1RDBA

Crystal structures of ribonuclease hi active site mutants from escherichia coli
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMQLMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Crystal structures of ribonuclease HI active site mutants from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 49
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rdbA00
4DF4A 1BCMA 3VQ8A 1KVBA 1VSDA 3B6PA 1EXQA 1Z25A 2RF2A 1NKCA 1WSJA 3M8SA 1D9DA 4KB0A 4C8LA 3AVCA 3AVFA 2VWJA 2OPRA 1RCHA 3S3MA 1X9MA 2HHXA 4B8AB 2YNHA 3CFPA 4BDZA 2IOCA 3C94A 4ZHRA 3G0ZA 4FK4A 2P5OA 4BWMA 4W5NA 3RRHA 1O1WA 1BIZA 2JGUA 3TAGA 1B9DA 3DRRA 1ZYQA 1TV6A 1KCFA 1N5YA 2HW3A 4AH9A 4BE0A 3VN5A 2X6NA 4HUGA 4DFPA 3BDPA 2HHTA 4CF9A 3TR8A 1NKEA 4FJHA 3TAFA 5JS1A 3VQAA 3L2UA 3CQ8A 4IG0A 4PA1A 3RRGA 2YNFA 5HP1A 3V6DA 4Z4IA 3LAKA 1A5VA 2OPPA 4DTPA 3NGZA 3PO4A 4CCHA 2D0AA 3QETA 1S9GA 4OKEA 1NK7A 3RR7A 1ZBFA 4E19A 3WNGA 1TKXA 3KLGA 3HP6A 1SKRA 3V1QA 2YNGA 4E7HA 4DG1A 4CGHA 3L2VA 4FZYA 2G8IA 4HHTA 1HYSA 1S1WA 3OS2A 1YVUA 1NJXA 3ZCMA 3L3UA 3K58A 5E41A 3AO4A 4LH5A 4FJNA 2RN2A 1R0AA 2PZSA 4M3TA 1B9FA 2FBXA 3QEXA 1HNVA 3ZT2A 4CIGA 3F73A 1U47A 3CM5A 1VSLA 2QXFA 4I9QA 4OGCA 1BHLA 3KK1A 1LAVA 3D45A 4KO0A 5CZ2A 3EYZA 1T03A 4DTUA 3O4NA 4KTWA 4CESA 1LW2A 2ATQA 4KHYA 4CF2A 4W5RA 2VWKA 4M3WA 2OYQA 3QINA 4CJSA 3CFRA 4FM0A 4O44A 1S1UA 4CJWA 1ZBLA 4N56A 3KK2A 4HTUA 4F3TA 2DFHA 5J2MA 3KJVA 4N5SA 4O0JA 1JKHA 4ELVA 4M42A 4E0DA 1JLBA 3C95A 2IDOA 1SUQA 4IDKA 4IKFA 3LZJA 3E01A 3OVNA 1XI1A 3HL8A 4CEDA 4FLYA 1QSYA 1IKXA 1RT3A 1XWLA 3VQBA 1VK0A 1KVCA 2YHAA 4AHSA 4J2DA 4FJGA 4ZTFA 5SWMA 3VQ6A 4FJMA 3HPHA 2E6LA 1MU2A 1ASWA 3NBPA 3O3HA 4E7JA 3HO1A 2HHWA 5DK5A 4W5QA 3MXMA 2XY6A 4ICLA 3SI6A 1J9AA 4O5BA 2Q3SA 4Q0BA 3DYAA 1SKWA 4J2AA 3DRPA 4Z4GA 1RBRA 5HBMA 1KVAA 1SL1A 3KLFA 3AA3A 4CJVA 5CYQA 3HT3A 1S6PA 4PQUA 3SQ1A 3OYKA 4CGDA 4CJQA 5KTQA 3OYDA 4CJ5A 3AA4A 3WNEA 3K59A 2ZE2A 3OYLA 3U6FA 3V81A 2ITGA 4M41A 3ZT4A 3CYMA 3V9XA 4DTSA 4DS4A 3OJSA 4HUEA 4FLZA 1WAJA 2EHGA 3LPTA 1UWBA 3U3GA 4FK2A 2G8UA 4E7LA 3LPUA 3S9HA 2AJQA 4DFMA 3RMDA 1XHZA 3DOLA 3NH2A 3OY9A 4DFKA 1XC9A 1RDAA 4DS5A 3ZSXA 1NK6A 1Q9YA 4B9TA 3QNNA 4Z4CA 3CG7A 4M3XA 3KLIA 5KGWA 3QEVA 1DTTA 1TK8A 2G8FA 1ZBHA 1S9EA 3F9KA 3OYMA 1HRHA 1RBUA 4FW1A 1JLCA 3PUFA 1KFDA 3VQEA 3V9ZA 3AO5A 4F3OA 1X9SA 4B9SA 2O4IA 4LH4A 4KHQA 4ELUA 3M8PA 5HRSA 4CFBA 3OYCA 3ZT1A 2JLEA 3MEEA 4CHPA 4DSFA 4I2PA 4M3YA 3P1GA 1RILA 1IKVA 1SKSA 3NHGA 2B4JA 1C1CA 1NJWA 4QOZB 2KZMA 4JS4A 3IS9A 4JLHA 3K5NA 1NK5A 3B6OA 3VQDA 3TABA 5J2NA 4PUOA 3RMCA 4Z4FA 4MFBA 1U45A 4DU3A 3NF8A 4KRFA 1BIUA 3D0PA 4GW6A 3AVMA 4LD0A 1NOZA 3ZSZA 1EETA 1VSJA 5CYMA 2KQ2A 4DTJA 4L8RB 1TKZA 4AHRA 4NYFA 3LDSA 4DLEA 4FM1A 4CEQA 4CHZA 3DMJA 2IGIA 4CHQA 1C1BA 2I5JA 3LP3A 4CIFA 4FW2A 5C24A 5FRNA 3MAQA 4CJLA 2QK9A 4FJ5A 3TI0A 1TK5A 4K8ZA 3MECA 3I8DA 4O0IA 3ULDA 3OYHA 3SZ2A 3T19A 3EZ5A 4ELTA 3QEPA 3AVAA 3TAPA 4LY7A 4ID1A 1KLNA 3IG1A 2LSNA 4OGEA 1UOCA 1RT2A 2HHQA 4BDPA 2P1JA 2XY8A 1WSHA 3LALA 3SPYA 2BGGA 3PO5A 1S1VA 4NCBA 3IRXA 1RTIA 4HCBA 1NK8A 4EZ6A 3SYZA 1RTJA 3HPOA 1I39A 2D0BA 3ITHA 2YKNA 2D0CA 4EP5A 4CGIA 1IG9A 3KKRA 2G8VA 2KZZA 1JL1A 3G10A 1VRTA 3HVRA 4HCCA 4RW6A 3ALYA 3ZT3A 4CHNA 3RMBA 1D8YA 4B9NA 1C1AA 1U04A 4J2EA 4PWDA 3LZIA 1U49A 3ZSYA 2YKMA 3DRSA 2P5GA 1RDBA 5FROA 4KAZA 4M3RA 3UIQA 1EKEA 3T3FA 4CECA 4DSIA 4Q5VA 3HXMA 4DQIA 3SQ4A 3L2QA 4CK2A 3SNNA 4E1NA 1CZ9A 4C8MA 2ZD1A 4QCLA 2DY4A 1WSGA 1RDCA 2DFFA 4DQQA 3WNHA 1QSLA 1HYVA 4DF8A 3LANA 1T8EA 2GV9A 3OS0A 3OYIA 1RT1A 4ID5A 1UA0A 3K5OA 3RMAA 1RBSA 2YNIA 3NAEA 3AVIA 3OYBA 3ZSQA 1JLEA 4FLVA 1KFSA 2O4GA 1S1TA 3JSMA 4CFDA 1Q8IA 3ZSVA 4CJFA 3SUNA 4ZTJA 1VSEA 3L2RA 4K8XA 1JXBA 4CEEA 3P5JA 4YNQA 4FVMA 2OPQA 3MXJA 1KRPA 1BQMA 4BACA 4XIUA 4F2RA 1HQEA 4CF1A 4OVLA 1BL3A 3KKSA 1JLGA 4DU4A 3AVGA 2P51A 3OYGA 2FBYA 1T05A 2DFEA 1WLJA 4FLUA 3NFAA 3SQ2A 4AHTA 4CEBA 5KRSA 2KW4A 3DLRA 4GVMA 4J2BA 4FZZA 1WAFA 4CGFA 3AO2A 4CF8A 3V1RA 5HRNA 3K5LA 1U4BA 3M8RA 4KTZA 4E89A 3DLBA 3T1AA 1TGOA 1NJZA 3TANA 4OLAA 1X9WA 2YV0X 3KD5E 3C6TA 4F4KA 4KKOA 3ASMA 1D9FA 3KTQA 2BDPA 3KD1E 1FKPA 1VRUA 1ZBUA 4FM2A 1JLFA 1RNHA 3QO9A 1FXXA 4MQ3A 4WE1A 1NK9A 1UAXA 1C0TA 1BGXT 4RW7A 4IG3A 4DFJA 3S3NA 1L3SA 3LP0A 3SCXA 1L3UA 5J2QA 3QEIA 1ASVA 1C0UA 1CZBA 3LWMA 1GOAA 2ZQBA 4B08A 4FJ7A 2OZMA 2D5RA 1C6VA 3SV3A 4E7KA 2Z1GA 2Z1HA 4I9LA 4CEZA 3VQPA 2XO7A 3A2FA 2QKBA 2FBTA 3ZT0A 1TK0A 2WONA 2YHBA 1HYZA 3HVTA 2OZSA 1HQUA 4KTQA 1CLQA 4UQGA 1ASUA 3KLHA 3PX4A 4JRPA 1I3AA 4AHUA 4F2SA 4FLTA 1EX4A 4LSLA 4BDYA 3HK2A 4IBNA 4I2QA 3SUPA 4RW9A 2A1RA 1KLMA 4OKJA 3OS1A 4CGGA 4KI6A 1WN7A 4FLXA 1NK4A 5JS2A 3TAQA 4N41A 1BQNA 2HNDA 5KI6A 4DQSA 3HM9A 3I0SA 1YT3A 3QLHA 3ZSOA 5C42A 4DTNA 3PV8A 3AVKA 1WSFA 1XHXA 2VG6A 3VA3A 3RR8A 2WOMA 3VQ4A 4C8NA 3ZSWA 4EP4A 1BCOA 4OPJA 4IFVA 5J2PA 3HPGA 4CE9A 3ZSRA 3RTVA 1TAQA 3DLHA 4KHNA 2HHSA 1HPZA 1VSMA 1RBVA 3NF7A 3NF6A 1W0HA 3CFOA 4FJIA 1DTQA 1RT4A 1YTAA 5T7BA 3KIOA 4CF0A 4CGJA 4B8CA 4LSNA 3V1OA 4CJ3A 3ISNC 4JS5A 3MEDA 1CXUA 4BE1A 2G8WA 4Y1DA 4HVJA 2KFNA 3V9UA 1TL3A 3AA5X 1RT7A 1RBTA 4CERA 2X6SA 5K14A 4M45A 1B92A 3BGRA 1RTDA 4E1MA 2KFZA 1LWFA 5EU7A 3JYTA 3KLEA 2RKIA 4Z0UA 3K2PA 4DSLA 1GOCA 3AVJA 3RWUA 4KHWA 1IKYA 2VG7A 4CHOA 5C25A 1KTQA 1S5JA 4DU1A 1YTUA 4B9UA 5HLFA 3L8BA 5J1EA 3NH0A 1A5WA 4Z4EA 3AVBA 3LWLA 1Q9XA 3QESA 2GBZA 1U48A 5KGXA 2HB5A 2HHUA 3VQQA 3QERA 1GOBA 1TVRA 1C0MA 4FJ9A 2G8KA 4KHUA 2E4LA 2FBVA 1LWEA 4H8KA 4DTOA 3VQ9A 4CIEA 3VQ7A 3OYJA 1IKWA 1TAUA 3WNFA 3QNOA 2B6AA 2ETJA 4CJTA 1LV5A 4CJEA 2B5JA 1HJRA 2XY7A 1BISA 4DTRA 3PY8A 3SJJA 3HYFA 2IS3A 1A5XA 3VA0A 4I7FA 3OYAA 2PYJA 3QIOA 1DLOA 3HSTB 2IAJA 4H4OA 1TL1A 3O3FA 1W9HA 1WSIA 3DM2A 4DSEA 3TAEA 5HROA 4B9LA 4NCGA 4RW8A 2HNYA 2VG5A 3HJFA 3LAMA 1RDDA 3K5MA 3PX0A 4CK1A 4FCYA 1K6YA 4NCAA 4DLGA 1RT5A 1LWCA 1FK9A 4FZXC 2Y1JA 4OPKA 3P83D 4CFAA 3L2WA 3SQ0A 2F8TA 1CXQA 3NCIA 2Z1JA 1JLAA 5CZ1A 3LP2A 4KFBA 4IFYA 4N47A 3O3GA 4OJRA 3LP1A 3KK3A 3VQCA 3AO1A 4FJLA 1WNSA 2Y1IA 1JL2A 4N76A 1ZBIA 4B3OA 3M8QA 2HVIA 1NKBA 4W5OA 1S6QA 1L5UA 2G8HA 2F8SA 4PY5A 2HVHA 3C6UA 3AVLA 3NDKA 3NE6A 2HMIA 4OLBA 3TWHA 1QE1A 2R7YA 4G1QA 4KHSA 1JXEA 1ITGA 1SV5A 1F21A 4B9MA 4C8KA 1Y97A 4OKKA 1HMVA 2F96A 4KREA 4TSXA 3HP9A 1QHTA 4O55A 1RTHA 1Z26A 2PY5A 4DSJA 1FKOA 3OYNA 1J54A 2BE2A 3MXIA 3V4IA 1G15A 3TARA 3SV4A 4EZ9A 1TKTA 3SPZA 1NOYA 4DWIA 4M3UA 5SZTA 1BI4B 4BE2A 1X1PA 3NGYA 4GMJB 4RW4A 4CK3A 4FK0A 2EX3A 1VSFA 4Y1CA 3DLEA 2W42A 3NGIA 3IAYA 4NYNA 4JRQA 3V9WA 3CM6A 3SUOA 3L3VA 4O4GA 2A1SA 4CJRA 4KPYA 2HHVA 3AVNA 4BWJA 2BANA 4KB1A 4FLWA 4R5PA 4YFUA 1S1XA 3DLGA 2XHBA 3OYEA 3DOKA 4FYDA 5CY4A 1WSEA 1JLQA 1VSIA 2XRIA 2NUBA 5DMRA 5I42A 1LAWA 4DQRA 1NK0A 3DLKA 4RG8A 4FXDA 4B9VA 1IH7A 4CEAA 4AILC 4CJ4A 4Z4HA 4FJ8A 5FDLA 4E3SA 3QIPA 3K57A 2FC0A 3V9SA 3OYFA 2QKKA 1T7PA 2PYLA 2X78A 4H4MA 2XY5A 3S3OA 4CEOA 1SL2A 3AV9A 3OJUA 1QS4A 2KTQA 2OA8A 3QEWA 5D3GA 3NH1A 2IC3A 1J5OA 4CJKA 2Z1IA 1SL0A 2X74A 4DMNA 2RPIA 1IO2A 3DI6A 4HUFA 4CEFA 4AHCA 1QTMA 3H08A 3VQ5A 5KRTA 3U3YA 3AO3A 3PX6A 1LW0A 4DTXA 1L3VA 4KI4A 2E6MA 4W5TA 4QAGA 3EY1A 2DTUA 1EP4A 1VSKA 2OPSA 1TKDA 3FFIA 4E7IA 1QQCA 3MEGA 4DSKA 1REVA 1UA1A 1N6QA 1J53A 1HNIA 3I0RA 3O4QA 1NJYA 3TAMA 5HRPA 1KSPA 4M3ZA 3NF9A 1L3TA 4DTMA 3THVA 2HNZA 5FRMA 5I3UA 1BI4A 2GUIA 4FJJA 1D5AA 1QSSA 1VSHA 4KV8A 1RT6A 3SUQA 3AVHA 4CHYA 4DQPA 3AA2A 4F8RA 4CFCA 4AHVA 4C8OA 5HRRA 4FJKA 4CJPA 4FJXA 4CJUA
chains in the Genus database with same CATH superfamily
4DF4A 1EO1A 1KVBA 2CGLA 5I9EB 4BGBA 1EXQA 2RF2A 1WSJA 2O8FA 3AVFA 3ENBA 4A5AA 4X64K 4W5NA 4FK4A 1N32K 4B1UB 1T44A 3RRHA 1O1WA 2HW3A 1TV6A 4BE0A 2HHTA 3VN5A 2E1ZA 3BDPA 4FOEA 4XEIA 1NKEA 1KD1O 4UY8O 3VQAA 3L2UA 5AQKA 4IG0A 5CE3A 5HP1A 1A5VA 2HMPA 4OKEA 1NK7A 1ZBFA 4E19A 1Z05A 3KLGA 3WXKA 4E7HA 4XH5A 4FZYA 1S1WA 3CJ7A 1YVUA 3L3UA 2RN2A 2HF4A 2PZSA 3QEXA 3ZETB 3F73A 1U47A 3CM5A 2Q0RA 1T03A 1NJIO 3EYZA 3ENHA 1BOTO 4DTUA 4CESA 2ATQA 5M1NA 5AQSA 3QINA 4JKFA 1S1UA 4CJWA 4FWRA 4DR5K 4BRIA 3A0IX 4ELVA 1JKHA 4ISGA 3RVCA 4E0DA 1JLBA 3C95A 3CF5L 3T7ZA 3VEXA 5AQLA 4CEDA 1Y64A 4BRKA 1IKXA 1RT3A 1QSYA 1U2VA 5FPNA 4FJGA 4ZTFA 3D2EA 4FL9A 2E6LA 4KH6A 3JS6A 1CZAN 3PIPL 3MX2A 1DEJA 1MDUB 3HBTA 1KVAA 3KLFA 1KAYA 2KHOA 2YCHA 4KH4A 3HT3A 3WNEA 2QXLA 3OYLA 1Q81O 2VGMA 5ADXA 3V9XA 4DS4A 4HUEA 4FOIA 2EHGA 3U3GA 3CCQN 2G8UA 3S9HA 5LJVA 3RMDA 5JLFA 1XC9A 1XNRK 5AQTA 1Q9YA 4YDUA 3KLIA 5KGWA 3QEVA 4OPAA 1S9EA 3MDQA 1JLCA 1OH6A 4LH4A 3M8PA 5HRSA 4BRDA 5LJWA 3CPWM 3ZT1A 3E66A 3E1YA 1J5EK 5TKWA 4NLBA 1IKVA 4JKCA 3NHGA 1NJWA 1BO5O 4JS4A 3IS9A 4JLHA 3WUHA 2A3ZA 1NK5A 3B8AX 1N36K 4MFBA 3NF8A 4RCHA 5JICA 4GW6A 3AVMA 4LD0A 1NOZA 1EETA 4M7XA 4WQ5C 1VSJA 5CYMA 4IOAL 2IGIA 3T1HK 4BR9A 5LY3A 2JWLA 4CJLA 3H45C 3SZ2A 1NGIA 3EZ5A 4JI0K 4LY7A 5ELZA 5GINA 3SAFA 5BN9A 4JKAA 3LALA 4YOVA 3G6EN 1S1VA 3IRXA 4MO4A 3C7NA 2OANA 3I56N 3ITHA 3ZEUA 1SQKA 1IG9A 3G10A 3BP8A 4MO5A 4HCCA 3ALYA 4B9NA 4MLHA 1U49A 1TUUA 4A59A 3DRSA 5FROA 3D2FA 3L4IA 4DQIA 3SQ4A 4CK2A 4YOUA 2ZD1A 4QCLA 1RDCA 2DFFA 2GV9A 3OS0A 1RT1A 1UA0A 3EZWA 2A42A 3AVIA 3ULEA 1LCUA 1KXPA 1Q8IA 3K0SA 4QS9A 4CJFA 3SUNA 4K8XA 1EWQA 1RFQA 4CEEA 1WUAA 3P5JA 2OPQA 3MXJA 1KRPA 4JV5K 1YXQA 4B1VA 1GLBG 3KKSA 1U6ZA 4CZIA 1G99A 1T05A 3SQ2A 4AHTA 4GVMA 3AO2A 1U4BA 3M8RA 4KTZA 4FWSA 4E89A 2FSNA 2BH1A 3KD5E 3C6TA 4BC4A 2PAVA 1FKPA 2P9KB 1NK9A 1UAXA 1C0TA 1BGXT 4DFJA 2W41A 2QA4N 1OVYA 2ASOA 3SCXA 4NLCA 3WXMB 5J2QA 3QEIA 1NWKA 1C0UA 3OA9A 2OZMA 3SK3A 2F7TA 3E9PA 4I9LA 1NGBA 4IJAA 2QKBA 1HKCA 1TK0A 2WONA 3ENOA 1HYZA 2OZSA 3CCMN 3CD6N 1KAXA 1VHXA 3J80O 3R3LA 3PX4A 2J4RA 1YJ9N 1EX4A 5DM7L 3THXB 2UUAK 4I2QA 4FWPA 3G4SN 2QWMA 3WEEA 2HNDA 5KI6A 1YITN 1QQNA 3QLHA 3PV8A 1BA0A 3VA3A 3RR8A 4J2DA 2VG6A 3ZSWA 5J2PA 1VQ5N 1BWFO 2P9UA 2DPNA 3ZSRA 3RTVA 4KHNA 1VSMA 1RBVA 1XQSC 4BVOA 3KIOA 2YHXA 4KBOA 1DGKN 1BU6O 1CXUA 2YJEA 4Y1DA 4HVJA 5BN8A 3UB5A 5C0YA 5HL7L 5IWAK 4M45A 4WFNL 2KFZA 2RKIA 4DSLA 3LDPA 3KZBA 2P9IA 3RWUA 4CHOA 4DR4K 1YTUA 4HWIA 4B9UA 3L8BA 3VERA 5LMUK 3QESA 1U48A 3QDKA 2HHUA 3DXMB 2ZWHA 2IVOA 1TVRA 1C0MA 4FJ9A 1J6ZA 2I7NA 5KPZA 2FBVA 1TAUA 1W97L 3A8YA 4FO0A 1LV5A 2XY7A 4DTRA 3PY8A 5AZIA 2ZJRL 3HYFA 3P31A 5EX5A 3VESA 2PYJA 1DLOA 2Q97A 1TL1A 3DM2A 4RW8A 5AQXA 1RDUA 1RDDA 4BG9A 3K5MA 1RT5A 2GWKA 1LWCA 4FZXC 2HOEA 2OCEA 3P83D 3L2WA 2ZJPL 1CXQA 2Q31A 3O3GA 4KFBA 4IFYA 4FJLA 3ZYYX 1ZBIA 4B3OA 3IMXA 1L5UA 3AVLA 3NDKA 4A2BA 2HMIA 2OTLN 2R7YA 4G1QA 4FPAA 1NMNA 2VCPA 1N34K 2P9NA 1Z26A 3MXIA 3V4IA 3VEWA 3TARA 3SV4A 4DWIA 3VF6A 3SPZA 3JXUA 3LDLA 4JI7K 4M3UA 3W0LA 4BE2A 4GMJB 3UKUB 3IAYA 4IEEA 2W42A 2QWNA 1YF5L 3CM6A 2A1SA 4KB1A 4YFUA 4ISFA 2NUBA 5DMRA 1YJWN 4AILC 4Z4HA 3THWA 4B1YB 2RHKA 4H5VA 2H3GX 4GV9A 4ELTA 4H4MA 3S3OA 1ZXOA 1ESVA 4CEOA 3AV9A 1SL2A 2NRWA 2A6AA 3MN7A 1VQPN 4K42A 3NH1A 1J5OA 5D3GA 4CJKA 2Z1IA 2X74A 3L6QA 2QWQA 1RDWX 3J7YP 1QHAA 3PSIA 2O8EA 3VQ5A 5KRTA 3U3YA 3AO3A 1L3VA 1OH8A 4W5TA 3CJBA 3A5NC 4CZKA 3HOSA 1J53A 3I0RA 1NJYA 1Q86O 3TAMA 1HX1A 3K9KA 4M3ZA 3NF9A 1L3TA 3NVMA 3DWLA 1BI4A 1D5AA 1FW6A 2WFBA 4DQPA 4CFCA 4C8OA 5HRRA 4JK8A 4CJPA 4U67L 3VQ8A 2P9SB 1Z25A 4BG8A 1VQ4N 2NRXA 3QFPA 3T69A 3FLCO 1D9DA 4KB0A 4IOCL 2VWJA 1U2VB 4IDHA 4PHTX 2HHXA 4B8AB 2YNHA 3CFPA 3FZMA 2IOCA 4ZHRA 3IFRA 1ZYQA 2KLAA 3DRRA 3D2EB 1LOTB 5H1SQ 2UYTA 2X6NA 3TR8A 5JS1A 3CQ8A 5F2RA 4Y0WA 5AQUA 3RRGA 3LAKA 4YOTA 2CGKA 3NGZA 4R79A 2F9WA 3RR7A 4BR7A 5AQRA 3WNGA 4BR0A 1TKXA 3HP6A 1SKRA 3C0BA 3ZLJA 2G8IA 4AM7A 3ZCMA 3U8XA 4LH5A 5AQOA 1R0AA 3ZT2A 4C1NI 2QXFA 4I9QA 4JI6K 3KK1A 1LAVA 3CERA 4KO0A 3O4NA 3MN6A 4CF2A 2OYQA 3LDNA 2VGNA 4O44A 4AM6A 4HTUA 4B1XB 3HI0A 5J2MA 4IZ9A 4CJ7A 4CZLA 4O8KA 1SUQA 3HL8A 1XWLA 3VQBA 4WFAL 2ASMA 4L3QA 1GLAG 3H3NO 4LF6K 5SWMA 3VQ6A 5EXWA 4FJMA 3NBPA 3HO1A 5LL6Z 3PIOL 4ICLA 3TSQA 4LFAK 2PFUA 4M7YA 3DYAA 3O80A 4J2AA 4Z4GA 1SL1A 2FLOA 1HR0K 4PQUA 3SQ1A 3DXKA 4CJQA 3OYKA 4CJ5A 1T3VA 2ZE2A 3U6FA 3V81A 4M41A 3ZT4A 4CBUA 3OJSA 3O6WA 4FLZA 5AQIA 1HJOA 3LPTA 3EE9A 5M1PA 3OY9A 4DFKA 1Q7YO 1GLDG 4XH4A 4B9TA 1N33K 4K0KK 3C7NB 2QWRA 3FE1A 3ID8A 1TK8A 2G8FA 3OYMA 2UXDK 3ZEUB 4H0PA 3PUFA 4B9SA 4H03B 2CH6A 4ELUA 4CFBA 2GUPA 1VQLN 2JLEA 3OTOK 4PL7A 1K8AO 4B3MK 4M3YA 3D2FB 4GKKK 2B4JA 1C1CA 3FZHA 1NMDA 3K5NA 4PUOA 3RMCA 4Z4FA 4RWTA 4DU3A 5AQGA 2KQ2A 2QWLA 4WQ5A 3ULEB 4B3SK 4DLEA 5KQDA 3BY5A 3VEZA 4CHQA 3U9DA 3AAQA 5FRNA 3TI0A 3ULDA 4O0IA 3OYHA 3T19A 3QEPA 3TAPA 4DV7K 2NRTA 2NLXA 3FR0A 1RT2A 2HHQA 1WSHA 4CZHA 2A41A 1NK8A 3QBXA 3MWTA 2D0BA 2YKNA 3H6EA 2D0CA 3SJHA 4LC9B 3R9PA 3I33A 3ZT3A 5KPRA 1RDBA 4KAZA 4DV2K 4M3RA 3PSFA 4CECA 4DSIA 4Q5VA 1WBBA 4JD2A 2E2OA 5A2QO 3CMAN 4E1NA 2YX6A 1WSGA 5AJ3K 1QSLA 4B9QA 3LANA 2FF3B 4IO8A 4DHYA 1RBSA 3OYBA 1KFSA 1S1TA 4CZMA 3JSMA 3ZSVA 4PKGA 2P9LB 3O5BA 4YNQA 2GWJA 3KWGA 4CBWA 4BR2A 4BACA 1HQEA 4CF1A 1JLGA 3D6RA 3MN5A 3IKMA 1JCEA 3DLRA 1HLUA 1WAFA 3V1RA 5HRNA 1TGOA 4BRMA 3TANA 5C12A 2YV0X 1X9WA 3LDOA 3KTQA 5AQWA 2V7YA 4WE1A 4IG3A 3BUZB 4BRLA 3AAPA 1NGFA 2P9IB 2D5RA 4C23A 3SV3A 3ID6A 4E7KA 2Z1HA 2GTDA 3F9MA 4OX9K 3VQPA 1Q18A 3A2FA 2FBTA 3QBWA 4DR1K 4CI6A 1NGGA 2YHBA 3HVTA 1CLQA 4CZFA 4UQGA 4NXNK 2UUCK 2NRZA 4LF4K 1I3AA 5AZIB 4AHUA 3TTFA 4IBNA 2A1RA 4FLXA 5JS2A 5B8HA 4N41A 3ZX3A 3HM9A 1WSFA 2WOMA 4EP4A 4C8NA 2KKZA 4OPJA 4IFVA 4JKBA 3WXJA 3HPGA 4CE9A 2QEXN 3CC2N 4GKJK 4OPHA 1HPZA 3NF7A 1W0HA 3BEXA 1RT4A 5T7BA 4JEPA 3ZX0A 1XC3A 3ISNC 4JNEA 4JS5A 2G8WA 3AGRA 3V9UA 3L0QA 1RT7A 4A61A 2P9NB 4WQ4C 4CERA 5K14A 1ILYA 4E1MA 3JYTA 4GY2B 4YOXA 3K2PA 1ATNA 2VG7A 4LF8K 1S5JA 3VGKA 5HLFA 1NGEA 1QVGM 3LWLA 1Q9XA 2HB5A 3U4LA 3VQQA 1GOBA 4DR7K 3GOIA 4AF1A 1N8RO 4CW7B 4F9OA 5AQFA 1HJRA 3SJJA 2YJFA 2HBJA 3VA0A 5AQYA 2HHHK 3HSTB 5HROA 4B9LA 4DSEA 3TAEA 1WSIA 5C2DA 4BQZA 4NCGA 3HJFA 5BPMA 1GLJO 5FLXO 3THWB 3SAHA 5AQMA 4JKGA 2F9TA 4GV3A 2O8CA 4CFAA 2Z1JA 3MWPA 1JLAA 5CZ1A 4N47A 5JVGL 4LF5K 4OJRA 3LP1A 3KK3A 4H5TA 2ZJQL 1JL2A 3H1VX 1NKBA 2G8HA 2F8SA 4MLEA 2HVHA 3C6UA 4JK9A 4OLBA 3TWHA 4KHSA 1JXEA 4YHHK 1K8KA 4C8KA 1O13A 1Y97A 4EIAA 1HMVA 3GE1A 4KREA 4DR3K 4X65K 4ILJA 1FKOA 1NM1A 4EZ9A 1TKTA 3O9TA 1NOYA 3R1XA 5SZTA 3QB0A 1BI4B 2NNWA 4RW4A 4CK3A 4GVEA 4Y1CA 1IJJA 3NGIA 4KHPK 5M1OA 3V9WA 4CJRA 4O4GA 4KPYA 2BANA 5DM6L 4FLWA 4R5PA 3DLGA 3OYEA 3G71N 3DOKA 5C2FA 1VSIA 3CCLN 2XRIA 2BTFA 5I42A 4DQRA 1NK0A 3TU5A 1IH7A 4CEAA 3EE8A 2YI1A 4FJ8A 1NG9A 5FDLA 2QKKA 4LF9K 3I8BA 1GLFO 1T7PA 2UXCK 2OA8A 4DMNA 4YDUC 4DQ8A 3FFKB 4BRCA 2V51B 4CEFA 5JVHL 3H08A 4ISEA 1LW0A 4QAGA 1EP4A 2OPSA 2O8BA 1HNIA 3O4QA 1E4FT 1KSPA 3AARA 4DTMA 2GUIA 4B3RK 3SUQA 4CHYA 4F8RA 3HM8A 4AHVA 4FWOA 4CJUA 4OO1J 1VSDA 3B6PA 4DUZK 2GEMA 3M8SA 4C8LA 4BRNA 2OPRA 1RCHA 4DV6K 4CD3A 3C94A 4JI3K 4K41A 3CIPA 2JGUA 1B9DA 4WYBA 4HUGA 5KQ8A 3KWIA 4PA1A 3L4QA 2YNFA 3V6DA 1NGJA 2OPPA 4DTPA 5BR8K 3PO4A 4CCHA 2D0AA 4ILGB 5BPNA 3MN9A 3V1QA 2YNGA 4CGHA 3L2VA 4HHTA 3OS2A 1NGDA 1NJXA 2WUSA 3DAWA 2FBXA 2CH5A 4CIGA 4NXMK 4OGCA 4PKHA 4KTWA 4KHYA 4B1WB 3UKRA 3O9RA 4CJSA 3O08A 4LF7K 2DFHA 2P9PB 2ZF5O 4I6MA 4O0JA 4M42A 2IDOA 3C65A 3LZJA 3E01A 3VF4A 3OVNA 3MX5A 1XI1A 4BRFA 3GG4A 1KVCA 3AGKA 4AHSA 3R8EA 1V4SA 4LFCK 3VOVA 4IOXA 3JAMO 2NRHA 1ASWA 1IBKK 4E7JA 5DK5A 3VMFB 3MXMA 4B3TK 2XY6A 3SI6A 3VEOA 3EKSA 2O8FB 1RBRA 5AR0A 3MMVA 1S6PA 4CGDA 5KTQA 4E1JA 1R59O 3AA4A 3K59A 2O8DA 2FSJA 2E8AA 3CC7N 1HNWK 2ITGA 1SAZA 2NRRA 3KHYA 1NNEA 5BR9A 2QI2A 4GNIA 3HTVA 4FK2A 4E7LA 4JI2K 3O9QA 4DFMA 1XHZA 3DOLA 3NH2A 4QS8A 1RDAA 4BR4A 4Z4CA 4M3XA 1GLCG 1DTTA 1HRHA 1RBUA 4FW1A 3V9ZA 3AO5A 1M1KO 4F3OA 3G25A 5IT9O 4KHQA 2IVPA 3BF3A 3O1BA 1KQSM 3Q7BA 4CHPA 4I2PA 5AFUA 5GIOA 1RILA 4IWVA 2ZGYA 2FF6A 4JD2B 2KZMA 3VEYA 4JKEA 3HOTA 3B6OA 3TABA 3SMPA 1U45A 1NBWA 4G9ZA 1BIUA 1X9JA 1T6DA 1OVQA 3O8MA 2E2PA 4DTJA 4L8RB 4YY3K 3LDSA 4FM1A 4CHZA 3VEVA 2I5JA 5EY4A 4FW2A 1IG8A 3MAQA 4FJ5A 4V19S 5FPEA 1TYQA 3AVAA 1Z6RA 4ID1A 1C0FA 4OGEA 1UOCA 1SZ2A 3LM9A 4BDPA 2XY8A 1YIJN 2BGGA 1VQ9N 4NCBA 1RTIA 4HCBA 3SYZA 1RTJA 3HPOA 5JMVA 5M1KA 2VQEK 4EP5A 3F2KA 3KKRA 2G8VA 2E1YA 1JL1A 4FWKA 4O8UA 3HVRA 1V4TA 2KZZA 3RMBA 1U04A 3W3DA 1OH7A 5E26A 5GAHP 3LZIA 2YKMA 1NGCA 2P5GA 4DV4K 3THXA 3UIQA 1EKEA 3T3FA 3KK7A 3VENA 3HXMA 5BPLA 3L2QA 2QW9A 4C8MA 2E88A 2DY4A 4CVNE 4DF8A 4MDAA 3CMEN 3OYIA 4ID5A 3RMAA 2YNIA 3NAEA 1JLEA 3CCUN 4FLVA 2D0OA 3GDQA 3VPZA 4ZTJA 1VSEA 1JCGA 4JHDA 1JXBA 4FVMA 1JCFA 1BQMA 4F2RA 1BL3A 3R6MA 4DU4A 4CBXA 2FBYA 2DFEA 3SBTA 3NFAA 1T6CA 4FWQA 4CEBA 2F4VK 1D4XA 4FZZA 1QZ5A 3ATVA 1M90O 4F4KA 1MA9B 4KKOA 3CCSN 3KD1E 3CQYA 1VRUA 1ZBUA 1JLFA 1RNHA 1MWKA 4FWNA 4RW7A 3S3NA 5M1FA 1L3SA 2CGJA 3LP0A 5F0XA 1XNQK 3PLAA 4BGAA 2ZM6K 1MWMA 1ASVA 1CZBA 3FZLA 3LWMA 4FJ7A 2Q1NA 1K9MO 1C6VA 5CHIA 1YI2N 2Z1GA 4CEZA 3CCEN 2XO7A 1VQMN 4IO9L 3BZKA 3QFUA 3KLHA 4A2AA 4JRPA 1RGIA 4EAHD 4LSLA 3MCAB 3HK2A 1X3MA 3SUPA 1KLMA 4OKJA 3OS1A 4CD1A 4CGGA 4KI6A 1WN7A 3TAQA 3E9LA 3I0SA 4JKGB 3ZSOA 1YHQN 2BUPA 3WXIA 3AVKA 1HKBA 3VQ4A 1BCOA 2O8CB 2HHSA 4X62K 1TAQA 1GLLO 3DLHA 3CCVN 4FJIA 1YTAA 4CF0A 4B8CA 4LSNA 4BE1A 5AQNA 3TPQA 3MK6A 2KFNA 1K8KB 1TL3A 3AA5X 3THYA 1RBTA 3LDQA 5AQQA 4DV5K 2X6SA 4WQ4A 4EHUA 1RTDA 4H5RA 5EU7A 2V52B 4Z0UA 1GOCA 4KHWA 4BREA 5C25A 1KTQA 2ZGZA 3NH0A 4Z4EA 3AVBA 3QERA 3CXCM 4IEIA 3MCPA 4XH1A 3WT0A 2G8KA 5EVZA 4KHUA 2E4LA 4DTOA 3VQ9A 3VQ7A 3WNFA 3QNOA 2B6AA 4CJEA 5HOOA 3CJCA 1BISA 3J7AP 1A5XA 5AQZA 4I7FA 1QVFM 2IAJA 4H4OA 3SMSA 4EFHA 1W9HA 1NGHA 3LM2A 2VG5A 2IVNA 3PX0A 4CK1A 4FCYA 2D0PA 1I94K 1K6YA 4NCAA 2AP1A 3SQ0A 1QQOA 5GAEP 3NCIA 4H0OA 3WXLA 4FWLA 3VQCA 3WEEB 4YOWA 1WNSA 4N76A 4EHTA 1QE1A 2IIRA 3ZX2A 1SV5A 1F21A 4B9MA 4GV6A 4OKKA 2F96A 2P9UB 2E2QA 3HP9A 2PY5A 2O8BB 4DSJA 3FZKA 2P9SA 1J54A 2BE2A 3WQTA 2E5LK 1X1PA 3S41A 2Q2RA 2EX3A 4NYNA 3L3VA 2HHVA 1ZBSA 3AVNA 4BWJA 5BRHA 5GAGP 3RSEA 2UU9K 2A40A 5CY4A 4H0YB 1JLQA 2Q36A 3CETA 4DV0K 2V7ZA 1YJNN 1VQ7N 4B9VA 2WTUA 1HUXA 4NB4A 4E3SA 3K57A 3OYFA 4PL8A 5ADXH 3D7EO 4FVUA 1QS4A 3QEWA 2IC3A 5AZJA 2YHYA 1SL0A 2RPIA 1IO2A 3DI6A 4AHCA 1QTMA 4BRPA 1HNXK 4H5WA 3UE5A 4DCHA 1EQYA 1W7AA 4KI4A 1FJGK 4KH5A 3EY1A 1VSKA 2DTUA 3FFIA 4E7IA 1QQCA 3MEGA 4DSKA 1REVA 3CQXA 3Q7CA 5HRPA 1QZ6A 3UKRB 1HPMA 3THVA 2HSTA 5I3UA 3CC4N 2NZTA 1VQ8N 4FJJA 4QS7A 4I6MB 3AVHA 3A5LC 4U7BA 1QQMA 1BCMA 1VAZA 3CJAA 1NKCA 3AVCA 4BC3A 3E9OA 3FZFA 3S3MA 1X9MA 1W2BM 4BDZA 3G0ZA 4C1NK 2P5OA 4BWMA 1BIZA 1N5YA 3TAGA 4JI8K 3TSUA 1KCFA 4AH9A 4DFPA 2GELA 2D1KA 4BRGA 4CF9A 4FJHA 3TAFA 1X3NA 2VYPA 3CPEA 3O9SA 4Z4IA 1VQNN 3QETA 1S9GA 1DKGD 2O8DB 2FSKA 4DR6K 1BDGA 4DG1A 3OBWA 1HYSA 3O1WA 3C6AA 1ZC6A 3K58A 5E41A 3AO4A 4FJNA 4M3TA 1B9FA 1HNVA 1VSLA 3NMUA 1BHLA 3D45A 5CZ2A 3AY9A 1LW2A 1BA1A 1H1VA 4W5RA 2D4WA 2VWKA 4M3WA 3O4WA 1ATSA 3CFRA 4FM0A 1S22A 4YORA 1ZBLA 2O8EB 4N56A 3KK2A 4F3TA 3KJVA 4N5SA 5FPDA 1YUWA 2PBDA 4IDKA 4IKFA 1JJ2M 5GADP 1IV0A 1OH5A 5GIPA 2UXBK 2QTDA 4FLYA 3QMLA 1VK0A 2YHAA 3CJ9A 3TTDA 4CZGA 4IJNA 3HPHA 1MU2A 3O3HA 2HHWA 4W5QA 1J9AA 2ITMA 4O5BA 2Q3SA 4Q0BA 1SKWA 2E2NA 3DRPA 2Q0UA 5HBMA 3FGUA 2W40A 3AA3A 4CJVA 5CYQA 1WB9A 3A5OC 4AQYK 3C6HA 3OYDA 1TYQB 3M3ZA 3CYMA 4O5FA 4DTSA 1WAJA 4H5NA 3WQUA 1UWBA 1NU0A 1YAGA 1YVNA 3LPUA 3VGMA 2AJQA 3ZETA 4JI5K 2A5XA 4A5BA 4DS5A 3ZSXA 5TKYA 2W6KA 1NK6A 3OW2M 3QNNA 3CG7A 1E4GT 1ZBHA 4JYAK 3F9KA 4IFEA 4BVPA 3VQEA 1KFDA 2O4IA 1X9SA 2WC9A 2HBKA 3OYCA 5LMNK 3MEEA 3VETA 4DSFA 2FXUA 3P1GA 1S72N 1SKSA 4J8FA 4QOZB 3ATUA 2RE2A 2P9LA 3VQDA 3P39A 5J2NA 4ILHA 4DB3A 4DV3K 4KRFA 3D0PA 4BQLA 1VQKN 3O9UA 2GX9A 3ZSZA 3GBTA 3VGLA 1TKZA 2QWPA 4AHRA 4NYFA 4CEQA 3DJCA 3DMJA 1C1BA 2QM1A 3LP3A 4CIFA 4DV1K 1BUPA 4JHDB 5C24A 3TSPA 2QK9A 3NVKA 1TK5A 4K8ZA 1VQON 3MECA 3I8DA 1S3XA 3H1QA 1KLNA 3IG1A 2LSNA 4BC5A 1NGAA 2P1JA 3SPYA 3PO5A 3GL1A 2I7PA 5F1XA 3DXKB 4EZ6A 4PKIA 4RTFD 4JN4A 3EKUA 4A62A 1C0GA 1I39A 5CR4A 1XUPO 4CGIA 1XMQK 4LFBK 3CHWA 1VRTA 4FWMA 2QWOA 3OBYA 4RW6A 4CHNA 1D8YA 3HZ6A 4J2EA 1C1AA 4PWDA 3IUCA 3H3OB 4H0VB 3ZSYA 3F5TA 1VQ6N 1Q82O 3U9ZA 5MLCQ 3SNNA 3N4QA 1CZ9A 4WCEL 4M63C 3H46O 3WNHA 4DQQA 1HYVA 3CI5A 1T8EA 3QICA 4JI4K 3K5OA 2ASPA 2WBNA 3ZSQA 5AQJA 2O4GA 1KAZA 4CFDA 5BRDA 1HNZK 4BC2A 3L2RA 4BROA 4XIUA 4OVLA 3K9JA 3AVGA 2P51A 3OYGA 1WLJA 4FLUA 1NLVA 5AQVA 4J2BA 5KRSA 2KW4A 3VF2A 4CGFA 3BZCA 4CF8A 3K5LA 1KC8O 3DLBA 3T1AA 1NJZA 4OLAA 2HBMA 3ASMA 4BRAA 1D9FA 2BDPA 5FPMA 3VTHA 3CCJN 4FM2A 2HBLA 3QO9A 3THYB 1FXXA 1K73O 4MQ3A 3SAGA 4DUYK 2EWSA 3CJ1A 5E84A 3J7ZO 1L3UA 1OKJA 5C15A 1WBDA 1GOAA 2ZQBA 4H0XB 4B08A 4MDBA 5BRFA 2YHWA 3SBGA 3HRGA 3ZT0A 4KTQA 1IBMK 1HQUA 4YOYA 2E20A 1ASUA 4F2SA 4FLTA 3J8AA 4BDYA 1GLEG 4RW9A 1XMOK 3N4PA 1NK4A 2HF3A 1BQNA 1SS6A 4DTNA 4NO7A 4DQSA 1YT3A 4JAXA 5C42A 5AQPA 1XHXA 4K43A 3EEQA 3NF6A 3CFOA 3P4IA 5AQHA 4CZEA 1DTQA 3HSCA 4CGJA 3V1OA 4CJ3A 1HKGA 5AFUH 3MEDA 3A5MC 2P9KA 4H0TB 4JK7A 3OHRA 4A57A 1B92A 3BGRA 3M1FA 1LWFA 3KLEA 3AVJA 1IKYA 4DU1A 2VQFK 5J1EA 1A5WA 5KPTA 2GBZA 5KGXA 3LL3A 3M6GA 2VWBA 1LWEA 4H8KA 4CIEA 3OYJA 1IKWA 3IDHA 2ETJA 4CJTA 2B5JA 4X66K 1ATRA 5C10A 4BY9C 3RSEB 3VTIA 1DT9A 4Z94A 2IS3A 3OYAA 1BG3A 3QIOA 3O3FA 2NRVA 2W6LA 1P8ZA 2HNYA 3KVGA 3LAMA 3TTCA 4K25A 4DLGA 1FK9A 3EN9A 2Y1JA 3I55N 4OPKA 2F8TA 5AZJB 3LP2A 3AO1A 2Y1IA 2HVIA 5JLHA 3M8QA 4W5OA 1S6QA 4CZJA 4PY5A 3NE6A 4BRQA 1ITGA 4TSXA 1QHTA 4O55A 4BRHA 1RTHA 3OYNA 1G15A 3T1YK 3NGYA 4WF9L 4FK0A 3DXMA 4JKDA 1VSFA 3DLEA 4JRQA 2AA4A 3SUOA 4FPBA 1S1XA 2XHBA 4FYDA 4JKHA 3CCRN 1WSEA 1LAWA 1TUYA 4IXCA 4JI1K 3DLKA 4RG8A 3P38A 3EL2A 4FXDA 5BREA 4CJ4A 4DR2K 3QIPA 2FC0A 3V9SA 2PYLA 2X78A 2XY5A 2KTQA 3BF1A 3OJUA 4WFBL 2UUBK 4DKWA 4HUFA 2OTJN 4B1ZA 5M1QA 3PX6A 2P9PA 4DTXA 2E6MA 3J81O 1TKDA 3SLCA 1N6QA 1UA1A 1E3MA 4BR5A 3EO3A 1P90A 2JWKA 2HNZA 5FRMA 3M5RA 4HTLA 1QSSA 1WOQA 1VSHA 4KV8A 1RT6A 3UKUA 1IBLK 1EWRA 3DLLL 3AA2A 4FSVA 4FJKA 4FJXA 5EOYA
chains in the Genus database with same CATH topology
4DF4A 1BCMA 3VQ8A 1KVBA 1VSDA 3B6PA 1EXQA 1Z25A 2RF2A 1NKCA 1WSJA 3M8SA 1D9DA 4KB0A 4C8LA 3AVCA 3AVFA 2VWJA 2OPRA 1RCHA 3S3MA 1X9MA 2HHXA 4B8AB 2YNHA 3CFPA 4BDZA 2IOCA 3C94A 4ZHRA 3G0ZA 4FK4A 2P5OA 4BWMA 4W5NA 3RRHA 1O1WA 1BIZA 2JGUA 3TAGA 1B9DA 3DRRA 1ZYQA 1TV6A 1KCFA 1N5YA 2HW3A 4AH9A 4BE0A 3VN5A 2X6NA 4HUGA 4DFPA 3BDPA 2HHTA 4CF9A 3TR8A 1NKEA 4FJHA 3TAFA 5JS1A 3VQAA 3L2UA 3CQ8A 4IG0A 4PA1A 3RRGA 2YNFA 5HP1A 3V6DA 4Z4IA 3LAKA 1A5VA 2OPPA 4DTPA 3NGZA 3PO4A 4CCHA 2D0AA 3QETA 1S9GA 4OKEA 1NK7A 3RR7A 1ZBFA 4E19A 3WNGA 1TKXA 3KLGA 3HP6A 1SKRA 3V1QA 2YNGA 4E7HA 4DG1A 4CGHA 3L2VA 4FZYA 2G8IA 4HHTA 1HYSA 1S1WA 3OS2A 1YVUA 1NJXA 3ZCMA 3L3UA 3K58A 5E41A 3AO4A 4LH5A 4FJNA 2RN2A 1R0AA 2PZSA 4M3TA 1B9FA 2FBXA 3QEXA 1HNVA 3ZT2A 4CIGA 3F73A 1U47A 3CM5A 1VSLA 2QXFA 4I9QA 4OGCA 1BHLA 3KK1A 1LAVA 3D45A 4KO0A 5CZ2A 3EYZA 1T03A 4DTUA 3O4NA 4KTWA 4CESA 1LW2A 2ATQA 4KHYA 4CF2A 4W5RA 2VWKA 4M3WA 2OYQA 3QINA 4CJSA 3CFRA 4FM0A 4O44A 1S1UA 4CJWA 1ZBLA 4N56A 3KK2A 4HTUA 4F3TA 2DFHA 5J2MA 3KJVA 4N5SA 4O0JA 1JKHA 4ELVA 4M42A 4E0DA 1JLBA 3C95A 2IDOA 1SUQA 4IDKA 4IKFA 3LZJA 3E01A 3OVNA 1XI1A 3HL8A 4CEDA 4FLYA 1QSYA 1IKXA 1RT3A 1XWLA 3VQBA 1VK0A 1KVCA 2YHAA 4AHSA 4J2DA 4FJGA 4ZTFA 5SWMA 3VQ6A 4FJMA 3HPHA 2E6LA 1MU2A 1ASWA 3NBPA 3O3HA 4E7JA 3HO1A 2HHWA 5DK5A 4W5QA 3MXMA 2XY6A 4ICLA 3SI6A 1J9AA 4O5BA 2Q3SA 4Q0BA 3DYAA 1SKWA 4J2AA 3DRPA 4Z4GA 1RBRA 5HBMA 1KVAA 1SL1A 3KLFA 3AA3A 4CJVA 5CYQA 3HT3A 1S6PA 4PQUA 3SQ1A 3OYKA 4CGDA 4CJQA 5KTQA 3OYDA 4CJ5A 3AA4A 3WNEA 3K59A 2ZE2A 3OYLA 3U6FA 3V81A 2ITGA 4M41A 3ZT4A 3CYMA 3V9XA 4DTSA 4DS4A 3OJSA 4HUEA 4FLZA 1WAJA 2EHGA 3LPTA 1UWBA 3U3GA 4FK2A 2G8UA 4E7LA 3LPUA 3S9HA 2AJQA 4DFMA 3RMDA 1XHZA 3DOLA 3NH2A 3OY9A 4DFKA 1XC9A 1RDAA 4DS5A 3ZSXA 1NK6A 1Q9YA 4B9TA 3QNNA 4Z4CA 3CG7A 4M3XA 3KLIA 5KGWA 3QEVA 1DTTA 1TK8A 2G8FA 1ZBHA 1S9EA 3F9KA 3OYMA 1HRHA 1RBUA 4FW1A 1JLCA 3PUFA 1KFDA 3VQEA 3V9ZA 3AO5A 4F3OA 1X9SA 4B9SA 2O4IA 4LH4A 4KHQA 4ELUA 3M8PA 5HRSA 4CFBA 3OYCA 3ZT1A 2JLEA 3MEEA 4CHPA 4DSFA 4I2PA 4M3YA 3P1GA 1RILA 1IKVA 1SKSA 3NHGA 2B4JA 1C1CA 1NJWA 4QOZB 2KZMA 4JS4A 3IS9A 4JLHA 3K5NA 1NK5A 3B6OA 3VQDA 3TABA 5J2NA 4PUOA 3RMCA 4Z4FA 4MFBA 1U45A 4DU3A 3NF8A 4KRFA 1BIUA 3D0PA 4GW6A 3AVMA 4LD0A 1NOZA 3ZSZA 1EETA 1VSJA 5CYMA 2KQ2A 4DTJA 4L8RB 1TKZA 4AHRA 4NYFA 3LDSA 4DLEA 4FM1A 4CEQA 4CHZA 3DMJA 2IGIA 4CHQA 1C1BA 2I5JA 3LP3A 4CIFA 4FW2A 5C24A 5FRNA 3MAQA 4CJLA 2QK9A 4FJ5A 3TI0A 1TK5A 4K8ZA 3MECA 3I8DA 4O0IA 3ULDA 3OYHA 3SZ2A 3T19A 3EZ5A 4ELTA 3QEPA 3AVAA 3TAPA 4LY7A 4ID1A 1KLNA 3IG1A 2LSNA 4OGEA 1UOCA 1RT2A 2HHQA 4BDPA 2P1JA 2XY8A 1WSHA 3LALA 3SPYA 2BGGA 3PO5A 1S1VA 4NCBA 3IRXA 1RTIA 4HCBA 1NK8A 4EZ6A 3SYZA 1RTJA 3HPOA 1I39A 2D0BA 3ITHA 2YKNA 2D0CA 4EP5A 4CGIA 1IG9A 3KKRA 2G8VA 2KZZA 1JL1A 3G10A 1VRTA 3HVRA 4HCCA 4RW6A 3ALYA 3ZT3A 4CHNA 3RMBA 1D8YA 4B9NA 1C1AA 1U04A 4J2EA 4PWDA 3LZIA 1U49A 3ZSYA 2YKMA 3DRSA 2P5GA 1RDBA 5FROA 4KAZA 4M3RA 3UIQA 1EKEA 3T3FA 4CECA 4DSIA 4Q5VA 3HXMA 4DQIA 3SQ4A 3L2QA 4CK2A 3SNNA 4E1NA 1CZ9A 4C8MA 2ZD1A 4QCLA 2DY4A 1WSGA 1RDCA 2DFFA 4DQQA 3WNHA 1QSLA 1HYVA 4DF8A 3LANA 1T8EA 2GV9A 3OS0A 3OYIA 1RT1A 4ID5A 1UA0A 3K5OA 3RMAA 1RBSA 2YNIA 3NAEA 3AVIA 3OYBA 3ZSQA 1JLEA 4FLVA 1KFSA 2O4GA 1S1TA 3JSMA 4CFDA 1Q8IA 3ZSVA 4CJFA 3SUNA 4ZTJA 1VSEA 3L2RA 4K8XA 1JXBA 4CEEA 3P5JA 4YNQA 4FVMA 2OPQA 3MXJA 1KRPA 1BQMA 4BACA 4XIUA 4F2RA 1HQEA 4CF1A 4OVLA 1BL3A 3KKSA 1JLGA 4DU4A 3AVGA 2P51A 3OYGA 2FBYA 1T05A 2DFEA 1WLJA 4FLUA 3NFAA 3SQ2A 4AHTA 4CEBA 5KRSA 2KW4A 3DLRA 4GVMA 4J2BA 4FZZA 1WAFA 4CGFA 3AO2A 4CF8A 3V1RA 5HRNA 3K5LA 1U4BA 3M8RA 4KTZA 4E89A 3DLBA 3T1AA 1TGOA 1NJZA 3TANA 4OLAA 1X9WA 2YV0X 3KD5E 3C6TA 4F4KA 4KKOA 3ASMA 1D9FA 3KTQA 2BDPA 3KD1E 1FKPA 1VRUA 1ZBUA 4FM2A 1JLFA 1RNHA 3QO9A 1FXXA 4MQ3A 4WE1A 1NK9A 1UAXA 1C0TA 1BGXT 4RW7A 4IG3A 4DFJA 3S3NA 1L3SA 3LP0A 3SCXA 1L3UA 5J2QA 3QEIA 1ASVA 1C0UA 1CZBA 3LWMA 1GOAA 2ZQBA 4B08A 4FJ7A 2OZMA 2D5RA 1C6VA 3SV3A 4E7KA 2Z1GA 2Z1HA 4I9LA 4CEZA 3VQPA 2XO7A 3A2FA 2QKBA 2FBTA 3ZT0A 1TK0A 2WONA 2YHBA 1HYZA 3HVTA 2OZSA 1HQUA 4KTQA 1CLQA 4UQGA 1ASUA 3KLHA 3PX4A 4JRPA 1I3AA 4AHUA 4F2SA 4FLTA 1EX4A 4LSLA 4BDYA 3HK2A 4IBNA 4I2QA 3SUPA 4RW9A 2A1RA 1KLMA 4OKJA 3OS1A 4CGGA 4KI6A 1WN7A 4FLXA 1NK4A 5JS2A 3TAQA 4N41A 1BQNA 2HNDA 5KI6A 4DQSA 3HM9A 3I0SA 1YT3A 3QLHA 3ZSOA 5C42A 4DTNA 3PV8A 3AVKA 1WSFA 1XHXA 2VG6A 3VA3A 3RR8A 2WOMA 3VQ4A 4C8NA 3ZSWA 4EP4A 1BCOA 4OPJA 4IFVA 5J2PA 3HPGA 4CE9A 3ZSRA 3RTVA 1TAQA 3DLHA 4KHNA 2HHSA 1HPZA 1VSMA 1RBVA 3NF7A 3NF6A 1W0HA 3CFOA 4FJIA 1DTQA 1RT4A 1YTAA 5T7BA 3KIOA 4CF0A 4CGJA 4B8CA 4LSNA 3V1OA 4CJ3A 3ISNC 4JS5A 3MEDA 1CXUA 4BE1A 2G8WA 4Y1DA 4HVJA 2KFNA 3V9UA 1TL3A 3AA5X 1RT7A 1RBTA 4CERA 2X6SA 5K14A 4M45A 1B92A 3BGRA 1RTDA 4E1MA 2KFZA 1LWFA 5EU7A 3JYTA 3KLEA 2RKIA 4Z0UA 3K2PA 4DSLA 1GOCA 3AVJA 3RWUA 4KHWA 1IKYA 2VG7A 4CHOA 5C25A 1KTQA 1S5JA 4DU1A 1YTUA 4B9UA 5HLFA 3L8BA 5J1EA 3NH0A 1A5WA 4Z4EA 3AVBA 3LWLA 1Q9XA 3QESA 2GBZA 1U48A 5KGXA 2HB5A 2HHUA 3VQQA 3QERA 1GOBA 1TVRA 1C0MA 4FJ9A 2G8KA 4KHUA 2E4LA 2FBVA 1LWEA 4H8KA 4DTOA 3VQ9A 4CIEA 3VQ7A 3OYJA 1IKWA 1TAUA 3WNFA 3QNOA 2B6AA 2ETJA 4CJTA 1LV5A 4CJEA 2B5JA 1HJRA 2XY7A 1BISA 4DTRA 3PY8A 3SJJA 3HYFA 2IS3A 1A5XA 3VA0A 4I7FA 3OYAA 2PYJA 3QIOA 1DLOA 3HSTB 2IAJA 4H4OA 1TL1A 3O3FA 1W9HA 1WSIA 3DM2A 4DSEA 3TAEA 5HROA 4B9LA 4NCGA 4RW8A 2HNYA 2VG5A 3HJFA 3LAMA 1RDDA 3K5MA 3PX0A 4CK1A 4FCYA 1K6YA 4NCAA 4DLGA 1RT5A 1LWCA 1FK9A 4FZXC 2Y1JA 4OPKA 3P83D 4CFAA 3L2WA 3SQ0A 2F8TA 1CXQA 3NCIA 2Z1JA 1JLAA 5CZ1A 3LP2A 4KFBA 4IFYA 4N47A 3O3GA 4OJRA 3LP1A 3KK3A 3VQCA 3AO1A 4FJLA 1WNSA 2Y1IA 1JL2A 4N76A 1ZBIA 4B3OA 3M8QA 2HVIA 1NKBA 4W5OA 1S6QA 1L5UA 2G8HA 2F8SA 4PY5A 2HVHA 3C6UA 3AVLA 3NDKA 3NE6A 2HMIA 4OLBA 3TWHA 1QE1A 2R7YA 4G1QA 4KHSA 1JXEA 1ITGA 1SV5A 1F21A 4B9MA 4C8KA 1Y97A 4OKKA 1HMVA 2F96A 4KREA 4TSXA 3HP9A 1QHTA 4O55A 1RTHA 1Z26A 2PY5A 4DSJA 1FKOA 3OYNA 1J54A 2BE2A 3MXIA 3V4IA 1G15A 3TARA 3SV4A 4EZ9A 1TKTA 3SPZA 1NOYA 4DWIA 4M3UA 5SZTA 1BI4B 4BE2A 1X1PA 3NGYA 4GMJB 4RW4A 4CK3A 4FK0A 2EX3A 1VSFA 4Y1CA 3DLEA 2W42A 3NGIA 3IAYA 4NYNA 4JRQA 3V9WA 3CM6A 3SUOA 3L3VA 4O4GA 2A1SA 4CJRA 4KPYA 2HHVA 3AVNA 4BWJA 2BANA 4KB1A 4FLWA 4R5PA 4YFUA 1S1XA 3DLGA 2XHBA 3OYEA 3DOKA 4FYDA 5CY4A 1WSEA 1JLQA 1VSIA 2XRIA 2NUBA 5DMRA 5I42A 1LAWA 4DQRA 1NK0A 3DLKA 4RG8A 4FXDA 4B9VA 1IH7A 4CEAA 4AILC 4CJ4A 4Z4HA 4FJ8A 5FDLA 4E3SA 3QIPA 3K57A 2FC0A 3V9SA 3OYFA 2QKKA 1T7PA 2PYLA 2X78A 4H4MA 2XY5A 3S3OA 4CEOA 1SL2A 3AV9A 3OJUA 1QS4A 2KTQA 2OA8A 3QEWA 5D3GA 3NH1A 2IC3A 1J5OA 4CJKA 2Z1IA 1SL0A 2X74A 4DMNA 2RPIA 1IO2A 3DI6A 4HUFA 4CEFA 4AHCA 1QTMA 3H08A 3VQ5A 5KRTA 3U3YA 3AO3A 3PX6A 1LW0A 4DTXA 1L3VA 4KI4A 2E6MA 4W5TA 4QAGA 3EY1A 2DTUA 1EP4A 1VSKA 2OPSA 1TKDA 3FFIA 4E7IA 1QQCA 3MEGA 4DSKA 1REVA 1UA1A 1N6QA 1J53A 1HNIA 3I0RA 3O4QA 1NJYA 3TAMA 5HRPA 1KSPA 4M3ZA 3NF9A 1L3TA 4DTMA 3THVA 2HNZA 5FRMA 5I3UA 1BI4A 2GUIA 4FJJA 1D5AA 1QSSA 1VSHA 4KV8A 1RT6A 3SUQA 3AVHA 4CHYA 4DQPA 3AA2A 4F8RA 4CFCA 4AHVA 4C8OA 5HRRA 4FJKA 4CJPA 4FJXA 4CJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DF4 A;  1BCM A;  3VQ8 A;  1KVB A;  1VSD A;  3B6P A;  1EXQ A;  1Z25 A;  2RF2 A;  1NKC A;  1WSJ A;  3M8S A;  1D9D A;  4KB0 A;  4C8L A;  3AVC A;  3AVF A;  2VWJ A;  2OPR A;  1RCH A;  3S3M A;  1X9M A;  2HHX A;  4B8A B;  2YNH A;  3CFP A;  4BDZ A;  2IOC A;  3C94 A;  4ZHR A;  3G0Z A;  4FK4 A;  2P5O A;  4BWM A;  4W5N A;  3RRH A;  1O1W A;  1BIZ A;  2JGU A;  3TAG A;  1B9D A;  3DRR A;  1ZYQ A;  1TV6 A;  1KCF A;  1N5Y A;  2HW3 A;  4AH9 A;  4BE0 A;  3VN5 A;  2X6N A;  4HUG A;  4DFP A;  3BDP A;  2HHT A;  4CF9 A;  3TR8 A;  1NKE A;  4FJH A;  3TAF A;  5JS1 A;  3VQA A;  3L2U A;  3CQ8 A;  4IG0 A;  4PA1 A;  3RRG A;  2YNF A;  5HP1 A;  3V6D A;  4Z4I A;  3LAK A;  1A5V A;  2OPP A;  4DTP A;  3NGZ A;  3PO4 A;  4CCH A;  2D0A A;  3QET A;  1S9G A;  4OKE A;  1NK7 A;  3RR7 A;  1ZBF A;  4E19 A;  3WNG A;  1TKX A;  3KLG A;  3HP6 A;  1SKR A;  3V1Q A;  2YNG A;  4E7H A;  4DG1 A;  4CGH A;  3L2V A;  4FZY A;  2G8I A;  4HHT A;  1HYS A;  1S1W A;  3OS2 A;  1YVU A;  1NJX A;  3ZCM A;  3L3U A;  3K58 A;  5E41 A;  3AO4 A;  4LH5 A;  4FJN A;  2RN2 A;  1R0A A;  2PZS A;  4M3T A;  1B9F A;  2FBX A;  3QEX A;  1HNV A;  3ZT2 A;  4CIG A;  3F73 A;  1U47 A;  3CM5 A;  1VSL A;  2QXF A;  4I9Q A;  4OGC A;  1BHL A;  3KK1 A;  1LAV A;  3D45 A;  4KO0 A;  5CZ2 A;  3EYZ A;  1T03 A;  4DTU A;  3O4N A;  4KTW A;  4CES A;  1LW2 A;  2ATQ A;  4KHY A;  4CF2 A;  4W5R A;  2VWK A;  4M3W A;  2OYQ A;  3QIN A;  4CJS A;  3CFR A;  4FM0 A;  4O44 A;  1S1U A;  4CJW A;  1ZBL A;  4N56 A;  3KK2 A;  4HTU A;  4F3T A;  2DFH A;  5J2M A;  3KJV A;  4N5S A;  4O0J A;  1JKH A;  4ELV A;  4M42 A;  4E0D A;  1JLB A;  3C95 A;  2IDO A;  1SUQ A;  4IDK A;  4IKF A;  3LZJ A;  3E01 A;  3OVN A;  1XI1 A;  3HL8 A;  4CED A;  4FLY A;  1QSY A;  1IKX A;  1RT3 A;  1XWL A;  3VQB A;  1VK0 A;  1KVC A;  2YHA A;  4AHS A;  4J2D A;  4FJG A;  4ZTF A;  5SWM A;  3VQ6 A;  4FJM A;  3HPH A;  2E6L A;  1MU2 A;  1ASW A;  3NBP A;  3O3H A;  4E7J A;  3HO1 A;  2HHW A;  5DK5 A;  4W5Q A;  3MXM A;  2XY6 A;  4ICL A;  3SI6 A;  1J9A A;  4O5B A;  2Q3S A;  4Q0B A;  3DYA A;  1SKW A;  4J2A A;  3DRP A;  4Z4G A;  1RBR A;  5HBM A;  1KVA A;  1SL1 A;  3KLF A;  3AA3 A;  4CJV A;  5CYQ A;  3HT3 A;  1S6P A;  4PQU A;  3SQ1 A;  3OYK A;  4CGD A;  4CJQ A;  5KTQ A;  3OYD A;  4CJ5 A;  3AA4 A;  3WNE A;  3K59 A;  2ZE2 A;  3OYL A;  3U6F A;  3V81 A;  2ITG A;  4M41 A;  3ZT4 A;  3CYM A;  3V9X A;  4DTS A;  4DS4 A;  3OJS A;  4HUE A;  4FLZ A;  1WAJ A;  2EHG A;  3LPT A;  1UWB A;  3U3G A;  4FK2 A;  2G8U A;  4E7L A;  3LPU A;  3S9H A;  2AJQ A;  4DFM A;  3RMD A;  1XHZ A;  3DOL A;  3NH2 A;  3OY9 A;  4DFK A;  1XC9 A;  1RDA A;  4DS5 A;  3ZSX A;  1NK6 A;  1Q9Y A;  4B9T A;  3QNN A;  4Z4C A;  3CG7 A;  4M3X A;  3KLI A;  5KGW A;  3QEV A;  1DTT A;  1TK8 A;  2G8F A;  1ZBH A;  1S9E A;  3F9K A;  3OYM A;  1HRH A;  1RBU A;  4FW1 A;  1JLC A;  3PUF A;  1KFD A;  3VQE A;  3V9Z A;  3AO5 A;  4F3O A;  1X9S A;  4B9S A;  2O4I A;  4LH4 A;  4KHQ A;  4ELU A;  3M8P A;  5HRS A;  4CFB A;  3OYC A;  3ZT1 A;  2JLE A;  3MEE A;  4CHP A;  4DSF A;  4I2P A;  4M3Y A;  3P1G A;  1RIL A;  1IKV A;  1SKS A;  3NHG A;  2B4J A;  1C1C A;  1NJW A;  4QOZ B;  2KZM A;  4JS4 A;  3IS9 A;  4JLH A;  3K5N A;  1NK5 A;  3B6O A;  3VQD A;  3TAB A;  5J2N A;  4PUO A;  3RMC A;  4Z4F A;  4MFB A;  1U45 A;  4DU3 A;  3NF8 A;  4KRF A;  1BIU A;  3D0P A;  4GW6 A;  3AVM A;  4LD0 A;  1NOZ A;  3ZSZ A;  1EET A;  1VSJ A;  5CYM A;  2KQ2 A;  4DTJ A;  4L8R B;  1TKZ A;  4AHR A;  4NYF A;  3LDS A;  4DLE A;  4FM1 A;  4CEQ A;  4CHZ A;  3DMJ A;  2IGI A;  4CHQ A;  1C1B A;  2I5J A;  3LP3 A;  4CIF A;  4FW2 A;  5C24 A;  5FRN A;  3MAQ A;  4CJL A;  2QK9 A;  4FJ5 A;  3TI0 A;  1TK5 A;  4K8Z A;  3MEC A;  3I8D A;  4O0I A;  3ULD A;  3OYH A;  3SZ2 A;  3T19 A;  3EZ5 A;  4ELT A;  3QEP A;  3AVA A;  3TAP A;  4LY7 A;  4ID1 A;  1KLN A;  3IG1 A;  2LSN A;  4OGE A;  1UOC A;  1RT2 A;  2HHQ A;  4BDP A;  2P1J A;  2XY8 A;  1WSH A;  3LAL A;  3SPY A;  2BGG A;  3PO5 A;  1S1V A;  4NCB A;  3IRX A;  1RTI A;  4HCB A;  1NK8 A;  4EZ6 A;  3SYZ A;  1RTJ A;  3HPO A;  1I39 A;  2D0B A;  3ITH A;  2YKN A;  2D0C A;  4EP5 A;  4CGI A;  1IG9 A;  3KKR A;  2G8V A;  2KZZ A;  1JL1 A;  3G10 A;  1VRT A;  3HVR A;  4HCC A;  4RW6 A;  3ALY A;  3ZT3 A;  4CHN A;  3RMB A;  1D8Y A;  4B9N A;  1C1A A;  1U04 A;  4J2E A;  4PWD A;  3LZI A;  1U49 A;  3ZSY A;  2YKM A;  3DRS A;  2P5G A;  1RDB A;  5FRO A;  4KAZ A;  4M3R A;  3UIQ A;  1EKE A;  3T3F A;  4CEC A;  4DSI A;  4Q5V A;  3HXM A;  4DQI A;  3SQ4 A;  3L2Q A;  4CK2 A;  3SNN A;  4E1N A;  1CZ9 A;  4C8M A;  2ZD1 A;  4QCL A;  2DY4 A;  1WSG A;  1RDC A;  2DFF A;  4DQQ A;  3WNH A;  1QSL A;  1HYV A;  4DF8 A;  3LAN A;  1T8E A;  2GV9 A;  3OS0 A;  3OYI A;  1RT1 A;  4ID5 A;  1UA0 A;  3K5O A;  3RMA A;  1RBS A;  2YNI A;  3NAE A;  3AVI A;  3OYB A;  3ZSQ A;  1JLE A;  4FLV A;  1KFS A;  2O4G A;  1S1T A;  3JSM A;  4CFD A;  1Q8I A;  3ZSV A;  4CJF A;  3SUN A;  4ZTJ A;  1VSE A;  3L2R A;  4K8X A;  1JXB A;  4CEE A;  3P5J A;  4YNQ A;  4FVM A;  2OPQ A;  3MXJ A;  1KRP A;  1BQM A;  4BAC A;  4XIU A;  4F2R A;  1HQE A;  4CF1 A;  4OVL A;  1BL3 A;  3KKS A;  1JLG A;  4DU4 A;  3AVG A;  2P51 A;  3OYG A;  2FBY A;  1T05 A;  2DFE A;  1WLJ A;  4FLU A;  3NFA A;  3SQ2 A;  4AHT A;  4CEB A;  5KRS A;  2KW4 A;  3DLR A;  4GVM A;  4J2B A;  4FZZ A;  1WAF A;  4CGF A;  3AO2 A;  4CF8 A;  3V1R A;  5HRN A;  3K5L A;  1U4B A;  3M8R A;  4KTZ A;  4E89 A;  3DLB A;  3T1A A;  1TGO A;  1NJZ A;  3TAN A;  4OLA A;  1X9W A;  2YV0 X;  3KD5 E;  3C6T A;  4F4K A;  4KKO A;  3ASM A;  1D9F A;  3KTQ A;  2BDP A;  3KD1 E;  1FKP A;  1VRU A;  1ZBU A;  4FM2 A;  1JLF A;  1RNH A;  3QO9 A;  1FXX A;  4MQ3 A;  4WE1 A;  1NK9 A;  1UAX A;  1C0T A;  1BGX T;  4RW7 A;  4IG3 A;  4DFJ A;  3S3N A;  1L3S A;  3LP0 A;  3SCX A;  1L3U A;  5J2Q A;  3QEI A;  1ASV A;  1C0U A;  1CZB A;  3LWM A;  1GOA A;  2ZQB A;  4B08 A;  4FJ7 A;  2OZM A;  2D5R A;  1C6V A;  3SV3 A;  4E7K A;  2Z1G A;  2Z1H A;  4I9L A;  4CEZ A;  3VQP A;  2XO7 A;  3A2F A;  2QKB A;  2FBT A;  3ZT0 A;  1TK0 A;  2WON A;  2YHB A;  1HYZ A;  3HVT A;  2OZS A;  1HQU A;  4KTQ A;  1CLQ A;  4UQG A;  1ASU A;  3KLH A;  3PX4 A;  4JRP A;  1I3A A;  4AHU A;  4F2S A;  4FLT A;  1EX4 A;  4LSL A;  4BDY A;  3HK2 A;  4IBN A;  4I2Q A;  3SUP A;  4RW9 A;  2A1R A;  1KLM A;  4OKJ A;  3OS1 A;  4CGG A;  4KI6 A;  1WN7 A;  4FLX A;  1NK4 A;  5JS2 A;  3TAQ A;  4N41 A;  1BQN A;  2HND A;  5KI6 A;  4DQS A;  3HM9 A;  3I0S A;  1YT3 A;  3QLH A;  3ZSO A;  5C42 A;  4DTN A;  3PV8 A;  3AVK A;  1WSF A;  1XHX A;  2VG6 A;  3VA3 A;  3RR8 A;  2WOM A;  3VQ4 A;  4C8N A;  3ZSW A;  4EP4 A;  1BCO A;  4OPJ A;  4IFV A;  5J2P A;  3HPG A;  4CE9 A;  3ZSR A;  3RTV A;  1TAQ A;  3DLH A;  4KHN A;  2HHS A;  1HPZ A;  1VSM A;  1RBV A;  3NF7 A;  3NF6 A;  1W0H A;  3CFO A;  4FJI A;  1DTQ A;  1RT4 A;  1YTA A;  5T7B A;  3KIO A;  4CF0 A;  4CGJ A;  4B8C A;  4LSN A;  3V1O A;  4CJ3 A;  3ISN C;  4JS5 A;  3MED A;  1CXU A;  4BE1 A;  2G8W A;  4Y1D A;  4HVJ A;  2KFN A;  3V9U A;  1TL3 A;  3AA5 X;  1RT7 A;  1RBT A;  4CER A;  2X6S A;  5K14 A;  4M45 A;  1B92 A;  3BGR A;  1RTD A;  4E1M A;  2KFZ A;  1LWF A;  5EU7 A;  3JYT A;  3KLE A;  2RKI A;  4Z0U A;  3K2P A;  4DSL A;  1GOC A;  3AVJ A;  3RWU A;  4KHW A;  1IKY A;  2VG7 A;  4CHO A;  5C25 A;  1KTQ A;  1S5J A;  4DU1 A;  1YTU A;  4B9U A;  5HLF A;  3L8B A;  5J1E A;  3NH0 A;  1A5W A;  4Z4E A;  3AVB A;  3LWL A;  1Q9X A;  3QES A;  2GBZ A;  1U48 A;  5KGX A;  2HB5 A;  2HHU A;  3VQQ A;  3QER A;  1GOB A;  1TVR A;  1C0M A;  4FJ9 A;  2G8K A;  4KHU A;  2E4L A;  2FBV A;  1LWE A;  4H8K A;  4DTO A;  3VQ9 A;  4CIE A;  3VQ7 A;  3OYJ A;  1IKW A;  1TAU A;  3WNF A;  3QNO A;  2B6A A;  2ETJ A;  4CJT A;  1LV5 A;  4CJE A;  2B5J A;  1HJR A;  2XY7 A;  1BIS A;  4DTR A;  3PY8 A;  3SJJ A;  3HYF A;  2IS3 A;  1A5X A;  3VA0 A;  4I7F A;  3OYA A;  2PYJ A;  3QIO A;  1DLO A;  3HST B;  2IAJ A;  4H4O A;  1TL1 A;  3O3F A;  1W9H A;  1WSI A;  3DM2 A;  4DSE A;  3TAE A;  5HRO A;  4B9L A;  4NCG A;  4RW8 A;  2HNY A;  2VG5 A;  3HJF A;  3LAM A;  1RDD A;  3K5M A;  3PX0 A;  4CK1 A;  4FCY A;  1K6Y A;  4NCA A;  4DLG A;  1RT5 A;  1LWC A;  1FK9 A;  4FZX C;  2Y1J A;  4OPK A;  3P83 D;  4CFA A;  3L2W A;  3SQ0 A;  2F8T A;  1CXQ A;  3NCI A;  2Z1J A;  1JLA A;  5CZ1 A;  3LP2 A;  4KFB A;  4IFY A;  4N47 A;  3O3G A;  4OJR A;  3LP1 A;  3KK3 A;  3VQC A;  3AO1 A;  4FJL A;  1WNS A;  2Y1I A;  1JL2 A;  4N76 A;  1ZBI A;  4B3O A;  3M8Q A;  2HVI A;  1NKB A;  4W5O A;  1S6Q A;  1L5U A;  2G8H A;  2F8S A;  4PY5 A;  2HVH A;  3C6U A;  3AVL A;  3NDK A;  3NE6 A;  2HMI A;  4OLB A;  3TWH A;  1QE1 A;  2R7Y A;  4G1Q A;  4KHS A;  1JXE A;  1ITG A;  1SV5 A;  1F21 A;  4B9M A;  4C8K A;  1Y97 A;  4OKK A;  1HMV A;  2F96 A;  4KRE A;  4TSX A;  3HP9 A;  1QHT A;  4O55 A;  1RTH A;  1Z26 A;  2PY5 A;  4DSJ A;  1FKO A;  3OYN A;  1J54 A;  2BE2 A;  3MXI A;  3V4I A;  1G15 A;  3TAR A;  3SV4 A;  4EZ9 A;  1TKT A;  3SPZ A;  1NOY A;  4DWI A;  4M3U A;  5SZT A;  1BI4 B;  4BE2 A;  1X1P A;  3NGY A;  4GMJ B;  4RW4 A;  4CK3 A;  4FK0 A;  2EX3 A;  1VSF A;  4Y1C A;  3DLE A;  2W42 A;  3NGI A;  3IAY A;  4NYN A;  4JRQ A;  3V9W A;  3CM6 A;  3SUO A;  3L3V A;  4O4G A;  2A1S A;  4CJR A;  4KPY A;  2HHV A;  3AVN A;  4BWJ A;  2BAN A;  4KB1 A;  4FLW A;  4R5P A;  4YFU A;  1S1X A;  3DLG A;  2XHB A;  3OYE A;  3DOK A;  4FYD A;  5CY4 A;  1WSE A;  1JLQ A;  1VSI A;  2XRI A;  2NUB A;  5DMR A;  5I42 A;  1LAW A;  4DQR A;  1NK0 A;  3DLK A;  4RG8 A;  4FXD A;  4B9V A;  1IH7 A;  4CEA A;  4AIL C;  4CJ4 A;  4Z4H A;  4FJ8 A;  5FDL A;  4E3S A;  3QIP A;  3K57 A;  2FC0 A;  3V9S A;  3OYF A;  2QKK A;  1T7P A;  2PYL A;  2X78 A;  4H4M A;  2XY5 A;  3S3O A;  4CEO A;  1SL2 A;  3AV9 A;  3OJU A;  1QS4 A;  2KTQ A;  2OA8 A;  3QEW A;  5D3G A;  3NH1 A;  2IC3 A;  1J5O A;  4CJK A;  2Z1I A;  1SL0 A;  2X74 A;  4DMN A;  2RPI A;  1IO2 A;  3DI6 A;  4HUF A;  4CEF A;  4AHC A;  1QTM A;  3H08 A;  3VQ5 A;  5KRT A;  3U3Y A;  3AO3 A;  3PX6 A;  1LW0 A;  4DTX A;  1L3V A;  4KI4 A;  2E6M A;  4W5T A;  4QAG A;  3EY1 A;  2DTU A;  1EP4 A;  1VSK A;  2OPS A;  1TKD A;  3FFI A;  4E7I A;  1QQC A;  3MEG A;  4DSK A;  1REV A;  1UA1 A;  1N6Q A;  1J53 A;  1HNI A;  3I0R A;  3O4Q A;  1NJY A;  3TAM A;  5HRP A;  1KSP A;  4M3Z A;  3NF9 A;  1L3T A;  4DTM A;  3THV A;  2HNZ A;  5FRM A;  5I3U A;  1BI4 A;  2GUI A;  4FJJ A;  1D5A A;  1QSS A;  1VSH A;  4KV8 A;  1RT6 A;  3SUQ A;  3AVH A;  4CHY A;  4DQP A;  3AA2 A;  4F8R A;  4CFC A;  4AHV A;  4C8O A;  5HRR A;  4FJK A;  4CJP A;  4FJX A;  4CJU A; 
#chains in the Genus database with same CATH topology
 4DF4 A;  1EO1 A;  1KVB A;  2CGL A;  5I9E B;  4BGB A;  1EXQ A;  2RF2 A;  1WSJ A;  2O8F A;  3AVF A;  3ENB A;  4A5A A;  4X64 K;  4W5N A;  4FK4 A;  1N32 K;  4B1U B;  1T44 A;  3RRH A;  1O1W A;  2HW3 A;  1TV6 A;  4BE0 A;  2HHT A;  3VN5 A;  2E1Z A;  3BDP A;  4FOE A;  4XEI A;  1NKE A;  1KD1 O;  4UY8 O;  3VQA A;  3L2U A;  5AQK A;  4IG0 A;  5CE3 A;  5HP1 A;  1A5V A;  2HMP A;  4OKE A;  1NK7 A;  1ZBF A;  4E19 A;  1Z05 A;  3KLG A;  3WXK A;  4E7H A;  4XH5 A;  4FZY A;  1S1W A;  3CJ7 A;  1YVU A;  3L3U A;  2RN2 A;  2HF4 A;  2PZS A;  3QEX A;  3ZET B;  3F73 A;  1U47 A;  3CM5 A;  2Q0R A;  1T03 A;  1NJI O;  3EYZ A;  3ENH A;  1BOT O;  4DTU A;  4CES A;  2ATQ A;  5M1N A;  5AQS A;  3QIN A;  4JKF A;  1S1U A;  4CJW A;  4FWR A;  4DR5 K;  4BRI A;  3A0I X;  4ELV A;  1JKH A;  4ISG A;  3RVC A;  4E0D A;  1JLB A;  3C95 A;  3CF5 L;  3T7Z A;  3VEX A;  5AQL A;  4CED A;  1Y64 A;  4BRK A;  1IKX A;  1RT3 A;  1QSY A;  1U2V A;  5FPN A;  4FJG A;  4ZTF A;  3D2E A;  4FL9 A;  2E6L A;  4KH6 A;  3JS6 A;  1CZA N;  3PIP L;  3MX2 A;  1DEJ A;  1MDU B;  3HBT A;  1KVA A;  3KLF A;  1KAY A;  2KHO A;  2YCH A;  4KH4 A;  3HT3 A;  3WNE A;  2QXL A;  3OYL A;  1Q81 O;  2VGM A;  5ADX A;  3V9X A;  4DS4 A;  4HUE A;  4FOI A;  2EHG A;  3U3G A;  3CCQ N;  2G8U A;  3S9H A;  5LJV A;  3RMD A;  5JLF A;  1XC9 A;  1XNR K;  5AQT A;  1Q9Y A;  4YDU A;  3KLI A;  5KGW A;  3QEV A;  4OPA A;  1S9E A;  3MDQ A;  1JLC A;  1OH6 A;  4LH4 A;  3M8P A;  5HRS A;  4BRD A;  5LJW A;  3CPW M;  3ZT1 A;  3E66 A;  3E1Y A;  1J5E K;  5TKW A;  4NLB A;  1IKV A;  4JKC A;  3NHG A;  1NJW A;  1BO5 O;  4JS4 A;  3IS9 A;  4JLH A;  3WUH A;  2A3Z A;  1NK5 A;  3B8A X;  1N36 K;  4MFB A;  3NF8 A;  4RCH A;  5JIC A;  4GW6 A;  3AVM A;  4LD0 A;  1NOZ A;  1EET A;  4M7X A;  4WQ5 C;  1VSJ A;  5CYM A;  4IOA L;  2IGI A;  3T1H K;  4BR9 A;  5LY3 A;  2JWL A;  4CJL A;  3H45 C;  3SZ2 A;  1NGI A;  3EZ5 A;  4JI0 K;  4LY7 A;  5ELZ A;  5GIN A;  3SAF A;  5BN9 A;  4JKA A;  3LAL A;  4YOV A;  3G6E N;  1S1V A;  3IRX A;  4MO4 A;  3C7N A;  2OAN A;  3I56 N;  3ITH A;  3ZEU A;  1SQK A;  1IG9 A;  3G10 A;  3BP8 A;  4MO5 A;  4HCC A;  3ALY A;  4B9N A;  4MLH A;  1U49 A;  1TUU A;  4A59 A;  3DRS A;  5FRO A;  3D2F A;  3L4I A;  4DQI A;  3SQ4 A;  4CK2 A;  4YOU A;  2ZD1 A;  4QCL A;  1RDC A;  2DFF A;  2GV9 A;  3OS0 A;  1RT1 A;  1UA0 A;  3EZW A;  2A42 A;  3AVI A;  3ULE A;  1LCU A;  1KXP A;  1Q8I A;  3K0S A;  4QS9 A;  4CJF A;  3SUN A;  4K8X A;  1EWQ A;  1RFQ A;  4CEE A;  1WUA A;  3P5J A;  2OPQ A;  3MXJ A;  1KRP A;  4JV5 K;  1YXQ A;  4B1V A;  1GLB G;  3KKS A;  1U6Z A;  4CZI A;  1G99 A;  1T05 A;  3SQ2 A;  4AHT A;  4GVM A;  3AO2 A;  1U4B A;  3M8R A;  4KTZ A;  4FWS A;  4E89 A;  2FSN A;  2BH1 A;  3KD5 E;  3C6T A;  4BC4 A;  2PAV A;  1FKP A;  2P9K B;  1NK9 A;  1UAX A;  1C0T A;  1BGX T;  4DFJ A;  2W41 A;  2QA4 N;  1OVY A;  2ASO A;  3SCX A;  4NLC A;  3WXM B;  5J2Q A;  3QEI A;  1NWK A;  1C0U A;  3OA9 A;  2OZM A;  3SK3 A;  2F7T A;  3E9P A;  4I9L A;  1NGB A;  4IJA A;  2QKB A;  1HKC A;  1TK0 A;  2WON A;  3ENO A;  1HYZ A;  2OZS A;  3CCM N;  3CD6 N;  1KAX A;  1VHX A;  3J80 O;  3R3L A;  3PX4 A;  2J4R A;  1YJ9 N;  1EX4 A;  5DM7 L;  3THX B;  2UUA K;  4I2Q A;  4FWP A;  3G4S N;  2QWM A;  3WEE A;  2HND A;  5KI6 A;  1YIT N;  1QQN A;  3QLH A;  3PV8 A;  1BA0 A;  3VA3 A;  3RR8 A;  4J2D A;  2VG6 A;  3ZSW A;  5J2P A;  1VQ5 N;  1BWF O;  2P9U A;  2DPN A;  3ZSR A;  3RTV A;  4KHN A;  1VSM A;  1RBV A;  1XQS C;  4BVO A;  3KIO A;  2YHX A;  4KBO A;  1DGK N;  1BU6 O;  1CXU A;  2YJE A;  4Y1D A;  4HVJ A;  5BN8 A;  3UB5 A;  5C0Y A;  5HL7 L;  5IWA K;  4M45 A;  4WFN L;  2KFZ A;  2RKI A;  4DSL A;  3LDP A;  3KZB A;  2P9I A;  3RWU A;  4CHO A;  4DR4 K;  1YTU A;  4HWI A;  4B9U A;  3L8B A;  3VER A;  5LMU K;  3QES A;  1U48 A;  3QDK A;  2HHU A;  3DXM B;  2ZWH A;  2IVO A;  1TVR A;  1C0M A;  4FJ9 A;  1J6Z A;  2I7N A;  5KPZ A;  2FBV A;  1TAU A;  1W97 L;  3A8Y A;  4FO0 A;  1LV5 A;  2XY7 A;  4DTR A;  3PY8 A;  5AZI A;  2ZJR L;  3HYF A;  3P31 A;  5EX5 A;  3VES A;  2PYJ A;  1DLO A;  2Q97 A;  1TL1 A;  3DM2 A;  4RW8 A;  5AQX A;  1RDU A;  1RDD A;  4BG9 A;  3K5M A;  1RT5 A;  2GWK A;  1LWC A;  4FZX C;  2HOE A;  2OCE A;  3P83 D;  3L2W A;  2ZJP L;  1CXQ A;  2Q31 A;  3O3G A;  4KFB A;  4IFY A;  4FJL A;  3ZYY X;  1ZBI A;  4B3O A;  3IMX A;  1L5U A;  3AVL A;  3NDK A;  4A2B A;  2HMI A;  2OTL N;  2R7Y A;  4G1Q A;  4FPA A;  1NMN A;  2VCP A;  1N34 K;  2P9N A;  1Z26 A;  3MXI A;  3V4I A;  3VEW A;  3TAR A;  3SV4 A;  4DWI A;  3VF6 A;  3SPZ A;  3JXU A;  3LDL A;  4JI7 K;  4M3U A;  3W0L A;  4BE2 A;  4GMJ B;  3UKU B;  3IAY A;  4IEE A;  2W42 A;  2QWN A;  1YF5 L;  3CM6 A;  2A1S A;  4KB1 A;  4YFU A;  4ISF A;  2NUB A;  5DMR A;  1YJW N;  4AIL C;  4Z4H A;  3THW A;  4B1Y B;  2RHK A;  4H5V A;  2H3G X;  4GV9 A;  4ELT A;  4H4M A;  3S3O A;  1ZXO A;  1ESV A;  4CEO A;  3AV9 A;  1SL2 A;  2NRW A;  2A6A A;  3MN7 A;  1VQP N;  4K42 A;  3NH1 A;  1J5O A;  5D3G A;  4CJK A;  2Z1I A;  2X74 A;  3L6Q A;  2QWQ A;  1RDW X;  3J7Y P;  1QHA A;  3PSI A;  2O8E A;  3VQ5 A;  5KRT A;  3U3Y A;  3AO3 A;  1L3V A;  1OH8 A;  4W5T A;  3CJB A;  3A5N C;  4CZK A;  3HOS A;  1J53 A;  3I0R A;  1NJY A;  1Q86 O;  3TAM A;  1HX1 A;  3K9K A;  4M3Z A;  3NF9 A;  1L3T A;  3NVM A;  3DWL A;  1BI4 A;  1D5A A;  1FW6 A;  2WFB A;  4DQP A;  4CFC A;  4C8O A;  5HRR A;  4JK8 A;  4CJP A;  4U67 L;  3VQ8 A;  2P9S B;  1Z25 A;  4BG8 A;  1VQ4 N;  2NRX A;  3QFP A;  3T69 A;  3FLC O;  1D9D A;  4KB0 A;  4IOC L;  2VWJ A;  1U2V B;  4IDH A;  4PHT X;  2HHX A;  4B8A B;  2YNH A;  3CFP A;  3FZM A;  2IOC A;  4ZHR A;  3IFR A;  1ZYQ A;  2KLA A;  3DRR A;  3D2E B;  1LOT B;  5H1S Q;  2UYT A;  2X6N A;  3TR8 A;  5JS1 A;  3CQ8 A;  5F2R A;  4Y0W A;  5AQU A;  3RRG A;  3LAK A;  4YOT A;  2CGK A;  3NGZ A;  4R79 A;  2F9W A;  3RR7 A;  4BR7 A;  5AQR A;  3WNG A;  4BR0 A;  1TKX A;  3HP6 A;  1SKR A;  3C0B A;  3ZLJ A;  2G8I A;  4AM7 A;  3ZCM A;  3U8X A;  4LH5 A;  5AQO A;  1R0A A;  3ZT2 A;  4C1N I;  2QXF A;  4I9Q A;  4JI6 K;  3KK1 A;  1LAV A;  3CER A;  4KO0 A;  3O4N A;  3MN6 A;  4CF2 A;  2OYQ A;  3LDN A;  2VGN A;  4O44 A;  4AM6 A;  4HTU A;  4B1X B;  3HI0 A;  5J2M A;  4IZ9 A;  4CJ7 A;  4CZL A;  4O8K A;  1SUQ A;  3HL8 A;  1XWL A;  3VQB A;  4WFA L;  2ASM A;  4L3Q A;  1GLA G;  3H3N O;  4LF6 K;  5SWM A;  3VQ6 A;  5EXW A;  4FJM A;  3NBP A;  3HO1 A;  5LL6 Z;  3PIO L;  4ICL A;  3TSQ A;  4LFA K;  2PFU A;  4M7Y A;  3DYA A;  3O80 A;  4J2A A;  4Z4G A;  1SL1 A;  2FLO A;  1HR0 K;  4PQU A;  3SQ1 A;  3DXK A;  4CJQ A;  3OYK A;  4CJ5 A;  1T3V A;  2ZE2 A;  3U6F A;  3V81 A;  4M41 A;  3ZT4 A;  4CBU A;  3OJS A;  3O6W A;  4FLZ A;  5AQI A;  1HJO A;  3LPT A;  3EE9 A;  5M1P A;  3OY9 A;  4DFK A;  1Q7Y O;  1GLD G;  4XH4 A;  4B9T A;  1N33 K;  4K0K K;  3C7N B;  2QWR A;  3FE1 A;  3ID8 A;  1TK8 A;  2G8F A;  3OYM A;  2UXD K;  3ZEU B;  4H0P A;  3PUF A;  4B9S A;  4H03 B;  2CH6 A;  4ELU A;  4CFB A;  2GUP A;  1VQL N;  2JLE A;  3OTO K;  4PL7 A;  1K8A O;  4B3M K;  4M3Y A;  3D2F B;  4GKK K;  2B4J A;  1C1C A;  3FZH A;  1NMD A;  3K5N A;  4PUO A;  3RMC A;  4Z4F A;  4RWT A;  4DU3 A;  5AQG A;  2KQ2 A;  2QWL A;  4WQ5 A;  3ULE B;  4B3S K;  4DLE A;  5KQD A;  3BY5 A;  3VEZ A;  4CHQ A;  3U9D A;  3AAQ A;  5FRN A;  3TI0 A;  3ULD A;  4O0I A;  3OYH A;  3T19 A;  3QEP A;  3TAP A;  4DV7 K;  2NRT A;  2NLX A;  3FR0 A;  1RT2 A;  2HHQ A;  1WSH A;  4CZH A;  2A41 A;  1NK8 A;  3QBX A;  3MWT A;  2D0B A;  2YKN A;  3H6E A;  2D0C A;  3SJH A;  4LC9 B;  3R9P A;  3I33 A;  3ZT3 A;  5KPR A;  1RDB A;  4KAZ A;  4DV2 K;  4M3R A;  3PSF A;  4CEC A;  4DSI A;  4Q5V A;  1WBB A;  4JD2 A;  2E2O A;  5A2Q O;  3CMA N;  4E1N A;  2YX6 A;  1WSG A;  5AJ3 K;  1QSL A;  4B9Q A;  3LAN A;  2FF3 B;  4IO8 A;  4DHY A;  1RBS A;  3OYB A;  1KFS A;  1S1T A;  4CZM A;  3JSM A;  3ZSV A;  4PKG A;  2P9L B;  3O5B A;  4YNQ A;  2GWJ A;  3KWG A;  4CBW A;  4BR2 A;  4BAC A;  1HQE A;  4CF1 A;  1JLG A;  3D6R A;  3MN5 A;  3IKM A;  1JCE A;  3DLR A;  1HLU A;  1WAF A;  3V1R A;  5HRN A;  1TGO A;  4BRM A;  3TAN A;  5C12 A;  2YV0 X;  1X9W A;  3LDO A;  3KTQ A;  5AQW A;  2V7Y A;  4WE1 A;  4IG3 A;  3BUZ B;  4BRL A;  3AAP A;  1NGF A;  2P9I B;  2D5R A;  4C23 A;  3SV3 A;  3ID6 A;  4E7K A;  2Z1H A;  2GTD A;  3F9M A;  4OX9 K;  3VQP A;  1Q18 A;  3A2F A;  2FBT A;  3QBW A;  4DR1 K;  4CI6 A;  1NGG A;  2YHB A;  3HVT A;  1CLQ A;  4CZF A;  4UQG A;  4NXN K;  2UUC K;  2NRZ A;  4LF4 K;  1I3A A;  5AZI B;  4AHU A;  3TTF A;  4IBN A;  2A1R A;  4FLX A;  5JS2 A;  5B8H A;  4N41 A;  3ZX3 A;  3HM9 A;  1WSF A;  2WOM A;  4EP4 A;  4C8N A;  2KKZ A;  4OPJ A;  4IFV A;  4JKB A;  3WXJ A;  3HPG A;  4CE9 A;  2QEX N;  3CC2 N;  4GKJ K;  4OPH A;  1HPZ A;  3NF7 A;  1W0H A;  3BEX A;  1RT4 A;  5T7B A;  4JEP A;  3ZX0 A;  1XC3 A;  3ISN C;  4JNE A;  4JS5 A;  2G8W A;  3AGR A;  3V9U A;  3L0Q A;  1RT7 A;  4A61 A;  2P9N B;  4WQ4 C;  4CER A;  5K14 A;  1ILY A;  4E1M A;  3JYT A;  4GY2 B;  4YOX A;  3K2P A;  1ATN A;  2VG7 A;  4LF8 K;  1S5J A;  3VGK A;  5HLF A;  1NGE A;  1QVG M;  3LWL A;  1Q9X A;  2HB5 A;  3U4L A;  3VQQ A;  1GOB A;  4DR7 K;  3GOI A;  4AF1 A;  1N8R O;  4CW7 B;  4F9O A;  5AQF A;  1HJR A;  3SJJ A;  2YJF A;  2HBJ A;  3VA0 A;  5AQY A;  2HHH K;  3HST B;  5HRO A;  4B9L A;  4DSE A;  3TAE A;  1WSI A;  5C2D A;  4BQZ A;  4NCG A;  3HJF A;  5BPM A;  1GLJ O;  5FLX O;  3THW B;  3SAH A;  5AQM A;  4JKG A;  2F9T A;  4GV3 A;  2O8C A;  4CFA A;  2Z1J A;  3MWP A;  1JLA A;  5CZ1 A;  4N47 A;  5JVG L;  4LF5 K;  4OJR A;  3LP1 A;  3KK3 A;  4H5T A;  2ZJQ L;  1JL2 A;  3H1V X;  1NKB A;  2G8H A;  2F8S A;  4MLE A;  2HVH A;  3C6U A;  4JK9 A;  4OLB A;  3TWH A;  4KHS A;  1JXE A;  4YHH K;  1K8K A;  4C8K A;  1O13 A;  1Y97 A;  4EIA A;  1HMV A;  3GE1 A;  4KRE A;  4DR3 K;  4X65 K;  4ILJ A;  1FKO A;  1NM1 A;  4EZ9 A;  1TKT A;  3O9T A;  1NOY A;  3R1X A;  5SZT A;  3QB0 A;  1BI4 B;  2NNW A;  4RW4 A;  4CK3 A;  4GVE A;  4Y1C A;  1IJJ A;  3NGI A;  4KHP K;  5M1O A;  3V9W A;  4CJR A;  4O4G A;  4KPY A;  2BAN A;  5DM6 L;  4FLW A;  4R5P A;  3DLG A;  3OYE A;  3G71 N;  3DOK A;  5C2F A;  1VSI A;  3CCL N;  2XRI A;  2BTF A;  5I42 A;  4DQR A;  1NK0 A;  3TU5 A;  1IH7 A;  4CEA A;  3EE8 A;  2YI1 A;  4FJ8 A;  1NG9 A;  5FDL A;  2QKK A;  4LF9 K;  3I8B A;  1GLF O;  1T7P A;  2UXC K;  2OA8 A;  4DMN A;  4YDU C;  4DQ8 A;  3FFK B;  4BRC A;  2V51 B;  4CEF A;  5JVH L;  3H08 A;  4ISE A;  1LW0 A;  4QAG A;  1EP4 A;  2OPS A;  2O8B A;  1HNI A;  3O4Q A;  1E4F T;  1KSP A;  3AAR A;  4DTM A;  2GUI A;  4B3R K;  3SUQ A;  4CHY A;  4F8R A;  3HM8 A;  4AHV A;  4FWO A;  4CJU A;  4OO1 J;  1VSD A;  3B6P A;  4DUZ K;  2GEM A;  3M8S A;  4C8L A;  4BRN A;  2OPR A;  1RCH A;  4DV6 K;  4CD3 A;  3C94 A;  4JI3 K;  4K41 A;  3CIP A;  2JGU A;  1B9D A;  4WYB A;  4HUG A;  5KQ8 A;  3KWI A;  4PA1 A;  3L4Q A;  2YNF A;  3V6D A;  1NGJ A;  2OPP A;  4DTP A;  5BR8 K;  3PO4 A;  4CCH A;  2D0A A;  4ILG B;  5BPN A;  3MN9 A;  3V1Q A;  2YNG A;  4CGH A;  3L2V A;  4HHT A;  3OS2 A;  1NGD A;  1NJX A;  2WUS A;  3DAW A;  2FBX A;  2CH5 A;  4CIG A;  4NXM K;  4OGC A;  4PKH A;  4KTW A;  4KHY A;  4B1W B;  3UKR A;  3O9R A;  4CJS A;  3O08 A;  4LF7 K;  2DFH A;  2P9P B;  2ZF5 O;  4I6M A;  4O0J A;  4M42 A;  2IDO A;  3C65 A;  3LZJ A;  3E01 A;  3VF4 A;  3OVN A;  3MX5 A;  1XI1 A;  4BRF A;  3GG4 A;  1KVC A;  3AGK A;  4AHS A;  3R8E A;  1V4S A;  4LFC K;  3VOV A;  4IOX A;  3JAM O;  2NRH A;  1ASW A;  1IBK K;  4E7J A;  5DK5 A;  3VMF B;  3MXM A;  4B3T K;  2XY6 A;  3SI6 A;  3VEO A;  3EKS A;  2O8F B;  1RBR A;  5AR0 A;  3MMV A;  1S6P A;  4CGD A;  5KTQ A;  4E1J A;  1R59 O;  3AA4 A;  3K59 A;  2O8D A;  2FSJ A;  2E8A A;  3CC7 N;  1HNW K;  2ITG A;  1SAZ A;  2NRR A;  3KHY A;  1NNE A;  5BR9 A;  2QI2 A;  4GNI A;  3HTV A;  4FK2 A;  4E7L A;  4JI2 K;  3O9Q A;  4DFM A;  1XHZ A;  3DOL A;  3NH2 A;  4QS8 A;  1RDA A;  4BR4 A;  4Z4C A;  4M3X A;  1GLC G;  1DTT A;  1HRH A;  1RBU A;  4FW1 A;  3V9Z A;  3AO5 A;  1M1K O;  4F3O A;  3G25 A;  5IT9 O;  4KHQ A;  2IVP A;  3BF3 A;  3O1B A;  1KQS M;  3Q7B A;  4CHP A;  4I2P A;  5AFU A;  5GIO A;  1RIL A;  4IWV A;  2ZGY A;  2FF6 A;  4JD2 B;  2KZM A;  3VEY A;  4JKE A;  3HOT A;  3B6O A;  3TAB A;  3SMP A;  1U45 A;  1NBW A;  4G9Z A;  1BIU A;  1X9J A;  1T6D A;  1OVQ A;  3O8M A;  2E2P A;  4DTJ A;  4L8R B;  4YY3 K;  3LDS A;  4FM1 A;  4CHZ A;  3VEV A;  2I5J A;  5EY4 A;  4FW2 A;  1IG8 A;  3MAQ A;  4FJ5 A;  4V19 S;  5FPE A;  1TYQ A;  3AVA A;  1Z6R A;  4ID1 A;  1C0F A;  4OGE A;  1UOC A;  1SZ2 A;  3LM9 A;  4BDP A;  2XY8 A;  1YIJ N;  2BGG A;  1VQ9 N;  4NCB A;  1RTI A;  4HCB A;  3SYZ A;  1RTJ A;  3HPO A;  5JMV A;  5M1K A;  2VQE K;  4EP5 A;  3F2K A;  3KKR A;  2G8V A;  2E1Y A;  1JL1 A;  4FWK A;  4O8U A;  3HVR A;  1V4T A;  2KZZ A;  3RMB A;  1U04 A;  3W3D A;  1OH7 A;  5E26 A;  5GAH P;  3LZI A;  2YKM A;  1NGC A;  2P5G A;  4DV4 K;  3THX A;  3UIQ A;  1EKE A;  3T3F A;  3KK7 A;  3VEN A;  3HXM A;  5BPL A;  3L2Q A;  2QW9 A;  4C8M A;  2E88 A;  2DY4 A;  4CVN E;  4DF8 A;  4MDA A;  3CME N;  3OYI A;  4ID5 A;  3RMA A;  2YNI A;  3NAE A;  1JLE A;  3CCU N;  4FLV A;  2D0O A;  3GDQ A;  3VPZ A;  4ZTJ A;  1VSE A;  1JCG A;  4JHD A;  1JXB A;  4FVM A;  1JCF A;  1BQM A;  4F2R A;  1BL3 A;  3R6M A;  4DU4 A;  4CBX A;  2FBY A;  2DFE A;  3SBT A;  3NFA A;  1T6C A;  4FWQ A;  4CEB A;  2F4V K;  1D4X A;  4FZZ A;  1QZ5 A;  3ATV A;  1M90 O;  4F4K A;  1MA9 B;  4KKO A;  3CCS N;  3KD1 E;  3CQY A;  1VRU A;  1ZBU A;  1JLF A;  1RNH A;  1MWK A;  4FWN A;  4RW7 A;  3S3N A;  5M1F A;  1L3S A;  2CGJ A;  3LP0 A;  5F0X A;  1XNQ K;  3PLA A;  4BGA A;  2ZM6 K;  1MWM A;  1ASV A;  1CZB A;  3FZL A;  3LWM A;  4FJ7 A;  2Q1N A;  1K9M O;  1C6V A;  5CHI A;  1YI2 N;  2Z1G A;  4CEZ A;  3CCE N;  2XO7 A;  1VQM N;  4IO9 L;  3BZK A;  3QFU A;  3KLH A;  4A2A A;  4JRP A;  1RGI A;  4EAH D;  4LSL A;  3MCA B;  3HK2 A;  1X3M A;  3SUP A;  1KLM A;  4OKJ A;  3OS1 A;  4CD1 A;  4CGG A;  4KI6 A;  1WN7 A;  3TAQ A;  3E9L A;  3I0S A;  4JKG B;  3ZSO A;  1YHQ N;  2BUP A;  3WXI A;  3AVK A;  1HKB A;  3VQ4 A;  1BCO A;  2O8C B;  2HHS A;  4X62 K;  1TAQ A;  1GLL O;  3DLH A;  3CCV N;  4FJI A;  1YTA A;  4CF0 A;  4B8C A;  4LSN A;  4BE1 A;  5AQN A;  3TPQ A;  3MK6 A;  2KFN A;  1K8K B;  1TL3 A;  3AA5 X;  3THY A;  1RBT A;  3LDQ A;  5AQQ A;  4DV5 K;  2X6S A;  4WQ4 A;  4EHU A;  1RTD A;  4H5R A;  5EU7 A;  2V52 B;  4Z0U A;  1GOC A;  4KHW A;  4BRE A;  5C25 A;  1KTQ A;  2ZGZ A;  3NH0 A;  4Z4E A;  3AVB A;  3QER A;  3CXC M;  4IEI A;  3MCP A;  4XH1 A;  3WT0 A;  2G8K A;  5EVZ A;  4KHU A;  2E4L A;  4DTO A;  3VQ9 A;  3VQ7 A;  3WNF A;  3QNO A;  2B6A A;  4CJE A;  5HOO A;  3CJC A;  1BIS A;  3J7A P;  1A5X A;  5AQZ A;  4I7F A;  1QVF M;  2IAJ A;  4H4O A;  3SMS A;  4EFH A;  1W9H A;  1NGH A;  3LM2 A;  2VG5 A;  2IVN A;  3PX0 A;  4CK1 A;  4FCY A;  2D0P A;  1I94 K;  1K6Y A;  4NCA A;  2AP1 A;  3SQ0 A;  1QQO A;  5GAE P;  3NCI A;  4H0O A;  3WXL A;  4FWL A;  3VQC A;  3WEE B;  4YOW A;  1WNS A;  4N76 A;  4EHT A;  1QE1 A;  2IIR A;  3ZX2 A;  1SV5 A;  1F21 A;  4B9M A;  4GV6 A;  4OKK A;  2F96 A;  2P9U B;  2E2Q A;  3HP9 A;  2PY5 A;  2O8B B;  4DSJ A;  3FZK A;  2P9S A;  1J54 A;  2BE2 A;  3WQT A;  2E5L K;  1X1P A;  3S41 A;  2Q2R A;  2EX3 A;  4NYN A;  3L3V A;  2HHV A;  1ZBS A;  3AVN A;  4BWJ A;  5BRH A;  5GAG P;  3RSE A;  2UU9 K;  2A40 A;  5CY4 A;  4H0Y B;  1JLQ A;  2Q36 A;  3CET A;  4DV0 K;  2V7Z A;  1YJN N;  1VQ7 N;  4B9V A;  2WTU A;  1HUX A;  4NB4 A;  4E3S A;  3K57 A;  3OYF A;  4PL8 A;  5ADX H;  3D7E O;  4FVU A;  1QS4 A;  3QEW A;  2IC3 A;  5AZJ A;  2YHY A;  1SL0 A;  2RPI A;  1IO2 A;  3DI6 A;  4AHC A;  1QTM A;  4BRP A;  1HNX K;  4H5W A;  3UE5 A;  4DCH A;  1EQY A;  1W7A A;  4KI4 A;  1FJG K;  4KH5 A;  3EY1 A;  1VSK A;  2DTU A;  3FFI A;  4E7I A;  1QQC A;  3MEG A;  4DSK A;  1REV A;  3CQX A;  3Q7C A;  5HRP A;  1QZ6 A;  3UKR B;  1HPM A;  3THV A;  2HST A;  5I3U A;  3CC4 N;  2NZT A;  1VQ8 N;  4FJJ A;  4QS7 A;  4I6M B;  3AVH A;  3A5L C;  4U7B A;  1QQM A;  1BCM A;  1VAZ A;  3CJA A;  1NKC A;  3AVC A;  4BC3 A;  3E9O A;  3FZF A;  3S3M A;  1X9M A;  1W2B M;  4BDZ A;  3G0Z A;  4C1N K;  2P5O A;  4BWM A;  1BIZ A;  1N5Y A;  3TAG A;  4JI8 K;  3TSU A;  1KCF A;  4AH9 A;  4DFP A;  2GEL A;  2D1K A;  4BRG A;  4CF9 A;  4FJH A;  3TAF A;  1X3N A;  2VYP A;  3CPE A;  3O9S A;  4Z4I A;  1VQN N;  3QET A;  1S9G A;  1DKG D;  2O8D B;  2FSK A;  4DR6 K;  1BDG A;  4DG1 A;  3OBW A;  1HYS A;  3O1W A;  3C6A A;  1ZC6 A;  3K58 A;  5E41 A;  3AO4 A;  4FJN A;  4M3T A;  1B9F A;  1HNV A;  1VSL A;  3NMU A;  1BHL A;  3D45 A;  5CZ2 A;  3AY9 A;  1LW2 A;  1BA1 A;  1H1V A;  4W5R A;  2D4W A;  2VWK A;  4M3W A;  3O4W A;  1ATS A;  3CFR A;  4FM0 A;  1S22 A;  4YOR A;  1ZBL A;  2O8E B;  4N56 A;  3KK2 A;  4F3T A;  3KJV A;  4N5S A;  5FPD A;  1YUW A;  2PBD A;  4IDK A;  4IKF A;  1JJ2 M;  5GAD P;  1IV0 A;  1OH5 A;  5GIP A;  2UXB K;  2QTD A;  4FLY A;  3QML A;  1VK0 A;  2YHA A;  3CJ9 A;  3TTD A;  4CZG A;  4IJN A;  3HPH A;  1MU2 A;  3O3H A;  2HHW A;  4W5Q A;  1J9A A;  2ITM A;  4O5B A;  2Q3S A;  4Q0B A;  1SKW A;  2E2N A;  3DRP A;  2Q0U A;  5HBM A;  3FGU A;  2W40 A;  3AA3 A;  4CJV A;  5CYQ A;  1WB9 A;  3A5O C;  4AQY K;  3C6H A;  3OYD A;  1TYQ B;  3M3Z A;  3CYM A;  4O5F A;  4DTS A;  1WAJ A;  4H5N A;  3WQU A;  1UWB A;  1NU0 A;  1YAG A;  1YVN A;  3LPU A;  3VGM A;  2AJQ A;  3ZET A;  4JI5 K;  2A5X A;  4A5B A;  4DS5 A;  3ZSX A;  5TKY A;  2W6K A;  1NK6 A;  3OW2 M;  3QNN A;  3CG7 A;  1E4G T;  1ZBH A;  4JYA K;  3F9K A;  4IFE A;  4BVP A;  3VQE A;  1KFD A;  2O4I A;  1X9S A;  2WC9 A;  2HBK A;  3OYC A;  5LMN K;  3MEE A;  3VET A;  4DSF A;  2FXU A;  3P1G A;  1S72 N;  1SKS A;  4J8F A;  4QOZ B;  3ATU A;  2RE2 A;  2P9L A;  3VQD A;  3P39 A;  5J2N A;  4ILH A;  4DB3 A;  4DV3 K;  4KRF A;  3D0P A;  4BQL A;  1VQK N;  3O9U A;  2GX9 A;  3ZSZ A;  3GBT A;  3VGL A;  1TKZ A;  2QWP A;  4AHR A;  4NYF A;  4CEQ A;  3DJC A;  3DMJ A;  1C1B A;  2QM1 A;  3LP3 A;  4CIF A;  4DV1 K;  1BUP A;  4JHD B;  5C24 A;  3TSP A;  2QK9 A;  3NVK A;  1TK5 A;  4K8Z A;  1VQO N;  3MEC A;  3I8D A;  1S3X A;  3H1Q A;  1KLN A;  3IG1 A;  2LSN A;  4BC5 A;  1NGA A;  2P1J A;  3SPY A;  3PO5 A;  3GL1 A;  2I7P A;  5F1X A;  3DXK B;  4EZ6 A;  4PKI A;  4RTF D;  4JN4 A;  3EKU A;  4A62 A;  1C0G A;  1I39 A;  5CR4 A;  1XUP O;  4CGI A;  1XMQ K;  4LFB K;  3CHW A;  1VRT A;  4FWM A;  2QWO A;  3OBY A;  4RW6 A;  4CHN A;  1D8Y A;  3HZ6 A;  4J2E A;  1C1A A;  4PWD A;  3IUC A;  3H3O B;  4H0V B;  3ZSY A;  3F5T A;  1VQ6 N;  1Q82 O;  3U9Z A;  5MLC Q;  3SNN A;  3N4Q A;  1CZ9 A;  4WCE L;  4M63 C;  3H46 O;  3WNH A;  4DQQ A;  1HYV A;  3CI5 A;  1T8E A;  3QIC A;  4JI4 K;  3K5O A;  2ASP A;  2WBN A;  3ZSQ A;  5AQJ A;  2O4G A;  1KAZ A;  4CFD A;  5BRD A;  1HNZ K;  4BC2 A;  3L2R A;  4BRO A;  4XIU A;  4OVL A;  3K9J A;  3AVG A;  2P51 A;  3OYG A;  1WLJ A;  4FLU A;  1NLV A;  5AQV A;  4J2B A;  5KRS A;  2KW4 A;  3VF2 A;  4CGF A;  3BZC A;  4CF8 A;  3K5L A;  1KC8 O;  3DLB A;  3T1A A;  1NJZ A;  4OLA A;  2HBM A;  3ASM A;  4BRA A;  1D9F A;  2BDP A;  5FPM A;  3VTH A;  3CCJ N;  4FM2 A;  2HBL A;  3QO9 A;  3THY B;  1FXX A;  1K73 O;  4MQ3 A;  3SAG A;  4DUY K;  2EWS A;  3CJ1 A;  5E84 A;  3J7Z O;  1L3U A;  1OKJ A;  5C15 A;  1WBD A;  1GOA A;  2ZQB A;  4H0X B;  4B08 A;  4MDB A;  5BRF A;  2YHW A;  3SBG A;  3HRG A;  3ZT0 A;  4KTQ A;  1IBM K;  1HQU A;  4YOY A;  2E20 A;  1ASU A;  4F2S A;  4FLT A;  3J8A A;  4BDY A;  1GLE G;  4RW9 A;  1XMO K;  3N4P A;  1NK4 A;  2HF3 A;  1BQN A;  1SS6 A;  4DTN A;  4NO7 A;  4DQS A;  1YT3 A;  4JAX A;  5C42 A;  5AQP A;  1XHX A;  4K43 A;  3EEQ A;  3NF6 A;  3CFO A;  3P4I A;  5AQH A;  4CZE A;  1DTQ A;  3HSC A;  4CGJ A;  3V1O A;  4CJ3 A;  1HKG A;  5AFU H;  3MED A;  3A5M C;  2P9K A;  4H0T B;  4JK7 A;  3OHR A;  4A57 A;  1B92 A;  3BGR A;  3M1F A;  1LWF A;  3KLE A;  3AVJ A;  1IKY A;  4DU1 A;  2VQF K;  5J1E A;  1A5W A;  5KPT A;  2GBZ A;  5KGX A;  3LL3 A;  3M6G A;  2VWB A;  1LWE A;  4H8K A;  4CIE A;  3OYJ A;  1IKW A;  3IDH A;  2ETJ A;  4CJT A;  2B5J A;  4X66 K;  1ATR A;  5C10 A;  4BY9 C;  3RSE B;  3VTI A;  1DT9 A;  4Z94 A;  2IS3 A;  3OYA A;  1BG3 A;  3QIO A;  3O3F A;  2NRV A;  2W6L A;  1P8Z A;  2HNY A;  3KVG A;  3LAM A;  3TTC A;  4K25 A;  4DLG A;  1FK9 A;  3EN9 A;  2Y1J A;  3I55 N;  4OPK A;  2F8T A;  5AZJ B;  3LP2 A;  3AO1 A;  2Y1I A;  2HVI A;  5JLH A;  3M8Q A;  4W5O A;  1S6Q A;  4CZJ A;  4PY5 A;  3NE6 A;  4BRQ A;  1ITG A;  4TSX A;  1QHT A;  4O55 A;  4BRH A;  1RTH A;  3OYN A;  1G15 A;  3T1Y K;  3NGY A;  4WF9 L;  4FK0 A;  3DXM A;  4JKD A;  1VSF A;  3DLE A;  4JRQ A;  2AA4 A;  3SUO A;  4FPB A;  1S1X A;  2XHB A;  4FYD A;  4JKH A;  3CCR N;  1WSE A;  1LAW A;  1TUY A;  4IXC A;  4JI1 K;  3DLK A;  4RG8 A;  3P38 A;  3EL2 A;  4FXD A;  5BRE A;  4CJ4 A;  4DR2 K;  3QIP A;  2FC0 A;  3V9S A;  2PYL A;  2X78 A;  2XY5 A;  2KTQ A;  3BF1 A;  3OJU A;  4WFB L;  2UUB K;  4DKW A;  4HUF A;  2OTJ N;  4B1Z A;  5M1Q A;  3PX6 A;  2P9P A;  4DTX A;  2E6M A;  3J81 O;  1TKD A;  3SLC A;  1N6Q A;  1UA1 A;  1E3M A;  4BR5 A;  3EO3 A;  1P90 A;  2JWK A;  2HNZ A;  5FRM A;  3M5R A;  4HTL A;  1QSS A;  1WOQ A;  1VSH A;  4KV8 A;  1RT6 A;  3UKU A;  1IBL K;  1EWR A;  3DLL L;  3AA2 A;  4FSV A;  4FJK A;  4FJX A;  5EOY A; 
#chains in the Genus database with same CATH homology
 4DF4 A;  1BCM A;  3VQ8 A;  1KVB A;  1VSD A;  3B6P A;  1EXQ A;  1Z25 A;  2RF2 A;  1NKC A;  1WSJ A;  3M8S A;  1D9D A;  4KB0 A;  4C8L A;  3AVC A;  3AVF A;  2VWJ A;  2OPR A;  1RCH A;  3S3M A;  1X9M A;  2HHX A;  4B8A B;  2YNH A;  3CFP A;  4BDZ A;  2IOC A;  3C94 A;  4ZHR A;  3G0Z A;  4FK4 A;  2P5O A;  4BWM A;  4W5N A;  3RRH A;  1O1W A;  1BIZ A;  2JGU A;  3TAG A;  1B9D A;  3DRR A;  1ZYQ A;  1TV6 A;  1KCF A;  1N5Y A;  2HW3 A;  4AH9 A;  4BE0 A;  3VN5 A;  2X6N A;  4HUG A;  4DFP A;  3BDP A;  2HHT A;  4CF9 A;  3TR8 A;  1NKE A;  4FJH A;  3TAF A;  5JS1 A;  3VQA A;  3L2U A;  3CQ8 A;  4IG0 A;  4PA1 A;  3RRG A;  2YNF A;  5HP1 A;  3V6D A;  4Z4I A;  3LAK A;  1A5V A;  2OPP A;  4DTP A;  3NGZ A;  3PO4 A;  4CCH A;  2D0A A;  3QET A;  1S9G A;  4OKE A;  1NK7 A;  3RR7 A;  1ZBF A;  4E19 A;  3WNG A;  1TKX A;  3KLG A;  3HP6 A;  1SKR A;  3V1Q A;  2YNG A;  4E7H A;  4DG1 A;  4CGH A;  3L2V A;  4FZY A;  2G8I A;  4HHT A;  1HYS A;  1S1W A;  3OS2 A;  1YVU A;  1NJX A;  3ZCM A;  3L3U A;  3K58 A;  5E41 A;  3AO4 A;  4LH5 A;  4FJN A;  2RN2 A;  1R0A A;  2PZS A;  4M3T A;  1B9F A;  2FBX A;  3QEX A;  1HNV A;  3ZT2 A;  4CIG A;  3F73 A;  1U47 A;  3CM5 A;  1VSL A;  2QXF A;  4I9Q A;  4OGC A;  1BHL A;  3KK1 A;  1LAV A;  3D45 A;  4KO0 A;  5CZ2 A;  3EYZ A;  1T03 A;  4DTU A;  3O4N A;  4KTW A;  4CES A;  1LW2 A;  2ATQ A;  4KHY A;  4CF2 A;  4W5R A;  2VWK A;  4M3W A;  2OYQ A;  3QIN A;  4CJS A;  3CFR A;  4FM0 A;  4O44 A;  1S1U A;  4CJW A;  1ZBL A;  4N56 A;  3KK2 A;  4HTU A;  4F3T A;  2DFH A;  5J2M A;  3KJV A;  4N5S A;  4O0J A;  1JKH A;  4ELV A;  4M42 A;  4E0D A;  1JLB A;  3C95 A;  2IDO A;  1SUQ A;  4IDK A;  4IKF A;  3LZJ A;  3E01 A;  3OVN A;  1XI1 A;  3HL8 A;  4CED A;  4FLY A;  1QSY A;  1IKX A;  1RT3 A;  1XWL A;  3VQB A;  1VK0 A;  1KVC A;  2YHA A;  4AHS A;  4J2D A;  4FJG A;  4ZTF A;  5SWM A;  3VQ6 A;  4FJM A;  3HPH A;  2E6L A;  1MU2 A;  1ASW A;  3NBP A;  3O3H A;  4E7J A;  3HO1 A;  2HHW A;  5DK5 A;  4W5Q A;  3MXM A;  2XY6 A;  4ICL A;  3SI6 A;  1J9A A;  4O5B A;  2Q3S A;  4Q0B A;  3DYA A;  1SKW A;  4J2A A;  3DRP A;  4Z4G A;  1RBR A;  5HBM A;  1KVA A;  1SL1 A;  3KLF A;  3AA3 A;  4CJV A;  5CYQ A;  3HT3 A;  1S6P A;  4PQU A;  3SQ1 A;  3OYK A;  4CGD A;  4CJQ A;  5KTQ A;  3OYD A;  4CJ5 A;  3AA4 A;  3WNE A;  3K59 A;  2ZE2 A;  3OYL A;  3U6F A;  3V81 A;  2ITG A;  4M41 A;  3ZT4 A;  3CYM A;  3V9X A;  4DTS A;  4DS4 A;  3OJS A;  4HUE A;  4FLZ A;  1WAJ A;  2EHG A;  3LPT A;  1UWB A;  3U3G A;  4FK2 A;  2G8U A;  4E7L A;  3LPU A;  3S9H A;  2AJQ A;  4DFM A;  3RMD A;  1XHZ A;  3DOL A;  3NH2 A;  3OY9 A;  4DFK A;  1XC9 A;  1RDA A;  4DS5 A;  3ZSX A;  1NK6 A;  1Q9Y A;  4B9T A;  3QNN A;  4Z4C A;  3CG7 A;  4M3X A;  3KLI A;  5KGW A;  3QEV A;  1DTT A;  1TK8 A;  2G8F A;  1ZBH A;  1S9E A;  3F9K A;  3OYM A;  1HRH A;  1RBU A;  4FW1 A;  1JLC A;  3PUF A;  1KFD A;  3VQE A;  3V9Z A;  3AO5 A;  4F3O A;  1X9S A;  4B9S A;  2O4I A;  4LH4 A;  4KHQ A;  4ELU A;  3M8P A;  5HRS A;  4CFB A;  3OYC A;  3ZT1 A;  2JLE A;  3MEE A;  4CHP A;  4DSF A;  4I2P A;  4M3Y A;  3P1G A;  1RIL A;  1IKV A;  1SKS A;  3NHG A;  2B4J A;  1C1C A;  1NJW A;  4QOZ B;  2KZM A;  4JS4 A;  3IS9 A;  4JLH A;  3K5N A;  1NK5 A;  3B6O A;  3VQD A;  3TAB A;  5J2N A;  4PUO A;  3RMC A;  4Z4F A;  4MFB A;  1U45 A;  4DU3 A;  3NF8 A;  4KRF A;  1BIU A;  3D0P A;  4GW6 A;  3AVM A;  4LD0 A;  1NOZ A;  3ZSZ A;  1EET A;  1VSJ A;  5CYM A;  2KQ2 A;  4DTJ A;  4L8R B;  1TKZ A;  4AHR A;  4NYF A;  3LDS A;  4DLE A;  4FM1 A;  4CEQ A;  4CHZ A;  3DMJ A;  2IGI A;  4CHQ A;  1C1B A;  2I5J A;  3LP3 A;  4CIF A;  4FW2 A;  5C24 A;  5FRN A;  3MAQ A;  4CJL A;  2QK9 A;  4FJ5 A;  3TI0 A;  1TK5 A;  4K8Z A;  3MEC A;  3I8D A;  4O0I A;  3ULD A;  3OYH A;  3SZ2 A;  3T19 A;  3EZ5 A;  4ELT A;  3QEP A;  3AVA A;  3TAP A;  4LY7 A;  4ID1 A;  1KLN A;  3IG1 A;  2LSN A;  4OGE A;  1UOC A;  1RT2 A;  2HHQ A;  4BDP A;  2P1J A;  2XY8 A;  1WSH A;  3LAL A;  3SPY A;  2BGG A;  3PO5 A;  1S1V A;  4NCB A;  3IRX A;  1RTI A;  4HCB A;  1NK8 A;  4EZ6 A;  3SYZ A;  1RTJ A;  3HPO A;  1I39 A;  2D0B A;  3ITH A;  2YKN A;  2D0C A;  4EP5 A;  4CGI A;  1IG9 A;  3KKR A;  2G8V A;  2KZZ A;  1JL1 A;  3G10 A;  1VRT A;  3HVR A;  4HCC A;  4RW6 A;  3ALY A;  3ZT3 A;  4CHN A;  3RMB A;  1D8Y A;  4B9N A;  1C1A A;  1U04 A;  4J2E A;  4PWD A;  3LZI A;  1U49 A;  3ZSY A;  2YKM A;  3DRS A;  2P5G A;  1RDB A;  5FRO A;  4KAZ A;  4M3R A;  3UIQ A;  1EKE A;  3T3F A;  4CEC A;  4DSI A;  4Q5V A;  3HXM A;  4DQI A;  3SQ4 A;  3L2Q A;  4CK2 A;  3SNN A;  4E1N A;  1CZ9 A;  4C8M A;  2ZD1 A;  4QCL A;  2DY4 A;  1WSG A;  1RDC A;  2DFF A;  4DQQ A;  3WNH A;  1QSL A;  1HYV A;  4DF8 A;  3LAN A;  1T8E A;  2GV9 A;  3OS0 A;  3OYI A;  1RT1 A;  4ID5 A;  1UA0 A;  3K5O A;  3RMA A;  1RBS A;  2YNI A;  3NAE A;  3AVI A;  3OYB A;  3ZSQ A;  1JLE A;  4FLV A;  1KFS A;  2O4G A;  1S1T A;  3JSM A;  4CFD A;  1Q8I A;  3ZSV A;  4CJF A;  3SUN A;  4ZTJ A;  1VSE A;  3L2R A;  4K8X A;  1JXB A;  4CEE A;  3P5J A;  4YNQ A;  4FVM A;  2OPQ A;  3MXJ A;  1KRP A;  1BQM A;  4BAC A;  4XIU A;  4F2R A;  1HQE A;  4CF1 A;  4OVL A;  1BL3 A;  3KKS A;  1JLG A;  4DU4 A;  3AVG A;  2P51 A;  3OYG A;  2FBY A;  1T05 A;  2DFE A;  1WLJ A;  4FLU A;  3NFA A;  3SQ2 A;  4AHT A;  4CEB A;  5KRS A;  2KW4 A;  3DLR A;  4GVM A;  4J2B A;  4FZZ A;  1WAF A;  4CGF A;  3AO2 A;  4CF8 A;  3V1R A;  5HRN A;  3K5L A;  1U4B A;  3M8R A;  4KTZ A;  4E89 A;  3DLB A;  3T1A A;  1TGO A;  1NJZ A;  3TAN A;  4OLA A;  1X9W A;  2YV0 X;  3KD5 E;  3C6T A;  4F4K A;  4KKO A;  3ASM A;  1D9F A;  3KTQ A;  2BDP A;  3KD1 E;  1FKP A;  1VRU A;  1ZBU A;  4FM2 A;  1JLF A;  1RNH A;  3QO9 A;  1FXX A;  4MQ3 A;  4WE1 A;  1NK9 A;  1UAX A;  1C0T A;  1BGX T;  4RW7 A;  4IG3 A;  4DFJ A;  3S3N A;  1L3S A;  3LP0 A;  3SCX A;  1L3U A;  5J2Q A;  3QEI A;  1ASV A;  1C0U A;  1CZB A;  3LWM A;  1GOA A;  2ZQB A;  4B08 A;  4FJ7 A;  2OZM A;  2D5R A;  1C6V A;  3SV3 A;  4E7K A;  2Z1G A;  2Z1H A;  4I9L A;  4CEZ A;  3VQP A;  2XO7 A;  3A2F A;  2QKB A;  2FBT A;  3ZT0 A;  1TK0 A;  2WON A;  2YHB A;  1HYZ A;  3HVT A;  2OZS A;  1HQU A;  4KTQ A;  1CLQ A;  4UQG A;  1ASU A;  3KLH A;  3PX4 A;  4JRP A;  1I3A A;  4AHU A;  4F2S A;  4FLT A;  1EX4 A;  4LSL A;  4BDY A;  3HK2 A;  4IBN A;  4I2Q A;  3SUP A;  4RW9 A;  2A1R A;  1KLM A;  4OKJ A;  3OS1 A;  4CGG A;  4KI6 A;  1WN7 A;  4FLX A;  1NK4 A;  5JS2 A;  3TAQ A;  4N41 A;  1BQN A;  2HND A;  5KI6 A;  4DQS A;  3HM9 A;  3I0S A;  1YT3 A;  3QLH A;  3ZSO A;  5C42 A;  4DTN A;  3PV8 A;  3AVK A;  1WSF A;  1XHX A;  2VG6 A;  3VA3 A;  3RR8 A;  2WOM A;  3VQ4 A;  4C8N A;  3ZSW A;  4EP4 A;  1BCO A;  4OPJ A;  4IFV A;  5J2P A;  3HPG A;  4CE9 A;  3ZSR A;  3RTV A;  1TAQ A;  3DLH A;  4KHN A;  2HHS A;  1HPZ A;  1VSM A;  1RBV A;  3NF7 A;  3NF6 A;  1W0H A;  3CFO A;  4FJI A;  1DTQ A;  1RT4 A;  1YTA A;  5T7B A;  3KIO A;  4CF0 A;  4CGJ A;  4B8C A;  4LSN A;  3V1O A;  4CJ3 A;  3ISN C;  4JS5 A;  3MED A;  1CXU A;  4BE1 A;  2G8W A;  4Y1D A;  4HVJ A;  2KFN A;  3V9U A;  1TL3 A;  3AA5 X;  1RT7 A;  1RBT A;  4CER A;  2X6S A;  5K14 A;  4M45 A;  1B92 A;  3BGR A;  1RTD A;  4E1M A;  2KFZ A;  1LWF A;  5EU7 A;  3JYT A;  3KLE A;  2RKI A;  4Z0U A;  3K2P A;  4DSL A;  1GOC A;  3AVJ A;  3RWU A;  4KHW A;  1IKY A;  2VG7 A;  4CHO A;  5C25 A;  1KTQ A;  1S5J A;  4DU1 A;  1YTU A;  4B9U A;  5HLF A;  3L8B A;  5J1E A;  3NH0 A;  1A5W A;  4Z4E A;  3AVB A;  3LWL A;  1Q9X A;  3QES A;  2GBZ A;  1U48 A;  5KGX A;  2HB5 A;  2HHU A;  3VQQ A;  3QER A;  1GOB A;  1TVR A;  1C0M A;  4FJ9 A;  2G8K A;  4KHU A;  2E4L A;  2FBV A;  1LWE A;  4H8K A;  4DTO A;  3VQ9 A;  4CIE A;  3VQ7 A;  3OYJ A;  1IKW A;  1TAU A;  3WNF A;  3QNO A;  2B6A A;  2ETJ A;  4CJT A;  1LV5 A;  4CJE A;  2B5J A;  1HJR A;  2XY7 A;  1BIS A;  4DTR A;  3PY8 A;  3SJJ A;  3HYF A;  2IS3 A;  1A5X A;  3VA0 A;  4I7F A;  3OYA A;  2PYJ A;  3QIO A;  1DLO A;  3HST B;  2IAJ A;  4H4O A;  1TL1 A;  3O3F A;  1W9H A;  1WSI A;  3DM2 A;  4DSE A;  3TAE A;  5HRO A;  4B9L A;  4NCG A;  4RW8 A;  2HNY A;  2VG5 A;  3HJF A;  3LAM A;  1RDD A;  3K5M A;  3PX0 A;  4CK1 A;  4FCY A;  1K6Y A;  4NCA A;  4DLG A;  1RT5 A;  1LWC A;  1FK9 A;  4FZX C;  2Y1J A;  4OPK A;  3P83 D;  4CFA A;  3L2W A;  3SQ0 A;  2F8T A;  1CXQ A;  3NCI A;  2Z1J A;  1JLA A;  5CZ1 A;  3LP2 A;  4KFB A;  4IFY A;  4N47 A;  3O3G A;  4OJR A;  3LP1 A;  3KK3 A;  3VQC A;  3AO1 A;  4FJL A;  1WNS A;  2Y1I A;  1JL2 A;  4N76 A;  1ZBI A;  4B3O A;  3M8Q A;  2HVI A;  1NKB A;  4W5O A;  1S6Q A;  1L5U A;  2G8H A;  2F8S A;  4PY5 A;  2HVH A;  3C6U A;  3AVL A;  3NDK A;  3NE6 A;  2HMI A;  4OLB A;  3TWH A;  1QE1 A;  2R7Y A;  4G1Q A;  4KHS A;  1JXE A;  1ITG A;  1SV5 A;  1F21 A;  4B9M A;  4C8K A;  1Y97 A;  4OKK A;  1HMV A;  2F96 A;  4KRE A;  4TSX A;  3HP9 A;  1QHT A;  4O55 A;  1RTH A;  1Z26 A;  2PY5 A;  4DSJ A;  1FKO A;  3OYN A;  1J54 A;  2BE2 A;  3MXI A;  3V4I A;  1G15 A;  3TAR A;  3SV4 A;  4EZ9 A;  1TKT A;  3SPZ A;  1NOY A;  4DWI A;  4M3U A;  5SZT A;  1BI4 B;  4BE2 A;  1X1P A;  3NGY A;  4GMJ B;  4RW4 A;  4CK3 A;  4FK0 A;  2EX3 A;  1VSF A;  4Y1C A;  3DLE A;  2W42 A;  3NGI A;  3IAY A;  4NYN A;  4JRQ A;  3V9W A;  3CM6 A;  3SUO A;  3L3V A;  4O4G A;  2A1S A;  4CJR A;  4KPY A;  2HHV A;  3AVN A;  4BWJ A;  2BAN A;  4KB1 A;  4FLW A;  4R5P A;  4YFU A;  1S1X A;  3DLG A;  2XHB A;  3OYE A;  3DOK A;  4FYD A;  5CY4 A;  1WSE A;  1JLQ A;  1VSI A;  2XRI A;  2NUB A;  5DMR A;  5I42 A;  1LAW A;  4DQR A;  1NK0 A;  3DLK A;  4RG8 A;  4FXD A;  4B9V A;  1IH7 A;  4CEA A;  4AIL C;  4CJ4 A;  4Z4H A;  4FJ8 A;  5FDL A;  4E3S A;  3QIP A;  3K57 A;  2FC0 A;  3V9S A;  3OYF A;  2QKK A;  1T7P A;  2PYL A;  2X78 A;  4H4M A;  2XY5 A;  3S3O A;  4CEO A;  1SL2 A;  3AV9 A;  3OJU A;  1QS4 A;  2KTQ A;  2OA8 A;  3QEW A;  5D3G A;  3NH1 A;  2IC3 A;  1J5O A;  4CJK A;  2Z1I A;  1SL0 A;  2X74 A;  4DMN A;  2RPI A;  1IO2 A;  3DI6 A;  4HUF A;  4CEF A;  4AHC A;  1QTM A;  3H08 A;  3VQ5 A;  5KRT A;  3U3Y A;  3AO3 A;  3PX6 A;  1LW0 A;  4DTX A;  1L3V A;  4KI4 A;  2E6M A;  4W5T A;  4QAG A;  3EY1 A;  2DTU A;  1EP4 A;  1VSK A;  2OPS A;  1TKD A;  3FFI A;  4E7I A;  1QQC A;  3MEG A;  4DSK A;  1REV A;  1UA1 A;  1N6Q A;  1J53 A;  1HNI A;  3I0R A;  3O4Q A;  1NJY A;  3TAM A;  5HRP A;  1KSP A;  4M3Z A;  3NF9 A;  1L3T A;  4DTM A;  3THV A;  2HNZ A;  5FRM A;  5I3U A;  1BI4 A;  2GUI A;  4FJJ A;  1D5A A;  1QSS A;  1VSH A;  4KV8 A;  1RT6 A;  3SUQ A;  3AVH A;  4CHY A;  4DQP A;  3AA2 A;  4F8R A;  4CFC A;  4AHV A;  4C8O A;  5HRR A;  4FJK A;  4CJP A;  4FJX A;  4CJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...