 3PGCB 5T3XL 3UCRA 4FNTA 3CVBA 4CN6A 3RDTA 1Q0YL 1HCYA 4K7PL 4HUWA 3ZLQC 4BH8B 4XMTA 3TEYA 2VDPB 4JFYB 2PWDA 4FG2A 4F33A 2VW7A 4WI5A 1KEMH 4WUUD 5FDYA 4XNMB 3DX9B 2LQRA 2VQUA 4MJIB 1IBFA 3EOYG 4PY8J 5HYJD 3PAUA 1SN5A 3AROA 4G1MB 1PG7H 3EJZC 3U36B 3AY4C 1DJIA 5F9JA 2Z3FA 3PWLA 1PKOA 5BRQA 1YNLH 2V3EA 4ZXBA 1JTTA 1E5YA 5FDWA 3BESR 1YY9C 2KERA 1QVOB 5MENA 3RBSA 1X7QA 2PXYD 5SWZB 1ZSDB 4V1DE 3ARFD 4FNQA 3UP1A 2YOCA 3BDBA 3GIZH 1T2QH 3QVAA 2HH0H 2Z91A 5D7IA 1AOZA 3RBGA 3U30C 2E6JA 1M7IA 15C8L 5EH1A 4UOW0 2ADYA 4XBPB 4HYTB 3QXDA 4ZSOA 5L4JA 1SF3A 2XIDA 2FECI 1E28A 3PQYE 1BCIA 4N20A 2XWEA 5ESVA 5AB1A 3TNMB 4YDLC 2CCLA 1JPTH 5TE6H 2E7BA 3U1QA 4ZD3H 1UQSA 3TBBA 3Q0HA 4WI7A 2FDBP 3PABA 3O2WL 1E9OB 1UXMA 4TNWF 5LGHL 4MHHG 5IBLC 3OGCA 4AL8L 3H1ZA 1M3JA 2VWEE 1IQWH 4K9JA 4J7RA 2WIMA 2XA3A 3BQUA 4OLZL 4OZHA 3BEVA 3FT1A 1S7XA 2MCMA 2K4AA 1LEIB 3UPCA 1XAKA 4Y88A 1INDL 4NM4L 3MNWA 4IRSA 5F1NA 4D0CA 4ANUA 4XR8C 1QSEB 5FYJL 1KLUB 3K6FA 4CVWA 4QRSA 1U8JA 3TT3L 3OLDA 2VTFA 1WC7B 3QFJE 3X1GA 2R2EB 2YBGA 5CLYA 1PLCA 3A6BL 4JW3A 1G7PA 1E5BA 3BW9B 3ZGIA 4Z95L 4J39A 3EJCA 4PJBE 3X3GH 3G04A 4PRHB 4DVBB 4GMTH 1I1AD 3DOSB 4MMZC 1USQA 2WLLB 4OY9A 1JVLA 1ZGLA 1S7SB 3FCSA 4HFUH 4H88L 3JV5A 2PCPA 1KBVA 2EZ0C 1XWVA 1UACH 4OZFB 3X14B 3N0AA 3B6SB 1ORSB 5AG8A 1XCTB 1M05B 2Y1ZA 1BZQK 3UG4A 1SXBA 1TZIA 5CLZA 3FULA 1HL5A 1NLDH 1TVDA 1FL3A 1ZJAA 3NJLA 4KBPA 1LP9F 5EOCJ 3LZFL 3AQYA 5C0FB 1AQDA 2EE2A 3QZPA 2OJEB 3OAYH 4I48B 5T5NG 3AWFA 1Y6NR 4L37B 3K6IA 3MUUA 3UTSA 43CAB 2A0LD 4Q6IA 4DH2A 4I1NB 4NFDA 4RISH 5F9WB 3VG0L 4I7ZC 1QKZL 4PJFB 2VR9A 5JUEL 5CCHE 2I25N 5I8OH 1FNLA 4UNVA 2P48B 4MQ7B 2UWEF 1OARH 1CFSB 5ACZA 2YGPA 3MO1A 1PG7L 2PP8A 3PWVA 4MB4A 5ABAA 3D25A 4E41D 5L7XH 1U8QA 5I6OA 1V7MH 1A1MB 5GJSH 1DZBA 3BOVA 2CJSA 1TTUA 3QZOA 3L3JA 4JO3H 1LYQA 2EEAA 4B9FA 4IRJB 1HWWA 3PXJA 1YAZA 1KXQA 2GK2A 4GSRA 3V55A 2P5EA 2WW8A 4G3YH 4P46B 4E5XA 4ZFOL 1ZLWK 4Q0XH 5AALA 4I5BA 1UZGA 3LIZH 3MRIA 3WU1A 1UFGA 3PREA 5IR1A 4WU5B 2AQTA 1U21A 1GYWA 5AZEH 2V0AA 4N0YL 1CXLA 3FT4B 2G2PA 3PL6A 1QG3A 3KHOA 1JPTL 2B3RA 3ME0B 4GW1B 4ZD3L 4MMXC 1MCRA 3S3JA 3T6WA 3TASA 2W65B 1EVTC 1M9WA 3ENEA 3DX8A 3KGRA 2KZWA 4HHGA 1K5NB 3W82A 2C9UA 4U1IB 1URZA 2UZYA 5LG1A 1L7IL 5CGBA 1IQWL 1RZPA 3OZKA 4LMQE 2W0FB 3BZDA 5DD1H 5ERWA 4ELDA 3TZVA 4RFNC 5C09E 4RZCB 4R9HA 3NIFE 3ETBJ 1JDAA 1I3RA 4V11A 4DP7X 1PS3A 5F1IB 1KB5A 1A0QH 1XGYH 3RWJA 3IRZA 4JFWA 1GPOH 5E2VH 4DOHE 4HEMA 1BLNB 3GXFA 1MJJB 1AR1C 4HWZA 3IJYA 4QF1B 2OBGA 4G9FA 4KKNA 4L1DA 1H0DB 1ZSHA 3K81A 3LPPA 1AP2B 3O9WB 3CSYA 1DQJB