1RCYA

Rusticyanin (rc) from thiobacillus ferrooxidans
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
151
structure length
151
Chain Sequence
b'TTWKEATLPQVKAMLEKDDGKVSGDTVTYSGKTVHVVAAAVLPGFPFPSFEVHDKKNPTLEIPAGATVDVTFINTNKGFGHSFDITKKGPPYAVMPVIDPIVAGTGFSPVPKDGKFGYTDFTWHPTAGTYYYVCQIPGHAATGMFGKIVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUSTICYANIN
publication title Multiple wavelength anomalous diffraction (MAD) crystal structure of rusticyanin: a highly oxidizing cupredoxin with extreme acid stability.
pubmed doi rcsb
source organism Acidithiobacillus ferrooxidans
molecule tags Metalloprotein
total genus 35
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 1996-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1rcyA00
1GS7A 1PNDA 4AX3A 1NTDA 1ASPA 1I53A 2Y1AA 1BQ5A 4CSZA 4KOCA 5I6MA 1JERA 1WS7A 2QT6A 3PAZA 4BWTA 1TEGA 1BQRA 4YSEA 2YAPA 4G70B 4GP5B 4W9ZA 1NIFA 2GB2A 1NZRA 2XU9A 3WG7B 1SDDB 4YSSA 1KCWA 2FT6A 1ILUA 1JZIA 1SJMA 1IBYA 2FT7A 1J9QA 2FT8A 3ERXA 2AZAA 2WO3B 1KYAA 4YSQA 3C75A 5F7BA 1J9TA 5LDUA 1NWPA 4AKPA 1SFDA 2VSKB 3QQXA 1PAZA 6PAZA 3ABKB 2IH8A 4GP8B 1GY2A 2PCFA 2UXVA 3PPSA 3SBRA 7PCYA 2MRYA 2BO0A 2PPEA 1AS6A 1V10A 4N8UA 2FTAA 2W8CA 1ET5A 4HCIA 1ASOA 2QPEB 4E9TA 2YAEA 2GC7C 2GI0A 1R1CA 5D4IA 4JKNA 1TKWA 4MFHA 3ZX1A 1IKOP 1GW0A 2VMJA 2WO2B 5ANHA 1NWOA 4G72B 3FSZA 5I6OA 4NERA 2XLLA 1L9QA 1W6LA 1L9RA 1PLCA 2FQGA 4G7RB 3NP4A 1ILSA 2FQFA 4QLWA 4GY4A 1T5KA 1ETJA 2DYRB 4RH4A 4PCYA 3S3BB 3NSYA 4YVNA 1M9WA 3T6ZA 1JZHA 5D4JA 2XVBA 3UACA 2PLTA 1A4BA 1JXFA 1BXVA 1AQ8A 4A2FA 4F2FA 2GBAA 1J9RA 4K9JA 4A68A 2BP0A 3ASOB 2FJSA 3T6XA 1CYXA 1BXAA 1OE1A 4G71B 3MBWB 2LLNA 1XB3A 1ID2A 4YSRA 4E9XA 3GYRA 1OCZB 2IAAC 3H4HA 5I5JA 4CSPA 2YAMA 1DZ0A 3ASNB 1EHKB 2IDSA 2YAQA 4G7SB 4GXFA 3QPKA 2EIKB 2XV2A 3TU6A 2QDVA 5I6LA 3FPXA 1KBVA 1QNIA 3DIVA 4UANA 2YAFA 1E5YA 1JZJA 3WKQA 5B3SB 1JZGA 1PZBA 3AY2A 4YSAA 3ABMB 1SHWA 2CAKA 3OMAB 3QJVB 5EHFA 1N70A 3SQRA 2R7EB 1HAWA 3OQRA 1V55B 1A4AA 2OV0A 2I7OA 2OCCB 2IWFA 1FA4A 4KOBA 2BZCA 2HRGA 2QDWA 2ZWNA 2P80A 1A3ZA 2CALA 2GHZA 2UXGA 5B1JC 4EF3A 1L9PA 1IBZA 5AZUA 4FA7B 1N68A 3JTBA 2IDTA 4KO6A 4E9QA 3X1GA 5I5MA 4N4YB 4KNUA 3FSAA 3S3DB 3X1BA 3NJJA 4ZK8A 4E9RA 3D12B 2IWEA 3G5WA 5I6NA 1JXGA 5PAZA 1ET7A 3ZDWA 5AFAA 1AIZA 5F7AA 3AG1B 1SF5A 3FU7B 3PAVA 4YSOA 4KO5A 2CJ3A 2VM3A 3T6WA 4BWWA 2PP7A 2Y69B 3HEIB 4DP5X 1GS6X 1AANA 1AZNA 2DV6A 2RACA 2CUAA 2FQEA 4NAJA 1SFHA 3NJIA 5I6PA 1AG6A 1CUOA 5I5IA 1KV7A 2AZUA 3FYEB 4F2EA 1FFTB 2UX7A 2UXFA 3FT0A 2HLEB 2VW4A 3NJLA 4WKXA 1A8ZA 1KCBA 3OM3B 1UATA 2VN3A 3BQVA 3EF4A 4DPBX 4HCGA 6PCYA 1NIDA 4DPCX 3CDZA 1TEFA 1BQKA 3FU8A 2YXWA 5IY5B 3WI9A 2TSAA 5PCYA 1OCOB 1BAWA 2I7SA 1OV8A 4A2GA 4E9VA 8PAZA 1E5ZA 2PPAA 3EHBB 3OMNB 3AG2B 1MG2C 1QLEB 4AKOA 1CC3A 2EIJB 5I6KA 3T9WA 7PAZA 4NB7A 4YVUA 1GS8A 4KNSA 4BDVB 2IH9A 5E9NA 1PZAA 2BP8B 3T71A 3QJUB 2EILB 2VW6A 1L9TA 2XV3A 3NJNA 1GSKA 4HCFA 4YSPA 3UABA 1SF3A 4AKQA 4YL4A 3NJGA 2EINB 1BYPA 4UAHA 4HHGA 3IN2A 2PP9A 1ZDSA 1URIA 1ZDQA 5TK4A 3T6VA 3FYIB 1KGYE 1XMEB 3FQ2A 2QPDB 2JXMA 1SDDA 2WSDA 4KO7A 3JT2A 2W88A 1NDTA 2YAHA 3CVDA 3PXLA 1M57B 5B1BB 3GXUB 1A4CA 2N0MA 2PPFA 1AZCA 1SNRA 3WNJA 1PF3A 3AZUA 1PLAA 3UADA 1E30A 3NJFA 2PPDA 1OOWA 2YXVA 3TA4D 2HZHA 4HIPA 2A3TA 3CG8A 1AACA 3FSWA 3FQYA 4GYBA 4DP2X 1B3IA 2MTAA 5B1AB 1PMYA 3V9CA 2ZXWB 2P80D 2Q9OA 1ZV2A 4G7QB 3RYMA 2BP8A 3NSFA 1YLBB 1TU2A 2X87A 2VSMB 1L9OA 1NINA 1AG0A 3NT0A 1ASQA 4Q8BA 1AS8A 1ZPUA 3EH3B 3FS9A 3L45A 4DP8X 4L0PB 4A67A 2ZONA 1V54B 3KW8A 4QKTA 4UF7C 2H47C 3AG4B 3NJMA 1JOIA 1JZFA 3ZIYA 3GDCA 4E9YA 1NPJA 1JZEA 2EIMB 3NJHA 2PPCA 2AVFA 3NSCA 1E67A 4M4RB 5AKRA 4A2EA 5B1KA 1PY0A 1RCYA 4E9SA 1OCCB 4A66A 5D4HA 3IN0A 2X88A 1AAJA 2BHFA 2HRHA 2XYBA 4DP4X 2CBPA 5B1JA 2IWKA 2UXTA 2IDUA 2OJ1A 1X9UA 3U25A 2DY2A 4DP9X 1NIBA 1PNCA 1QHQA 1ADWA 1KBWA 2BWDA 2HX9A 1F56A 2XX1A 4E9WA 1WS8A 2CCWA 2I85A 4DP0X 1HAUA 3IE9A 2TSBA 4BXSV 5I28A 3CVCA 1OE3A 3UAEA 2AFNA 2DWTA 2BWIA 2YARA 2R7EA 3H56A 1MZZA 3S8GB 1AZUA 1NIAA 2B3IA 5B7MA 1EZLA 1SHXA 3NYKA 3FSVA 2BZ7A 4HHWA 2J57A 3UAAA 2GIMA 1X9RA 2BP0B 1ZIBA 2IDFA 1XB8A 1AZBA 3OMIB 2XWZA 4F7KA 4HZ1A 1IUZA 4M3HA 2XUWA 3AW5A 2ZOOA 4YSTA 2BW5A 1M56B 9PCYA 2GC4C 1RZPA 4DPAX 2BW4A 2Q5BA 1AS7A 3WKPA 4BK5C 3MX0B 3QJQB 4KO9A 1GR7A 1VLXA 3KW7A 3CVBA 3TBBA 3UGEA 2J55A 1ZIAA 2JKWA 3NJKA 3S8FB 2XXGA 2VW7A 4BWUA 3V9EA 3ABLB 1FWXA 3S3CB 1J5DA 4X4KA 4DP6X 3FU7A 3X2QB 5I26A 3WNIA 1GYCA 1JVLA 4KNTA 3N55A 4W1TA 4FAAB 1PCSA 1WA0X 3NP3A 3SBQA 3PLYA 4A2HA 3FQ1A 3BVDB 2DYSB 1CYWA 1PZCA 1DYZA 1W6WA 2AANA 4ENZA 1NPNA 1W8EA 3WIAA 3QJRB 1JVOA 1J9SA 2NRDA 3QJTB 3EH4B 3TASA 3AG3B 1RKRA 2PCYA 5B7EA 3OD3A 1CURA 2XXFA 2GSMB 4JHUA 4Q89A 3DTUB 4WTQA 1J5CA 2H3XC 5A7EA 1KDIA 1IC0A 3CZUB 4GP4B 1WAEA 3DKHA 3HB3B 3ABGA 2J5WA 2HX7A 3IEAA 3EH5B 3IBOA 1MG3C 1XB6A 2PP8A 3ZBMA 2UX6A 1ET8A 3N2JA 4AI7A 4BDVA 5TK2A 3NSDA 1NIEA 3PCYA 4YSDA 2FWLB 3X1EA 4HALA 1RZQA 2B08A 1AZRA 1BEXA 4P5RA 1AR1B 4YSUA 2FQDA 1E65A 3FPYA 2XX0A 1OCRB 3QJSB 4AZUA 3X1FA 2YAOA 2IDQA 1A65A 1NICA 4JHVA 3CDZB 2HX8A 2FNWA 1WA2X 1AOZA 2JFCA 3FU9A 1OF0A 5FC9A 4A2DA 1MDAA 1BYOA 3SBPA 3TBCA 1BXUA 4DP7X 4BXVA 4PAZA 1KDJA 1GY1A 2H5UA 4TXVB 4DP1X 1HFUA 1PLBA 2VM4A 4HAKA 1WA1X 1JXDA 3PAUA 3H4FA 5B7FA 1L9SA 1MZYA 2YQBA 1OE2A 4P5SA 4YSCA 3X1NA 2HXAA 2DWSA 2J56A 2E86A 2XV0A
chains in the Genus database with same CATH superfamily
4TSBH 2Z31A 3MV7B 4ENEC 1IGYB 1I53A 4XMWA 3RBGA 3LPFA 4H40A 1AR1C 1IBDA 1U6AH 3NCFB 3WKNA 5DI8A 1LGVA 1KIRB 1UWYA 4JGNA 4KBPA 4N2GA 1GIGH 5EU3A 2ICES 2WXJA 1N18A 4JQIA 3BZEB 4JY5L 1NZRA 2XKSA 4DEPB 3AGVA 3NFNB 4EDXB 3SPCA 4WFHD 1YHPA 3IDXH 2J88H 3QNYA 3T77A 4O2FA 5JLZA 3HBQA 1T22B 3VGEA 5FPIA 3MGOA 2WO3B 1ZE3H 4WO0A 1LD9B 4E5XA 1N0XL 5GS1A 2Y7MA 1DUZA 1QRKA 4M7ZB 2ED8A 1CLZL 3LZQA 4KNQA 4XN5A 5C09B 4L8BA 4ESKA 2P5WB 4FMKA 3W5MA 3QC5X 5KYUA 3CFCL 1CD1A 1UB6B 3MACL 4YBHA 2GJZA 2HVKA 4XCFL 3RX5A 1OW0A 3SE4C 1A1NB 5T33H 2W0FA 3V5KB 2X70A 2K6YA 4I0KA 2E8ZA 5D2NC 3K2UH 4ZZFA 2H1PH 3ZL1A 1RHHB 3TV8A 1FAIH 1FI8C 2A74A 2ZG2A 1TKWA 2AV7B 4IJ3C 5BOPA 1S7XB 2VMJA 5HI5C 3T8XA 4DIXA 3D85A 3QI9A 3R4DA 3IDIB 2FB4L 4U6HB 1R5WB 4D9RE 3CH1B 5EIIB 5CJQH 1OGAB 4BKLA 1M7DA 1KSRA 2R0KH 2YN5A 4Y1AD 2WUBH 3PU7A 2FJHB 3EGXA 4L9LC 4LRNH 4LU5H 3OZLA 4M62L 4CADB 4UU9A 5F1IA 1CXIA 3WIIH 5JHLA 2YEVB 3KNBA 4X7TA 4ADGA 5KSUB 4N8VA 1WHOA 3QDGA 4Z7UF 2NTSP 3MHZA 2L0DA 2FX8L 1I1YA 5DSCB 4GKZB 2WZ6A 3OKDB 3OSKA 2ADFH 3DTXA 1DHKA 2NXZC 3KL3A 4M5SA 4WCYH 4ZNEA 5KBPA 2GPZA 2CK0H 2A7BA 1YJDL 1JYWA 2QTVA 1FO0A 4GBXC 4N0CC 2DKMA 2IWGA 3O3BA 4JZJB 5J12B 2QADC 3MBWB 3REVB 3T0EB 3UG5A 1E2WA 4FTVA 3FNKA 2OMWA 5C07B 1Z9OA 2YAMA 3LQAL 3RY6A 5AOMA 3W82A 3FDWA 1HCFX 4JFVA 5ICZA 5F89A 4X6DE 2ZJSH 3QZPA 4RAUB 4D0BB 1Q9OA 2NUPA 2ZSWA 3ZOAA 4F9PC 1R3LA 1T0OA 1ZHBB 1OM3H 4HSAC 3AY2A 1PZBA 2ZWSA 4J12A 4B7IA 3LN9A 5IUCA 3QJVB 5EHFA 4ELKA 1O5PA 5KW9L 3ESOA 3HHMA 4RZCA 4O2EB 2EH7L 1KXVC 5JYLA 2P52A 3LZFH 3CFNA 1YEHL 4EUPG 4JEGB 2OCCB 4ZOEA 3ZZ1A 5F7KC 1SN5A 2ICWJ 3GRWH 5CCKL 3P0VL 1JNLH 4WNQB 1MH5A 2DW5A 4B9IA 2CO4A 4DW2L 5I0ZA 2UXGA 5B1JC 4CJ0A 3MFGB 3TJPA 1O9ZA 1AFVH 1ZGLB 1L7IL 2WXRA 3V7AG 4JPWL 4J8RB 3X17A 2NX5A 3BJLA 5SWZE 2FDBP 3LN4B 2RH0A 4P4RB 3VFUB 2Z0BA 3L5XL 4JHWH 4KK5D 5BOZG 5L8JB 1NGPL 1GGCL 4UINH 4NUGH 1ZLUH 1JWUB 5F7AA 4KRLB 3WYRA 2A1WL 1UWXH 3ZE0F 3RTQA 2NY1B 3BAIA 2YPVL 1L3WA 1D5MB 1F6AA 2CUAA 5I23A 1A7PH 3NJIA 3MROA 1HL4A 2F53E 1Q9WA 3FH5A 1KFAL 1KV7A 5B8CC 2EDWA 1XXFC 4Y9GA 2UXFA 2OX5B 4ZG1A 4CW1B 4WKXA 4HT1L 3TVMC 1UH4A 2FX7L 3BYTA 4AV4A 2XBZA 4UM9B 4RNRB 4URTB 3GBNL 4W9HC 1L9NA 6PCYA 5JXED 3PWLA 2W1NA 1IX2A 3CVHA 2LU5A 2HFTA 1XEUA 3E6FB 1HNFA 4R83A 4ZUTA 3VI4A 3BKML 1OARH 5IFJA 4TOYH 1OCOB 3C8KA 3NH7H 3QUMA 4X6EA 5C0AD 3PL6B 2GTZA 4LP5A 3LMJH 4HBCL 3TN0C 3VU2A 3AXHA 3IJSB 3DV4A 5DUMH 3GGWB 1INEL 1LEIA 1A66A 1F4WL 2HTLC 4X0KA 3SYCA 3KG5A 2VE6B 4U6YA 1M05B 5I6KA 4LMQE 3SGKC 1GS8A 1QVOB 3ETSA 3N91A 4EXKA 1IFRA 3MU3A 4GQ9H 1BEYH 2EILB 4TPRL 1T2XA 2YBRB 3NTCL 5IJVB 1Q8MA 1MRDH 3PWPD 4TL4A 3GDBA 5LAPA 3ZMNA 3D39B 4E41B 2IBZY 1VKXB 3MA7B 3CFBB 1RULL 5C0BD 5IEHA 4NHUB 2BHYA 1IM3D 3NDYE 3WO4C 4HIXH 4OCSL 5A40E 2ICWA 3HG1B 4Q58C 2QPDB 5H37G 5L2JA 4NDMB 3UYOD 1LK2A 1NC2D 5I18H 1OPGH 3FCGA 4GSUA 4ODXB 1P2CA 3MXWH 5DD0L 4UNIA 3Q48A 1CFTA 2EUWA 3S97C 3LYRA 3ARVA 3TEUA 1SNRA 3CIQA 5G4MA 2F74B 2PO6A 4KH9A 4LZKA 2X1PA 3UTSB 2VLJB 3CQFA 1D5XB 4OLZL 5EG6C 3DYPA 1QKZH 4PWFA 1S7QB 4APQD 5T5NG 4ODTH 4PRIB 4BFNA 4YGAB 3DX6B 2ZD0A 2Z7ZA 3RU8H 2X12A 2NUTB 2FLRT 4L8DB 5LCVH 2DD8L 4E9LA 3LZRA 5ERWB 5GJSH 1VZIA 1CR9L 1JRHI 1T7WA 2MTAA 5DVKA 5B1AB 5ESAB 5J11B 5A3ID 1OLLA 3FH8A 4PVNA 2F68X 2WHVA 4Z18A 5GQBA 4EVNA 3GTVA 1PX4A 4TTDC 1GMEA 2IIJA 5IHZB 4ODSL 1QR1A 4DVBA 1T1YB 3RA7H 1KLGB 3CLEH 5CZKA 1NINA 4LXFA 4GLRI 1ZT7B 5I16A 3F5WB 2O4EA 3M8OH 5KSAC 1U0QA 5DS8B 4MKTA 4QRPB 1YEDB 3UG4A 4CC4C 4XX1E 2DLGA 2WBKA 3RURA 4AITA 3QJHB 2BJMH 5DLLA 3MJWA 3V2AR 1E67A 3QEHA 2IBZX 4JGUA 2HG0A 4MVBD 4A66A 1HNYA 4DKFL 4IBWA 2W0LA 3AT9A 3QORD 3BQUC 5J0BA 2AI0L 3JXAA 2XYBA 1A2YA 4OQTA 3OXSA 5EZPA 4YR6A 4F7CB 4WUUA 5E56A 2OP4L 3F7VA 3B37A 4JPKH 2IQ9L 4P5TA 2EE2A 4ORZC 3NQIA 1JHTB 1A6UL 4FQ1L 4X99B 1DE4A 1X6LA 3C2AH 3VXMA 3QB7C 4OLVH 3JV5A 3WKML 3QO1A 4V1DD 4AEHL 3RIAK 4DP0X 3FB7A 1DBML 2CNZA 3T2OA 2ZG3A 5ADPH 2WSKA 4QCIA 4EIGB 1F02I 4IW4C 4X9HA 2Y7NA 3QG7H 4HEPG 3QDME 1DVTA 4OZFA 5I74C 3UAEA 2Z65C 1AOHA 2BVPB 4BKSC 5EU7E 1J1OL 3PJLA 1U8KA 2PCPB 2WQWA 2EDFA 5BRQA 2BP0B 2VXVH 3AWFA 2AXJA 4LCCC 5K93A 3TONA 2AW2A 2J1ZA 3MRLB 3CUPA 1UA3A 4U3SB 1E5CA 1OXYA 4OLYH 1H9VA 2BVQB 3LD8B 5KVDH 1EXUA 4WQOA 4BFBD 3T3PB 2FECI 3MRBA 5JIDA 4XR8C 4TTGA 4OCMC 4HS8L 4XAKD 1TENA 1LO2H 1N9PA 3MJ8A 3H3BC 1A7RL 3BLKA 4QRBA 1KIUB 1S9XA 1JHLH 3QUYB 2VDLH 4WFFE 3RI5K 3ZUCA 2P48B 4UIMA 5D71H 3QWNA 3S3CB 4DZ8B 4DP6X 3UH8A 4XBEH 3TURA 1YMME 1Y6KR 3BD3A 2WQXA 1GOFA 2W07A 4P2RD 3GMRB 4QPEA 4AUJA 5I1KL 3PLYA 4BK5A 3B34A 3BYYA 3FQ1A 5FO9B 3G5ZA 3T2QA 4FZ8L 3L4WA 1I7ZB 1PD6A 3FB6A 3MLWH 2EDRA 1WFIA 4JO4L 5HGDB 3ARBB 4F7PB 3WIAA 4UQIM 5JO5B 5CWSA 1C1EL 3QDAA 4OCWH 4LP4A 4I18A 2QEJA 3NIFF 5B7EA 2VLRA 3U4BL 3EOTH 4Q89A 5I1IL 4DN4L 5FYJH 4RMQA 5D6CA 1UM5H 3SYQA 3HMXH 4JL2A 4P2AA 5D7LB 1Q1JH 3ZSSA 4Z6AT 2ENSA 4WY7H 3FF7A 1C08B 4U1LB 5DRZB 5HYIA 1S7SB 3GSNH 3WSQL 2J1KA 2O26U 1YCSA 2CRMA 4XPGH 3N85H 1QACA 1SEQL 2ZCLL 3MGAA 3WNKA 5I75C 2R1XB 5IFHL 5L9DL 1S5HA 4LARL 4BCYA 1TG8A 3CCHA 3AS2A 1NCIA 3SEPA 2WLNA 3H42H 4JMNA 2NSQA 4ANKA 1G7HB 4LQ1A 4I87A 4ODHL 1HWHB 1YECL 1QRND 3ZYOA 2P4AB 1NCWL 5KN5A 2VGLM 1P7BA 4M5ZL 4UV4L 3DK2A 4JFTA 4ZUSA 4JK0D 1MFNA 2PR9A 5HYSA 3SDDA 2X4UA 4OD2B 4S1SH 3DHJA 3IBEA 4EQ3A 3ATDA 2KC0A 3B43A 1MJUH 4HKXA 4V11A 3SN6N 5ISZD 3BH4A 1P5UA 2I9TB 1RK1A 4DP7X 4IK6A 2XQBL 4O2CA 4IMLA 4HZLB 3O45A 2GJ6D 4FFTA 2WMPB 3R1GL 5DD1L 2ZG1A 3QPQD 5JMRA 1EEZA 3G9AB 5E7FA 5I1CL 3AAZA 1MZYA 3ARGC 1AO7A 7FABL 1O6TA 2XN9A 3IFNL 4MQXC 2B8OT 2HXAA 3L3GB 3OPZL 5E8DH 1CL7L 4ZX4A 2Y2TA 2YBGA 3OTTA 3QO0B 2XV0A 4OV5A 5FOJA 3GI8H 2AS5M 3ES6B 5AUMA 4YO0B 5K39A 3ZR5A 2H2SD 3W11D 3OX8A 1H6UA 5TDOA 3A67L 3UTZB 3FUKA 4KOCA 3EJZD 5T1LA 2A9BA 4O9HL 4OT1H 2AK1H 4NZDA 4I0PD 2NDGA 5C2BH 5DQ9B 3D4GA 4FX5A 3BAXA 1KCRH 4K3EH 2HKHH 1MRFL 5EZOH 1SN2A 4U2YA 3DVFA 1OOAA 4N5EC 1NAKL 3HE6B 3Q5TA 1JGDB 1ZHKA 4ZRGA 4FKKA 1TCMA 4HSQA 1IBYA 5SV4A 3B2UD 5E9AA 4TNVF 1CGVA 1Q9KA 1WWBX 4OKVA 3UO8B 4YSQA 3IFPB 5GZOC 1CO1A 1J9TA 4OFYA 2AXWA 5K9OB 1QZNA 4L5FH 1D5BB 3JYCA 1PAZA 3KJ4B 4MAYB 3BPLB 2IV8A 3L5HA 3MZTA 1QW9A 3QDJE 4OLWL 1S7UB 1GY2A 3TO4D 4PYGA 3RL1B 5EBMB 1U3NA 3MRDB 4FQHA 1EAJA 3JVGC 4NKIL 4H26B 4XMVA 1IAMA 3AREC 2KHAA 3GMMB 5LDSA 3BRGC 1OP4A 1HJBC 4E0RB 1T0PB 3TNMB 2VDRB 2B15A 3RVUD 2K4AA 4P5MA 3TIEB 1BM3H 5CZRA 4H8WH 4JJ5A 1EFXA 1IKOP 2A0LC 4OZ4A 5DS2A 3MYJA 4L4JA 3FSZA 3S8WA 3N44B 2I24N 4XP5L 5A7BA 3I2CL 5KBKA 1IAKB 2VDRL 5EU6D 4WHYG 1SJEA 5I8OL 2XN0A 1HL5A 3BPOB 3LQZA 5KOMC 1WD9A 4FQ2L 4ZTOL 4QO1B 1UXLA 2W5PA 1ZE3C 43CAA 3BGFB 1A1MA 1S46A 1N59A 4KKLD 4L3AA 1D2OA 4EKXA 2XQYG 3WNMA 2HSIA 2CKBH 3M1OA 3I6SA 4S0SD 1YEWA 4OZGB 3HCVA 5D7KE 4P46B 3LHPH 2XA8H 4GO8A 1VIWA 1BJ8A 3HZVA 2GBAA 3LRGA 2X6UA 3VDCA 4A6YH 1QLFB 1I8IA 4FLSA 3TGXA 3VG0L 1ZTXH 4IEFA 5SWSD 2BSSA 2KLRA 4HH9B 2PYEB 2D7TH 3KD4A 4L1SA 3VMPA 4OLUH 4ZX3A 4YBQC 3H55A 2UZYA 3UX9B 4Y4KA 2EDMA 1DJWA 2EIKB 1IAII 4I2XE 4PY8J 4XX1G 1MVFA 1WT5C 4G8EA 5FKPB 4EMZA 4JFFA 4AQOA 1MJ8H 4PJBE 3QW9A 4KKAD 3D6GA 4U1NA 1OQOA 4MJJA 4FLRA 2JI3A 1NFDE 5IQ9A 1BMGA 1HKFA 3BFWA 5DZLA 2XOTA 2VH5H 5CGYC 3OQRA 4LLDB 3HC3H 3LRSA 4L8CA 3W9DB 2H6PA 3I6LE 5E6IC 2ZT9C 2OM5A 3NK4A 3O3DB 2G5UA 3G6JB 3OSVA 4LAQL 4IBUA 3O8XC 4KPHL 1R4XA 2IQAB 4JFPB 2Q3XA 4NO3A 4F58H 1Y0LA 3IAPA 3GS0A 3GSUA 2WXKA 3UYRH 3HG2A 3HLAB 5EWIH 3UBFA 5F7DB 4YHNB 5J4MA 2WPGA 5J56B 5DK0A 1VB9A 3MLXL 2GY5A 1FL5A 1B0RB 2IDTA 4JMXA 5E2VL 4CU6A 5I1GH 3ABZA 5T1JA 4R90H 5L88L 2VABB 2HFFB 5D70L 3DO7B 5IQOA 3ULSB 3P4NB 3D12B 4B41A 2IWEA 2NX5E 1OAQH 4OM0H 5PAZA 4RCAA 4O4YH 4FS0A 2BNRB 4L23A 4JN1L 4XPHH 3LKPB 3AG1B 3U46B 2PW1B 4NQCD 4BWWA 1VPOL 1GS6X 5D1ZI 2C9AA 4NM4L 3UC2A 4HMEA 3U7YL 3S3PA 5KVEH 1IZJA 1R3IL 2OL3A 5I6PA 5HPMA 4JUTA 5DS1A 5L6YH 3ET9F 1WITA 1E4WH 2WN2A 3FT3B 5IV2B 5JOEA 3RILA 4LSQL 4NQED 2VLJE 3MCLH 1DFBL 1D7DA 4JKKA 2OULB 3GMLA 2ZXEB 4ZW6A 1U8PB 2WLJA 4MSWB 2A4CA 5TFSH 5C8JA 4NKQB 3TIDA 2I07A 5BW7A 1I7UA 4U6XA 1E90A 2P3YA 3HN8A 5JHDA 1BAWA 2V17H 5I9QC 1OV8A 3EJCA 3T4AC 1VFAB 4N2LA 4FYSA 3D3VA 5KVFE 1P0SE 2I60H 5KBLA 2PPAA 5E8NA 3WDHA 4Z5RA 4PJAB 1BVOA 1X9LA 4DKDC 5EC1B 3GHBH 4HYTB 4ZSOB 1Y1DA 3TFBA 1BQHA 4JLRB 4FJZA 3MO1A 1G4RA 2PKDA 4KAQL 5IB4A 3U1SL 1Z9SA 4NO0A 4ACTA 3RWGB 3FONB 1S3KL 1IEBB 3DDFA 3PP4H 4LK4A 3L54A 2ODHA 5BXFA 2AV1A 2IPKA 2NR6D 5FWQA 4WFHE 1GGTA 2UV3A 2Z93A 2VITA 3LDBC 1F5WA 3U7AA 5ICXA 2DLEA 4NI6A 1URIA 3LKRA 4UTAL 4XPBL 2F1BA 2DQFB 5H37A 1HXYA 4EUPH 3B3IA 5HVFB 5DRWB 1QRNB 2VL5B 1EO7A 3K8LA 4G5AA 2DMBA 1PBYA 1MELA 5FO8A 4JFZH 2QFPA 4PRPA 3OJ2C 1I9JL 5IT2H 1AZCA 4LNRB 1LP9F 3UADA 4NKOB 5ISZB 1TVHB 2WN3A 5CLZA 4XP1L 5AW5B 1KIPB 5GSRB 1A7NL 4JO1H 2GJ6B 5FYKD 1FVEB 1IC7L 2EDDA 1H3VA 4LPUA 3DI3B 2FHFA 1JGVL 4LCYA 3FSWA 4AY0A 1E9PB 4AQEA 4Y1AE 2PTTA 3MRKB 4PJGE 1F2QA 2F8IA 4WWPA 1T04A 2PWDA 3PIQB 2NY2D 3TEXA 2N1KA 1A6ZA 4KV5E 3THML 1ZJBA 4A7TA 2VXUL 1TETH 5FIEA 3D69B 5BS0A 1UEYA 3PUUA 5FHBH 4K23H 2QLVB 1SOQA 4GG8B 1DJZA 2OMVB 4JFQA 1DSFH 1YA5A 1GGBH 1X4ZA 2CR6A 3MZGB 2YC1A 5CLTA 4HPHA 1KEML 1JZFA 1EHXA 4ANUA 3A6OA 1WGOA 2VRAA 3V0IA 1MVYA 4GAFB 3H3KA 3BMWA 5GZNC 4OFDA 3RJOA 1MCOL 5E6RB 5INDA 3CGTA 4QRQA 5TE4H 1QAWA 3ZDYF 1B0GA 3B9KD 5K59E 3HZMB 4FNQA 1AH1A 1DP0A 2OJ1A 5T3XD 3LXBA 3U25A 4KVCH 3TLRA 1JRHL 1NIBA 1TMQA 5DVOA 2DKUA 4A2MA 4E42A 3VDBA 5D7SH 3I6KA 1RMFH 2Q7AA 5E2WH 2AEPL 3RBSA 5FOBB 1MCNA 3ZZSA 2VXTL 1QFHA 3RZCD 2AKRA 1AMXA 5GRVK 3NPSC 3VNZA 3TFKD 4X5XB 3BWZA 2G9HA 3IE9A 3F85A 1FP5A 3PE9A 1TLKA 1AGBA 3BWUC 1N8OE 1UB5A 4LP8A 5H37H 4HEPA 5G4NA 5EU6B 3HG3A 5DF0A 4XZUB 4JDVA 2XPGB 2EABA 3IK2A 2DQJH 3Q6FB 4Y2DB 2QQLL 3NQKA 4CGTA 1FNAA 1KENH 1B0IA 3P69A 1Z2KA 5GGTA 3HNVH 4OFPA 4Q9QH 3EFFB 2DLIA 4U1GB 3BWUF 1KYFA 3Q2WA 3RL2A 3HG4A 2HPTA 2GHWB 2WSPA 3I85A 2XT1B 1Z3GL 3J2PA 1ONQB 1HIML 2BSBA 3W39B 2Q5BA 1T2QL 1SGKA 5D7JA 1NUDA 3TF4A 4A04A 3T0XA 3LKOB 1FFOA 4WU7A 5FLUA 2CDGB 3PABB 2C3VA 2ESVB 4OGAD 1ZA6A 5T5FH 1KJVA 2E7HA 4LVEA 3OR7A 3GLDA 2JKIS 3LPGA 3VW3H 4N0UB 1XQ4A 4ZQKB 5MHSD 1XF2A 3QFJD 1GYCA 3RZWA 1NM4A 3L9EA 2PXYB 2P44B 1CK0L 1GYWA 1MFBL 3NP3A 4KMTH 3ARSA 4NUQA 3VI3F 4HIIB 1P4BH 2FATH 4JFOB 2O6PA 4OIIL 4PBVC 1W6WA 1MRCH 4GKNB 4GKOA 2OSLA 1CE6A 3IGUA 4HJJL 4GAGL 5IHUH 5C0AE 4ORGB 4XOEA 1W72B 1DQDH 4MD4B 4BZ2L 4GFTB 1GGIL 2NRDA 2W80C 3JTSA 3QIWB 4R4NC 2BCKB 3B9DA 4LSRH 2UZXB 3EZJB 4H88L 3ZY7A 1MKFA 1RKRA 1RUMH 2VM9A 4BE6A 4GW5A 1NCBL 4QGTA 1VSCA 1ZWIA 4HS6A 5KJRH 1D9KD 2ADYA 1ZEAL 4MHHG 3P9WB 1KT2B 3RWDA 4DH2A 2FECL 1W72L 3BVNB 3L2MA 3DKHA 2CJTA 4TV3A 5FDWA 2VLRE 3PWPE 3QWOB 5KSBE 4G7YH 2UX6A 3KDMB 1FYHB 5LWYL 5C0BE 1BLNA 1INDL 5IHLB 5C0DA 3MJ9A 2MCG1 5T3ZE 5D5MF 1MCEA 1EO5A 5EF1A 3EJYD 3Q3GB 2FEDC 2FH8A 3H0TA 1UT1A 3RWCA 5BPPA 5IIEB 4YUEL 2AVGA 3AU1A 2HFGH 3VWKB 5DURB 3UC0L 1T1WA 1LO5A 5TPWH 4LPXA 2HT4D 1O6SB 4FQJL 3VD4A 1T1XB 1S7TA 1M6UA 4WUKL 1FORH 3SKMB 4NQEB 3JWNC 2J8UF 4L8SB 4NP4H 2YD9A 1PU0A 3SB3A 1F58H 5J1SC 1A7OL 2G4GA 3IXTB 3ELAT 3VRIB 5K9KA 1JZ5A 3AWEA 3UPCA 3FB8A 3Q5YA 3RGHA 1JGIA 3QEQA 3X3FL 3O6LL 3ZTEA 1TYRA 4B95C 1DLFL 4N90D 3RY4A 4PV9B 2K78A 3AT0A 1EXHA 4JG1H 1Z5LB 5EC2B 2VNCA 2ZUQB 1N8ZB 2VR8A 5FUZL 2B20A 3O2DH 4CVZB 1PTZA 4Z0BH 1UD8A 2P26A 3B5TA 3VD1A 1IT9H 2XDHA 2ZUUA 4PV1C 5F9WB 3O6MH 4M1GH 5BV7C 1G6VK 2GCYB 2K8MA 1QNZH 1DVSA 3VG9B 5IFAH 3AM8C 2J6WA 5H94A 1AY1L 2GB2A 3F00A 3WG7B 3WEMA 4XMXA 5A6IA 5F3BB 3MOAH 3ETBJ 4NRZA 2DWEA 2EC8A 4N24A 2CO2A 4M8UA 5C0IA 3GBLA 4A39A 4YHZH 4HJEA 3QXDB 2X4PA 2A6JA 3N9GH 4AKPA 2G3XA 3PHAA 5IMKB 2VAAA 4ZW7A 3MCKB 4TLTA 2A9ML 3PPSA 7PCYA 4UILL 5IK3A 3NIGE 3NZUA 1A9BB 2VMEA 4H0HB 2JH2A 4KTEH 2FTAA 4LHUA 1JI2A 2HLFC 3MRCA 1IB5A 1RIVH 2KMWA 1PD1A 2OMXA 1E5BA 2YLKA 2R69A 4LSTL 1DBKH 5GISH 5L4IA 3DX8A 4V1DE 1OK0A 2KERA 4M7JL 2QQKL 2ICEA 2QMKA 4N2DA 4RDQF 2H8PA 3VH8B 3D08A 3ZZLA 3PGFH 4IRZA 4JX0A 3ML9A 4MDJA 4Y19B 4MXVE 4F1SA 4G72B 3E6HA 3G6JE 5JW5B 2DQTL 5DJCA 5D2LB 2H45A 4HJTA 2XLLA 1L9RA 2Q20A 4HF5H 2CO3A 3QEUB 3ARDC 3SQBB 3SDXE 5ADOL 2JQAA 4RVBA 2V2TB 5B1CA 5LGHL 4XVSH 3QAZC 4U4IA 4EAEA 4LKXA 3ARFA 2RCSL 4Z7WA 1HQRA 4EI5A 3TV3L 1E9QA 4AH2A 4ZMOA 4RIRA 1BBDH 1JZHA 3WGUB 3LEYH 4RGNC 4DGVL 1BGXH 3DTDA 5IWLC 1HOCB 3QJFA 1WBYB 1J9RA 4K8RH 3RIKA 4XAKE 4M1CC 4XWGL 4Q9BA 1T2JA 1SYSA 4G71B 2B1HH 4BZ1L 4FFWD 4X9YA 4BK4A 1YPZB 2QZ5A 2NY5L 3FSOA 4KQ3H 3T1WA 3GUTB 1HNGA 4Y4HB 5DJXB 3VWJB 4E9XA 1RPUA 4H8WC 3W0WB 2K9FB 1GZQA 3RWHA 5EFIA 3IPFA 2BSCA 4P2RE 3FO0H 4DFHA 5IB3A 3ZGHA 4JO2H 5FGBA 1X7TA 4WZ9A 1I82A 1OSPH 2DN7A 3O4LA 5DJDA 4PJXF 1EBAA 1WYJA 2A73B 4K7FB 1U3YA 3PF2A 1JZGA 4L4VD 4OUUA 5T1DL 1F0LA 2MSPA 1PG7L 1WTGT 2JKJA 3QZLA 3RZCB 2VISB 32C2B 3NACL 4H8QA 1KLFB 2OV0A 2WLKA 2Y07L 3GMOA 4KXZH 1V5JA 2DKSA 1NGQH 1UWEL 2VDNB 1UJ3A 1CN4A 3ZKXC 4KQ4L 3LRLA 3LH8A 4RQQB 2GHZA 2DEWX 5EZIL 3OHXB 4XCYB 2OYLA 4Y4FA 1TO4A 5DRNA 3TBYA 3MRHB 4Z0XA 2XG5A 3DOSA 5E2TL 3JTBA 2VO5A 3BDXA 3GSVB 3HC0B 2VDNL 1JPFB 2R2HB 5AB0A 2PETA 1CDCA 2ZPKL 1Q9LB 3CZGA 1IGFH 1OSZA 1TSHA 3HUJA 5CJOH 3FQNA 4ZK8A 1UM6L 2MHAA 3G5WA 1S6NA 2W0PA 1A14H 3STLB 4A7GA 1QA9B 5C6PB 3FQRB 3DJTA 1IAIL 3AMKA 3SGJC 4TULH 3QUXB 4ENED 1DVQA 2H32B 1RUKL 4JR9H 1EBPA 4PBDA 2XETA 3Q8CA 1UOWA 4Q14A 1SJXA 4WHYH 4KDWA 2VLKB 4QXTA 4Z7VE 3OF6A 4MDIB 2FSDA 4L37A 4AZ8B 4N2IA 5BMFH 2DI7A 3LEXA 4CL7A 2YXFA 5ISZE 1IARB 3C8HA 3SE3C 4OSUL 5IEKB 1SBSL 4PJFB 5EU4B 2GJ6E 4Y5VA 1X5HA 2NCEA 1DVFB 4WJKB 1TEFA 1NCHA 3N1FC 4KMLB 4ONGL 2XICA 12E8H 4UNVA 1IMHC 4X5WB 5TE6H 2ZCHL 3INOA 1FPTL 1OB0A 2R29H 2JCCF 2Q6WA 2CU9A 3DVGB 4GRLD 4NT6A 2D3NA 2OJZH 3ELQA 4OW6A 2JB5H 5E6YA 4JVPA 5JPNA 5D1ZB 4CGUB 4NQTA 1I3GL 1F00I 3DSNA 5EOTB 4ZW8A 5D9SA 4JZOA 4H4NA 5DUBA 4DKTA 3LIUA 1FDLH 4LF3A 5E0QA 3V0VA 4C56A 4PS8A 1I9EA 1DBJL 3FQWB 4RZKA 5I76A 1G9NH 3QJUB 1OD9A 4PGCA 4GSDH 4ZMZA 5DQJA 3BT2H 4YSPA 1WAPA 4QHPA 4ODVL 5HI5D 1YEIL 3U4EB 3MV7A 5HI4C 4PBWD 3K8KA 4HHGA 4HG4J 4PMEA 4XP6H 1KIRA 1CFVL 1TEYA 2YUXA 5TK4A 2CXGA 1HHJB 4LFHG 3UDWC 3T6VA 4HQQL 3ZO9A 3BZEA 4IKIA 2D3VA 3FL7A 1KY7A 3MNZB 2ZSVB 1PJ9A 3NFNA 3TT1L 5CSGA 4FNSA 2OZ4H 4HUWA 4YGVB 1T22A 3HE7C 2D0HA 2EDOA 1LD9A 3GIZH 2NXZD 3BEVA 2XBDA 1XH1A 3Q8FA 2VJXA 1KB9J 2H6UA 5C09A 2L7QA 1NBVH 1KTKE 2FBJH 1AGEB 1E30A 2P5WA 1ANUA 2KDYA 2X9XA 1BVLA 1RJLB 3ZKMC 3N04A 4N0CD 1UB6A 2ZOUA 3I3EA 1IIIA 1PS3A 2C9XA 2QADD 4QRUA 1U8OA 4PW4A 2QLYA 3V5KA 1MQKH 5AAPA 1K5NB 1N6UA 5EU6E 2YMOA 4OZHF 3V6OC 1QWUA 1I4FA 5SX4H 4P2QD 4WSKA 1EH9A 3GXDA 5D72L 5F9OL 1RHHA 5HDBE 1X3DA 4BFFA 4GB9A 5HYQB 1E9OB 3U1QA 4RFOH 1S7XA 2EDBA 2IH1A 1CE1L 3KBPA 2BXZA 2VWEE 3IDIA 3IT8D 4JRYA 4K5OA 1R5WA 1BFTA 4U6HA 4YFDB 5DR5L 5G5DB 5EIIA 1XCQB 1OGAA 3VMOA 1O5DT 1QBML 2NW2B 4UNUA 4PGBB 2OA9A 3MV9D 3E9TA 4OVVA 1F4YL 3WE6B 5ID0B 2YD3A 3IFLL 5LHDA 1WD8A 4J3UA 3AVEA 4M4PA 5BS0E 5SWSE 3D07A 2EKSA 5ANME 5IBLC 4GKZA 1SYVB 4TNGA 1ZLVH 4Z78B 3KE0A 2QKSA 2ZUWA 3OKDA 3W2DL 2DJSA 2WXLA 2ZF8A 1IJNA 5B1KA 4OFQA 3RWFB 4X4ZA 5EZLB 3QJXA 4AL8L 4KZEL 4ZNCD 2ARJB 4MD5B 4ALAL 5GS2H 2A9AA 2J6EL 1YQ2A 4GSXA 3REVA 3V6BR 3T0EA 1NAMH 5EBGA 4JZNA 5HGBB 5C07A 2BWDA 2R0ZL 4PJ7B 4ELMB 2YLHA 4HIHA 1QFOA 4JY5H 3AXIA 4MNGE 4XO9A 4BSWB 4AYEC 4AV5A 2JELH 4NOFA 3F12B 4RAUA 1URLA 4K2UH 4D0BA 2J1YA 3MCG1 3FO2B 5F7FA 1OTTD 2EE3A 3RUGE 1WFUA 2P1YA 1CLZH 3V0WH 1CLCA 3TVMD 2Y2WA 5EZJB 3LVEA 3GSXB 3QRGL 4B3EA 3C5JB 3CFCH 2AXHA 4C58B 3A5VA 2UWEE 1KXQE 3NYKA 4IGBC 5I1DB 4OJDH 4R2GC 1U3HB 3QG6B 2WBJD 4NN5B 5I0DA 2BS71 3ZTNL 1TSRA 1KCUH 2ZCKL 4O5LL 6FABH 5IHBA 3LXUX 3ISYA 3IB4A 4J8RA 4B0MB 1RZPA 4C4UA 4DPAX 4HMCA 4NQCE 1S9YA 3ORJA 1REIA 3PJSB 2OMTA 1DLHB 1MAMH 5EN2A 3VFUA 2YPVA 4LSVL 1XEDA 4TUJB 3ZKND 4I5BB 3UYPB 3Q8EA 2DQEH 2J1XA 2VW7A 3V9EA 3K1KC 1BVKA 4ADJA 1FWXA 1UH2A 1JWUA 2B9AA 2RIKA 3QWRA 4PTUB 2A38A 1WWAX 2UUDK 4PJ8D 5AALA 3LZLA 5IP4A 5T8IA 3TL5A 1HKLL 4NO2B 1M3JA 1Z3RA 1MI5B 1WIPA 4JM2C 3ZE2E 4PG2A 4F2MB 4G1EB 1I8AA 1YJDH 2C4XA 4UM9A 1DJSA 5H35B 4RNRA 2VC2H 2XPZA 3QJTB 3PRZA 4JVWA 1T83C 3HBGA 2ENPA 4JHUA 2EUXA 3F64A 4JM2F 4J3VA 3LQAH 2ZCZA 3CZUB 2YJQA 4U7KA 1QUNB 4PHZA 4LE8A 3PL6A 3IJSA 1MPAL 1EGJH 3QQ9C 2J5WA 2JJTA 2PP8A 3ZRFC 4OKDA 1GZPB 3HRZC 1M05A 4F37F 4PJEF 3IU4L 4K9EC 2QVIA 1G7PB 5T5NF 5TK2A 4LKCA 4NQXB 5HVWA 3HS0C 1V3JA 4UT6A 4XPAL 4I3RL 5A2KH 1P84K 5HYEA 4LEXH 4YLBA 3A4DA 4JRFA 3WJJA 4OTXH 1BFOB 4XCEB 3X1EA 1CFNA 4FXKC 3CFDB 4N9GB 3D39A 3RJDA 1YEHH 4E41A 1W0VB 1U30A 1VKXA 4IBVA 1AR1B 2ERJC 3CFBA 3BAYA 3F8UB 3P0VH 4JHAL 1OCRB 2IDQA 3HG1A 4JKLA 4ZAKC 1WA2X 4HUXA 1M6OB 1L7IH 4MLIA 1K8DB 4JPWH 5MENA 4DTGH 4NDMA 2E4FA 5E99L 4MMZC 5I0VA 4ODXA 3M86A 1G84A 3L5XH 4ISVB 5FYKE 1TJHL 2VKXA 3CK0L 4PI0A 1IJ9A 4Y9FA 1FLRH 1NGPH 1BJ1J 4XHJC 4PLJC 4HAKA 5EPMB 3SKOB 3BLPX 4M8QB 3UCQA 3VGAC 3OKOA 4AM0B 3BAEL 3UTSA 3C6SA 4GT7A 1S7QA 4Y16C 5E1AA 3QHZL 3I84A 3DX6A 4R4FL 4YHPB 1GS7A 5H8DA 4NCC1 1KFAH 5D2NB 2NUTA 3V5DB 5ERWA 2AERT 2EDNA 3TBVB 3M17A 4NN7C 2F54B 5ESAA 4XMKL 2JK5B 4IJ3B 2R39A 4LL9A 2Y1YA 2Z6FA 1ES0A 4Z7UB 3VFPB 3BKMH 2ATPA 1SJMA 4P59L 1WQVT 1E3ZA 3QIBD 1DL7L 1P53A 5J13C 2AZAA 1YPZE 5I6XC 1SXNA 1ZT7A 3F5WA 3PHQA 4L9LB 5IB2B 2FLMA 3Q01A 1GGUA 2E7DA 3OKMB 1F4WH 3CFJA 3HW7A 4XBPB 1M4KA 4QRPA 1HU8A 4Z76B 2YRLA 1YAIA 3ABKB 4NZFA 4KFZC 3IM1A 5T3XE 2AK4B 2PW2B 2NXZB 3DGGB 3WHXB 5FFLA 1CF8L 2LV4A 4W6WB 4TPRH 1TJXA 2JJVA 2WTRB 3NTCH 1ZGLM 4GAJL 4XPFL 4BQ8A 3RIFF 4GBXB 5M95B 3OAZH 4UIKL 3ARRA 5EBLB 2QADB 1RULH 2AJ3B 4F7CA 3VFRB 1OALA 3ZX1A 3CHRA 4N68A 5FW8A 4J3WA 4OCSH 1NWOA 4G82A 4KKQA 1S4IA 5I6OA 5ALCL 5DVPA 3WUWB 4FYQA 1JHTA 4P2QB 3TP4A 4KXCA 4X99A 1W6LA 5A2CA 1PLCA 5F8RC 4K3DH 4LQFH 3WN5A 1NLBL 5DRXB 3KBHE 3TBSB 5DD0H 1PAMA 4N2AA 2X4QB 3T65B 1T7YA 4PCYA 4HULB 2MJWA 5EB9A 3EO1B 4L3CB 1XGQB 5E6ZA 4KI5C 4LASL 1L9MA 2J1WA 4FI7A 1QG3A 4H7VA 1QSVA 4TYUA 4RWYH 1T3FB 4G9FB 2PCPA 1H6EA 2BP0A 1IAOA 4AJWA 1UZ6E 3JYBA 4C4KO 1ITCA 4H8UA 3D87B 2HKFH 1E40A 4KI5F 2DD8H 4I1NB 4U3SA 4D3CH 4GINA 2WVTA 1CR9H 4XB8A 4YSRA 5MHSE 1F97A 1I8UA 2R83A 1L5GB 3QFJE 2GBVA 5I5JA 1BOGA 5BZZA 2CO6B 2XHNA 3DMMC 4GKSB 2Y72A 3QNXA 4WGWB 5EOCL 3ZE0B 4PJFE 2HCZX 4ODSH 3IJ7A 1KIUA 4HBQA 4QXGL 3FPXA 4QXUH 2OXGB 1A6TA 3QUYA 1C16B 1RZIB 2CR3A 1UGNA 3DIVA 3C5SA 2F2HA 5HHMD 2ZNXA 1YEEH 4UI2A 5LXGH 1JG9A 4DZ8A 1PGRB 4MCZA 4MZ2A 2CAKA 4WO4C 2VXSH 4B9GA 3GMRA 1KELL 4R3SB 4RMWA 4GUOA 3GRBA 1A4AA 1DFXA 5B8CB 3WIHA 1FA4A 1X5GA 3JV6B 5HGDA 3ARBA 5DT1L 4F7PA 3TVMB 5DEGB 2P42B 2DM4A 3DGCR 4HSCX 3D30A 2HT3D 2OP4H 4JG9A 4PJHA 3MVSA 3SY6A 4KO6A 3RWJA 4PBXA 2WKOA 5D7LA 4N4YB 3ARGD 1I1AD 3TN0B 4A1RA 4FQ1H 1C08A 4MQXD 5DRZA 4XHQA 1S7SA 3N40P 5CUSL 4HPYL 3UPRB 3VFWB 2Y23A 3UERA 4QEGA 1DBMH 2YZ8A 4FG0A 3FU7B 1K4DB 3NZ8B 4PJCF 2VZ3A 3O11A 1II4E 2XIBA 4WLCA 1SN0A 1G7HA 1NSNH 1GJWA 1JPTH 4L05A 1FNFA 3WJLC 1J1OH 4UQ3B 5BZDA 1QPKA 2BNQB 3KLLA 1F8TL 1A8ZA 4JG0L 2NY4C 5FWRA 3L16A 5DFAA 3FT9A 1MHCB 5EO1B 3VQ2C 3MMEA 1W8OA 3BQVA 2WB7A 1TO5A 3SBWA 3NJXA 1BJ1H 5DHXB 1I75A 1WGVA 2KZKA 5IY5B 4WWOA 3C6EA 4N90E 4PJ9C 4YHOL 43C9B 3SDCD 1FNGB 3OWEA 4A2GA 2I9TA 1OAXH 4HGWB 3MXVH 8PAZA 5DZAA 3SOBL 2E7LC 1A7RH 5IZ7A 2GVYA 4X4XA 4MNQA 2P24A 5GGRB 3IJHB 1OZTG 1V3LA 1O7VA 1THCA 3UJIH 4Z95H 3KLAA 4S1QH 1PZUB 4ZUUB 1KG0A 3BDYL 4GW1B 3L3GA 2UVEA 2VW6A 1CICC 3F04A 1NGXB 3QO0A 4AXWB 3QSKB 2A0LD 5SX5H 1SF3A 2B16A 4AKQA 3ES6A 2WVUA 2EINB 3RAJL 3UTZA 2J5LC 4AG4H 1RPQA 2KL6A 4R26L 1HK6A 5L0QC 1S7WB 3KPNB 3N1MC 1T6WA 5M94B 1ETA1 4HWBL 2V7NB 3ECWA 1C1EH 2DS4A 4KU1A 4XNZC 5FECB 3A6CL 1FC2D 1HWWA 5I1IH 3HE6A 4NNYB 1JGDA 4BFKA 1F90L 4CBZA 2YAHA 1F1GA 3L6FB 2YPLB 3B9EA 4KUZH 1EQWA 1RJZB 5B1BB 3MLUL 5BRZD 5B3JE 2VRKA 3U79A 5KSAB 4ZJ9A 1CJYA 2IC2A 1BZOA 1CXKA 4K4KA 5DWUL 5K9OA 4LDLB 1I9IL 1UASA 1D5BA 4MAYA 1NEPA 4OLXL 2HFEB 1NPUA 4FQIH 1S7UA 5TF0A 2WQRA 4AC2A 1BVNT 3RL1A 5EBMA 3QCTH 3EJSA 1EX0A 4OUOA 4UQEA 4YDLC 5ITFB 5IFHH 4H26A 3TC9A 2K8QA 4XVUC 3GMMA 4YHLH 3G3LA 3LIZH 3TA3D 1AACA 1QPPA 5K9QG 3CTTA 1NMAL 2CDEB 2Q2LA 5C2UB 4ODHH 1ND0B 4ODBD 1MY5A 2ZWYA 4P23C 2WWKO 3N06B 4YBQD 1WSST 3BQUB 3QQ4A 2V7HA 4P2OA 5C7ZA 2YXMA 4JPVL 3TIEA 3KYOB 3CDGB 2ZXWB 2COQA 3PAYA 3WY4A 1ROCA 1V7ML 4UV4H 3VH8G 4G7QB 1FC1A 1TTBA 3TYFB 2DJUA 3KXFD 2VDPB 4NYLA 4N26A 3MRGA 4MQ7B 4PI2A 5E00A 2FGZA 1I8KB 3AXLA 4HFUL 2ZF9A 1PLGH 5CGYD 3II1A 1ZPUA 1BP3B 4QO1A 4DP8X 1RZFL 4F8NA 3MBEA 5E6ID 1M2VB 4JRYE 5GGVY 3R1GH 3ARUA 3QDHA 5DYOB 2VDPL 1JK8B 5I74B 5I1CH 4E9YA 2AHIA 3VGFA 3MTXA 3TEZA 4ZODA 4OZGA 3QQ3B 4AQAB 1PKQB 3T4YB 4P46A 3SE8H 3KYNB 3OPZH 3V8CA 4HDIA 1JAEA 3KZ8A 4LO9A 3HJ0A 4LLAA 3OGCA 5FKAB 1PVHA 4LCCB 1QLFA 4B97A 1JTPA 1A3RH 4ONHB 1P1VA 3QUZB 4YHKL 5I66A 3A67H 3IMSA 4K7PY 5EU7C 1OCWL 3EOAB 1J0IA 3BUIA 3F62A 2PYEA 5F1SA 4IMKA 3II2A 4I77L 2AJYH 4L4VE 4R4BA 3QXTA 3S36L 2NYZA 3FQTA 2EZ0D 1MRFH 5F0LB 4HIQA 4L0YA 4CN6A 2ITDB 1FGNL 3IS1X 4BIKA 1F1DA 5FKPA 3O2WL 4PG9A 4JQXC 3MV8A 2H1LM 1EHAA 1E2ZA 3N43F 3OAUL 1J0JA 1EK3A 2D2OA 1XR9B 4IKKA 4W9LC 4XGZB 5DC9B 5DMGC 4IDJH 2H9GB 4QTFA 4WDIA 1MN4A 1CIDA 3WHE1 1JZ7A 4HAGA 4LLDA 3NIFB 3W9DA 1OAUH 3IJEB 2R0WL 5LJYH 1K72A 1G7JB 3O3DA 4QJ4B 3ILDA 2FUTA 4JFPA 5DUJA 2C9SA 1Z9PA 4M3HA 2AQSA 2YOAA 4HV8B 4C4KT 3ZL2A 4YHNA 3GBMH 5FR3A 1PDKB 1B0RA 3DURA 3KH3A 4LVHB 4BSJA 4XCCL 4ZTPL 4U1HB 5C86A 4BZYA 2F08A 3GXMA 1SVZA 2WW8A 4OB5L 4TQEL 2HFFA 4ZXBC 1UVQB 1G6RB 3GXNA 4JAMB 3UGEA 3ULSA 4H1LB 3P4NA 1T0MB 2K7PA 4GFXA 2FZ3A 3NABL 5J6SA 4FQ2H 1I7RB 2BNRA 3LNGA 3LKPA 3CPLB 2XWTB 4X4KA 2NMSA 5HHNA 3FTWA 2Q8AL 3TTSA 2WD0A 4KXAA 5LBSL 5I75B 2I25N 2PWGA 1G6RL 1LJMA 1WCBB 1FFRA 3VMNA 4KKPA 4A2HA 4KQ0A 5HI3D 4CC1A 5HHMB 3FT3A 4BH7B 5IV2A 4ZUVA 3MTRA 4KK9D 2Q86B 1IBHA 2W94A 3P02A 3BGAA 1A6WL 2OTWB 2R51A 2EVJA 3VG0H 5JZ7C 1U8PA 4NM8L 3DPBB 4MSWA 4PGDB 2BP3A 4X98A 4XN4A 2P47B 4H8HA 3DOHA 2G0LA 3DTUB 3HI5H 5LGYA 5LN8A 4PGZA 1KYOJ 4OZIE 3J8F7 4KRPC 3G7TA 3TS8A 1YNLL 2BFVL 4JFWA 1P5VB 3QYCA 3BD5A 1VFAA 1J5IA 4HWEL 4CA4A 1AXSA 5EEXA 1ED3B 2CJUL 4PJAA 3BO8B 2O61B 4X83A 1OP3H 1P7KA 4ZSOA 3U2IA 1BHGA 4JLRA 3OZ9H 3ARGB 3CVIL 4P5KB 5JIMA 3IJ8A 3NCYS 3H7BA 4ZFZB 4PRNB 4UTAA 3D4CA 3FONA 1TZ8A 4YSDA 3IWUA 1IEBA 3FUDA 4IIQC 2DJMA 3MCYA 3BEWB 3DC0A 3WEAA 3SJVD 3MRRB 1RZQA 2DAVA 1I8LC 1WZAA 4FRWA 2DTML 1PQZA 2E6QA 4JFDD 3DBXB 2N3JA 2DQFA 1AKJB 3BIKA 4PPTA 1QSED 2BSEA 4P9HC 4U49A 1HHKA 3MLXH 5FC9A 3W5NA 1BYOA 1DANU 3OXRB 1C8QA 5I24A 3D4YA 2Z91A 1TT6A 1EUUA 1QBBA 2ZYRA 2R9HC 1DSWA 5GZND 1CWVA 2EE9A 4LNRA 5DDHB 4OCXL 4KGJA 1IBGL 3S35X 1SJHA 4NKOA 2Z64C 2R1WA 3QXUA 2CSPA 4P2QE 1BMWA 2XG4B 1KIPA 4TNWF 1BW8A 5B38B 4HUCA 5CEZE 1JPSH 1W0WB 2EC9T 1M3IA 1LTXA 1FVEA 3AREB 4D0CB 2DMGA 3VXNA 3BMVA 2VR7A 2Q1EA 2YN3A 1AXTL 4IBLT 4BUHA 3JUZA 4Z7QF 3MR9B 3WHE0 2BVOB 4LCWD 5H2BB 1E9PA 4M1DH 4S11A 1XMWA 2AJUL 2ZUSA 3BZ4A 4U3CA 5HHOD 5L7XH 5DZJA 3OJDB 3MRKA 3MV9E 3VXSD 3PIQA 3QQDB 1JHKL 2DM3A 4PWKA 3TH2T 2BK8A 3OC8A 2ZOKB 3BRFA 1MCPH 1N5YH 2EYTA 3SPVB 3QPXH 2BSRA 2EUVA 5HGHB 5DLML 4KJPD 1A5FH 2HPOA 4WK0B 5DTFA 3LPOA 3D69A 4AWJC 4K0OA 1G0XA 1CT8B 4GG8A 1COBA 4Q74A 2HWZH 1RSYA 5DK2B 2A74C 1EUTA 1GIGL 4XN8A 1JZ2A 2WQUA 3WGVB 5DD3H 4UQ2B 3H9SD 4R0LA 3QI9C 2YS4A 5BRZB 3U1SH 3IDXL 2J88L 3MJGX 1Z0MA 1V10A 2ZXQA 2JIXB 3TH3T 3TZVC 4EXPX 3NFSH 1A9VA 4NRYB 3VSQA 1J05B 3OL2A 3WFZA 4AYGA 1L3NA 4XVJL 3HZMA 5E24E 4WW2C 4KK6C 2WWKT 4MFHA 2QPUA 1ZVSB 3D52A 4XPBH 4IBSA 4QDGA 4LCUB 3WMSA 2YD0A 3RI5F 3K91A 3V79C 4N1CA 5T33L 1EIBA 5F7EH 2FH6A 4QHMB 5K5YA 2XTJC 1XGUA 4WW2F 4QOKA 3KJ6H 3AMLA 4X5XA 1CI3M 1U91A 1I9JH 3FTXA 3T0VA 1QWNA 1AGFB 2GJRA 4PB0L 4R9HA 4QXWA 1U92B 4J1UB 4EIZC 1R5VB 2ED7A 4XZUA 4PW9A 1LEKA 3Q6FA 4Y2DA 2VN7A 2XVBA 4MMYB 1C5BL 1EHLH 1KPUB 1Q0XL 5FGSA 5GGRY 1MJJB 2R0KL 3U4KA 3LSOA 3RGVB 3S96B 3EFFA 3DJZA 4HUUA 1F6FB 3O8XB 3ASOB 4LU5L 2FJSA 1LQBC 2IFFL 3ESNA 4FNLH 4DEWA 3WIIL 2ZX5A 1WRFA 2RHEA 3NN8B 4PJBF 3VCLB 1K85A 1E4JA 5INCB 3W39A 3DIFB 1AGCB 2ADFL 3FRPA 3IMWA 3PABA 2ESVA 3PFQA 2CIKB 3BDBA 3N1GC 3JV4B 1XSIA 2F6AA 1XZ0B 2QDVA 1P9MA 3BUDA 3M6DA 4PJDA 5C0GB 4N0UA 4ZQKA 4G43B 5IG7B 1MHEB 3WKQA 2FEDD 4PRHD 1AMYA 5ETUB 3LKNB 1SHWA 2OCFD 1V27A 3FQ4A 4N1HB 4CKVX 2PXYA 4QAWA 2C7FA 4HIIA 2KT6A 3DYOA 4TKWA 5DC0A 1J18A 5T1KD 1JNNL 4GKNA 5EUKB 3S5LB 3MV01 2K4WA 3B2PA 1U8CA 4ORGA 1NCCH 1W72A 4MD4A 1WZLA 1OM3L 3QIWA 2BCKA 5BQ7A 4ANWA 2UZXA 2X2YA 3RTQC 3FCTA 2WNGA 1JRHH 3LZFL 3ILPA 1KT2A 5I9QB 4JO3H 2XPYA 3BVNA 3T4AB 1JNLL 4PUBL 1J11A 1WFJA 2VXTH 1JXGA 1T5XB 2J25A 1CG9B 3QWOA 2P45B 1I1FB 1NM9A 1AFVL 1MW3A 4CUCA 2G0KA 3KDMA 1IRAY 3GXPA 4OGXH 5C0JA 1HQ4B 3V9FA 4ZMNA 3C5ZD 4CMHC 4X2UA 1RXLA 4BFIB 3KPSB 3GKWH 1ZLWK 3WNNA 1ZT4B 4KTGA 2FQEA 2EVHA 1HHHB 4JHWL 5C0RH 3KPRB 3L7EB 1ORSB 5DQDH 4UINL 4NUGL 4ABQA 5IIEA 2ENYA 2RAMA 1SVCP 3CPUA 1ECYA 3LDBB 3VWKA 5JDJA 2HT2D 4FMVA 4FZEL 3L95B 3EJPA 3UZEA 1O6SA 4ZT1A 1Z3GH 1T1XA 3L4TA 1LP9B 3SKMA 2P5EA 4X6FB 2ZKXA 2WQSA 1T2QH 5JIIA 2I7SA 3QCUL 2EVIA 1G1KA 2YD6A 4NFBA 2F8XC 1QLEH 3IXTA 3ZTJG 3VRIA 1RUPH 5CIPB 1PX3A 2C3XA 1MCIA 4F1ZA 4AKOA 3ZPDA 4NAMA 1ZSHA 2BP8B 3FHEA 1OARL 4PV9A 4TOYL 1Z5LA 2WWOA 3NH7L 5IQ7H 4Y88A 3NJNA 1NCDL 1WWWX 4W70A 3SPHA 5KZCD 2H7WA 2WXPA 4ACPA 4Q6IA 3D0AA 3KYKH 1AR2A 3Q6GH 2X6VA 1INQB 3LNFA 3ROOA 4GAGH 2PP9A 2Q76B 3ARDD 4BZ2H 2OJEB 3BI9X 5CN1A 3UTTB 4C57C 5CU5A 2NR6A 4H88H 5DJ0B 3RG1C 3SJVB 1BEYL 2JXMA 1MCWM 1NCBH 3WDIA 1MRDL 1U41A 2OCJA 2UY6B 4MXWL 5F3BA 5I8EA 5BVJB 1VJSA 3GXUB 3FFOA 3MRFB 4P49A 1B9KA 4FKEA 4B7LA 4RGND 1GSMA 1JP5A 3H9HB 2XNAB 4XVTH 5IMKA 4PJGF 3ZDYB 3LV3B 4M1CD 4MCYB 5LG1A 1TMCB 1PSKL 3VFTB 5D96C 1TZIA 3TA4D 2R2CA 2Y7QA 4KV5F 4NZTL 1T7XA 3X13A 3WL9B 4JRWA 4O51B 3BUYB 4DP2X 1B3IA 1BLIA 3VFSB 5KJ7E 3GK8H 3AQYA 4Y19A 3EBIA 1UZGA 1HH6B 2VMFA 2YUZA 4FQJH 5JW5A 2Q2EB 5D2LA 4WUKH 4PY8I 2X87A 4GQQA 3QEUA 3K2KA 3RU8L 5LCVL 5IM7B 2V2TA 3NPSB 1IC1A 4L0PB 3W56A 4OBSA 3L1GA 2WAHA 3UG3A 3VTTA 3BPCB 3KW8A 4QNPF 1PIGA 1ETZB 2P8LB 4HJGA 5C3TA 2X09A 5DHVH 4BQ9A 4M6AA 3VUAA 2EIMB 5IMMA 1IU1A 1WIUA 3RA7L 4JN2A 1HOCA 1TCRB 3H2PA 5FUZH 5FLVA 5DJAB 1OLZA 4G1MB 3M8OL 2X88A 1AD0B 3H9SB 5FF6A 3PGCB 2HRHA 3SZ6A 5DD5H 2JTYA 5IGXH 3ISRA 1PZDA 1CXFA 5FGCB 1RK7A 2B9BA 3D0VB 5HHME 1NCTA 4Y4HA 5DJXA 2YKKA 2BJML 3VWJA 3EO9H 1YEJH 3CFKB 3ZHNA 4UTBH 3W0WA 3UTQB 1AY1H 3K80A 1CLOH 4GO9A 2NSMA 4JFED 3VI3B 1SEBA 3T09A 1QPXA 4FXGA 1MJ7H 2DQUL 1HAUA 2AJZB 1RP8A 4NQDD 2A73A 4NQUA 1KYOK 1RSFA 4BXSV 1A6AB 4X7FC 3SODB 2IAMB 3MLVL 1IKNA 1J8HB 2WLIB 2FYVA 2VISA 2A9MH 1QP1A 1KLFA 4UILH 5JIKA 4FQLH 3OBAA 2B0SL 4JO5A 4FYRA 4UYQA 5D1QA 5DJYB 2ZKHL 1XIWD 3IDGB 3VXOA 2ZKYA 4LSTH 3OHXA 2C9PA 4JFHD 2OMZB 2Z0UA 4RGMC 3FU6A 3GLAA 5I1EH 3HC0A 1H5BC 5HDLA 4RESB 1JPFA 4BK5C 1J1XL 1Q9LA 3D9AL 4I1PA 5D5MB 5KG9B 1D6EB 3NJKA 3STLA 1GL4B 1QA9A 3CFUA 5FYKH 5LGHH 3QUXA 1MFEH 4OLYL 4CSSA 2DLTA 1TJMA 4WTZG 5HI4D 5KVDL 1HHGA 1HHIB 5MEOB 3N5AA 2QR0A 1XL6A 3TV3H 1SY6H 2QVKA 2VLKA 4JNXA 1LO2L 1KN2H 4WKZB 2ID5A 3GSOA 5IVZB 4JPSA 4MDIA 3FQUB 4PRHB 1P1ZB 2HJKB 1JHLL 4YBLC 2J8UB 1IGJA 3CIAA 4AZ8A 4PJ5A 1ZA3A 3IDMB 5FK9B 3HC4H 3BC9A 4MQTB 4XXWA 5IEKA 3WFCH 5EU4A 4XWGH 4XBEL 2E27H 2O5NA 4L1LA 3P0YH 5KSBF 3TASA 2V2XA 4XOCA 1DVFA 4BZ1H 1F3JB 1QLRB 1HS6A 3D5OF 3BP7B 4TNFA 3NG5A 2EXTA 4GUPB 4WTQA 1PW3A 2X89A 4X5WA 2XWJB 4IOFD 3GZQA 3MLWL 1JN6A 3ZKMD 3DVGA 4DK6A 4F33B 2QKIC 5D1ZA 2XN2A 1BIIB 5EOTA 4OCWL 3S48A 3GSNB 2EIBA 4AI7A 2BS8A 3EOTL 3FQWA 3SDDC 3IMTA 2KPWA 5T1DH 1QBAA 5FYJL 3C9NB 4F5CA 3PCYA 5I1HL 4QY8B 5M7QA 1U93B 3HMXL 3MX0A 1UXMA 3IJYB 1UUSA 3F6LA 3P40A 3PQYD 4BFOA 3NACH 4NIKB 5T3XH 4WY7L 4FHBD 1D5RA 4PB9H 3ULUE 3GSNL 1UWEH 2ZOWA 1E65A 4MB4A 4AE0A 3VXPB 3P9LB 1P6AB 1HHJA 1RK0B 2ARWA 3OKEB 4A37A 2HX8A 1YO4A 5BV7B 3DXAA 3HZYB 1WZ1L 1OQXA 2ZSVA 2IPTL 3MNZA 3H42L 5B4MC 1TFPA 2VDNH 5C08D 4PVLA 4YGVA 4M48H 3LRMA 2ZPKH 4DGIL 5CEXB 5IBLD 3WTXA 4HC1A 4LVOC 1T89A 3QIUD 4Z7NE 5BV7L 1HFUA 2OS7A 1V05A 3VSTA 2P8MB 2F9BT 3MODL 4J3XA 1JXDA 1AGEA 2E9IA 3CBRA 4S1SL 1RJLA 1QEWB 1MJUL 5HDQL 3QORC 4IU3B 3KXFE 2XY2A 2PR4H 3W3BA 2D03L 3GFUA 3LEVH 1K5NA 3LS4H 4J6RL 2H32H 1MVUB 5HYQA 1J9CT 1YZZA 3EG9B 5E8DL 3F05A 1FSKC 4AYSA 5G5DA 1MFCH 3HHSB 3KHOA 2FEEI 2ZOTA 3GI8L 1S78D 3NIGF 5E9DA 5HYJD 4S0HA 1B4JH 2FD6L 3WTYA 1UKQA 4PGBA 4OI7A 3WO3B 1FN4A 5KSVB 3QAZB 4LCIL 3WE6A 4PP2B 4IGBD 2WOBA 1FZJB 1I3GH 4TUOB 4R2GD 5C2BL 3UEQA 1NWPA 5E1GA 4GAYA 4Y5XC 3ARQA 6PAZA 2J6EA 4GI6A 4K3EL 5BO0D 5FO7A 5EZOL 1AQMA 1SYVA 4Z78A 2HN7B 1D6VH 3GLEA 3PGDB 3PWUA 4MXVF 4RGNB 3RB7A 3V10A 2UYLB 4G6MH 5TF1L 3CSPA 1Y6MR 5IJKC 5EZLA 5DK3A 1YEIH 2ARJA 2YAEA 3VRLE 3WFHB 4JDEA 3SDXF 3SE9H 2FJFB 4L5FL 2GI0A 1A7BA 2JTDA 1XGYL 4U0RC 1HESA 3L3OC 4PJXB 1GW0A 1CFVH 5HGBA 1SMAA 3G08B 2CHNA 4X50A 4PJ7A 2R4SL 4ELMA 1CDJA 1A1OA 1SQMA 1EMTH 4BSWA 4I48B 4OF0A 1CFSB 4X9BA 2N4IA 1ZSDB 3F12A 3CSBA 4JRXD 4QLWA 5KYWA 2NNAB 4YAQB 4H8WL 4JM2D 2HYMA 3ULAB 3P4OB 3S3SA 3V5HB 5D4JA 4QOKE 5EZJA 1GOGA 3T3MF 2KDGA 3GSXA 4FXTA 2X1WL 3C5JA 4FFVD 3QYMA 2FNBA 4Y4KC 4R8WH 1BXVA 2ZX9A 1Q90A 4F2FA 1ZV5A 1U3HA 3MNDA 3ZL4H 1RZGB 2G9KA 1SPDA 1KJMB 4LMQI 3GJEB 1X9QA 5F9OH 2NT0A 3QQ9D 4KXZI 1FHNA 2NDFA 4WEUD 2R8SL 3IFOB 1UACL 1U8IB 3ASNB 4HZAA 4F8PA 4HOMA 1BECA 1DLHA 2D3JA 3K4AA 3PWNB 5DR5H 2EEXA 3TU6A 4F24A 4TUJA 5ESVB 1XCTB 3MUJA 3BZFB 4H1LG 1QBMH 4NUJB 5E5LA 1I85A 4UANA 3GXIA 3EGDB 1P7QD 4PTUA 2BINA 3TCLB 3DIDA 4D7BA 1HAWA 2DBLL 1V55B 4NQDB 1O7SA 1MI5A 5A2IH 3SGDH 1HSAB 1RURL 4I85A 3P2DA 5CKAA 2M26A 4P3CH 3VB9A 4F2MA 4EE2A 1MJ8L 4G1EA 2JCCB 2CALA 3EOBB 3T8MA 4TSCL 4IRJA 5J1AA 4AK2A 3FRUB 1ZKAA 2WBXA 3VDAA 3L3JB 1CDGA 2WIIA 4U1MB 1KPRA 2AXGB 2VH5L 4C83B 1B2YA 4PLJD 4QRRD 2R0ZH 1QUNA 1G7MB 3FSAA 4Z7VF 1KNOB 4F58L 2FL5A 1R17A 3BIAX 4Y16D 2F5AL 4YDVB 3PDDA 2WWMD 3SJVE 1GZPA 3UYRL 2PTVA 5EWIL 3T6WA 3FZUC 3CN3A 4FN0A 3UP1A 2WLZA 4JFDE 4LHJB 1AZNA 5BW7C 5I1GL 5JIHA 2IEPA 2F1EA 2H2SC 3W11C 4NAJA 4JCMA 5A2FA 1QSEE 3CFDA 3EJZC 3GEWB 4F91B 1JZ4A 1W0VA 1EO8H 2V5YA 3CFIC 1KYDA 4I0PC 2H26A 3BP4A 3OKNB 4OM0L 3ZDYE 5C0CB 2FWOB 2HJLB 2JF1A 3R0MA 3WDJA 4AGPA 3EF4A 3MDJA 2R2EB 2ZCKH 4NHCH 3CSYB 3BIBX 3M07A 2V9TA 1M6OA 4D9RD 3EKCA 1K8DA 2YXWA 5KVEL 2I27N 2TSAA 1DQJB 1H3UA 4FFYL 3DHUA 5L6YL 4N22A 3HE7B 2F7QA 4OGQC 4FI8A 2Q7YB 2Y1ZA 4ISVA 3U2JA 2CQVA 4WI4A 1EZSA 1MOEA 2X2IA 1AD9B 3RHWF 1WC7A 2APBA 1MG2C 4O00A 4WU5B 2P5EE 3TO4C 3T9WA 3SKOA 4LCWE 5E08H 4TNEA 3UJTH 4AM0A 5HHOE 4MJIA 4WWKA 5JHAA 4MASA 4LAJH 1LE5A 3VXSE 5B38G 4ZZKA 4U1IB 2V17L 1VFBB 1B2WL 3RVUC 2WXIA 5F8QC 3PV7A 4YL4A 1HSBA 1SXBA 2I60L 2ZTBA 3NJGA 2RB8A 5D2NA 5EULV 3S88H 3LHAA 2NY3B 5IVOA 3APCA 5GGQH 1J5HA 3GHBL 2F54A 3K6FA 4LBEB 3BP6B 2DH3A 4MJ5B 2YD1A 2EDHA 5IB5B 1EEUA 2Y6SC 4Z7UA 1QW8A 3PP4L 5SX4I 3VFPA 4EUPB 3O2VL 2DYPD 1FZMA 2K6ZA 3S37X 1BWWA 4KI5D 4WENB 4YPGB 5LXVA 2BS9A 4KKLC 1CD0A 4IOSA 5EEUA 2EUZA 1MPAH 3OKMA 2LAGB 1VGEH 4XBPA 4Z76A 2LFGA 5HDBF 4TQPA 2R23B 2GIXA 1FYTD 3VI3E 4BH8B 2AK4A 4XPAH 4I3RH 3U0PB 3DGGA 4NN6B 3WHXA 1U33A 4JFZL 1IQWL 2WTRA 3IDUA 2CPUA 4M56A 4EI0A 4GBXA 2OQJB 3FUJA 4B0MM 5EBLA 5GRUH 2Z4QB 2AJ3A 3VFRA 3FCBA 4MDRA 5IBTL 2P80D 2J12B 3FOMB 2Q9OA 4JO1L 3RVWD 4NBXB 1AJ7L 4LOFA 2YMXL 1YLBB 4GJTB 3WUWA 2OXHB 5F97E 4WO4D 3CHSA 3JUYA 4IJTA 1FBIL 3ESMA 1OP5K 4Q7DA 1IFGA 2XFGB 5DRXA 3TBSA 1ITBB 4NP9A 4F9PA 3T65A 3SCMD 4HU2A 3GKZA 1WPCA 2OR9H 3EO1A 4BJLA 1BF8A 1CVRA 1S9WB 1XGQA 5HYJB 5D5ME 5JDSB 3D2UB 3NDZE 3ROLB 5L2JB 4EOWL 2Y0SA 3KWWB 3ZTJH 4IGBB 2EEFA 2XA3A 3MQIA 4G9FA 3QHZH 4NENB 4A2EA 1NANH 4R2GB 5FHBL 2I26N 3PXHA 2VDQB 1KWGA 4RFEB 3DETD 1ZT1B 3WENA 3U6RB 1DO6A 1AAJA 3V0AC 1DSFL 2A6IB 4P4KD 3LNEA 4LLMB 5HDWA 5B1JA 4MAUH 1GGBL 3C08L 4HK3N 1X9UA 1O9VA 2R4RH 4N2HA 1L5GA 3RUGF 5BUPA 4PRHE 4WI6A 1QHQA 2CO6A 4GKSA 4YDMA 1F56A 2VDQL 3IU3B 3FQXB 4L3EB 1MCWW 2CRIA 3L1OH 2WYZA 3AS1A 2UWEF 3WCYA 4KTDH 5CP7B 4W9KC 1C16A 3N0PB 4YXHL 2TSBA 2WNKA 3JWNE 4X8XA 3UBXB 5I17A 3CVCA 4KVCL 4JREC 2JJSC 2VMDA 2NY4D 4L4TB 3S35L 2RJMA 4HFWB 5E0FA 4WJ5B 4R3SA 4QRFA 35C8H 2FIKB 2YARA 5D7JC 4JKPH 4OIFA 4KKBD 5D7SL 4LESA 4JRXB 5DXWA 4EEEA 3LX9A 3N6YA 5B8CA 3QRBA 2YO3A 4JM2B 1CF8H 3JV6A 2XZQL 1RUQH 4G3YH 3OWRA 2DQCL 3QVAA 3QWQB 4PJ9D 5DEGA 1CXHA 4XPFH 1I8MB 3VYOA 3VNYA 4J3BA 4XXDB 1EXGA 2VQUA 4JY4B 5F9AC 1HWGB 4PJEB 5AW4B 4BQ6A 5JR1H 1KENL 2OYKA 1KLUB 4HJUA 3NA9L 3CX2A 3HNVL 3ULVC 3TN0A 3DRQB 5L2KB 2J7LA 1CICD 4Y9BA 3S8FB 3UPRA 3ZE2F 4LIQE 4FHJA 3EBGA 3HRZB 3VX0A 5KWYC 1GKOA 6TAAA 3FU7A 4HLZG 3WNIA 3NZ8A 1UADC 3HS0B 3ULVF 4DZBA 1YN6B 2A5UA 1BPLB 3BVDB 4LEBA 5T5FL 4FXKB 1P7QB 4RSVA 3VW3L 2IBBA 2BNQA 4K9EL 2ERJB 2F8VA 1MHCA 5EO1A 1N64H 3FB5B 2X0VA 4WEMB 4ZAKB 4AT6A 2PCYA 1OZUA 1P4BL 2FATL 2WKGA 5AVXB 3Q2NA 4HP5A 1WTLA 1KDIA 2ZXBA 4JCLA 4YDJB 3WJMA 4NPKA 3EFOB 1FNGA 4PREB 2GFBB 1VADA 3K46A 1WAEA 3WEBA 2C7UB 4HGWA 4N2KA 4QJ5B 5IHUL 3ABGA 3RKDD 3B5GA 5CLYA 4WI5A 1DQDL 4ONFH 4QXGH 5E1IA 2DQIH 5GGRA 5CZVH 3IJHA 4LSRL 3VGAB 1ET8A 1RUML 5DJ6B 4PP1D 4U1KA 4ZUUA 3HVNA 5KJRL 3X11A 4HWBA 4Y16B 4AXWA 1CGSL 1E7VA 1VAHA 1MWAH 4FP8H 3BE1H 1VEOA 1YUHA 1ZVNA 1U3ZA 4G7YL 3VX1A 2QPSA 2ZNWA 4NN7B 3SDYL 4RGNE 3GZKA 2V7NA 1G87A 5FECA 4RSYA 8FABB 1AOZA 1CDIA 1T80A 2CE6A 1JL8A 2EEBA 2R27A 3EH2A 3IVKB 1XTLA 3L4XA 2BVYA 4Q0XH 3HR5B 1BXUA 5HHXH 3L6FA 5I19L 2YPLA 3VXUA 2HB0A 1RJZA 5BZWA 5J13B 1KCLA 5I6XB 2D9QB 4PJXE 4D0DB 5KSAA 2H5UA 4GEIA 1IM9D 1XH3B 5TPWL 3P3YA 3O9WA 5HHQB 5DZ9A 5C3IA 2HFEA 3GMPB 1H15B 1FORL 1CDHA 3JV0A 4WK2B 2IPUG 1F58L 4X42A 3K74B 5D8JH 2LTQC 4AX3A 2CDEA 1ND0A 2IANA 5D1XA 5LG6A 4MHHI 3BQUA 2Y1AA 1F8TH 5I6MA 2QT6A 2YSTA 3CDGA 2XXMB 1ZY9A 2CLZB 1VEMA 3BFOA 2V9QA 1TEGA 2GW5A 4X6BB 1V8HA 2LQRA 4JB9L 2W92A 2Z34A 4K71B 4MQ7A 4KROC 1IIKA 4L1BA 1I8KA 4Z0BL 5DYFA 2NY7L 1NC4B 4QI3A 1BVZA 3B1TA 3L9BA 1IT9L 1M2VA 4PJIA 3O6ML 2ICEC 1QNZL 2VSKB 5IFAL 1T03H 2CLRB 3L8QA 5DEJA 3SE6A 4Z3FA 1ICTA 3NZSA 3QQ3A 4G9DB 1PKQA 4LPVA 4MXQC 1AS6A 3T4YA 3KYNA 3NFPA 1JYXA 3QYNA 3BJ91 5TGBB 1EDQA 5FKAA 5D7IA 4X80L 4LCCA 1FYTB 4JFEE 2HMIC 4DUXA 3D09A 2EXWC 4PRAB 3QUZA 4ZXBD 1UD4A 3RAJH 2QSVA 2C1PB 3UJJH 1BAGA 3EOAA 4TM9A 3PV6B 4NQDE 4EI5C 4U6VL 4OGAC 4Q9CA 1GAFH 4APXB 3DMMB 4KTEL 1QO3B 2B1AH 3BUQA 1RIVL 2ITDA 3P1VA 4HWZB 4QHUB 1F90H 4KXBA 2Z7YA 2B59B 4G7RB 1JWMB 2FEEL 1PZ2A 5SWZB 5C0FB 3MLUH 1XDTT 2V5TA 2Z8RA 3QFDA 4ZFOB 4OGYL 3ZRSA 2BP5M 1XR9A 2IMNA 4RBPH 5DWUH 1SBBA 3PGFL 4WO4B 5F9DC 3CFQA 1OWRM 3KWXA 1JDDA 1NBZA 4JFHE 1YEFH 4OLXH 3C6LB 3UACA 2OMYA 5JZ7D 3IJEA 1J88A 4D2NA 1G7JA 4ZFOL 5FYLD 5MI0C 4NLAA 4FEMA 4DO6A 4XVSL 4AYID 3VYNA 4D8OA 2F53B 1N3NB 4HV8A 4JHBA 4OJFL 2F1AA 5F6IC 2LLNA 3CZFB 4A7VA 3NCCB 1PIFA 1BBDL 1FL6B 2EYSB 4QRSB 1WO2A 3WS3B 3L2NA 4GIPD 3F6JA 4U1HA 1BGXL 4R7VA 3AU0A 2WJ7A 1IEAB 1EHKB 2L7UA 4MMXC 2I9LB 4PJCB 5LBSA 2VQ4A 1UVQA 1G6RA 1UJ3C 5K1NA 1T0MA 3POHA 1BA9A 3QGVA 1QSFA 2QPFA 3GIVA 2GIYA 1JZJA 3SQOH 4D8PB 5B3SB 3FFCD 1VZHA 3CPLA 2XWTA 3IPEA 3O3EB 4B9FA 4KQ3L 3ESUF 3TJEH 2Z8WC 2KZWA 4CVWA 5K1JA 1WCBA 4HXBL 1TTFA 1G7LB 3FO0L 4MCMA 4JO2L 4BH7A 4KITB 1X4XA 2BZCA 4WFGD 1JV5A 1OSPL 2QDWA 3CDFA 3KYMB 4FEIA 4OZHE 4ETQB 2HT4C 2NY4B 2CGZA 2OTWA 2Z31D 2GUOB 4YHKH 2ZWZA 3DPBA 1OCWH 4PGDA 2R9HD 4YHIB 2EEAA 1RY7B 4PJ9B 2H6OA 3JWNG 1T1ZB 1NGQL 4CNIB 2ETWA 3QHFH 4E68A 3VXQB 1I7TA 4P2CG 2VUKA 3RX8A 4FL4B 3PQYE 1UT2A 1FGNH 1ED3A 4GXVH 2RA1A 4F7MB 2O61A 2B1OA 3UTOA 5ICYA 2B4CC 3OAUH 4BK8A 1AZVA 4J3OC 4P5KA 4GSQA 1LO4H 2DV6A 4ZFZA 4PRNA 4HMDA 1CICB 2GK2A 1SFHA 2G30A 4XWOD 3BEWA 3T04D 4BELD 1ZMYA 2OMBA 3MRRA 5EOQL 5CJXC 1RI8A 4PCTA 5C08E 3MFFB 5JPNC 1IE5A 2J5LB 2P8PB 4J3OF 5L0QB 2C9VA 4D9LH 3I9IA 3ZGIA 1MW2A 1ZHLB 1AKJA 4EQ2A 5CZXC 5DHYB 4PW3A 4KI1A 1SMDA 1W0YT 3FU8A 3MN8A 4UQCA 5I2IB 3OXRA 4ZTPH 3EYOB 1CGUA 4PMFA 5BMFL 3D85D 3QI9D 1E5ZA 2X2JA 4NNXA 3V52H 5DHEA 4C8XA 3K72B 4ZUWB 5GZOA 3DJRA 1UKTA 4W4OA 3L7FB 2M8XA 3QE5A 1ECZA 5D7KD 12E8L 2Q8AH 1PZAA 1W0WA 1TU2B 4RDQG 1FF5A 4YDLB 1OB1A 3QUKB 3QZBA 2R29L 4KK6D 3QDGD 1KTLA 3AREA 4H1LH 2EXSA 2JB5L 3CN0A 1R47A 4WIQA 5ENWB 4P23B 2BVOA 5H2BA 1RERA 5B3JF 5HYJE 4A63A 1IVTA 1A6WH 3KCWA 1FDLL 3GS7A 2ENJA 3DROA 2XTJD 4M8VA 1JGEB 3ENEA 3QQDA 1E4KC 1BYNA 4NM8H 2ZOKA 3KGSA