1RDQE

Hydrolysis of atp in the crystal of y204a mutant of camp-dependent protein kinase
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
350
structure length
340
Chain Sequence
GNAAASVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEALAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
publication title Crystal Structure of a cAMP-dependent Protein Kinase Mutant at 1.26A: New Insights into the Catalytic Mechanism.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 109
structure length 340
sequence length 350
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2003-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1rdqE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1rdqE02
3ELJA 2ITNA 4ACDA 4C2VA 3HP2A 4CRSA 3UOHA 4CFFA 2F49A 4FG9A 4JT3A 4U80A 1MRUA 1XBAA 4WNKA 4C36A 4I1ZA 5CX9A 4BCIA 5K0XA 3RPRA 3MSSA 4BRXA 3PFQA 4TYGA 5T68A 3UVQA 4FL3A 4WO5A 5C01A 1Y6BA 1TQPA 2WQOA 1H08A 1YXXA 1RW8A 3EN7A 1GAGA 2XS0A 3GBZA 2JAVA 4JDHA 4AN3A 3SKCA 4Y5QA 4U9AA 4LGDA 2ITZA 4W4XA 3E8NA 2H6DA 3MB7A 2WEIA 4Y73A 4RA4A 4UZDA 4Y46A 1BI8A 4FOCA 5EI8A 3R9HA 2GNJA 4XNEA 4CMTA 4C35A 4GT3A 3QQKA 4E7WA 3R9RA 5HZNA 1VYWA 2B9IA 2ZV2A 4G6NA 4RIXA 3LXNA 2VO6A 4CFVA 1ATPE 5HVKA 4IC7A 2PULA 3DBEA 2HOGA 5LQFA 2REIA 2VTNA 4JBPA 3Q4UA 1LUFA 3DK7A 3CJFA 4N4SA 2GQGA 4BCGA 2X81A 4L44A 1CDKA 4H3PA 4RX7A 3D94A 2B0QA 3GQLA 3P7AA 1P4OA 2ZVAA 4BI0A 2LAVA 3UE4A 2A1AB 4O21A 3LMGA 4X2JA 5A6NA 5E8WA 4BBFA 5IISA 2PUIA 4DH3A 1H07A 3DLZA 4AS0A 5CVFA 2CCIA 2WMTA 2BDWA 4CZTA 5A4EA 1Q8UA 2RFSA 3QF9A 2I0HA 4QP3A 2X6DA 2BRHA 1QPEA 1FGIA 4AFEA 4IAAA 2OF4A 5FP5A 4NM0A 5KKRC 2YA9A 3EQIA 3BHHA 2BHHA 3VJNA 4ANNA 2OO8X 4FV3A 5KUPA 1DI8A 3Q9ZA 3ORNA 4CFWA 2EXEA 4JIKA 3DAEA 1B39A 2Y4IC 4V0GB 2ZB1A 2YM7A 3N51A 5DR2A 3Q04A 5JGAA 5EOBA 4AT4A 4FTLA 4IQ6A 2E9OA 1ZY5A 5GJDA 4CFMA 1IR3A 3O71A 4AGUA 1Q8WA 4NFMA 5FLFA 4IWPA 3II5A 2BZHB 2O0UA 2QO9A 4UWCA 4FSRA 5CU4A 3MFSA 2BIKB 1WFCA 3BLRA 4FIJA 2VZ6A 3ID6C 3ORMA 3UG2A 2ITWA 4J7BA 3CLYA 1OPKA 4YO6A 1NXKA 2BR1A 2XB7A 3OEZA 2VU3A 3WF9A 4GU9A 4O0XA 4M69A 1PF8A 3CIKA 2GTNA 4FIIA 4APCA 4ZIMA 4L67A 2BZJA 4O0VA 4KBCA 4ONAA 3DK6A 2BFYA 4FV1A 4NKSA 3ZFMA 3VNTA 4AAAA 3F2NA 3CJGA 3PRFA 2Y4PA 4IM3A 2IWIA 2V0DA 3G15A 5KMIA 3T3VA 1CSNA 1YOLA 2XNNA 3HV7A 4KKHA 4FTAA 4XBUA 5D7VA 3AOXA 5BUJA 1H28A 4H05A 4TYJA 3BLQA 3BYUA 3KVWA 4NH1A 5HD4A 2PVHA 3PJ8A 3PLSA 5FTQA 4L42A 5JRSA 2VD5A 4IVBA 2CNQA 4FIFA 1TQIA 3VS1A 1VR2A 4FTNA 2OJGA 4X6RA 4XBRA 4MXXA 5C03A 4GK3A 4RFZA 5AM6A 5LMAA 3HECA 4CKRA 2WTJA 4PNIA 4ZJVA 4WNOA 3PA4A 4J1RA 2QOHA 5IUIA 5KMKA 4H36A 5AR2A 5M53A 5GNKA 4AT3A 3OROA 2CKEA 5J9LA 2XBAA 5CZHA 5AIRA 3S00A 2UW3A 5JH6A 3IONA 4X3FC 4O0UA 5L6OA 1OL2A 2C0TA 1JKLA 5KNJA 3O8TA 4JQ8A 4BDJA 2CLXA 2BVAA 3VUDA 4E73A 2R3KA 4DLJA 3F3WA 3EQDA 3Q60A 4GT4A 3Q52A 2XK4A 2PUUA 2GHLA 1B6CB 3GFWA 3E93A 4S2ZA 1JSUA 4I21A 4IM0A 3OT8A 3NAXA 3F69A 1IRKA 5HLPA 5IEVA 4G5PA 3QA0A 4EH6A 4LOPA 5E1SA 4CEGA 5AR5A 1IASA 3TACA 3WE4A 4XH6A 4CMOA 3OTUA 5AA8A 3ATSA 3WBLA 4D2TA 4LM5A 2FGIA 1WVXA 2B9JA 1URCA 3FI3A 3MYGA 5C4KA 4HW7A 4ERKA 2PZ5A 2R64A 2EXMA 3BLHA 4YJQA 5HTBA 3EIDA 3DBDA 4AGWA 4EK3A 4IB5A 5M07A 2OXXA 3NIZA 4XMOA 2PVYA 3SOAA 2UZLA 3WYXA 3EZRA 4RWLA 4YJTA 2CKOA 3CTQA 5AA9A 3LFDA 2X39A 5AAFA 2JITA 3VS2A 2J9MA 4K1BA 4R7IA 2W5HA 4IAZA 5JEBA 3C5IA 4HVSA 2GNHA 3LFNA 5CEPA 4OTQA 3QA8A 2WIHA 4UWYA 3OG7A 3EQGA 2WMBA 3L9PA 2HYYA 3DKGA 3MPMA 1ZYLA 2QLQA 3NLBA 2ITVA 4CFXA 3P7BA 1GZNA 2VO3A 3F7ZA 2BKZA 4I5PA 4FKWA 5EYDA 5GIOE 1Q61A 1REKA 3POOA 4G3DA 5AV2A 3VS4A 5BUIA 4DH5A 5CI7A 3DBCA 2Y7JA 3CQEA 3LAUA 3NW7A 3FC1X 2OFVA 3C4ZA 1JWHA 3TTIA 4U43A 5FUTA 4CFNA 3LIJA 4AZSA 1EH4A 3UJGA 4WG5A 1ZY4A 2RKUA 3FSKA 5CSHA 4O86A 2J90A 2VWIA 2C6MA 5FQDC 4FNZA 4RIXB 3O17A 2OU7A 3COMA 4PMPA 1XH5A 4W4VA 3Q9XA 4WG3A 2RG5A 4NKAA 4PDOA 5TR6A 3QXOA 2X1NA 5AIKA 3ZFYA 3U87A 3O50A 3THBA 2GDOA 4AQCA 2UW4A 4CMUA 5BPYA 4V05A 5JN2A 2PVJA 3TKIA 2JKQA 2UVXA 4BZOA 3UVPA 3ETAA 3CSVA 2XK9A 1UV5A 5L3AA 4CG9A 1OVEA 2UZBA 3R7UA 4JBVA 4OTGA 5B2KA 2XKFA 5L2TA 4NL0A 3PY1A 3V6RA 4G3FA 4F6UA 1U4DA 4FBXA 2YCFA 4CCBA 2CPKE 2RL5A 3PSDA 4AUAA 5K5XA 1VJYA 3GEQA 4R7BA 4HYHA 4C4FA 5EW3A 3GU6A 5AUUA 4EHZA 5EYCA 4A07A 1YWNA 1Q5KA 2ZM3A 3HL7A 4JBOA 5J1VA 4O6EA 1O9UA 1KE7A 1IEPA 2SRCA 1J7UA 3GC9A 4NW5A 3NUYA 2XNPA 3V8SA 4QPSA 5DNRA 5GZ9A 3KN6A 3OS3A 4H3BA 2W05A 3UMXA 3V5TA 1PXJA 2HY81 5JK3A 3BV3A 2VTMA 2W1IA 4KS8A 2PWLA 3MY1A 5FD2A 3AC1A 2PMLX 2QURA 1VEBA 1YHWA 4FKOA 1OL5A 5HE1A 4F7LA 5GZAA 3CY2A 4K6ZA 3EL7A 5IQHA 2R9SA 4TYHB 1ZYCA 4KIPA 3HV5A 4IW0A 2JAMA 4YJOA 4QP7A 1PXLA 4YHTA 3UTOA 1GOLA 2XIKA 5F94A 4GFGA 2IPXA 4BCMA 2VAGA 4QMLA 4ZSAA 4D4VA 4YUQA 3ORPA 1WMKA 5CF5A 3VW6A 3NYNA 3ET7A 5E8XA 2CN5A 5B7VA 3AMBA 3ZBFA 4GUBA 2VV9A 4IANA 4B4LA 3QRUA 3QL8A 4BDKA 3V5PA 4B9DA 3W10A 5HTCA 3V8WA 3PXYA 2I40A 4QP2A 3DTCA 5HIDA 5ACKA 3HYHA 5KCVA 3BHYA 4E4NA 5DBXA 2NO3A 4J8NA 2QOLA 4YPDA 2RF9A 2OKRA 5EI6A 4FV8A 4DHFA 5HO7A 2QOIA 2Y6MA 3P78A 3CTHA 2RIOA 4OBPA 2P3GX 3RWPA 3AD4A 2FSMX 2R3FA 4QTEA 2RFNA 3BGPA 1KV1A 1GIIA 2PHKA 4J98A 3UYSA 5AFVA 3E5AA 1OBDA 1KE9A 4PUZA 4XX9A 5DT0A 2PMOX 2ITXA 1OI9A 3AMAA 4QT1A 4ALVA 4ERWA 2B9HA 4EJ7A 3PPZA 1J3HA 2OZAA 2NP8A 1JSTA 5FEEA 3ZEWA 1BLXA 2NRYA 1KOBA 4KRDA 4O81A 3UOLA 2IW6A 4I20A 5JT2A 4U3YA 3GCQA 3FI4A 4FKLA 4F1TA 3CEKA 1OIUA 4O6LA 3UOJA 2IZSA 5FXRA 3G33A 3KB7A 3VS7A 4LRKA 2VTLA 2ZDUA 2O64A 3GVUA 3NNUA 5FRIA 2VWVA 3KULB 4EH4A 4F99A 4F4PA 4FSQA 2JKOA 1YXVA 3PWYA 4J99A 4O84A 3D9VA 4D2VA 4EYMA 5CVGA 2UW6A 4FSNA 3L8XA 3FHIA 1SYKA 2OK1A 3UPZA 3Q5IA 4YMJA 3RI1A 4HNFA 5CYIA 3MS9A 4YHJA 3LFEA 4QRCA 4LL0A 1Z57A 4YHFA 1P4FA 3Q3BA 4EBWA 2R3PA 3LCSA 2OJ9A 2CKPA 2EB3A 3VQUA 3VBTA 4GU6A 4IVCA 3QX2A 3GCVA 2YCQA 3F5GA 4M97A 4CYIA 3VF9A 4BCPA 2CGUA 4GW8A 4MQ1A 5DEWA 3R8VA 5KMOA 4AOIA 3T8OA 5HQ0A 4C62A 2BILB 4X2FA 4NZWB 4XEYA 1UKHA 1V0OA 3FZRA 1W98A 2YEXA 3NNVA 3GC0A 4GL9A 3NIEA 3PE1A 4KSQA 4BKYA 3GC8A 2QQ7A 2HIWA 3NUNA 4D5KA 1G8AA 4BWPA 3VUHA 3AD5A 3IW8A 4IACA 4OTFA 1W83A 2XKCA 3QWJA 2YIQA 4ZTRA 5AUZA 3TNIA 3TNWA 4GH2A 4YZBA 3FBVA 2HZ0A 5GJFA 1KE5A 2C30A 3C4EA 4IB3A 4KS7A 3ZRMA 4ZZMA 5E8TA 4BGQA 3I0OA 4QMSA 2JLDA 2WEVA 2X4FA 3GB2A 3NYVA 5KX8A 4KD1A 5TKDA 4CCUA 4DEEA 4JG7A 2VWXA 3CTJA 3RK5A 2OIQA 5IA3A 4XS2A 2QCSA 5IA2A 1OECA 4ZJJA 2NPQA 4JRNA 2QG7A 3E7OA 1RQQA 3BE9A 3SHEA 3BWFA 3GU5A 2FSTX 4C4JA 4RC3A 5J8IA 5M57A 3FY2A 4O7WA 5H3QA 3LW0A 5ANJA 3TIYA 4YJSA 4O83A 4BIDA 3HRFA 4D5HA 3NW5A 2P33A 5K9IA 2ONLC 2HK5A 2PE2A 3IW7A 3IOPA 4I0RA 3JVRA 5AR8A 2PL0A 3CQUA 4OTIA 4C37A 4EH3A 4EZ3A 4KIQA 2P55A 4TW9A 4AW0A 3O2MA 1ZMWA 3BU3A 2W7XA 4EWHA 5CT0A 3P08A 1I09A 3ALNA 3KMUA 3QHWA 4H1MA 4MBLA 4O7LA 5IQAA 3WE8A 3GXLA 3R1YA 2YM5A 4LI5A 4RFYA 3N4TA 3BZ3A 4X3JA 4MXCA 4OTRA 3V01A 3WARA 2Y9QA 3RCJA 2LGCA 1ZYSA 4XG8A 4WSYA 3JUHA 1ERKA 5ETCA 4EUTA 5BVEA 5F95A 5HEZA 4JI9A 4PP7A 2HY0A 5I9XA 4O2PA 5GJGA 1LEZA 3U4UA 5ETIA 2ERKA 4IAIA 3W32A 4BYIA 3SA0A 5IPJA 2C6EA 3UZRA 2VX1A 5D12A 1V1KA 4HGTA 5CI6A 1BL7A 3FMHA 3KK9A 4FTQA 1UWJA 5D1JA 3R2YA 5B2LA 4R8QA 3COKA 4GRBA 2H8HA 2HW7A 1Q8ZA 2Z7SA 3D5XA 1H1QA 3G90X 3G9NA 3JS2A 3QLGA 5CENA 3U8WA 4FE2A 2CNVA 1PXNA 3PG1A 5HD7A 4YJNA 1OUYA 2YIYA 4BDEA 2JDTA 3HA8A 4ZXTA 3OCTA 4PMSA 1W84A 1YDRE 1QPCA 3ZSIA 3D2IA 5E91A 4NYEA 5KHWA 2J5EA 4QQJA 4YC3A 4WUAA 4NU1A 2VWWA 1QMZA 3FZ1A 4DEHA 1CKPA 4D1SA 2G9XA 2W4OA 2FH9A 1MUOA 4ZLYA 3KN5A 1YWVA 2QOFA 2A27A 4KBAA 4C4GA 4D2RA 1Q8TA 2QHNA 3EFKA 2WTWA 2WAJA 3B8RA 1VYZA 5I9YA 3D5UA 2W1FA 4E6AA 2R7BA 3M2WA 1KE6A 3D2KA 4IVDA 4FT0A 5KMMA 3LVPA 4ZS0A 4AGCA 4EH7A 3PZEA 2EU9A 4W4YA 4D28A 4R7HA 4C8BA 3TNQB 2VNYA 4BCQA 2R5TA 4HVHA 3L1SA 3LKMA 2X7OA 2YZAA 1M14A 4UXQA 3O7LD 4JXFA 4M67A 4FNYA 4UEUA 3PXFA 5FWKK 2C5NA 3WIGA 4D1ZA 4FX3A 4UMTA 3ZO2A 4OT5A 5HE0A 5L6WL 4ZAUA 5EDQA 4IX4A 5LCJA 4HCTA 1WBSA 3WZKA 2AC3A 2CLQA 3QUEA 1BUHA 3KVXA 2PVNA 3VWAA 2WTCA 5HORA 2WMXA 3QTXA 4I92A 4KRCA 4QQ5A 4FSMA 4K2RA 4GUEA 1UVRA 1STCE 1FPUA 2XP2A 2WQNA 4L3JA 5EKOA 5LWNA 2BMCA 3WZDA 3D83A 4I3ZA 1O6YA 3QCYA 4FT9A 4RIWB 4ANQA 2WNTA 5KZIA 4A9YA 4EOLA 3BHVA 4UN0C 2OZAB 4C38A 1R78A 4TL0A 4GKIA 4JG8A 5F9EA 4EI4A 4DFNA 4JDJA 3M42A 3Q4ZA 2B1PA 2G01A 2C5XA 3FZPA 4FEUA 5FDXA 4DEDA 2WFYA 2VWYA 4HVGA 4L01A 2WMUA 4AZWA 2W1HA 3NX8A 4NM5A 2OXYA 3DJ7A 3I4BA 2GHGA 3TIZA 4CT1A 4D9UA 3RPOA 2YZLA 4RJ5A 1JSVA 2XEZA 3R00A 2OZOA 4BI1A 3FMDA 2PUPA 3KREA 4DTAA 5IDPA 1BKXA 2W9FB 5CSXA 5HI2A 4FOBA 3PPJA 4EL9A 4ZLOA 2IW8A 5JZJA 5L2QA 5EK7A 4ASDA 4YBJA 3RWQA 4F1MA 2C69A 4O7ZA 3EN9A 4HZSA 1FVRA 2Y6OA 1OL6A 2WMAA 3KXNA 3Q96A 3WYYA 2CSNA 3RAHA 4CKJA 4ZTHA 2UZEA 3B2WA 3QHRA 4FZ6A 4A9UA 3CGOA 4AN2A 1J7IA 3QYWA 3QD0A 4R6VA 5IH4A 4AW1A 5B0XA 2BHEA 3PA3A 3QRJA 3HMMA 3PP1A 3TUDA 4PTCA 1Q8YA 2PVRA 4FNWA 3PTGA 5HX8A 2WD1A 2QO7A 3UYTA 5K5NA 5E8SA 1FGKA 2PK9A 3RZFA 2A2AA 3FMLA 3M1SA 2JGZA 4FIGA 4OBQA 3I5ZA 4FTTA 4YLKA 5DWRA 2XM9A 4TT7A 5JSMA 3KL8A 4XG7A 5ITAA 2WTVA 1LR4A 4A4LA 4DFLA 1FINA 5F20A 1JNKA 4GMYA 4C4EA 1PW2A 3FE3A 4JR7A 4PY1A 4DEAA 4BCJA 1IAJA 2IJMA 5C8NA 4EHGA 4YJRA 4AOTA 4FGRA 2W4KA 1V0BA 2JIIA 3C5UA 3DU8A 4B8LA 3TDVA 4P5QA 2UV2A 4HVIA 1XQZA 4A9RA 2IZTA 2JKKA 4DGOA 3QZFA 4CGAA 4EZ7A 1JLUE 4DGMA 4JG6A 1W82A 4XG9A 3MFTA 4BB4A 5LVNA 5M4UA 3CY3A 2VTSA 2YITA 3F3TA 5DA3A 1WBPA 1YWRA 3PXKA 4HPTE 3JR1A 4RJ4A 2PZRA 2FUMA 5I9ZA 2GFSA 4FZFB 3FMEA 3FI8A 1T46A 4AA5A 3R22A 4D55A 3FYJX 4ZY4A 3F88A 4RRVA 1XKKA 2FSLX 5E8YA 2AC5A 3OP5A 4GK4A 2W5AA 3D5WA 3TNPC 4ASZA 4PMTA 3HZTA 2W1ZA 1UNLA 3P79A 1UKIA 3QQHA 4LYNA 3TZ9A 4L00A 4UMPA 3O51A 4P90A 5IEXA 4I94A 2J6MA 2UZVA 3VC4A 1TKIA 4NIFA 3VBQA 4IX6A 2I0EA 3BQRA 2YIRA 1PMEA 3AGMA 4G9RA 3WOWA 3ZMMA 4QMWA 3MVLA 5IQIA 2BAQA 3H3CA 4GG7A 5EG3A 3EH9A 2WO6A 2UW5A 2ZDTA 3BYOA 5BYZA 5FTGA 5HHWA 5FM2A 4DTKA 3OCBA 5BVOA 5EI2A 2X8DA 4AE6A 3O96A 2J2IB 2DQ7X 3UQCA 3B8QA 3OWLA 2WQMA 4V01A 3F2AA 4I24A 4AZVA 2W99B 1XO2B 3OY1A 2YHVA 2KULA 2ZAZA 4IX5A 3VS0A 1F3MC 3HA6A 3R01A 4ZMFA 2X2KA 4RC2A 2I0YA 2OI4X 3FZOA 4YPSA 4O0WA 4C34A 4E6DA 3DZQA 4E6QA 5AR7A 4CZUA 3EB0A 4AA4A 4KSPA 3A7JA 3H9FA 4IMYA 5BQ0A 4I23A 3ORKA 5L2WA 1YHSA 4AZEA 4MXOA 4FA2A 3TKUA 2OICA 3ZC6A 2XJ1A 2VN9A 1QPJA 4R78A 4JR3A 3ZS5A 4BC6A 3SQQA 4C7TA 3QTWA 5M4FA 1WAKA 2ZV7A 3MI9A 4YLLA 4BI2A 4D2WA 4M0ZA 4H58A 3COHA 2YISA 3RPSA 4AX8A 1ZOHA 3R9OA 1BL6A 4LFIA 1XBCA 1FMOE 1OKYA 2Y8OA 3V5QA 4XJ0A 2NNWB 1Q3DA 4BZDA 3MN3A 1R0PA 3WIKA 3L9NA 1M2PA 3MY0A 3R7YA 5A54A 3HDNA 4M0YA 4EKLA 2X0GA 2CHLA 4TNDA 1U5RA 4YLJA 1U54B 4U41A 5J95A 3VRYA 4CFUA 1UA2A 3FXWA 4RVKA 3DS6A 4WNPA 3DTWA 3ZFXA 4GIHA 1M2QA 3R73A 1DI9A 5GINE 2CDZA 3HMIA 5C8MA 2OIBA 4FYNA 5AV4A 3LCDA 3WF7A 3UNKA 5EM7A 3D0EA 4X3FA 3IOKA 3DNEA 5T6KA 4E6CA 4IZAA 2WOUA 2IZUA 4X6QC 3EWHA 5F1ZA 4WT6A 4EH2A 2GPHA 3ZTXA 4BBEA 3DJ6A 1H1WA 3Q9YA 4BVUA 5KMLA 4DFYA 2CJMA 4EORA 3FLSA 2J0JA 5EFQA 5BVDA 3UQFA 5FBNC 1AGWA 4FT3A 3TWJA 2BKKA 2EWAA 4EC8A 5A4CA 3AC5A 1NA7A 5AX3A 2YJRA 3EQBA 3KCFA 3R63A 2XIXA 3LXKA 3QC4A 2RFDA 5I3OA 3NVKI 4GJ3A 5J9YA 2VNWA 3CR0A 3KKVA 2E9UA 2XF0A 5HKMA 4F9YA 4BTFA 4FKGA 2F57A 5CF4A 4LUDA 3GU8A 3OF0A 3RKBA 4IWOA 4QP6A 4WNMA 5GIPE 1OIYA 5CTPA 5E7RA 1OIQA 4GFOA 4O1PA 3CPCA 4QTCA 3QZGA 2UZDA 4Z7HA 4TWOA 2ITTA 2QG5A 4JIAA 2PZYA 3HMPA 4IEBA 4IX3A 5AM7A 1GJOA 1A06A 3KA0A 4ZZOA 2OH4A 3ZHPC 3FAAA 4IVAA 5L6PA 1SZMA 3FQSA 3HKOA 4QYHA 4R1YA 5CSVA 4E4MA 2DUVA 5HVYA 4OTPA 1WBNA 3C4CA 2PPQA 3FQHA 3K5VA 3VQHA 5ANGA 4EHEA 4NUSA 4F9AA 5KO1A 1GNGA 4AE9A 3EHAA 4DEGA 4FTRA 4RFMA 3JXWA 1JVPP 5HU9A 4IZ7A 2J0LA 1Q3WA 4BF2A 1SNUA 4H1JA 3SGCA 3FSFA 3BHUA 4AU8A 4QP1A 2YACA 3IDBA 3MW1A 4JDIA 1U5QA 3IK3A 4FV0A 3EKKA 5CU2A 4AGDA 4RT7A 1R3CA 2R0UA 1PHKA 3G51A 2ITUA 5HE2A 1M7QA 2I1MA 3V5JA 5AP0A 4IAYA 3SVVA 5M09A 3LCKA 2JIVA 4CSVA 2C0IA 4HYSA 2VTPA 4M7IA 2B54A 3GQIA 3R8LA 1H27A 2R0IA 2FB8A 5IH6A 3OD6X 3BX5A 3VW8A 4BY9E 3A60A 4FYOA 2F7XE 4ZS4A 5EQEA 5CAVA 3QQJA 1URWA 4G3EA 2EUFB 3OEFX 2XJ0A 3ENHA 4MBJA 5EHLA 4DGLC 5K4JA 1Y91A 4DT9A 3NDMA 1HCKA 4QP9A 1OUKA 4IB1A 4GVAA 2BTSA 3IGOA 4YGAA 1PXPA 2QOCA 3W18A 3TM0A 4L3PA 2JIUA 1U46A 5HG8A 5JZNA 5AJQA 5KKRB 5IQEA 4UMQA 1BMKA 2PY3A 5HBEA 2X7FA 5CF8A 3HAMA 5E92A 3KK8A 1E9HA 4BBMA 3P7CA 4NIFB 2Y4IB 4WA9A 4DH7A 4EZ5A 3BI6A 1W0XC 3CGFA 2XNOA 1ZZ2A 3R8UA 3BIZA 2BALA 4YU2A 3AT3A 4U81A 1YOMA 3WF6A 3FI2A 1H1RA 4PDPA 4O7VA 4ANOA 4EOKA 3CXWA 1WVYA 3MH0A 2ZM1A 4CRLA 4O7RA 2ACXA 4N6YA 5AADA 4BDDA 4FKPA 3BRBA 3CD8A 3HX4A 3VUTA 4E8AA 2BDJA 3N4UA 3PLAE 3H0ZA 2XCHA 5CEKA 5T3QA 4ACHA 2R2PA 4R3RA 4LOOA 5E4HA 4BTJA 3NMUF 5CZIA 4D2PA 4Z55A 4D58A 3RINA 4DGGA 3CCNA 3F66A 4JQEA 4RSSA 5CASA 5IU2A 4YP8A 2PVLA 4S34A 3R1NA 4BCFA 1PRYA 2PZIA 4EC9A 4UWBA 3T9TA 4DLIA 4BN1A 2VX3A 1JKSA 4YJVA 1P5EA 3EQCA 3OUNB 5H9BA 3C1XA 4FV5A 4ANSA 4YC8A 1XH6A 4BDGA 5CU3A 4F9WA 3DDQA 4FKRA 2RFEA 4J97A 3LQ8A 3MH3A 4MNEA 3SW7A 3ORIA 4RC4A 5H2UA 2UVZA 3DV3A 4FK6A 5FXQA 5IF1A 4UBAA 4O82A 2E9PA 4ZTQA 4DE4A 3TI1A 4OBOA 1P14A 4ZTMA 4ZJIA 3HV4A 5DE2A 4R5YA 1O6LA 3E88A 1XJDA 4YC6A 4EEVA 3F3ZA 1YXSA 5DYJA 4RJ6A 2PMIA 1ZYJA 2VGPA 4U79A 3UC4A 4G9CA 3QX4A 4B7TA 2Z7RA 3RZBA 2RGPA 4F09A 2UW7A 4DA5A 4GIIA 2WIPA 4GK2A 3LOKA 5DMZA 5ANDA 2R3MA 5JFWA 3H10A 3U6IA 1XWSA 3RM7A 4HNIA 3IQ7A 3S0OA 1NW1A 3UODA 3LLAA 2AUHA 4QMPA 3SXSA 4F63A 3DDPA 2XNEA 3E7VA 3OXTA 4YTCA 2QLUA 4X3FB 3FC2A 4KNBA 5KBRA 4QNAA 2Z02A 2YFXA 4BDBA 3ERKA 3MTFA 3JPVA 3MBLA 4BYJA 4PNKA 3U6JA 3QGWA 3RM6A 4MH7A 2Q0NA 3PY0A 3W2SA 4M68A 4FEXA 2HZ4A 3LQ5A 4HYUA 1HCLA 3Q6UA 1SVHA 2WTKC 1AD5A 4JQ7A 3K3IA 3LHJA 1YI6A 3RPVA 4FEWA 3AT2A 4BDFA 4P5ZA 1SNXA 1FMKA 3DLSA 4P2KA 4XCUA 3CS9A 3D15A 3UVRA 4LMNA 4E93A 4RGJA 5LWMA 4BR3A 2FA2A 2JKMA 2IVTA 3GFEA 5D9HA 2PVMA 3DAKA 4M69B 5FEDA 4R3PA 3TZMA 4USEA 2EVAA 2GNFA 4IB0A 2X9EA 2W06A 4U40A 2C5YA 2YJSA 3OTVA 1H8FA 3KMWA 1W8CA 1YQJA 3ENMA 3UMWA 2JFLA 4L3LA 4D0XA 5EM8A 4UY9A 1LPUA 2F7ZE 2W1DA 2I6LA 2XK3A 5ANOA 5KBQA 1BYGA 3NNXA 3AT4A 4IFCA 2F7EE 3UNZA 3UO5A 3CC6A 3RMFA 2VTJA 3ZLSA 5EYMA 4MNFA 1R0EA 3RALA 2JDRA 1Y57A 4O0TA 5C27A 2W1EA 4S32A 3VBYA 5IG1A 4DGNA 3S95A 3BU6A 3GI3A 4OTDA 4PL3A 5E1EA 4L46A 4BTMA 4FTKA 3EZVA 4L68A 2IZRA 4BIBA 3R1SA 4G2FA 3FMMA 3P23A 4ASXA 2QD9A 3LJ2A 4FICA 5DR6A 2OGVA 3RAKA 4U42A 4ANLA 1RJBA 2BRNA 3KY2A 4DEBA 4FV4A 4XUFA 3C51A 3PWDA 2A19B 1YI4A 1OKZA 2UW0A 2YAAA 3OHTA 4M14A 3GCUA 1OL7A 3F5XA 3PA5A 1NT2A 4QYGA 1PMVA 4TYEA 3SLSA 5I5ZA 3ZZWA 5HNIX 2IVUA 4YNEA 2BROA 2G1TA 5KE0A 3AD6A 1F0QA 4O2ZA 4QMXA 2ONLA 2YDJA 4KIOA 2FO0A 3PXRA 3ACJA 3GUBA 4C61A 4O0RA 3IDCA 4I0SA 3F3VA 2W0JA 4B99A 2OWBA 4BTKA 4E3CA 3PXZA 2IW9A 3BBTB 2DWBA 4DFUA 3MTLA 4QPAA 5DT3A 1WCCA 3SX9A 3UIMA 3MA3A 1GIJA 2UZWE 3V5LA 5ACBC 5CEIA 2C3LA 4RA5A 2HW6A 3RBWA 2WHBA 3AC4A 3FPQA 4TWCA 4B8MA 4YTFA 4YR8A 2ITPA 4TNBA 4DAWA 5C26A 1CKJA 1UNGA 3HP5A 2ITYA 3O8UA 4J8MA 2F9GA 3L8VA 3HRCA 4X21A 4XG4A 3G6HA 3KXXA 4FTOA 2VTRA 4O0SA 3G0EA 4FKQA 1A9UA 4PF4A 3VHEA 3NUSA 4O7YA 3Q53A 3NPCA 1H24A 2VTIA 4O7NA 3ITZA 3KGAA 1XBBA 1FOTA 5IKWA 3NYOA 3VHKA 4A9TA 5AUVA 3OXIA 3EJ1A 5IZFA 3B2TA 4G34A 4TWNA 2GS7A 4GVJA 4M15A 4UV0A 5CT7A 2OLCA 3G2FA 5H8GA 5ICPA 1ZRZA 4XLVA 2BZKB 1DS5A 3OWKA 4PPCA 4RWKA 4HOKA 5HO6A 5LJJA 5IEYA 4PWNA 3ROCA 4I5CA 5DI1A 3VS6A 2ZMDA 4Q9SA 3FL5A 3MH2A 4RBLA 3V51A 3R9NA 4HGLA 1H26A 3MV5A 4EH9A 5AMNA 5AEPA 5HIEA 4M13A 3RHKA 2X7GA 2IO6A 2WMVA 4GYGA 4OAUC 2ZB0A 5EDRA 2W4JA 3E3BX 3GNIB 5DIAA 4C3RA 3K5UA 4MXAA 4C33A 4MTAA 4FTUA 2FSOX 3QKMA 3ORLA 4FT5A 3VAPA 5IH5A 4ZZNA 2XNMA 3DBFA 3RTPA 2HZNA 4K9YA 1OKWA 2PZPA 3MIYA 5BVFA 4KUJA 5BVWA 2J0IA 2YAKA 4BIEA 4DH1A 4NFNA 3BQCA 4G6OA 3PY3A 1WZYA 3AQVA 4QYEA 1REJA 5ANIA 2GCDA 3HAVA 5IQBA 3TZ8A 4IM2A 1R39A 3DXPA 3L9MA 1FQ1B 3P5KA 2YLFA 4MNEB 3WILA 3A7IA 3ZLXA 5HTIA 1E1VA 4LGHA 3VUGA 3K54A 2A4LA 3MGYA 3U54A 4I5HA 4WD5A 4EH8A 3PSCA 3C7QA 4QMZA 5IA5A 2R3JA 2J51A 5BMMA 3MB6A 4JDKA 5LXMA 5J79A 3SG9A 1CTPE 3E3PA 2GNLA 3ZSGA 4PMMA 1I44A 3LCTA 4QYFA 3F61A 3MA6A 2WTIA 5TO8A 4MAOA 1K3AA 2YLEA 4PPAA 2WTDA 3OVVA 4EOIA 5AAGA 3BHTA 5IDNA 3AG9A 1PYEA 2JDVA 2PE1A 3LFBA 4Y5HA 3PJ2A 5M06A 2ERZE 2JDSA 3ZU7A 2RSVA 3C4FA 4UYNA 3Q2JA 3QRIA 4G5JA 3NUPA 2C4GA 3NCGA 1LP4A 5J9ZA 4FR4A 2DS1A 4LV5A 2YCRA 4J96A 2XIYA 2XZSA 5EQYA 3FKOA 1PYXA 5DLSA 3W2QA 3QQLA 4HVDA 4PRJA 1PKGA 4D0WA 3FDNA 3I7CA 3WI6A 3ZOSA 3MWUA 3Q32A 4USDA 4XP3A 4AACA 2X9FA 2QOKA 3KU2A 5IUGA 1RE8A 5HG9A 3KRWA 4O1OA 1OGUA 3FYKX 3TUCA 4K0YA 4XP0A 3H30A 5AP1A 3A8XA 4FV2A 2W5BA 4I4FA 2VX0A 4YTHA 5DFPA 5CEQA 5LOHA 3NYXA 5C8KA 3OW4A 1UU7A 5IUHA 3OY3A 4ZSLA 3VJOA 5HBHA 3ZCLA 1OMWA 2UZNA 3R7IA 4DG3E 2V7AA 2ZYBA 4L43A 5FM3A 2JFMA 3MVHA 3OCGA 4QOXA 2QONA 2WKMA 4ZY5A 3S1HA 3VS5A 4CLIA 2PVKA 3DFAA 3UIUA 4TTHB 4RPVA 4OT6A 4C02A 4APPA 4AG8A 4C57A 3DPKA 3F5UA 2VO0A 3BWJA 5DRBA 4ZMEA 2C6OA 4ORKA 2BIYA 1H4LA 2ETRA 3D5VA 4FZAB 4AT5A 2Y0AA 3LJ1A 2H9VA 4A4OA 4AFJA 2QKRA 3KFAA 4PQNA 2UW9A 2R3NA 3SG8A 3V8TA 3C0GA 3QTUA 3TN8A 1UWHA 4Y85A 3G9LX 3L8PA 4FUXA 5I9VA 2IG7A 3L8SA 4O38A 2V55A 4GG5A 5HIBA 2B52A 1KWPA 2XNBA 4TKSA 4G3GA 4FK3A 1JPAA 4EOSA 3OFMA 4HZRA 1NY3A 2X2MA 4WOVA 4PV0A 4JL9A 4WUNA 5EW9A 3SRVA 3N9XA 5FBOA 4MWIA 3UZTA 3DQXA 3GOKA 5HESA 3TT0A 4IAFA 4L9IA 4EOOA 1P2AA 3LFFA 2C5VA 4BHZA 3H4JA 5AP7A 4FZDB 4ENXA 5LMKC 5TOZA 3ODYX 4IADA 5ANEA 4ASEA 2R3LA 4ZOGA 1YVJA 4JAIA 5J5SA 2W1GA 1PJKA 5A6OA 3HLLA 4MYGA 4TN6A 3ORTA 4G1WA 2R3GA 3CBLA 5D10A 3W16A 3OXZA 2VWUA 4LL5A 4W8DA 1QPDA 2E9VA 3BKBA 4CKIA 1G5SA 2QC6A 4K33A 4BWKA 3QUPA 3BYVA 3OW3A 4KWPA 4RZVA 5EHYA 1WBVA 3S2PA 3RPYA 5JQ8A 5L8KA 4JX3A 5IQGA 3RGFA 1PXMA 2YN8A 1H1SA 3IW6A 1XR1A 5M51A 4F0IA 3PJ3A 3ACKA 4MQ2A 3LM5A 2UVYA 4GS6A 3MIAA 3KMMA 2JC6A 4HJOA 3FUPA 3PVWA 4FKTA 4E5WA 4YURA 2VTAA 3I79A 2BAKA 3V04A 3LE6A 4AP7A 5IMEA 2ESMA 4KBKA 2OG8A 2C6IA 4DEIA 3BYSA 3KXZA 4ACCA 1ZXEA 3U9NA 3F5PA 2UW8A 5HOAA 4AW5A 5HLNA 3HUBA 4DFZE 4GT5A 3QTSA 4IZYA 5AR3A 2O2UA 2WU6A 1SVGA 4OGRA 4C0TA 4YSJA 4C2WA 4WKQA 2WELA 3LFAA 3AMYA 4ZSJA 4IBMA 3CKWA 3BGZA 1JBPE 3IW5A 2V62A 4RQVA 3IGGA 3Q4CA 3F82A 2Z7QA 3FKNA 1CM8A 2ITQA 3QRKA 3QRTA 3FLQA 1Q99A 4DYMA 2O63A 3CPBA 2XK8A 5J5TA 2UUEA 3L9LA 4EOMA 2QR7A 4XV1A 3TV4A 3TDWA 1OPJA 4OTWA 1JOWB 2C6DA 3PXQA 1K2PA 4FKUA 5ETAA 4A4XA 4MD8E 3R8MA 4FSWA 4F6SA 3C4WA 1OIRA 5I4NA 1Q4LA 2VWBA 4UMUA 3QC9A 4JOAA 4AOJA 5CEOA 4E1ZA 1SMHA 2QO2A 2C3IB 3D4QA 4M12A 5AAEA 1GZ8A 4WG4A 2XMYA 1YXUA 3EQRA 2J50A 5A46A 2F2UA 3W33A 4F6WA 4ITIA 3BCEA 2X6EA 2J5FA 3K2LA 1PMUA 4FVQA 2OJFE 4FV7A 4TPTA 1ZLTA 3DY7A 4IFGA 5KZ0A 5CQUA 1WBOA 4Y95A 4F70A 1ZWSA 1J1BA 3S4QA 4EK5A 3TJCA 1X8BA 1M17A 3DAJA 4X7QA 3VUIA 2F4JA 1XH8A 1YDTE 4ACGA 1QCFA 4KKGA 5CALA 4NCTC 2ETMA 2XKDA 2YIWA 4ZEGA 3NUAA 4X2NA 2J4ZA 3A4OX 3SOCA 3R6XA 3Q9WA 4DBNA 3E92A 5G6VA 4RZWA 5AV0A 4IH8A 3HNGA 5CY3A 3EN6A 5AUXA 3P4KA 2BFXA 2YABA 3R8PA 1IAHA 4YSMA 4J95A 3AC2A 3MVMA 3FJQE 4IHPA 2VTTA 3K3JA 4CT2A 4W9WA 3MJ1A 4ALUA 3I60A 5BNJA 4BL1A 2G2HA 4AF3A 4NM7A 4K8AA 4O27B 3QTZA 4LMUA 4MBIA 4WRGA 4RLKA 5M08A 2VRXA 5GZ8A 4NSTA 4RIOA 4ZY6A 2BPMA 3MPTA 4EK6A 1PMNA 1S9IA 3ULIA 1OKVA 1U59A 4QO9A 3R7GA 3NVMB 4FIHA 4I6HA 4X0MA 5J7BA 2QNJA 4JS8A 3SDJA 3NWWA 3ZC5A 4FSTA 2J7TA 3LM0A 4J52A 4RWJA 2GU8A 4AXAA 4ENYA 4TRLA 5FXSA 5IQDA 4Y83A 3DB8A 4DF3A 5DH3A 5F4NA 3R9DA 4ZLZA 4FTJA 5EQPA 3FKLA 4XRLA 5HE3A 3ZBXA 1J7LA 3BBWA 4F7SA 4O91A 5L4QA 1UU3A 1XH9A 2WOTA 3O8PA 1PXIA 1GZKA 3EQHA 4D4RA 5KHXA 1JKTA 3DBQA 1GIHA 2VTOA 1ND4A 3QTQA 3HMNA 3VUKA 4QD6A 2YM8A 2XVDA 4ZSGA 4MWHA 4D4SA 1PKDA 3FMNA 4GV1A 4XV2A 4DH8A 4WHZA 4YZDA 4E5AX 2G15A 3ZSHA 2ZV8A 4IAKA 4XRJA 4FVRA 3C50A 4PPBA 4U8ZA 4BCHA 1GY3A 2Z7LA 4EUUA 4DFXE 2OXDA 4MHAA 2B7AA 3OOMA 3VBWA 3U4WA 4L7FA 1OM1A 1KSWA 4XYFA 5JGBA 3IW4A 3KXMA 4RX8A 3WF5A 3DA6A 3KRLA 4NWMA 1ZOEA 4RX5A 3N4VA 3QD2B 1JKKA 3EQFA 3F7WA 2DYLA 3TCPA 5JFVA 4P4CA 4DBXA 3ZLYA 4FSZA 4RVMA 3DNDA 4I0TA 5FTOA 4QMNA 2WQBA 3OT3A 5DR9A 4C3FA 1FBNA 2AYPA 3EN5A 4N6ZA 1V0PA 3JY9A 2WMSA 3CE3A 3SRVB 4BKJA 5K0KA 3PDTA 4DTBA 1YRPA 3PJCA 5L2IA 2VUWA 2YM4A 4TYHA 5DGZA 5CXZA 4C3PA 5E9EA 5GHVA 3FLZA 3FPMA 1F5QA 3QTRA 4G6LA 4BDIA 2YDIA 4YZNA 3LFQA 1LEWA 3NUXA 2PMNX 3ZONA 3QUDA 4CYJA 5CSPA 3GT8A 4FV6A 4HCUA 5BVKA 3EFLA 3CKXA 2EXCX 4QP8A 3CP9A 4W4WA 3ATTA 1CKIA 3QTIA 4U5JA 4CV8A 3T9IA 5M44A 3LMIA 2NRUA 4PP9A 5K4IA 4EOJA 1MQ4A 4EWQA 3BELA 4RIYA 2BRGA 4E4XA 4S33A 3AC3A 3CD3A 5AV1A 2HWPA 5BVNA 5I0BA 4PX6A 3QZIA 4QMQA 4L7SA 2QU5A 5I3RA 2C5OA 4O7SA 3NNWA 2XIZA 5EYKA 5JGDA 1Y8GA 1A48A 5L8LA 1UNHA 3R0TA 4FNXA 1O6KA 5CWZA 5HNGA 4C58A 3FLYA 4M3QA 5J87A 1MRYA 3QLFA 4HYIA 3G6GA 4BDCA 3QAME 2O8YA 5HICA 3LFCA 1YI3A 1TQMA 2W17A 4NM3A 3I5NA 3ZUTA 1ZARA 2P4IA 3R02A 4JJRA 4G31A 4DCEA 1S9JA 3QGYA 3DXNA 4RLLA 4IZ5A 4AWIA 4QMVA 4ZK5A 1GZOA 2GQSA 1JAMA 1CMKE 3DK3A 3EKNA 4F65A 5CU0A 3RHXA 3RAWA 3Q4TA 3QXPA 4F08A 3IPHA 4V04A 3ZRLA 4CQEA 1WBWA 3OMVA 3OWJA 4D1XA 4QTBA 4YNOA 5K3YA 4BFMA 5AR4A 3H9RA 4I93A 4UMRA 5CAQA 4QPMA 3FMJA 4EQUA 3F3UA 4MKCA 4QMUA 4W9XA 3BU5A 3KULA 3KRXA 4TZRA 3O0GA 4JNWA 4EK4A 3HV3A 1XHAA 2Q0BA 4AZTA 1L3RE 2WMRA 2HXQA 1M2RA 3QQGA 4TWPA 3RJCA 3D7TA 4NTSA 1H0VA 4U7ZA 4QTAA 3REPA 3RCDA 2C1AA 1KE8A 1QL6A 3AGLA 2QVSE 3C4XA 3E8DA 3HV6A 3I0QA 4FSYA 2BAJA 2V22A 4ITJA 2A0CX 3GOPA 4GJ2A 3EMGA 2P0CA 4EQCA 3TV7A 3BE2A 3MFUA 3G0FA 4FTIA 2OFUA 4KIKA 3R04A 2VTHA 3OWPA 2OIDA 2JBOA 4LRMA 2C3KA 2G2IA 1OITA 4ANMA 4GEOA 3MJ2A 4IE9A 2R3IA 5HCYA 1MQBA 4Z16A 5CF6A 3A2CA 5HX6A 4DINA 4ZSEA 4NK9A 4FGBA 5BYYA 1MP8A 3EFJA 5CNOA 3U6HA 3I6UA 5AP5A 3HRBA 3HVCA 3OBJA 3ZLWA 2RG6A 5AV3A 4G3CA 4NJDA 1H1PA 3VBXA 3LLTA 3F6XA 3LXPA 5L8JA 3VO3A 4CD0A 2IVVA 3SD0A 4FG7A 2PUNA 3HEGA 5KMNA 1IG1A 1XH7A 4MD9E 3QQUA 4WSQA 3R28A 3HUCA 4UXLA 3WF8A 4QQTA 4LGGA 2QKWB 2WXVA 4BKZA 2G2FA 3W2OA 4FKSA 1NVQA 2W1CA 1IA9A 3C0HA 4QQCA 4YBKA 4I6BA 3LJ0A 3AXWA 3FLNC 3HDMA 4NT4A 3DXQA 1H25A 1G8SA 3DKFA 2WMWA 2I7QA 4XG6A 4O7TA 3QCXA 2HCKA 3RVGA 3EN4A 5JFSA 3PJ1A 4YZMA 2B55A 4I22A 5H8BA 1ZAOA 2PTKA 3C9WA 4LOQA 1DAWA 5EW8A 4BCOA 5LVOA 4I41A 3O23A 3JYAA 5AP2A 2VTQA 2C0OA 4CV9A 3MVJA 1DAYA 2J0KA 3NR9A 3EOCA 4M66A 4OLIA 2X8EA 3E8CA 4FIEA 4K11A 4XHKB 3UZPA 1OB3A 4AZFA 3UNJA 4KABA 4XLIA 4BWXA 4I6QA 2X8IA 1YDSE 2ZJWA 4BCKA 5DRDA 1K9AA 3S3IA 3MESA 5DN3A 2C3JA 3EYHA 4U6RA 2XK6A 5BUEA 3A61A 4I6FA 2QOBA 4EOPA 3LQ3A 3NZ0A 1TVOA 3TZ7A 3GC7A 2KTYA 3IS5A 3DQWA 1IA8A 5AWMA 3R7OA 4BCNA 2HELA 3QCSA 4DC2A 1Y6AA 3BEGA 2R7IA 1KUTA 3TG1A 3QQFA 4F9BA 1G3NA 5A4LA 2Z60A 2OSCA 1FVVA 3QKLA 3RK9A 3W8LA 3FMKA 4BZNA 5DEYA 3MDYA 3VN9A 4HGEA 3IO7A 4BDHA 3I81A 4KKEA 4NTTA 2C1BA 4FKIA 5D11A 2QU6A 4MXYA 4AW2A 3GU7A 3COIA 4PL5A 3TNHA 2XRUA 2CGWA 1J91A 3GCSA 4XOZA 5HCZA 4BGGA 3R7EA 5M4CA 2BRBA 5H8EA 4C4HA 2JBPA 4ID7A 3W55A 5E90A 3IECA 5M4IA 4YTIA 2R3HA 4L8MA 3D7ZA 4MEDA 2ZV9A 3PVBA 3U55A 3ZUUA 4F1OA 4RMZA 1SM2A 2VO7A 2YERA 3OOGA 4AA0A 2GQRA 4M8TA 3FQEA 1BX6A 5AP6A 2QOOA 3IDPA 2X2LA 3QKKA 2VWZA 5D41A 5AUWA 4F9CA 3QFVA 2CGVA 5HU3A 5LVPA 3IG7A 4NEUA 4ZTLA 1NVRA 3PSBA 3KF7A 4DITA 5HG5A 4X2KA 4HGSA 2PYWA 2PSQA 3FL4A 3QD4A 4QMOA 4B0GA 4RX9A 4RIYB 3HMOA 4Q5EA 2WB8A 2GNIA 4Q2AA 3TEIA 3I7BA 4UALA 1AQ1A 1PXKA 1Z5MA 3KXHA 2P2IA 3E62A 3R21A 5J1WA 4ALWA 2XYNA 3D14A 3PRIA 4MD7E 3F2RA 5KMJA 3NCZA 3PIXA 4RG0A 1KOAA 3FLWA 2WPAA 4FV9A 3SW4A 5BMSA 3I1AA 1PY5A 3QBNA 1ZZLA 2HZIA 4CG8A 3ORZA 1UU8A 2YIXA 4FC0A 4RIWA 1XH4A 3E87A 3ZRKA 3TV6A 4N70A 3U9CA 5JRQA 4NJ3A 3DGKA 4DG0E 1OZ1A 3UQGA 3GP0A 3LZBA 4IDVA 4C4IA 1Q24A 4CNHA 2OJJA 5DVRA 4E4LA 2HAKA 2V5QA 5TT7A 3ZO4A 3NRMA 3LMHA 5CSWA 4J53A 4CXAA 4F7JA 2O5KA 5L2SA 3DB6A 5DOSA 5JQ5A 4IWQA 1OBGA 2WQEA 4GSBA 3ZO1A 5BYLA 5E8VA 2F2CB 4ZTNA 2GS6A 3KC3A 3NGAA 3SAYA 4D2SA 1NVSA 3KRRA 1YKRA 3AC8A 4RWIA 3WZJA 2BCJA 3D7TB 4HPUE 2BTRA 4BICA 4Q9ZA 4MF0A 4CVAA 4E5BA 2CN8A 2YWPA 4IJPA 2R3QA 4D9TA 4I5MA 4KA3A 5DT4A 2GNGA 3ZDUA 4BGHA 4LRJA 1M52A 3HGKA 4FEQA 3R71A 2GHMA 4U44A 3P86A 3SC1A 5HNBA 4OR5A 4ARKA 4XP2A 2HXLA 4KIKB 3FWQA 1J1CA 3M11A 5JMSA 3PUPA 4QP4A 3VUMA 1ZMVA 4KINA 4LV8A 3EFWA 4PTEA 4QMMA 1OPLA 4TYIA 4U0IA 2W9ZB 2YWVA 3R30A 3V6SA 4P7EA 5EDPA 4LUEA 3UOKA 4S30A 5A4QA 4YZ9A 3NUUA 1H00A 2WTKB 4HCVA 5IMXA 5J7HA 4F0GA 4GFMA 2OJIA 3UDBA 5A14A 5CAUA 4DG2E 5JKGA 1FVTA 3KEXA 4A06A 3T3UA 5M56A 2H34A 4UB7A 4EOQA 4L53A 5JFXA 2JEDA 5A4TA 5A9UA 3PVUA 3ZXTA 4CTBA 3VIDA 2XEYA 4XG2A 4DN5A 4N57A 5BX0A 5LARA 4RQKA 3DFCB 5IA0A 3A7GA 1Q41A 3H0YA 4PL4A 2Z2WA 3ZXZA 1UU9A 4MK0A 2V7OA 1YHVA 2QOQA 5EOLA 4ANBA 3GU4A 4R5SA 4OW8A 3JVSA 3POZA 3NAYA 4EQMA 4EH5A 2B9FA 3BV2A 4RVTA 3VBVA 3QZHA 2B53A 4EHVA 1YOJA 4FL2A 3EL8A 5EM6A 3VRZA 3TJDA 5I9WA 3ALOA 3A4PA 3MH1A 4FKVA 4WBOA 3UGCA 1Q97A 1SVEA 4IC8A 4FKJA 3UG1A 4IXPA 5CANA 4Q5HA 2GMXA 2OBJA 4WIHA 2WMQA 3ZUVA 5AX9A 3BEAA 5EM5A 5FEQA 3TKHA 2P2HA 2FVDA 3FY0A 3OUKA 3ODZX 1R1WA 2XNGA 5AUTA 4Z7GA 3W2RA 3ZO3A 3OCSA 4EBVA 2XUUA 4FUYA 4U45A 5CS6A 4D4YA 3QD3A 5LCKA 4FZ7A 3V5WA 3DCVA 2XH5A 1ZMUA 2GS2A 4CLJA 3C13A 3E63A 4JVGA 3WZUA 2GSFA 3A62A 5LVMA 2CCHA 3H9OA 5LMKA 2ETKA 3GENA 2CMWA 2IN6A 5AP3A 3RNIA 3A8WA 1YXTA 3ZH8A 1M7NA 4O22A 4U3ZA 3UP2A 2BUJA 4F0FA 4Z3VA 4IWDA 4U97A 4O96A 3PYYA 4X2GA 5C1QB 3FEGA 2ZM4A 2R3OA 2XJ2A 3UO6A 4OUCA 5IA4A 4XV9A 4IDTA 2PVFA 4RJ8A 4TY1A 5C9CA 4FODA 2I0VA 3QWKA 2YM6A 2QI8A 3QCQA 4LQMA 1E1XA 4PDSA 5TE0A 3RK7A 5B2MA 3ZEPA 3A7HA 2C6KA 2XCKA 2O3PA 2YM3A 2ZMCA 3E64A 1DM2A 4KB8A 4R77A 2H96A 4OTHA 3PPKA 4EK8A 5CAPA 3RAIA 4CQGA 4KAOA 2PU8A 3WZEA 3SXRA 4F64A 5FDPA 2JD5A 4W8EA 1H01A 5CQWA 3FZSA 4DT8A 2E9NA 2CGXA 4RJ3A 4UX9A 3R2BA 4LG4A 2WZJA 2QR8A 4A7CA 5IQCA 4QNYA 2GTMA 3Q6WA 4O0YA 4UYAA 1ZOGA 4M84A 1Y8YA 1MRVA 3DKCA 4TXCA 4A9SA 5TF9A 3PG3A 5HO8A 4FVPA 4XG3A 3Q2MA 1BI7A 4IJ9A 3UP7A 4R3CA 5LMBA 4B6LA 3DOGA 3KF4A 1U54A 4L45A 5EKNA 4N0SA 1Q62A 3O7LB 5E8ZA 2W96B 4FTMA 2C6TA 4QYYA 5G1XA 3ORXA 4EYJA 5I9UA 3ULZA 3MFRA 4V0GA 2C68A 3UIXA 3FV8A 3KRJA 4NW6A 3PP0A 2YCSA 3VS3A 4G16A 4PTGA 2XIRA 2XRWA 3JY0A 4Y8DA 3W2CA 3VULA 5IA1A 4QTDA 4JX7A 2OF2A 2OW3A 4FI1A 4WRSA 3KQ7A 3ZZEA 2YDKA 1T45A 4UZHA 2XBJA 3R83A 3ZM4A 4FL1A 2UZOA 5DPVA 4S31A 5FG8A 4CTCA 2R3RA 1OL1A 4JBQA 4JLCA 4Z9LA 4CZYB 3E8EA 3DKOA 3QALE 3CQWA 3KXGA 4MF1A 5CVHA 3SXFA 4JAJA 3IKAA 4FEVA 2XM8A 4YJPA 3VF8A 2FYSA 4I4EA 2C6LA 1ZYDA 4MVFA 5HG7A 4BHNA 3G5DA 4DFBA 4ITHA 2IVSA 1HOWA 5A3XA 4C59A 3EQPA 5CNNA 5LVLA 4K18A 5D7AA 4AN9A 3PE2A 3P9JA 3UO4A 3DT1A 4FG8A 3W8QA 5AP4A 3DJ5A 3ANRA 5HLWA 3SV0A 5DG5A 2GFCA 3A99A 1PXOA 5HCXA 3V3VA 2ZOQA 3NEWA 3NW6A 4FF8A 2XYUA 4RJ7A 3R8ZA 4NCTA 2ITOA 3BPRA 3LXLA 2Q83A 5HGIA 5E8UA 4RVLA 5ETFA 4EONA 5FP6A 4USFA 3LFSA 4PDYA 3ZDIA 2UZUE 3P0MA 5IQFA 1YW2A 4JRVA 2HWOA 4E20A 3TL8A 4H3QA 4ZTSA 4YO4A 3PIZA 4L52A 3R1QA 4F7NA 3RP9A 3QU0A 4FT7A 4WBBB 5ANKA 4GKHA 3EYGA 2C47A 5CLPA 4ACMA 4GCJA 3UPXA 4EKKA 4MCVA 2CNUA 4FMQA 5EHOA 5CAOA 2VGOA 2EB2A 3FXXA 3GCPA 4XV3A 5CU6A 5HVJA 3TTJA 4L6QA 5AUYA 4DCAA 1L8TA 4K77A 2JDOA 2UZTA 4FSUA 3W1FA 3ZYAA 4XOYA 2Z8CA 4H39A 4E26A 5EH0A 2WGJA 2OH0E 1W7HA 4GYIA 3C0IA 3Q5ZA 3R7VA 1RDQE 3MY5A 3RNYA 2BRMA 4QMYA 4ZP5A 3UIBA 4G17A 2WU7A 4FTCA 2BZIB 3QYZA 2XA4A 2R4BA 3P1AA 5CXHA 3ANQA 3F9NA 2QHMA 3MPAA 3ROYA 2XK7A 3ZM9A 4MXZA 3DZOA 1KV2A 5HBJA 3BGQA 3U51A 2PE0A 1WBTA 3BYMA 2HENA 3NSZA 4R1VA 4QMTA 3FXZA 4MX9A 4YZCA 2J0MB 5FGKA 1APME 3TUBA 1JQHA 5DHJA 3A7FA 2QODA 3OZ6A 5CEMA 2BDFA 2CKQA 1H0WA 3FZTA 3LCOA 4II5A 1Z9XA 5C4LA 3LPBA 3UC3A 4YJUA 2B4SB 5M55A 2XKEA 4J71A 3W2PA 1VZOA 2E2BA 3OBGA 3I6WA 3FHRA 3GGFA 3NS9A 1WVWA 2X4ZA 3PVGA 4Y72A 3KCKA 3VVHA 4BDAA 4EJNA 4IIRA 3UBDA 3OC1A 3TXOA 1B38A 3PZHA 2O65A 4OAVB 3PIYA
chains in the Genus database with same CATH superfamily
3ELJA 2ITNA 4ACDA 4C2VA 3HP2A 4CRSA 3UOHA 4CFFA 2F49A 4FG9A 4JT3A 4U80A 1MRUA 1XBAA 4WNKA 4C36A 4I1ZA 5CX9A 4BCIA 5K0XA 3RPRA 3MSSA 4BRXA 3PFQA 4TYGA 5T68A 3UVQA 4FL3A 4WO5A 5C01A 1Y6BA 1TQPA 2WQOA 1H08A 1YXXA 1RW8A 3EN7A 1GAGA 2XS0A 3GBZA 2JAVA 4JDHA 4AN3A 3SKCA 4Y5QA 4U9AA 4LGDA 2ITZA 4W4XA 3E8NA 2H6DA 3MB7A 2WEIA 4Y73A 4RA4A 4UZDA 4Y46A 1BI8A 4FOCA 5EI8A 3R9HA 2GNJA 4XNEA 4CMTA 4C35A 4GT3A 3QQKA 4E7WA 3R9RA 5HZNA 1VYWA 2B9IA 2ZV2A 4G6NA 4RIXA 3LXNA 2VO6A 4CFVA 1ATPE 5HVKA 4IC7A 2AEGA 2PULA 3DBEA 2HOGA 5LQFA 2REIA 2VTNA 4JBPA 3Q4UA 1LUFA 3DK7A 3CJFA 4N4SA 2GQGA 4BCGA 2X81A 4L44A 1CDKA 4H3PA 4RX7A 3D94A 2B0QA 3GQLA 3P7AA 1P4OA 2ZVAA 4BI0A 2LAVA 3UE4A 2A1AB 4O21A 3LMGA 4X2JA 5A6NA 5E8WA 4BBFA 5IISA 2PUIA 4DH3A 1H07A 3DLZA 4AS0A 5CVFA 2CCIA 2WMTA 2BDWA 4CZTA 5A4EA 1Q8UA 2RFSA 3QF9A 2I0HA 4QP3A 2X6DA 2BRHA 1QPEA 1FGIA 4AFEA 4IAAA 2OF4A 5FP5A 4NM0A 5KKRC 2YA9A 3EQIA 3BHHA 2BHHA 3VJNA 4ANNA 2OO8X 4FV3A 5KUPA 1DI8A 3Q9ZA 3ORNA 4CFWA 2EXEA 4JIKA 3DAEA 1B39A 2Y4IC 4V0GB 2ZB1A 2YM7A 3N51A 5DR2A 3Q04A 5JGAA 5EOBA 4QDEA 4AT4A 4FTLA 4IQ6A 3NFFB 2E9OA 1ZY5A 5GJDA 4CFMA 1IR3A 3O71A 4AGUA 1Q8WA 4NFMA 5FLFA 4IWPA 3II5A 2BZHB 2O0UA 2QO9A 4UWCA 4FSRA 5CU4A 3MFSA 2BIKB 1WFCA 3BLRA 4FIJA 2VZ6A 3ID6C 3ORMA 2ZFYA 3UG2A 2ITWA 4J7BA 3CLYA 1OPKA 4YO6A 1NXKA 2BR1A 2XB7A 3OEZA 2VU3A 3WF9A 4GU9A 4O0XA 4M69A 1PF8A 3CIKA 2GTNA 4FIIA 4APCA 4ZIMA 4L67A 2BZJA 4O0VA 4KBCA 4ONAA 3DK6A 2BFYA 4FV1A 4NKSA 3ZFMA 3VNTA 4AAAA 3F2NA 3CJGA 3PRFA 2Y4PA 4IM3A 2IWIA 2V0DA 3G15A 5KMIA 3T3VA 1CSNA 1YOLA 2XNNA 3HV7A 4KKHA 4FTAA 4XBUA 5D7VA 3AOXA 5BUJA 1H28A 4H05A 4TYJA 3BLQA 3BYUA 3KVWA 4NH1A 5HD4A 2PVHA 3PJ8A 3PLSA 5FTQA 4L42A 5JRSA 2VD5A 4IVBA 2CNQA 4FIFA 1TQIA 3VS1A 1VR2A 4FTNA 2OJGA 4X6RA 4XBRA 4MXXA 5C03A 4GK3A 4RFZA 5AM6A 5LMAA 3HECA 4CKRA 2WTJA 4PNIA 4ZJVA 4WNOA 3PA4A 4AXDA 4J1RA 2QOHA 4O4EA 5IUIA 5KMKA 4H36A 5AR2A 5M53A 5GNKA 4AT3A 3OROA 2CKEA 5J9LA 2XBAA 5CZHA 5AIRA 3S00A 2UW3A 5JH6A 3IONA 4X3FC 4O0UA 5L6OA 1OL2A 2C0TA 1JKLA 5KNJA 3O8TA 4JQ8A 4BDJA 2CLXA 2BVAA 3VUDA 4E73A 2R3KA 4DLJA 4FJVA 3F3WA 3EQDA 3Q60A 4GT4A 3Q52A 2XK4A 2PUUA 2GHLA 1B6CB 3GFWA 3E93A 4S2ZA 1JSUA 4I21A 4IM0A 3OT8A 3NAXA 3F69A 1IRKA 5HLPA 5IEVA 4G5PA 3QA0A 4EH6A 4LOPA 5E1SA 4CEGA 5AR5A 1IASA 3TACA 3WE4A 4XH6A 4CMOA 3OTUA 5AA8A 3ATSA 3WBLA 4D2TA 4LM5A 2FGIA 1WVXA 2B9JA 1URCA 3FI3A 3MYGA 5C4KA 4HW7A 4ERKA 2PZ5A 2R64A 2EXMA 3BLHA 4YJQA 3W0PA 5HTBA 3EIDA 3DBDA 4AGWA 4EK3A 4IB5A 5M07A 2OXXA 3NIZA 4XMOA 2PVYA 3SOAA 2UZLA 3WYXA 3EZRA 4RWLA 4YJTA 2CKOA 3CTQA 4I6LA 5AA9A 3LFDA 2X39A 5AAFA 4DHZA 2JITA 3VS2A 2J9MA 4K1BA 4R7IA 2W5HA 4IAZA 5JEBA 3C5IA 4HVSA 2GNHA 3LFNA 1W2DA 5CEPA 4OTQA 3QA8A 2WIHA 4UWYA 3OG7A 3EQGA 4O4CA 2WMBA 3L9PA 2HYYA 3DKGA 3MPMA 1ZYLA 2QLQA 3NLBA 2ITVA 4CFXA 3P7BA 1GZNA 2VO3A 3F7ZA 2BKZA 4I5PA 4FKWA 5EYDA 5GIOE 1Q61A 1REKA 3POOA 4G3DA 5AV2A 3VS4A 5BUIA 4DH5A 5CI7A 3DBCA 2Y7JA 3CQEA 3LAUA 3NW7A 3FC1X 2OFVA 3C4ZA 1JWHA 3TTIA 4U43A 5FUTA 4CFNA 3LIJA 4AZSA 1EH4A 3UJGA 4WG5A 1ZY4A 2RKUA 3FSKA 5CSHA 4O86A 2J90A 2VWIA 2C6MA 5FQDC 4FNZA 4RIXB 3O17A 2OU7A 3COMA 4PMPA 1XH5A 4W4VA 3Q9XA 4WG3A 2RG5A 4NKAA 4PDOA 5TR6A 3QXOA 2X1NA 5AIKA 3ZFYA 3U87A 3O50A 3THBA 2GDOA 4AQCA 2UW4A 4CMUA 5BPYA 4V05A 5JN2A 2PVJA 3TKIA 2JKQA 2UVXA 4BZOA 3UVPA 3ETAA 3CSVA 2XK9A 1UV5A 5L3AA 4CG9A 1OVEA 2UZBA 3PFYA 3R7UA 4JBVA 4OTGA 5B2KA 2XKFA 5L2TA 4NL0A 3PY1A 3V6RA 4G3FA 4F6UA 1U4DA 4FBXA 2YCFA 4CCBA 2CPKE 2RL5A 3PSDA 4AUAA 5K5XA 1VJYA 3GEQA 4R7BA 4HYHA 4C4FA 5EW3A 3GU6A 5AUUA 4EHZA 5EYCA 4A07A 1YWNA 1Q5KA 2ZM3A 3HL7A 4JBOA 5J1VA 4O4DA 4O6EA 1O9UA 1KE7A 1IEPA 2SRCA 1J7UA 3GC9A 4NW5A 3NUYA 2XNPA 3V8SA 4QPSA 5DNRA 5GZ9A 3KN6A 3OS3A 4H3BA 2W05A 3UMXA 3V5TA 1PXJA 2HY81 5JK3A 3BV3A 2VTMA 2W1IA 4KS8A 2PWLA 3MY1A 5FD2A 3AC1A 2PMLX 2QURA 1VEBA 1YHWA 4FKOA 1OL5A 5HE1A 4F7LA 5GZAA 3CY2A 4K6ZA 3EL7A 4MUQA 5IQHA 2R9SA 4TYHB 1ZYCA 4KIPA 3HV5A 4IW0A 2JAMA 4YJOA 4QP7A 1PXLA 4YHTA 3UTOA 1GOLA 2XIKA 5F94A 4GFGA 2IPXA 4BCMA 2VAGA 4QMLA 4ZSAA 4D4VA 4YUQA 3ORPA 1WMKA 5CF5A 3VW6A 3NYNA 3ET7A 5E8XA 2CN5A 5B7VA 3AMBA 3ZBFA 4GUBA 2VV9A 4IANA 4B4LA 3QRUA 3QL8A 4BDKA 3V5PA 4B9DA 3W10A 5HTCA 3V8WA 3PXYA 2I40A 4QP2A 3DTCA 5HIDA 5ACKA 3HYHA 5KCVA 3BHYA 4E4NA 5DBXA 2NO3A 4J8NA 2QOLA 4YPDA 2RF9A 2OKRA 5EI6A 4FV8A 4DHFA 5HO7A 2QOIA 2Y6MA 3P78A 2RIOA 3CTHA 4OBPA 2P3GX 3RWPA 3AD4A 2FSMX 2R3FA 4QTEA 2RFNA 3BGPA 1KV1A 1GIIA 2PHKA 4J98A 3UYSA 5AFVA 3E5AA 1OBDA 1KE9A 4PUZA 4XX9A 5DT0A 2PMOX 2ITXA 1OI9A 3AMAA 4QT1A 4ALVA 4ERWA 2B9HA 4EJ7A 3PPZA 1J3HA 2OZAA 2NP8A 1JSTA 5FEEA 3ZEWA 1BLXA 2NRYA 1KOBA 4KRDA 4O81A 3UOLA 2IW6A 4I20A 5JT2A 4U3YA 3GCQA 3FI4A 4FKLA 4F1TA 3CEKA 1OIUA 4O6LA 3UOJA 1VLRA 2IZSA 5FXRA 3G33A 3KB7A 3VS7A 4LRKA 2VTLA 2ZDUA 2O64A 3GVUA 3NNUA 5FRIA 2VWVA 3KULB 4EH4A 4FRFA 4F99A 4F4PA 4FSQA 2JKOA 1YXVA 3PWYA 4J99A 4O84A 3D9VA 4D2VA 4EYMA 5CVGA 2UW6A 4FSNA 3L8XA 3FHIA 1SYKA 2OK1A 3UPZA 3Q5IA 4YMJA 3RI1A 4HNFA 5CYIA 3MS9A 4YHJA 3LFEA 4QRCA 4LL0A 1Z57A 4YHFA 1P4FA 3Q3BA 4EBWA 2R3PA 3LCSA 2OJ9A 2CKPA 2EB3A 3VQUA 3VBTA 4GU6A 4IVCA 3QX2A 3GCVA 2YCQA 3F5GA 4M97A 4CYIA 3VF9A 4BCPA 2CGUA 4GW8A 4MQ1A 5DEWA 3R8VA 5KMOA 4AOIA 3T8OA 5HQ0A 4C62A 2BILB 4X2FA 4NZWB 4XEYA 1UKHA 1V0OA 3FZRA 1W98A 2YEXA 3NNVA 3GC0A 4GL9A 3NIEA 3PE1A 4KSQA 4BKYA 3GC8A 2QQ7A 2HIWA 3NUNA 4D5KA 1G8AA 4BWPA 3VUHA 3AD5A 3IW8A 4IACA 4OTFA 1W83A 2XKCA 3QWJA 2YIQA 4ZTRA 5AUZA 3TNIA 3TNWA 4GH2A 4YZBA 3FBVA 2HZ0A 5GJFA 1KE5A 2C30A 3C4EA 4IB3A 4KS7A 3ZRMA 4ZZMA 5E8TA 4BGQA 3I0OA 4QMSA 2JLDA 2WEVA 2X4FA 3GB2A 3NYVA 5KX8A 4KD1A 5TKDA 4CCUA 4DEEA 3BL7A 4JG7A 2VWXA 3CTJA 3RK5A 2OIQA 5IA3A 4XS2A 2QCSA 5IA2A 1OECA 4ZJJA 2NPQA 4JRNA 2QG7A 3E7OA 1RQQA 3BE9A 3SHEA 3BWFA 3GU5A 2FSTX 4C4JA 4RC3A 5J8IA 5M57A 3FY2A 4O7WA 5H3QA 3LW0A 5ANJA 3TIYA 4YJSA 4O83A 4BIDA 3HRFA 4D5HA 3NW5A 2P33A 5K9IA 2ONLC 2HK5A 2PE2A 3IW7A 3IOPA 4I0RA 3JVRA 5AR8A 2PL0A 3CQUA 4OTIA 4C37A 4EH3A 4EZ3A 4KIQA 2P55A 4TW9A 4AW0A 3O2MA 1ZMWA 3BU3A 2W7XA 4EWHA 5CT0A 3P08A 1I09A 3ALNA 3KMUA 3QHWA 4H1MA 4MBLA 4O7LA 5IQAA 4AXEA 3WE8A 3GXLA 3R1YA 2YM5A 4LI5A 4RFYA 3N4TA 3W0NA 3BZ3A 4X3JA 4MXCA 4OTRA 3V01A 3WARA 2Y9QA 3RCJA 2LGCA 1ZYSA 4XG8A 1W2FA 3JUHA 1ERKA 4WSYA 5ETCA 5BVEA 5F95A 5HEZA 4EUTA 3BLAA 4JI9A 4PP7A 2HY0A 5I9XA 4O2PA 5GJGA 1LEZA 3U4UA 5ETIA 2ERKA 4IAIA 3W32A 4BYIA 3SA0A 5IPJA 2C6EA 3UZRA 2VX1A 5D12A 1V1KA 4HGTA 5CI6A 1BL7A 3FMHA 3KK9A 4FTQA 1UWJA 5D1JA 3R2YA 5B2LA 4R8QA 3COKA 4GRBA 2H8HA 2HW7A 1Q8ZA 2Z7SA 3D5XA 1H1QA 3G90X 3G9NA 3JS2A 3QLGA 5CENA 3U8WA 4FE2A 2CNVA 1PXNA 3PG1A 5HD7A 4YJNA 1OUYA 2YIYA 4BDEA 2JDTA 3HA8A 4ZXTA 3OCTA 4PMSA 1W84A 1YDRE 1QPCA 3ZSIA 3D2IA 5E91A 4NYEA 5KHWA 2J5EA 4QQJA 4YC3A 4WUAA 4NU1A 2VWWA 1QMZA 3FZ1A 4DEHA 1CKPA 4D1SA 2G9XA 2W4OA 2FH9A 1MUOA 4ZLYA 3KN5A 1YWVA 2QOFA 2A27A 4KBAA 4C4GA 4D2RA 1Q8TA 2QHNA 3EFKA 2WTWA 2WAJA 3B8RA 1VYZA 5I9YA 3D5UA 2W1FA 4E6AA 2R7BA 3M2WA 1KE6A 3D2KA 4IVDA 4FT0A 5KMMA 3LVPA 4ZS0A 4AGCA 4EH7A 3PZEA 2EU9A 4W4YA 4D28A 4R7HA 4C8BA 3TNQB 2VNYA 4BCQA 2R5TA 4HVHA 3L1SA 3LKMA 2X7OA 2YZAA 1M14A 4UXQA 3O7LD 4JXFA 4M67A 4FNYA 4UEUA 3PXFA 5FWKK 2C5NA 3WIGA 4D1ZA 4FX3A 4UMTA 3ZO2A 4OT5A 5HE0A 5L6WL 4ZAUA 5EDQA 4IX4A 5LCJA 4HCTA 1WBSA 3WZKA 2AC3A 2CLQA 3QUEA 1BUHA 3KVXA 2PVNA 3VWAA 2WTCA 5HORA 2WMXA 3QTXA 4I92A 4KRCA 4QQ5A 4FSMA 4K2RA 2XAMA 4GUEA 1UVRA 1STCE 1FPUA 2XP2A 2WQNA 4L3JA 5EKOA 5LWNA 2BMCA 3WZDA 3D83A 4I3ZA 1O6YA 3QCYA 4FT9A 4RIWB 4ANQA 2WNTA 5KZIA 4A9YA 4EOLA 3BHVA 4UN0C 2OZAB 4C38A 1R78A 4TL0A 4GKIA 4JG8A 5F9EA 4EI4A 4DFNA 4JDJA 3M42A 3Q4ZA 2B1PA 2G01A 2C5XA 3FZPA 4FEUA 5FDXA 4DEDA 2WFYA 2VWYA 4HVGA 4L01A 2WMUA 4AZWA 2W1HA 3NX8A 4NM5A 2OXYA 3DJ7A 3I4BA 2GHGA 3TIZA 4CT1A 4D9UA 3RPOA 2YZLA 4RJ5A 1JSVA 2XEZA 3R00A 2OZOA 4BI1A 2XAOA 3FMDA 2PUPA 3KREA 4DTAA 5IDPA 1BKXA 2W9FB 5CSXA 5HI2A 4FOBA 3PPJA 4EL9A 4ZLOA 2IW8A 4F78A 5JZJA 5L2QA 5EK7A 4ASDA 4YBJA 3RWQA 4F1MA 2C69A 4O7ZA 3EN9A 4HZSA 1FVRA 2Y6OA 1OL6A 2WMAA 3KXNA 3Q96A 3WYYA 2CSNA 3RAHA 4CKJA 4ZTHA 2UZEA 3B2WA 3QHRA 4FZ6A 4A9UA 3CGOA 4AN2A 1J7IA 3QYWA 3QD0A 4R6VA 5IH4A 4AW1A 5B0XA 2BHEA 3PA3A 3QRJA 3HMMA 3PP1A 3TUDA 4PTCA 3O5AA 1Q8YA 2PVRA 4FNWA 3PTGA 5HX8A 2WD1A 2QO7A 3UYTA 5K5NA 5E8SA 1FGKA 2PK9A 3RZFA 2A2AA 3FMLA 3M1SA 2JGZA 4FIGA 4OBQA 3I5ZA 4FTTA 4YLKA 5DWRA 2XM9A 4TT7A 5JSMA 3KL8A 4XG7A 5ITAA 2WTVA 1LR4A 4A4LA 4DFLA 1FINA 5F20A 1JNKA 4GMYA 4C4EA 1PW2A 3FE3A 4JR7A 4PY1A 4DEAA 4BCJA 1IAJA 2IJMA 5C8NA 4EHGA 4YJRA 4AOTA 4FGRA 2W4KA 1V0BA 2JIIA 3C5UA 3DU8A 4B8LA 3TDVA 3TMOA 4P5QA 2UV2A 4HVIA 1XQZA 4A9RA 2IZTA 2JKKA 4DGOA 3QZFA 4CGAA 4EZ7A 1JLUE 4DGMA 4JG6A 1W82A 4XG9A 3MFTA 4BB4A 5LVNA 5M4UA 3CY3A 2VTSA 2YITA 3F3TA 5DA3A 1WBPA 1YWRA 3PXKA 4HPTE 3JR1A 4RJ4A 2PZRA 2FUMA 5I9ZA 2GFSA 4FZFB 3FMEA 3FI8A 1T46A 4AA5A 3R22A 4D55A 3FYJX 4ZY4A 3F88A 4RRVA 1XKKA 2FSLX 5E8YA 2AC5A 3OP5A 4GK4A 2W5AA 3D5WA 3TNPC 4ASZA 4PMTA 3HZTA 2W1ZA 1UNLA 3P79A 1UKIA 3QQHA 4LYNA 3TZ9A 4L00A 4UMPA 3O51A 4P90A 5IEXA 4I94A 2J6MA 2UZVA 3VC4A 1TKIA 4NIFA 3VBQA 4IX6A 2I0EA 3BQRA 2YIRA 1PMEA 3AGMA 4G9RA 3WOWA 3ZMMA 4QMWA 3MVLA 5IQIA 2BAQA 3H3CA 4GG7A 5EG3A 3EH9A 2WO6A 2UW5A 2ZDTA 3BYOA 5BYZA 5FTGA 5HHWA 5FM2A 4DTKA 3OCBA 5BVOA 5EI2A 2X8DA 4AE6A 3O96A 2J2IB 2DQ7X 3UQCA 3B8QA 3OWLA 2WQMA 4V01A 3F2AA 4I24A 4AZVA 2W99B 1XO2B 3OY1A 2YHVA 2KULA 2ZAZA 4IX5A 3VS0A 1F3MC 3HA6A 3R01A 4ZMFA 2X2KA 4RC2A 2I0YA 2OI4X 3FZOA 4YPSA 4O0WA 4C34A 4E6DA 3DZQA 4E6QA 5AR7A 4CZUA 3EB0A 4AA4A 4KSPA 3A7JA 3H9FA 4IMYA 5BQ0A 4I23A 3ORKA 5L2WA 1YHSA 4AZEA 4MXOA 4FA2A 3TKUA 2OICA 3ZC6A 2XJ1A 2VN9A 1QPJA 4R78A 4JR3A 3ZS5A 4BC6A 3SQQA 4C7TA 3QTWA 5M4FA 1WAKA 2ZV7A 3MI9A 4O4BB 4YLLA 4BI2A 4D2WA 4M0ZA 4H58A 3COHA 2YISA 3RPSA 4AX8A 1ZOHA 3R9OA 1BL6A 4LFIA 1XBCA 1FMOE 1OKYA 2Y8OA 3V5QA 4XJ0A 2NNWB 1Q3DA 4BZDA 3MN3A 1R0PA 3WIKA 3L9NA 1M2PA 3MY0A 3R7YA 5A54A 3HDNA 4M0YA 4EKLA 2X0GA 2CHLA 4TNDA 1U5RA 4YLJA 1U54B 4U41A 5J95A 3VRYA 4CFUA 1UA2A 3FXWA 4RVKA 3DS6A 4WNPA 3DTWA 3ZFXA 4GIHA 1M2QA 3R73A 1DI9A 5GINE 2CDZA 3HMIA 5C8MA 2OIBA 4FYNA 5AV4A 3LCDA 3WF7A 3UNKA 5EM7A 3D0EA 4X3FA 3IOKA 3DNEA 5T6KA 4E6CA 4IZAA 2WOUA 2IZUA 4X6QC 3UDTA 3EWHA 5F1ZA 4WT6A 4EH2A 2GPHA 3ZTXA 4BBEA 3DJ6A 1H1WA 3Q9YA 4BVUA 5KMLA 4DFYA 2CJMA 4EORA 3FLSA 2J0JA 5EFQA 5BVDA 3UQFA 5FBNC 1AGWA 4FT3A 3TWJA 2BKKA 2EWAA 4EC8A 5A4CA 3AC5A 1NA7A 5AX3A 2YJRA 3EQBA 3KCFA 3R63A 2XIXA 3LXKA 3QC4A 2RFDA 5I3OA 3NVKI 4GJ3A 5J9YA 2VNWA 3CR0A 3KKVA 2E9UA 2XF0A 5HKMA 4F9YA 4BTFA 4FKGA 2F57A 5CF4A 4LUDA 3GU8A 3OF0A 3RKBA 4IWOA 4QP6A 4WNMA 1XMMA 1OIYA 5CTPA 5GIPE 5E7RA 1OIQA 4GFOA 4O1PA 3CPCA 4QTCA 3QZGA 2UZDA 4Z7HA 4TWOA 2ITTA 2QG5A 4JIAA 2PZYA 3HMPA 4IEBA 4IX3A 5AM7A 1GJOA 1A06A 3KA0A 4ZZOA 2OH4A 3ZHPC 3FAAA 4IVAA 5L6PA 1SZMA 3FQSA 3HKOA 4QYHA 4R1YA 5CSVA 4E4MA 2DUVA 5HVYA 4OTPA 1WBNA 3C4CA 2PPQA 3FQHA 3K5VA 3VQHA 5ANGA 4EHEA 4NUSA 4F9AA 5KO1A 1GNGA 4AE9A 3EHAA 4DEGA 4FTRA 4RFMA 3JXWA 1JVPP 5HU9A 4IZ7A 2J0LA 1Q3WA 4BF2A 1SNUA 4H1JA 3SGCA 3FSFA 3BHUA 4AU8A 4QP1A 2YACA 3IDBA 3MW1A 4JDIA 1U5QA 3IK3A 4FV0A 3EKKA 5CU2A 4AGDA 4RT7A 1R3CA 2R0UA 1PHKA 3G51A 2ITUA 5HE2A 1M7QA 2I1MA 3V5JA 5AP0A 4IAYA 3SVVA 5M09A 3LCKA 2JIVA 4CSVA 2C0IA 4HYSA 2VTPA 4M7IA 2B54A 3GQIA 3R8LA 1H27A 2R0IA 2FB8A 5IH6A 3OD6X 3BX5A 3VW8A 4BY9E 3A60A 4FYOA 2F7XE 4ZS4A 5EQEA 5CAVA 3QQJA 1URWA 4G3EA 2EUFB 3OEFX 2XJ0A 3ENHA 4MBJA 5EHLA 4DGLC 5K4JA 1Y91A 4DT9A 3NDMA 1HCKA 4QP9A 1OUKA 4IB1A 4GVAA 2BTSA 3IGOA 4YGAA 1PXPA 2QOCA 3W18A 3TM0A 4L3PA 2JIUA 1U46A 5HG8A 5JZNA 5AJQA 5KKRB 5IQEA 4UMQA 1BMKA 2PY3A 5HBEA 2X7FA 5CF8A 3HAMA 5E92A 3KK8A 1E9HA 4BBMA 3P7CA 4NIFB 2Y4IB 4WA9A 4DH7A 4EZ5A 3BI6A 1W0XC 3CGFA 2XNOA 1ZZ2A 3R8UA 3BIZA 2BALA 4YU2A 3AT3A 4U81A 1YOMA 3WF6A 3FI2A 4AAYA 1H1RA 4PDPA 4O7VA 4ANOA 4EOKA 3CXWA 1WVYA 3MH0A 2ZM1A 4CRLA 4O7RA 2ACXA 4N6YA 5AADA 4BDDA 4FKPA 3BRBA 3CD8A 3HX4A 3VUTA 4E8AA 2BDJA 3N4UA 3PLAE 3H0ZA 2XCHA 5CEKA 5T3QA 4ACHA 2R2PA 4R3RA 4LOOA 5E4HA 4BTJA 3NMUF 5CZIA 4D2PA 4Z55A 4D58A 3RINA 4DGGA 3CCNA 3F66A 4JQEA 4RSSA 5CASA 5IU2A 4YP8A 2PVLA 4S34A 3R1NA 4BCFA 1PRYA 2PZIA 4EC9A 4UWBA 3T9TA 4DLIA 4BN1A 2VX3A 1JKSA 4YJVA 1P5EA 3EQCA 3OUNB 5H9BA 3C1XA 4FV5A 4ANSA 4YC8A 1XH6A 4BDGA 5CU3A 4F9WA 3DDQA 4FKRA 2RFEA 4J97A 3LQ8A 3MH3A 4MNEA 3SW7A 3ORIA 4RC4A 5H2UA 2UVZA 3DV3A 4FK6A 5FXQA 5IF1A 4UBAA 4O82A 2E9PA 4ZTQA 4DE4A 3TI1A 4OBOA 1P14A 4ZTMA 2NYAA 4ZJIA 3HV4A 5DE2A 4R5YA 1O6LA 3E88A 1XJDA 4YC6A 4EEVA 3F3ZA 1YXSA 5DYJA 4RJ6A 2PMIA 1ZYJA 2VGPA 4U79A 3UC4A 4G9CA 3QX4A 4B7TA 2Z7RA 3RZBA 2RGPA 3AKJA 4F09A 2UW7A 4DA5A 4GIIA 2WIPA 4GK2A 3LOKA 5DMZA 5ANDA 2R3MA 5JFWA 3H10A 3UDSA 3U6IA 1ST0A 1XWSA 3RM7A 4HNIA 3IQ7A 3S0OA 1NW1A 3UODA 3LLAA 2AUHA 4QMPA 3SXSA 4F63A 3DDPA 2XNEA 3E7VA 3OXTA 4YTCA 2QLUA 4X3FB 3FC2A 4KNBA 5KBRA 4QNAA 2Z02A 2YFXA 4BDBA 3ERKA 3MTFA 3JPVA 3MBLA 4BYJA 4PNKA 3U6JA 3QGWA 3RM6A 4MH7A 2Q0NA 3PY0A 3W2SA 4M68A 4FEXA 2HZ4A 3LQ5A 4HYUA 1HCLA 3Q6UA 1SVHA 2WTKC 1AD5A 4JQ7A 3K3IA 3LHJA 1YI6A 3RPVA 3P5JC 4FEWA 3AT2A 4BDFA 4P5ZA 1SNXA 1FMKA 3DLSA 4P2KA 4XCUA 3CS9A 3D15A 3UVRA 4LMNA 4E93A 4RGJA 5LWMA 4BR3A 2FA2A 2JKMA 2IVTA 3GFEA 5D9HA 2PVMA 3DAKA 4M69B 5FEDA 4R3PA 3TZMA 4USEA 2EVAA 2GNFA 4IB0A 2X9EA 2W06A 4U40A 2C5YA 2YJSA 3OTVA 1H8FA 3KMWA 1W8CA 1YQJA 3ENMA 3UMWA 2JFLA 4L3LA 4D0XA 5EM8A 4UY9A 1LPUA 2F7ZE 2W1DA 2I6LA 2XK3A 5ANOA 5KBQA 3W0SA 1BYGA 3NNXA 3AT4A 4IFCA 2F7EE 3UNZA 3UO5A 3CC6A 3RMFA 2VTJA 3ZLSA 5EYMA 4MNFA 1R0EA 3RALA 2JDRA 1Y57A 4O0TA 5C27A 2W1EA 4S32A 3VBYA 5IG1A 4DGNA 3S95A 3BU6A 3GI3A 4OTDA 4PL3A 5E1EA 4L46A 4BTMA 4FTKA 3EZVA 4L68A 2IZRA 4BIBA 3R1SA 4G2FA 3FMMA 3P23A 4ASXA 2QD9A 3LJ2A 4FICA 5DR6A 2OGVA 3RAKA 4U42A 4ANLA 1RJBA 2BRNA 3KY2A 4DEBA 4FV4A 4XUFA 3C51A 3PWDA 2A19B 1YI4A 1OKZA 2AQXA 2UW0A 2YAAA 3OHTA 4M14A 3GCUA 1OL7A 3F5XA 3PA5A 1NT2A