1RDQE

Hydrolysis of atp in the crystal of y204a mutant of camp-dependent protein kinase
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
350
structure length
340
Chain Sequence
GNAAASVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEALAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a cAMP-dependent Protein Kinase Mutant at 1.26A: New Insights into the Catalytic Mechanism.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase, alpha-catalytic subunit
total genus 109
structure length 340
sequence length 350
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2003-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1rdqE01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1rdqE02
5I9XA 2UW6A 2NO3A 4UN0C 4GW8A 2WQNA 2XB7A 2GHLA 4WSQA 3VUDA 4CQEA 3QD2B 2JKQA 3AOXA 4U3YA 5JFXA 4BHZA 2BRMA 5CENA 2PUIA 4II5A 1UNHA 4BKYA 4Q9SA 3W33A 2VTSA 2BAQA 1UKHA 4G6LA 4ZY6A 4JAIA 2B0QA 3LJ2A 1LR4A 3GUBA 2ERZE 2VRXA 3NDMA 3GFWA 4I4FA 4M15A 3VBQA 4FIJA 2PVMA 4BYJA 3Q6UA 2OFUA 4RFZA 4X7QA 4BCKA 4DFNA 3F3UA 5JGBA 3I1AA 4YJTA 4I92A 5CQWA 5DRDA 3ZDUA 4ANBA 3KULA 3NCGA 4X2JA 3HRFA 1XR1A 4EQCA 4FV8A 3W2OA 4MQ1A 3SQQA 3RPVA 4N6YA 5J1WA 4FIIA 4WA9A 1AD5A 5EDQA 2RF9A 3Q4CA 3R83A 4RLLA 2GNLA 3DB6A 4AW2A 4R3CA 3OFMA 1PXPA 2Y6OA 2QO2A 5FXQA 4LUEA 2YIRA 2R0IA 2NP8A 5ANKA 3TI1A 2WMVA 4DBNA 4MXAA 2GNFA 4OAVB 1KE9A 3NNWA 5HG8A 3IGGA 4BDIA 3W8QA 5DNRA 3WF5A 4PTCA 1M7NA 3MA3A 2IVSA 3QUPA 4YSMA 3VWAA 4IZ7A 2C69A 4F9AA 2QU5A 4RG0A 3VO3A 3VW8A 4N70A 3FZTA 3OF0A 3E8DA 4IANA 5ANOA 4YP8A 5TT7A 2CNUA 3L9LA 2ERKA 3OC1A 3VQHA 3QUDA 4XP2A 1SVHA 5M07A 5HTCA 3R9DA 3AMAA 4KKGA 3HAMA 4X2KA 1YXVA 2JKOA 4F6SA 4EH5A 3VBTA 3EQGA 3PJ8A 4FTLA 4ZS4A 2DWBA 4FV2A 1MQBA 4TWNA 4QTEA 3KL8A 3VS2A 5LQFA 3DKFA 5AR8A 5AUWA 4MD8E 2B9HA 4L53A 3MFSA 5HORA 4FZFB 4MKCA 3ERKA 3QRJA 5K5NA 2CPKE 3ZYAA 1VYWA 3NCZA 4UWCA 3GCSA 3B8QA 3HAVA 3IDPA 1OKVA 2C5YA 3FV8A 2QOCA 4W4XA 4DYMA 3PXFA 5DYJA 1SM2A 3TL8A 4BI2A 4E20A 4MX9A 4LOPA 1K9AA 4NUSA 3PE1A 3JY0A 2UW9A 4LM5A 5HBJA 2J0IA 3NUXA 3ZOSA 4KNBA 2E9UA 3TNIA 3G15A 4RX8A 5M08A 2C4GA 4G5PA 3V5QA 3A60A 3HYHA 3KN6A 4EHZA 4I6BA 2Y4PA 4NW5A 5CVHA 3A2CA 3MY1A 4YZBA 3O51A 1XWSA 2VWZA 4I0TA 3DZQA 3PZEA 3A8WA 5HGIA 5C03A 3UZRA 2P55A 4C34A 3FY2A 4UMQA 2W5HA 5HG7A 3ZO2A 2GTMA 4GVAA 2C3LA 3CC6A 3VC4A 2OF2A 2W1CA 5J9ZA 4C4IA 4EJ7A 2WB8A 2R3FA 4OT5A 3VVHA 2J5EA 3QHRA 1K2PA 2Y4IB 2QR7A 3F69A 2GS7A 3KC3A 1R1WA 4D1ZA 3QYZA 5I4NA 3C51A 4JDKA 3CTJA 4Z9LA 3N9XA 2WQOA 3ENMA 1YDTE 2XNBA 5D10A 5CNNA 4ARKA 3HUCA 3TNWA 5IUGA 2O5KA 2XIYA 4KBCA 4NCTC 4W9XA 2OFVA 4G2FA 3LQ5A 3V51A 5DR9A 2QR8A 2DS1A 5I9UA 4UMTA 5IUHA 2C6IA 5IUIA 4G34A 3MN3A 4FNZA 4UWYA 2BDJA 3DB8A 4ZJIA 4NYEA 3OCTA 4GS6A 3FKOA 4XJ0A 4EH8A 1OITA 4MBLA 4W4WA 3RK9A 5DT3A 1M17A 2F7XE 4MH7A 4ACCA 3LLAA 4CT2A 4QMOA 3VNTA 4DH8A 1H24A 1PXJA 3FPQA 2EU9A 4YJQA 3SC1A 4U43A 2OO8X 3GCQA 4BDDA 3W32A 3POZA 4I6QA 3OY1A 1XH6A 1RDQE 2ONLA 1OBDA 2BILB 1FVRA 1APME 2IJMA 4JX3A 3BHTA 5AP1A 4X21A 5ETAA 3VS7A 3QBNA 5E4HA 4ZTSA 5EM6A 4MBJA 3SOAA 3KVWA 4IX6A 3V5PA 4C3RA 2ONLC 3I6UA 2ZV2A 2O0UA 4LRMA 4MEDA 5FP5A 4I3ZA 3PLAE 2ITWA 5H8BA 1Q41A 1KWPA 2XEYA 5C27A 4FYOA 3FMDA 4FKGA 4JLCA 4WUNA 4R5SA 1FINA 4QTCA 1W8CA 4NFMA 5AA9A 4R1YA 2GSFA 3DBDA 3AGLA 4TZRA 3ZU7A 5IA4A 3KXGA 5CSWA 4OTPA 5HEZA 4L9IA 4APCA 3UIUA 3UO5A 2VGOA 1OB3A 3PA5A 2CNVA 3VF9A 2CDZA 2X39A 3RHXA 3HVCA 1RJBA 3C5UA 4BCFA 2VNWA 2C5NA 3EOCA 5B2KA 5CAVA 3MV5A 4F7LA 2XS0A 4FG8A 2PE0A 3QXOA 3BI6A 4M0ZA 3Q5IA 2V55A 1JKTA 4P7EA 1YKRA 3FY0A 5D7VA 5KNJA 2R4BA 3ORXA 4EH9A 3MFRA 4WUAA 4RX5A 2W4OA 1ZY4A 4HCVA 4GYIA 3R1SA 4UXQA 4D5KA 3NR9A 2A27A 5L3AA 2J2IB 4FI1A 4GEOA 3C0IA 3ZXTA 2BKZA 4ALVA 2C0OA 4GT4A 3QC9A 4MXCA 4FEVA 4FOCA 5BMMA 1U46A 3O17A 3L8VA 3TCPA 1ND4A 4IFCA 2XRUA 1OGUA 3FHRA 3L9PA 3Q9WA 4FSYA 4H39A 3R7VA 4EZ5A 3R01A 1CTPE 2GFSA 4NKSA 4QMWA 2ITVA 3DNEA 4NZWB 3VAPA 3OG7A 1PRYA 5HNIX 3QWKA 1JBPE 4RWKA 2ZM1A 4DCAA 3P86A 3ZTXA 4EHGA 3KB7A 1ZOEA 5EQYA 4UALA 2J9MA 1BL7A 1ZAOA 3PVGA 4YHJA 3UQGA 4AZWA 3PG1A 4IX5A 1NXKA 2X2MA 3COKA 3E62A 3FLYA 4ACMA 1ZZ2A 1P5EA 3HMPA 1Y6AA 3WZEA 2VNYA 3AT4A 3D7TA 4P90A 3RWQA 2UUEA 3O96A 5ANIA 3C4XA 3C13A 4J96A 5AP6A 4A9RA 2EB3A 3IG7A 2WTJA 3EQIA 3EHAA 3ZFXA 4HW7A 5EHYA 5CX9A 1ZYSA 4CQGA 2BHHA 2UVZA 3PXYA 2AYPA 3TACA 3C4ZA 2BFXA 3UJGA 4QTBA 4GMYA 3LXLA 5A54A 2UZWE 4QYGA 1P14A 5DMZA 5DWRA 4AZFA 4WG4A 4AZSA 2WIHA 2C3KA 3W8LA 3DK6A 3TT0A 4FV9A 3TTJA 4A9TA 2UZBA 2WIPA 3H9FA 3KRJA 2X1NA 2F49A 4HNIA 4IC7A 3E5AA 5IH6A 4JIAA 1JSUA 4FKLA 2R3IA 5A6NA 3WARA 3CCNA 1H0WA 4UB7A 1OIYA 3O0GA 5JZJA 2YA9A 5IMEA 1Y6BA 3QQFA 3E93A 1F0QA 4O38A 5GJFA 3TTIA 3UYSA 3E64A 2CGXA 3LKMA 4DH1A 4XG4A 1ZMVA 2PMIA 3R1QA 2C6MA 2FH9A 3QQKA 4ASDA 3MVHA 4JDHA 4AT5A 4BBMA 3FEGA 4QO9A 3D5VA 4BGQA 2EXEA 3F5GA 3RCJA 1WBSA 5BPYA 1BI7A 3BE2A 4ZZMA 2PVHA 3DKOA 1PF8A 4BYIA 3E8NA 3POOA 4AW5A 2X4ZA 2GNIA 4USEA 3OS3A 2ZV8A 4DG3E 4MYGA 4QYFA 3MB6A 2YIQA 1ZMUA 4L68A 3K54A 4HCUA 1V0BA 4IVBA 5L2IA 2BCJA 4JBPA 2ETRA 2QNJA 3DLZA 5HE3A 3FZPA 3CBLA 3QXPA 4HCTA 4IADA 1J7LA 2JDVA 2FO0A 5AR7A 3GQLA 4XEYA 4JDIA 3U54A 3K5VA 1QMZA 3ZLXA 2CGUA 3ORNA 3DT1A 5AR2A 3KXZA 4EJNA 3PP0A 4GUEA 4QP1A 2P2IA 2CN8A 2X2KA 4I93A 5DN3A 5AP0A 4MXZA 4LMUA 2PE1A 3BWFA 1CKJA 1XH5A 1ZRZA 2B55A 4QQJA 4MWIA 2JDSA 5E8TA 4F63A 2I0VA 3KMUA 2BROA 2XNOA 1YDSE 3FMNA 3PA3A 4KBAA 5JKGA 4BDJA 3CE3A 3I60A 2I0HA 2OJJA 3EZVA 4BTMA 3CTQA 5LMKC 4E8AA 2QOLA 4ANOA 1XJDA 1T46A 4FR4A 3UDBA 3DBFA 4QMPA 4A06A 5EI2A 4AAAA 4ZLYA 3NEWA 3WZUA 4MNFA 2B9IA 1ERKA 5HG9A 1ZLTA 4JG7A 1Q8YA 3FLWA 3P7BA 3CKWA 4JRVA 5JT2A 5CEQA 1W98A 3FUPA 5EM7A 3CIKA 3NYXA 3WZDA 4TYEA 4B6LA 4FV4A 2YJSA 2JDRA 4CCBA 2IW9A 1M7QA 5BQ0A 3QKKA 5A4QA 4KABA 1J1BA 4M67A 3G5DA 3ZLSA 4UMRA 4BY9E 4F1MA 4Q2AA 2Z7QA 3D5XA 4H1JA 4JT3A 3NUSA 1HCKA 4LV8A 4XP0A 4CXAA 4F70A 4EHEA 4HGEA 4Y95A 4I5PA 1GOLA 4M8TA 4KSPA 4OAUC 4PQNA 4K33A 3TDVA 2V7AA 4DTBA 4FYNA 2IVVA 2X81A 1Q24A 3F61A 5CU2A 4XNEA 3ULIA 2HXLA 4AW0A 1NVQA 1W84A 3V8TA 3F6XA 4CT1A 1ZYCA 4IAKA 4BWKA 2HW6A 2YJRA 3WOWA 1FMOE 2XH5A 3EQBA 4YPDA 3QF9A 2VX0A 3BQCA 3QTWA 5AUUA 4L45A 1H1PA 2XM8A 2XCKA 3H0ZA 4AP7A 2QOBA 3AMYA 2VO7A 3OTUA 2GCDA 4MXOA 2A1AB 4O27B 4FGRA 4AWIA 4IBMA 2WMBA 1DS5A 1SYKA 4BICA 3FLQA 5GJGA 2JKMA 4UBAA 4C33A 4OLIA 4AGUA 3MVLA 4HVSA 4FTCA 4NJ3A 2QKWB 4RWIA 5CAPA 2IW6A 3HMNA 4YC8A 3RHKA 4TYHA 3CXWA 4WBBB 3T3VA 3ZSGA 2FA2A 3NIZA 4ZK5A 1GAGA 3TV6A 5DE2A 1H25A 4CYIA 2QCSA 4ENYA 1FBNA 4CNHA 1Q8TA 4IM0A 3GOPA 1Q3DA 4B9DA 2V22A 5HESA 1MUOA 3I79A 2W0JA 3LCSA 3T9IA 4ACGA 4RFYA 3A7FA 5TR6A 3R28A 4XH6A 5JN2A 1PXNA 3TNHA 4L67A 1JKLA 4QTDA 4I21A 4W4VA 5FTQA 5CS6A 4O0UA 2YCRA 4L00A 1PMVA 4GT5A 4OTFA 4E3CA 3CD3A 3NW7A 3F3TA 2VWBA 4PDSA 1QPEA 4FL2A 5EI6A 4QQTA 2RFDA 2X7FA 4RMZA 4F64A 2QG7A 2E9PA 4HZSA 3VJNA 4FKIA 1YXXA 4O0VA 2UW0A 3GCVA 2GS2A 4U7ZA 5HE0A 4NM3A 4ZSLA 3LHJA 2YABA 4IM3A 3IQ7A 3TKHA 5D7AA 4ZTLA 3WIKA 4C4GA 2DUVA 3UQFA 3IOPA 4KAOA 3ZZWA 3TUDA 4D0WA 4Y8DA 2C47A 5M53A 2VAGA 2VN9A 4PPAA 4BWXA 3UZTA 1ZY5A 3GB2A 5BX0A 4IJPA 5AR3A 2R7IA 4DINA 4F7SA 5A9UA 4Z7HA 3LW0A 3K2LA 3NPCA 3L1SA 3RM7A 5JGAA 5KZIA 3B2TA 4L7SA 3Q04A 2PVNA 3OCSA 3NS9A 2XCHA 5CY3A 4WNPA 2WMUA 3MA6A 5F94A 5T6KA 2BRHA 1Q8WA 3MWUA 4PY1A 3SGCA 2OH0E 2P4IA 3JVSA 5H8EA 3RWPA 3TV7A 2EB2A 2JGZA 4UYNA 4YJSA 3ZC6A 3KFAA 1GIJA 5LCKA 5CLPA 2C30A 1SMHA 5L8KA 1QPJA 3Q53A 5M56A 5L2SA 4Q9ZA 2XK6A 4FEXA 4AZVA 5HTBA 2B4SB 2JD5A 5LWMA 4HVIA 1BX6A 1VEBA 3BKBA 4LRJA 5D12A 5I9ZA 1NW1A 4JR3A 2QHNA 3GP0A 4YJPA 5EW9A 4PNKA 2FVDA 3DTCA 3OMVA 4U80A 1IA8A 3A7IA 3M1SA 2HZNA 2UZEA 4TNDA 5KMMA 2V5QA 1H1WA 4ZTNA 5KZ0A 4CLJA 4DT9A 2I40A 2QQ7A 5HI2A 2O2UA 4JRNA 4GG7A 3S00A 4DEGA 4QPAA 2YFXA 4Z7GA 3AT2A 5CAOA 3FL5A 2JDTA 3DBQA 4FBXA 4QQ5A 4TYIA 4YTCA 3BELA 2C6DA 4FTOA 1MQ4A 2C1BA 3VBVA 5AV3A 2JFLA 2H6DA 3Q32A 2WO6A 4FSUA 4ASXA 1IAHA 4G6NA 3A7GA 4K9YA 2PUPA 4U6RA 5B7VA 4S33A 2GDOA 1Y57A 2OZAA 5KX8A 4RIWA 5GJDA 4NTSA 3NNVA 2OJIA 2VO0A 2FSOX 4C2WA 4RJ8A 1H27A 3P9JA 5KMNA 5AFVA 2AC5A 3RGFA 4RQVA 3UO6A 2HAKA 4BI1A 3LFCA 4ZZNA 3UP7A 4BDHA 2G1TA 2F2UA 4D4YA 3R02A 2B7AA 3KCKA 3SA0A 2XYUA 2WEIA 2BRGA 4AG8A 2C5VA 3MDYA 4QPMA 3VS3A 3ZRKA 2PULA 3NYOA 4F7NA 5CXHA 2HELA 4LQMA 3LPBA 4PMTA 4CFUA 4ZIMA 2QOHA 4W8DA 3PVWA 3QAME 4TWPA 4F6WA 4U41A 3PJCA 4LOQA 4PTGA 3ZO4A 2EVAA 3GC0A 4RJ7A 4E5WA 4G17A 4QT1A 1YWNA 3RAIA 1YXSA 3NUUA 1VYZA 3FSFA 5AM7A 4X3FB 1OL2A 5M4FA 4C4HA 1OVEA 4O0XA 3MY0A 5CYIA 2ZOQA 5BNJA 4FODA 4ZLZA 5J9YA 3NW6A 3G0FA 3HV3A 4KB8A 3MBLA 2F4JA 5FM3A 1OKZA 3OROA 4EQMA 4YU2A 5B0XA 4G31A 1WAKA 2W5AA 4M97A 4IZ5A 3I7CA 3UOKA 3QTXA 5M4IA 3HP2A 4FA2A 1ZZLA 3ZBXA 3AMBA 5CALA 4QP4A 1GZNA 2WQMA 3EQHA 4CCUA 3C5IA 5C26A 2CKOA 4DT8A 5KMJA 5KMOA 1YOLA 2C1AA 1PXOA 3FMHA 3QHWA 5AUYA 3DK7A 2YCSA 1U5RA 3TWJA 1FGIA 5IA0A 3WI6A 4FKRA 4WG5A 2XIXA 4BDGA 2VTMA 3IW8A 4J53A 5AUVA 4FMQA 4LGHA 2VWYA 4EHVA 3PLSA 3DAKA 4LGGA 3OWLA 2CKQA 3SAYA 4O7LA 2WXVA 5BUJA 3A7JA 4IVCA 1P2AA 4XLIA 3I0OA 3PJ3A 4F0GA 5EQEA 5LVNA 5CAQA 2Z60A 1ATPE 3UQCA 3BU5A 3ZLYA 1ZOHA 3NUNA 5KHXA 4BB4A 1CM8A 4IDTA 4QD6A 4J7BA 2W4JA 5L4QA 3BRBA 4FSMA 4EK3A 2W1DA 2BTRA 3LFEA 4Z55A 5CT7A 4IXPA 4K8AA 4QMTA 1KE8A 5HQ0A 1OBGA 2VWXA 3KRXA 3ORPA 3QKMA 4J71A 4O7VA 2YM8A 4CFXA 3AD4A 2OIQA 1R0EA 2BTSA 2BZKB 3BGQA 2UZVA 4JI9A 3ZDIA 5FUTA 3SD0A 2AC3A 4JBOA 3KXMA 5LMBA 3VHKA 4HPUE 3CEKA 3W1FA 4O91A 2OJ9A 3QLFA 2JITA 3R1NA 4FV3A 4PL3A 3LJ1A 4A7CA 4C62A 1RE8A 4EH3A 5DLSA 5CSPA 5JQ8A 4IW0A 4MK0A 2XK7A 4A4XA 4ZJVA 1MRVA 2PVJA 2R3HA 5GHVA 2HWOA 3E7OA 4OBOA 4DG2E 3FI4A 1LP4A 4IAYA 2BZIB 4BDCA 5HU9A 3QLGA 3RKBA 2I6LA 2CHLA 5CVGA 4GKHA 3OVVA 5CVFA 5ANJA 4RJ4A 4Y46A 4DTAA 3ROYA 3D5UA 4FV1A 2GMXA 3R8PA 5HLNA 2G9XA 4PTEA 2IWIA 5IEVA 4C3PA 1BUHA 4AA4A 3PXZA 3BBTB 4DEAA 4EI4A 5AAGA 2Y4IC 2W06A 5K4JA 3Q9XA 4GK2A 4PF4A 3ALNA 2V0DA 4FG9A 1Z57A 5AP5A 4I4EA 4M0YA 4EYJA 5CEPA 5JMSA 1PW2A 5EOLA 4TWCA 3PIYA 4H58A 5IEXA 3QKLA 5JQ5A 4O7RA 4RT7A 2VTRA 4Y72A 4XV9A 1G3NA 1YHSA 5CU4A 2ITQA 4RJ6A 3GNIB 1OIRA 4ASEA 3RTPA 1A06A 4EH2A 3HZTA 4AXAA 5IQIA 2HOGA 3FQHA 3FJQE 4PNIA 3F3VA 2QLUA 3VRZA 5CANA 2VTLA 2HY81 4JQ8A 4V01A 1R3CA 2IN6A 3JXWA 5BMSA 4DGMA 2UW3A 1DI9A 3HEGA 4R1VA 1YI6A 4GRBA 3ZMMA 4J97A 1ZMWA 2ITNA 2ZMCA 4CV9A 4YNOA 3FI2A 1QPCA 3O8TA 3MI9A 3PPKA 4AGDA 2QOOA 3IPHA 4BGHA 4R8QA 4ZY4A 5B2LA 4AFJA 3SLSA 3FZ1A 3MIYA 4MBIA 3ZONA 2J6MA 5M51A 3PRIA 4C35A 5C8KA 4FSTA 5E8SA 4JAJA 1OL5A 5GINE 3PY3A 5EKNA 3O7LD 4RC4A 4O86A 2IZRA 2CKPA 3R1YA 3QTQA 3C4EA 3HA8A 4V05A 5HVJA 4DFZE 2RIOA 5EW3A 5FDXA 2X8EA 5I9WA 5AV2A 4D9TA 1Q4LA 3FKLA 4LOOA 3RVGA 3V6SA 3ZCLA 3SW7A 2BKKA 4I6HA 3SKCA 4KSQA 5K0KA 4CMUA 1J3HA 2JBOA 4RZWA 2ETKA 3HGKA 4YTFA 3MFUA 2XKFA 2CSNA 3LFDA 2GQRA 5T3QA 1BI8A 2J0MB 2C68A 2R3LA 2YIYA 3BYVA 4GG5A 4MD9E 3L9NA 4A07A 4BBFA 3AC3A 5J1VA 4J52A 4R7IA 1M2PA 5DR6A 5K0XA 3Q4TA 4GV1A 4MCVA 2VUWA 5L8JA 1OL1A 3HV4A 5A46A 3C9WA 4IWOA 3H9OA 2IPXA 3ALOA 3BLRA 4GT3A 4L46A 3SV0A 2BVAA 3EYGA 4NIFA 5FP6A 4M68A 1KE6A 1XBCA 4P4CA 4IB3A 5FWKK 5LVMA 3V04A 2PMOX 3GBZA 2ZB1A 4CMTA 3CY3A 3AD5A 2NRUA 3GT8A 2QONA 2Y6MA 4ACDA 4MD7E 4BCIA 3VS1A 2HZ0A 4G9RA 2W7XA 3HX4A 5JH6A 4NH1A 5CU6A 2YCFA 3BQRA 1YI3A 4JG8A 4FKOA 3ROCA 3FXWA 4RSSA 4XYFA 1UV5A 3NZ0A 1JOWB 5EYDA 4UMPA 3DLSA 2B1PA 4BKJA 4O21A 3O23A 1H07A 4CZUA 5DVRA 4OTRA 4M66A 1H00A 4FT3A 4PDPA 4F6UA 1CMKE 3CSVA 5M4CA 4U8ZA 4N4SA 4A9UA 4TW9A 5ACKA 4FTMA 3S2PA 2B9FA 2C6KA 2W9ZB 3EN7A 2UV2A 3KEXA 4I94A 4QP6A 4QMXA 3C7QA 3F2AA 4I5HA 3RPOA 3V5TA 1B39A 4OTIA 2ZVAA 5AR4A 3QGWA 4BI0A 3FQSA 3R04A 4C02A 2CLXA 3P1AA 4CKRA 4GL9A 2W99B 3PY0A 3UIXA 5J7HA 5BVWA 4YO4A 2QOQA 3C1XA 4DFBA 3NNXA 3LOKA 4A9YA 3P08A 1M52A 2BAKA 3FZOA 4X2GA 3TZ9A 1E1VA 4FIFA 5IH4A 2J5FA 5HBHA 1FQ1B 3CTHA 5LVOA 4CTBA 3REPA 4X3JA 3NW5A 4XOYA 5M09A 1P4OA 3KMMA 4CMOA 5KHWA 3TJDA 4BDKA 3NIEA 2UW7A 2JAVA 2RFEA 2P33A 3KK8A 3QZHA 4C2VA 3K3JA 4DEIA 2QO9A 4DLJA 4ITIA 4BZDA 4JOAA 5L6WL 4CFNA 5BVNA 5K9IA 2UZOA 4X6QC 5CU0A 3D83A 2QHMA 1JSVA 5A4TA 4DH3A 1BKXA 4O2PA 4D2PA 3JY9A 2X8IA 1Q99A 4JXFA 3OEZA 4R77A 3BYOA 5HCZA 4PX6A 4EWHA 2Q0NA 2YLFA 2UZNA 3NYVA 4F1TA 2ZAZA 3E63A 2Y7JA 5AV4A 3OWPA 4L3PA 4QYEA 3DA6A 4AW1A 2XK8A 1IAJA 4IWDA 3RI1A 4YPSA 4F09A 3BZ3A 1EH4A 3CPCA 5EHOA 5CEKA 3RK5A 4UZHA 3F2NA 4BCQA 5E1SA 4PPBA 4IZYA 4K11A 4XBRA 3H0YA 3TJCA 2EWAA 5AP3A 4HYIA 3CR0A 1V1KA 2VTQA 2XNNA 2YM5A 3BV2A 3VBXA 5K4IA 1IEPA 4G1WA 3QL8A 5EOBA 4LV5A 4XCUA 3NSZA 3TIYA 3FMJA 2IW8A 4B8LA 4CRLA 2YIXA 3PFQA 1WMKA 4QRCA 4XUFA 3F7WA 4LL5A 4ZZOA 1YHWA 2GFCA 4NFNA 2Q83A 3AC1A 3K3IA 3PWDA 1JVPP 2YWVA 4MAOA 2O3PA 1URCA 2XKCA 4FKJA 3PA4A 4TTHB 3G2FA 3U51A 2HZIA 5K3YA 2Z7SA 3LMGA 3IONA 4FSZA 5A6OA 3KULB 2QD9A 4FTUA 3DKCA 3WE4A 3SXFA 5CEOA 2J7TA 4O7WA 4H3PA 3IW5A 5G1XA 4E73A 3GI3A 4M3QA 4DHFA 2I1MA 5CNOA 3VUGA 4Y85A 1OIUA 4O6EA 3DDQA 3AG9A 2B54A 3QRTA 2ZMDA 1JKKA 1DM2A 3SOCA 4I24A 3TKUA 4L52A 5LXMA 2W1FA 3M2WA 5J79A 3S1HA 4WT6A 3PIZA 4RJ3A 2OU7A 3DBEA 4F99A 5CXZA 3FLNC 3I4BA 3AD6A 3GCPA 3QQHA 4ALUA 4TPTA 5E8WA 1WVXA 2PYWA 3PSBA 2OXDA 3FI3A 5H2UA 3KVXA 3OOMA 2CGWA 2Y9QA 4KINA 2IO6A 2GU8A 4AX8A 4WNOA 4PDYA 4BTJA 5IQAA 1G5SA 5ANEA 2OICA 3AC4A 4PUZA 3U4UA 4N6ZA 2UZLA 2F7EE 3B2WA 4ANMA 3BEGA 2OXYA 1PYEA 1F3MC 3HECA 2X4FA 3QFVA 4FICA 2OZAB 4XG6A 4XP3A 2R3KA 3HDMA 4FNYA 3QA8A 4YURA 3QRUA 3A7HA 2RKUA 2HYYA 2UZTA 3RAHA 3N4TA 4YR8A 4ZSAA 1J1CA 3L8XA 3OD6X 4O0WA 1M2RA 4MTAA 4L8MA 4NKAA 5M57A 1WZYA 5C1QB 4RX9A 1WCCA 2A0CX 3TKIA 3KGAA 3VS5A 3D2KA 3C4CA 4TN6A 1BLXA 3DXQA 2ZB0A 3MJ1A 3H10A 3U6JA 3A8XA 2YERA 4JJRA 5T68A 3R7IA 4QOXA 3F3WA 4PP7A 2X6EA 1RW8A 2PHKA 4WHZA 4DBXA 1ZYDA 3TXOA 4C4EA 3QUEA 4L01A 4HPTE 3BV3A 1BYGA 3LM0A 4FV7A 3QRIA 3PWYA 4TWOA 1OL6A 3TG1A 3PVUA 1GJOA 3SW4A 3UE4A 4I23A 2W96B 4KIKA 3W18A 2V7OA 3NMUF 5B2MA 4MNEB 4WNKA 4FEUA 3THBA 3UMWA 1G8AA 3R73A 3Q3BA 3WZKA 4AT4A 5D41A 5JFVA 3R7EA 4L7FA 5AUZA 1XKKA 2R0UA 2BR1A 1W83A 3DZOA 3EYHA 1FGKA 3PPJA 4FG7A 4FT5A 3AC2A 4FTKA 3LVPA 4O83A 4HNFA 4NK9A 4EC8A 4WSYA 4WO5A 3OZ6A 4G3EA 2HXQA 3CKXA 3VQUA 1S9IA 1NY3A 5A14A 3KU2A 3AT3A 2WOTA 3BYMA 1WBWA 3HA6A 3TDWA 4EEVA 2PMLX 5KMKA 3HMOA 5F20A 4UXLA 4O1PA 4V0GB 3AXWA 1YWVA 5DH3A 4FKPA 3EKKA 4HYSA 2YCQA 4LRKA 4RFMA 2W1EA 5HOAA 2UZUE 1UA2A 4R3PA 3Q6WA 1Z5MA 4UV0A 3P79A 3WF8A 3HUBA 3R9NA 3G90X 2PTKA 3EQRA 3UNZA 5E8VA 5H3QA 1NT2A 3DJ7A 2ITYA 4AGCA 1PKGA 4CEGA 4GYGA 4U45A 4AE6A 4UY9A 4S32A 1DAYA 3QX4A 4TRLA 3ZBFA 4UX9A 3QRKA 1FVVA 4RC3A 4HGSA 3MPTA 3RP9A 3WZJA 4O84A 4ZMEA 1G8SA 2XNGA 3PZHA 2G2IA 4GU6A 2HIWA 5E8XA 2JC6A 2R7BA 4YO6A 4S34A 4NL0A 2BIKB 4WD5A 3RZFA 4AT3A 2RFNA 4JIKA 2BDWA 4RA5A 4TYHB 4TYGA 4V04A 4AN9A 4A4OA 4ZEGA 4K77A 3UP2A 4KD1A 5HO8A 4NEUA 5JEBA 4JVGA 3DJ6A 2PZRA 4EOQA 2BFYA 4KS8A 3D9VA 5J7BA 2XKEA 5JGDA 2O63A 3MJ2A 5D9HA 1J7IA 2XKDA 3W55A 2J0JA 1SZMA 4C59A 3DNDA 2IG7A 2RG5A 4MQ2A 4BF2A 3ZRMA 5IF1A 4ITHA 5EYCA 2ZV7A 3BPRA 3P5KA 5C9CA 4O1OA 2OZOA 2B53A 4CRSA 3R7GA 2CCHA 3FKNA 5IA1A 4Z16A 3ZFMA 2CN5A 3UOHA 4USDA 4HGLA 4FEQA 3TV4A 4H1MA 4BVUA 3CLYA 3OW4A 4I5CA 1B38A 4RIOA 3AC8A 5EKOA 4F0IA 2UVXA 1QL6A 3FC1X 2BZJA 3W2QA 5KO1A 2W05A 3LM5A 1W0XC 2YM3A 4GCJA 4KIKB 5CZHA 5AIRA 1XH7A 3N51A 3MH2A 4MNEA 3O50A 3EFJA 4IACA 4IVDA 4CGAA 1XO2B 2E9VA 2BIYA 1Y8YA 1ZWSA 2R3QA 3EIDA 4GVJA 4ZTQA 2BHEA 3UC3A 4C38A 4EOOA 5HX8A 2Z02A 2J50A 3ZM9A 3LFFA 3U8WA 4IAIA 4YLKA 3N4UA 1TQMA 2ITXA 5C4LA 3PRFA 4GU9A 4P2KA 4QP8A 2WTKC 2GNGA 3MTFA 5EFQA 2PZYA 3F5XA 2EUFB 3QZFA 5H8GA 2XNPA 3HMMA 2NPQA 4DEEA 5DBXA 4AF3A 4EUTA 3W2RA 4A9SA 3FYJX 2X8DA 4B0GA 4E4MA 4EL9A 2E9OA 3G51A 1YDRE 4NM5A 4RJ5A 4DEHA 4GUBA 2PWLA 4U3ZA 3LXNA 2WHBA 4DG0E 2JDOA 4YMJA 3UNJA 1O6KA 4DFXE 3R8LA 2GQSA 4O0SA 2CGVA 3EFKA 3QQUA 2UW4A 3D2IA 3N4VA 2XJ2A 2PE2A 2XNMA 4W4YA 1O9UA 3RK7A 1WVYA 4E5BA 5HD4A 1URWA 4JQ7A 3E87A 5A4CA 3OWJA 1H08A 4EH6A 5HIBA 2GQGA 4C61A 4YZDA 4FK3A 2J90A 1X8BA 1OL7A 3GU8A 5F4NA 4GJ2A 4EC9A 5HO6A 2WGJA 5KMLA 4IB1A 3A4OX 2PMNX 2R64A 3COMA 1WBPA 4CV8A 4FL1A 3KQ7A 2WAJA 4FKVA 4IZAA 5I3OA 5DIAA 3DU8A 4L42A 4RIYA 4W8EA 4DGLC 4E6QA 4IIRA 2ZYBA 4LUDA 5BYYA 2IZUA 3NNUA 3UYTA 4R7BA 4FV6A 3KRWA 4QNYA 3R9RA 4ERWA 2X7OA 4RWJA 4BHNA 4TL0A 3FE3A 4RVKA 2W1ZA 5L2QA 4C37A 4BZOA 1FMKA 4I5MA 5EI8A 3ZH8A 4CSVA 3R0TA 3TUBA 4OW8A 3IECA 4BDFA 2O65A 3GFEA 5JRSA 4HVGA 3DOGA 4Z3VA 3DV3A 5HLPA 3QD4A 3E8EA 5AX9A 4H3QA 5A4LA 3KMWA 1BMKA 4QQCA 3T3UA 2WTDA 4YHTA 3UC4A 4F9BA 4OUCA 4YUQA 4WKQA 2E9NA 4YJRA 4DA5A 1R0PA 3VULA 1SNUA 1H28A 4ZTHA 3KXHA 3Q96A 4GFMA 3O71A 3R7YA 1GNGA 1XBAA 5JFWA 3UBDA 2QO7A 3LXPA 4HJOA 3ZSIA 1LEWA 4EOLA 3WF7A 2ETMA 2VTAA 3RMFA 2QU6A 5CSXA 5E92A 4PP9A 3MFTA 4AZTA 3PJ2A 4TYJA 2OWBA 4QTAA 3SHEA 5KBQA 4ZTRA 2XK3A 4AN2A 4D5HA 4TNBA 2PU8A 4JR7A 1DI8A 3GU6A 4RRVA 3DFAA 3R30A 4S2ZA 3LFQA 4QMUA 2JAMA 4YZCA 4NM7A 2RGPA 2H96A 3HV7A 3RZBA 1JSTA 2PUNA 4O6LA 3NGAA 5E90A 4F0FA 5IDNA 5E9EA 5LCJA 3II5A 4WIHA 4ZS0A 3RAWA 3VUIA 4U9AA 4ERKA 4J95A 4P5ZA 1NVRA 2VWWA 2G01A 1J91A 4O0RA 3VUHA 3C50A 4B99A 4QMNA 4AUAA 1QPDA 4EK4A 2WMAA 3KY2A 2PZPA 2PZIA 1BL6A 3RJCA 2ZV9A 3DK3A 1UNGA 2ITOA 2VWIA 3BYUA 3GC9A 5CEMA 5I0BA 3VS0A 3DTWA 1KV2A 3SDJA 3UG2A 4AOIA 4C4FA 4CD0A 4E26A 4CTCA 4F4PA 4GIIA 3RBWA 3Q9ZA 3MB7A 3ORZA 2BZHB 4XHKB 2WNTA 3O7LB 3DGKA 1FVTA 2RL5A 3EQFA 2UZDA 2BRBA 2KTYA 4Q5EA 1YOJA 4FC0A 4X2FA 4RIXA 3F66A 4ZTMA 3Q4UA 3UTOA 4BCOA 3R6XA 3SXSA 4E4NA 3LFBA 3OWKA 3IW4A 4BWPA 3KK9A 4R6VA 2CKEA 4FT7A 5HX6A 4KIOA 4BCPA 4WBOA 3K5UA 4WRSA 3PXQA 4PMMA 1GY3A 2C0IA 3ZEWA 3QCSA 2OGVA 5AX3A 4C58A 3ENHA 4BIEA 2J0LA 5JZNA 4D2RA 5DG5A 5DR2A 4UMUA 4E6DA 2VTPA 2R3MA 4J99A 2VWUA 4NWMA 2YZLA 3BE9A 2R5TA 2VTHA 3VUTA 3ZM4A 4DAWA 4KUJA 1OI9A 4KBKA 3CGFA 4LYNA 1Q62A 3ELJA 4EOJA 2JLDA 5EDPA 3QWJA 2HENA 5CSVA 4EOMA 5IDPA 4LFIA 3SVVA 2PUUA 2BUJA 2EXCX 2JIUA 3F3ZA 2W1IA 3R22A 3LMHA 2E2BA 2OK1A 4QP7A 5E7RA 2REIA 4R5YA 4DEBA 3FYKX 3OCBA 4EORA 3V5LA 4BZNA 2FSMX 3MPAA 4IDVA 5EW8A 4BR3A 5AUXA 4BL1A 4DE4A 4FZDB 4CFMA 5ANGA 3CS9A 3EQPA 1PJKA 4EKLA 5IEYA 3DQXA 3WYYA 1IG1A 5FEEA 3QA0A 3TNPC 3FXZA 3IW6A 3P23A 3UO4A 1UNLA 2WMTA 3FPMA 2OJGA 4EBWA 3CQWA 1YOMA 3QD0A 5AEPA 4EUUA 3QTIA 5IG1A 4O0TA 4K1BA 3G6HA 1UWHA 5EK7A 4DF3A 4YZMA 3ORLA 4HVHA 3ORKA 5ETIA 2WMXA 2IVUA 4I41A 4RA4A 2YLEA 5KKRC 1VJYA 2ZDUA 4OBPA 1R78A 1YVJA 5I9VA 5TO8A 4EK8A 3HRCA 4AQCA 3VIDA 3LCOA 5L2WA 5ANDA 2HZ4A 3VUMA 4FX3A 3UPXA 3F88A 3R00A 2RG6A 3Q9YA 4RIWB 4D4VA 3FMEA 2BMCA 3FZRA 3EFWA 5GZ8A 3MH3A 3WE8A 4MVFA 3NUYA 5TE0A 1ZYJA 2JFMA 1V0PA 3LXKA 4ANQA 3UOJA 2XA4A 4O82A 4O7YA 2XP2A 4GK3A 4YLJA 2JEDA 3V8SA 5KUPA 3F9NA 5HCYA 2XEZA 3DCVA 3D4QA 5ITAA 5IQGA 1IASA 3BU3A 4RGJA 5J8IA 2A4LA 4K0YA 3C4WA 4WRGA 3TZ7A 1O6LA 1AGWA 2OKRA 2PL0A 4JS8A 4FE2A 5HIDA 4AU8A 3FLZA 3FZSA 3IS5A 1YI4A 4ZSJA 4EWQA 2YISA 3BGZA 1OECA 4C57A 3A99A 3LQ3A 5HE1A 5ETCA 3MS9A 4DLIA 3OXIA 4FKQA 3EFLA 5AM6A 4EBVA 5H9BA 1U54A 4CG9A 1H4LA 4X0MA 4D58A 3Q5ZA 4D2VA 3AGMA 4HZRA 3W2SA 4GSBA 2V62A 3HP5A 4KRDA 3PDTA 3Q52A 3EKNA 4ZOGA 4RIXB 1J7UA 3IGOA 3E92A 3OP5A 4JBQA 3GCUA 3EN6A 3ATTA 1U54B 2WFYA 3Q4ZA 2YIWA 2JIVA 3I5NA 3QTRA 3P7CA 5HIEA 5ICPA 3VF8A 2VD5A 4ACHA 3LMIA 2GTNA 2QODA 5AA8A 3UGCA 2BAJA 2VTNA 2H9VA 3WBLA 3ACJA 3E8CA 1W82A 5CSHA 5HG5A 2J4ZA 2ITUA 3ZUVA 1Y8GA 4RVLA 3D94A 3QGYA 4YBJA 4YC3A 4LI5A 1JLUE 1FOTA 1NVSA 5J5SA 4H3BA 1ZXEA 5GZ9A 4D4SA 4YZNA 5IQCA 4PMSA 2BRNA 4IX4A 4MWHA 4DEDA 4JQEA 2LAVA 4AE9A 4EONA 3GQIA 2OXXA 4PL5A 4C8BA 2PVYA 1V0OA 2R3NA 5CQUA 3WIGA 2YM6A 1JNKA 2GHMA 3BHUA 4NCTA 5C4KA 3HL7A 4FNXA 3RCDA 3P4KA 4CZYB 3WILA 3FAAA 4QP9A 4AZEA 1KE5A 4KIQA 2YN8A 4V0GA 3QCYA 1XHAA 5DT0A 4OTQA 5FLFA 3MYGA 4XG8A 4FV5A 3BX5A 2XIZA 4G9CA 4BC6A 4BCNA 3ZRLA 4FVPA 2IZSA 3R7OA 3EL7A 5JRQA 1CDKA 5LMAA 3ORMA 5HO7A 2WTIA 3MH1A 3MH0A 3ZZEA 2PK9A 2C6TA 2B52A 4QMQA 4U40A 4K2RA 2NNWB 4MXXA 3RAKA 1P4FA 3SG8A 3COHA 4I20A 5CI6A 2GNJA 4EH4A 3RPYA 3GOKA 3GU4A 1UWJA 3V8WA 4ZXTA 5IQBA 2F7ZE 3GENA 4BIBA 3BU6A 4IHPA 4YC6A 2R2PA 4E1ZA 4TXCA 2P0CA 4ZMFA 3NRMA 3GVUA 5DI1A 2CMWA 5BUEA 5IQFA 4NM0A 3FMKA 3ZUUA 4E6AA 1PXMA 1KV1A 3MPMA 2KULA 5KE0A 4IFGA 3U9CA 1WVWA 1OUKA 4FZAB 3PYYA 4BIDA 4CFFA 2W9FB 2G2FA 1YRPA 2QG5A 2QOKA 3LLTA 4PV0A 3S95A 3EH9A 4FL3A 4O81A 1H1QA 1ZARA 2CLQA 4FSWA 3ID6C 3FHIA 3FMMA 3HDNA 4EZ7A 4XBUA 2YAKA 1WBVA 5HNGA 5C8MA 5BYLA 3RNIA 4DGOA 3BLQA 3QQJA 4XG9A 2VU3A 1W7HA 3JUHA 1M14A 3D0EA 1UU3A 1DAWA 2C6LA 4UZDA 3VRYA 4FT0A 1TKIA 3PVBA 5DEWA 3ZO3A 3PY1A 4NIFB 3QZIA 5K5XA 2G15A 4KA3A 2WPAA 2XM9A 3FC2A 4FF8A 4QMLA 4U79A 3GU7A 4D1XA 1CKPA 4XV1A 4BFMA 4M69A 2UW5A 5CZIA 1VR2A 3LCTA 3S3IA 3MW1A 1H01A 1SVGA 4I6FA 1MRUA 5F9EA 4DGNA 2ZM4A 3FQEA 4ZP5A 5LVLA 2WQBA 4BCJA 4Q5HA 2FSTX 3OXTA 3F5PA 4NT4A 2GNHA 3TNQB 5EYKA 5J87A 5HD7A 3U9NA 4DFYA 3QCQA 5FEQA 3KRLA 4YHFA 3PE2A 3AC5A 4EYMA 3QU0A 3R7UA 4E5AX 1KE7A 2FB8A 2YITA 3GC8A 5AJQA 3Q2MA 1WBTA 3DKGA 3I81A 3GU5A 5CEIA 2ZM3A 2OIBA 1O6YA 4RPVA 4PL4A 3TZ8A 2A2AA 3C0HA 1JWHA 5DT4A 2GS6A 4CFWA 3FBVA 4MF1A 3CY2A 5LARA 3BCEA 3EZRA 3RPSA 1Q8ZA 4IWPA 2VX3A 3HLLA 1KSWA 2X9FA 5HCXA 4AACA 4CKIA 4FIHA 4F9YA 4FTAA 3EB0A 4F9CA 2UW8A 3W2PA 1UU9A 3E7VA 4JX7A 3TZMA 3ZEPA 4BKZA 4EKKA 1SVEA 5AV0A 3SRVA 2IZTA 2WEVA 4S31A 3WF9A 1Q3WA 3IK3A 3TIZA 2JBPA 4CKJA 3KRRA 4FKSA 4RWLA 1GZKA 2DQ7X 3P78A 1PXLA 2A19B 1UU8A 3GEQA 4XS2A 2YWPA 3W2CA 4CZTA 3OT8A 4U97A 1STCE 1H0VA 3VJOA 4IAZA 1PXIA 4XRLA 3H3CA 4XX9A 3BHVA 4LGDA 5EDRA 4D2SA 5IU2A 1NA7A 4XG2A 3W16A 4RZVA 5BVOA 3BBWA 3G0EA 4L43A 4G3DA 5KBRA 5FD2A 3VUKA 4O7ZA 2YDKA 3OOGA 3LFSA 4FSRA 2OSCA 4ZSEA 2OH4A 5CF6A 4IAFA 3ULZA 3DPKA 2CNQA 5EYMA 3KXNA 4YJOA 4DH7A 5CAUA 3ET7A 4I22A 5FQDC 1CSNA 3P0MA 5E8ZA 5CTPA 2JIIA 3MTLA 5E91A 2YZAA 3R9OA 5DA3A 4KWPA 4L3LA 4FUXA 3TEIA 4BRXA 5JFSA 3HV5A 1E1XA 3R21A 4PWNA 4AFEA 4U81A 4NW6A 2QOFA 4OR5A 4EZ3A 4FZ6A 4I0RA 4AN3A 5I9YA 3OXZA 3B8RA 5M06A 4EK5A 4FKUA 1F5QA 4ORKA 3MVJA 3VS4A 2CCIA 5AAFA 3GC7A 3ANRA 1OUYA 5M44A 2I0YA 3SG9A 3C4FA 4HGTA 3R2YA 4U42A 3KN5A 1PMUA 2HCKA 1HCLA 3EQCA 3QC4A 4RQKA 3LZBA 4YJNA 1PYXA 3LCKA 4FTIA 1TQPA 4B4LA 1XBBA 2PVFA 1QCFA 2WMRA 3UIBA 2BALA 5IQDA 3T8OA 4E6CA 1UKIA 4P5QA 4JNWA 3HV6A 5HVYA 3UG1A 2R3PA 3NAYA 4LL0A 2C6EA 3UVPA 1YW2A 4C7TA 3F2RA 1U4DA 4J1RA 3G6GA 3OCGA 5TKDA 1GIHA 3BGPA 2GHGA 5KMIA 4N57A 3R71A 3ZO1A 1YXUA 4IH8A 2FSLX 4NSTA 4OBQA 3DDPA 2GPHA 3MY5A 3HNGA 4HOKA 4ALWA 4ZY5A 4UWBA 5LOHA 2VX1A 2H34A 2ITTA 1CKIA 1FPUA 3E3BX 4O22A 4CYJA 5L2TA 2Y0AA 4QP2A 3OUNB 3U4WA 3MGYA 4DFLA 5J9LA 2W1HA 2W17A 2J51A 4G3GA 1TVOA 4L6QA 1KOBA 5IPJA 1AQ1A 2Q0BA 3NX8A 3LFNA 4RX7A 3V5JA 3FMLA 5AUTA 3A62A 4ITJA 2R9SA 3KF7A 2H8HA 5TF9A 4D28A 3S4QA 3U87A 4D2TA 4EH7A 3E3PA 3R8ZA 5HZNA 5LMKA 4XRJA 4ZLOA 3KKVA 2OJFE 4D0XA 5E8YA 3O2MA 1H26A 5AIKA 3UZPA 5I5ZA 4Y5HA 1R39A 2R3OA 4GFGA 3GXLA 1Q8UA 4IE9A 2R3JA 4R7HA 4C36A 4ENXA 3MESA 1WBNA 4FIGA 2C3JA 5L6OA 3EN9A 3HRBA 1LPUA 3ANQA 3OW3A 3RNYA 4CVAA 5DGZA 4YZ9A 4O7NA 2G2HA 4ID7A 2WTWA 2XYNA 4OGRA 5CT0A 5AADA 1S9JA 3DJ5A 1M2QA 2XUUA 4FNWA 4TKSA 2WU7A 4ANNA 2VTOA 4AOJA 5CF5A 1XH4A 4J8NA 3CD8A 4MHAA 1OM1A 4IMYA 4QMVA 4G3FA 5GNKA 3I6WA 2QURA 4O96A 5HICA 5IA5A 3R8VA 4B7TA 4D1SA 4EK6A 4EQUA 3ATSA 3H30A 2C3IB 4FVRA 4WG3A 4G16A 3ACKA 3QTSA 4X3FA 3RALA 3VS6A 2PPQA 2XBJA 3V6RA 4YJUA 4FTQA 4QP3A 2HK5A 3PG3A 4FEWA 4YTIA 3QCXA 4ZJJA 2Z2WA 2VTTA 4IC8A 5HBEA 3WF6A 3G9LX 3UMXA 3UNKA 2I7QA 2CJMA 2WTKB 4XMOA 5EQPA 4IQ6A 3KF4A 3DQWA 4Y83A 3PXKA 2YACA 4CG8A 3NUPA 3CQUA 3RM6A 3RINA 5LVPA 3LIJA 4BDAA 3ITZA 3QYWA 3ZHPC 2PY3A 3MVMA 3D14A 5C01A 2AUHA 3OTVA 4FTJA 4OTWA 1WFCA 5D11A 5IZFA 5FGKA 1K3AA 5AMNA 2PVRA 3FI8A 3SXRA 4BGGA 4YSJA 3EJ1A 3L8SA 2X9EA 2XBAA 3DAJA 3O8PA 2X2LA 4OTDA 4RVTA 3NLBA 4CFVA 5GZAA 4IX3A 2NRYA 5D1JA 1U5QA 3I5ZA 3PSDA 4U44A 3ZSHA 5IMXA 5E8UA 2J0KA 1GZOA 3NVKI 3NWWA 4WOVA 5J95A 4M7IA 4XOZA 4M84A 3OY3A 5FXSA 3D7TB 4FZ7A 4XV2A 4DN5A 5FRIA 2R3GA 3ORIA 3F82A 4BDBA 2XIRA 3BEAA 5KKRB 3FLSA 2X7GA 5CF4A 2VV9A 3QTZA 3TUCA 2HY0A 3M42A 4FOBA 1XH9A 4GK4A 4QMMA 5FTOA 5LWNA 3V5WA 3CPBA 2P2HA 2ACXA 3H4JA 3W10A 4USFA 3H9RA 2C6OA 4QYHA 2OG8A 5AV1A 4N0SA 2VO6A 5DPVA 1UVRA 5HTIA 2BDFA 3OT3A 4Y73A 2VTIA 5A3XA 5BYZA 4NTTA 3R9HA 2RFSA 4GKIA 1A9UA 3E88A 1IRKA 4M13A 2YHVA 1PY5A 2VWVA 2F2CB 2W1GA 3FSKA 5F95A 2QOIA 2XVDA 3NUAA 1PMNA 2FUMA 3QX2A 4IJ9A 2UVYA 3OUKA 4YTHA 2Z8CA 3DXNA 4FTRA 4GIHA 4RIYB 4GH2A 4JG6A 4H36A 4F9WA 1L3RE 4IAAA 3CQEA 5CU3A 5AWMA 2PSQA 1LUFA 4B8MA 4E93A 4F08A 4DITA 2FGIA 3PP1A 5HU3A 5KCVA 2RSVA 3ZC5A 4AA0A 2PVLA 5BVFA 4XG3A 3DS6A 2I0EA 5AP7A 4A4LA 1MRYA 1JAMA 2VZ6A 4X6RA 3L8PA 4YBKA 3LE6A 4DC2A 2OW3A 3VBWA 2XK9A 4RC2A 3PIXA 2R3RA 3D7ZA 3DFCB 3GGFA 3VN9A 1OPJA 3JS2A 3DBCA 5HNBA 3Q2JA 4D9UA 1OIQA 3PJ1A 5IA2A 3U55A 5TOZA 1GZ8A 4BTKA 4BCHA 4HVDA 2WTVA 3QZGA 5IISA 3D5WA 4I0SA 3UODA 1JPAA 3O8UA 4E4XA 1JKSA 4O7SA 3OBJA 3IO7A 4PRJA 4QYYA 3PPZA 5FDPA 2VTJA 3ZLWA 2QKRA 4AS0A 5IA3A 5L8LA 2YM4A 2XK4A 2OF4A 1Q97A 4CLIA 2WQEA 4E4LA 4R78A 5EHLA 4R3RA 4IB5A 1WBOA 3QALE 3T9TA 4KKEA 4M14A 4O2ZA 1YXTA 1ZOGA 4FIEA 4FKWA 5DRBA 5A4EA 2IVTA 1JQHA 3BHHA 3G9NA 4FTTA 5EH0A 3LCDA 4U5JA 3EQDA 3S0OA 1HOWA 4Y5QA 4FTNA 5AR5A 2XIKA 4ZSGA 3OHTA 5HHWA 3RPRA 4NJDA 1Y91A 4FSQA 4J8MA 3UPZA 2WTCA 1LEZA 3CGOA 4APPA 3WYXA 3SRVB 4FSNA 2OI4X 1OKWA 1IA9A 2BPMA 3A4PA 4OTHA 4PDOA 4KIPA 5G6VA 3CJGA 5I3RA 4I1ZA 4H05A 2QC6A 3ODZX 2XRWA 4XLVA 3ZS5A 5FTGA 4BCMA 5GIOE 2ESMA 5AP2A 4NU1A 1Z9XA 1KOAA 4GJ3A 4QMYA 3CJFA 2WMSA 4LMNA 2WU6A 5DFPA 4L3JA 4QMSA 5DOSA 1Q5KA 5DHJA 3VBYA 5F1ZA 3OBGA 3HMIA 4UEUA 5BVKA 3NVMB 4JBVA 1H8FA 4LG4A 4C0TA 2WZJA 1I09A 3HKOA 3R8UA 3MIAA 2ITPA 3LJ0A 3R2BA 4O0YA 3IDCA 2ITZA 1RQQA 3BHYA 4XV3A 4E7WA 5CWZA 5AAEA 1IR3A 2X0GA 2FYSA 2O8YA 1UU7A 2YDIA 4FVQA 5JSMA 4ONAA 3DXPA 3KREA 5IQHA 1OKYA 3OEFX 4DFUA 2LGCA 5IH5A 4G3CA 2C0TA 3EL8A 3BLHA 3FWQA 3Q60A 5IKWA 2OBJA 5FBOA 3DY7A 4OTGA 4FUYA 1XQZA 3P7AA 5FXRA 4BTFA 4MF0A 3VHEA 1YWRA 4JDJA 4ANLA 1I44A 1VZOA 2HWPA 4FGBA 1L8TA 5CF8A 3L9MA 5J5TA 2ZJWA 3F7ZA 3U6HA 4M12A 1PKDA 5BUIA 2QLQA 1PHKA 4IEBA 2QI8A 4X3FC 4PPCA 2W4KA 3FL4A 1A48A 5HE2A 1PXKA 4IB0A 2PZ5A 1TQIA 3COIA 1OPKA 2P3GX 3BWJA 2VGPA 3EMGA 4WNMA 1H1SA 4M69B 2HW7A 5ACBC 2WOUA 1MP8A 4ANSA 1SNXA 5CASA 3I7BA 2WMQA 4OT6A 5HVKA 3QD3A 4K18A 2B9JA 4D2WA 1KUTA 4FKTA 2XZSA 1OMWA 2Z7LA 4KRCA 3JYAA 3KXXA 3UVQA 3JR1A 1GIIA 2DYLA 5LJJA 3EN5A 1XH8A 5AP4A 2O64A 3EWHA 4U0IA 3ZXZA 1OZ1A 3MSSA 4S30A 4GFOA 2XJ0A 4C4JA 2YEXA 4YGAA 5ETFA 4RLKA 3QQLA 2Z7RA 4IWQA 5EM5A 5FBNC 4MXYA 5M55A 3UOLA 4PMPA 3IDBA 4QMZA 3F5UA 4FK6A 4W9WA 4ASZA 2OIDA 4F65A 2W5BA 4RVMA 3TN8A 4EOPA 2PVKA 3VW6A 2WELA 3QTUA 2F9GA 4YJVA 4YLLA 1YHVA 3ORTA 5FG8A 1Q61A 4FV0A 2JKKA 2SRCA 1REJA 3R8MA 3DAEA 3G33A 3ZFYA 2XMYA 5DEYA 4IVAA 4X2NA 4EOKA 3UVRA 2C5XA 4IM2A 2XJ1A 3V01A 3C0GA 3KA0A 2XNEA 3PXRA 2ZDTA 4G6OA 4DCEA 3ETAA 3R63A 3NYNA 4K6ZA 4UYAA 2WD1A 2VO3A 3CP9A 3M11A 3LFAA 4JL9A 4F1OA 4HYUA 2OLCA 4FT9A 2WKMA 2XF0A 4XG7A 4KS7A 5BVDA 5EG3A 3AQVA 3JVRA 4DGGA 3U6IA 4F7JA 3EN4A 3FXXA 3KCFA 4AA5A 5L6PA 5HKMA 1U59A 3FDNA 3SX9A 4BBEA 4TT7A 4AGWA 1ZYLA 4D55A 3NAXA 2YM7A 4BCGA 2Y8OA 5M4UA 4C3FA 2F57A 5FEDA 4D4RA 3LQ8A 5IQEA 3I0QA 1T45A 2YDJA 3PTGA 5FM2A 5CI7A 4KKHA 4QPSA 3A61A 2WMWA 1PMEA 4G5JA 2QVSE 3IOKA 4AOTA 4DTKA 4L44A 4TY1A 3JPVA 3LAUA 4HYHA 2C5OA 3BYSA 1H1RA 3PSCA 3ZUTA 4BN1A 2EXMA 4ZAUA 4EOIA 5C8NA 4RBLA 3IKAA 3TM0A 4O7TA 3BIZA 1B6CB 4YNEA 5E1EA 5EM8A 5HLWA 5JK3A 5BVEA 1E9HA 2X6DA 3ODYX 5GIPE 1REKA 1YQJA 3QQGA 3D15A 4QNAA 3IW7A 4J98A 4BDEA 4DH5A 4EOSA 3V3VA 3PUPA 3UIMA 1OPLA 2YAAA
chains in the Genus database with same CATH superfamily
5I9XA 2UW6A 2NO3A 4UN0C 4GW8A 2WQNA 2XB7A 2GHLA 4WSQA 3VUDA 4CQEA 3QD2B 2JKQA 3AOXA 4U3YA 5JFXA 4BHZA 2BRMA 5CENA 2PUIA 4II5A 1UNHA 4BKYA 4Q9SA 3W33A 2VTSA 2BAQA 1UKHA 4G6LA 4ZY6A 4JAIA 2B0QA 3LJ2A 1LR4A 3GUBA 2ERZE 2VRXA 3NDMA 3GFWA 4I4FA 4M15A 3VBQA 4FIJA 2PVMA 4BYJA 3Q6UA 2OFUA 4RFZA 4X7QA 4BCKA 4DFNA 3F3UA 5JGBA 3I1AA 4YJTA 4I92A 5CQWA 5DRDA 3ZDUA 4ANBA 3KULA 3NCGA 4X2JA 3HRFA 1XR1A 4EQCA 4FV8A 3W2OA 4MQ1A 3SQQA 3RPVA 4N6YA 5J1WA 4FIIA 4WA9A 1AD5A 5EDQA 2RF9A 3Q4CA 3R83A 4RLLA 2GNLA 3DB6A 4AW2A 4R3CA 3OFMA 1PXPA 2Y6OA 2QO2A 5FXQA 4LUEA 2YIRA 2R0IA 2NP8A 5ANKA 3TI1A 2WMVA 4DBNA 4MXAA 2GNFA 4OAVB 1KE9A 3NNWA 5HG8A 3IGGA 4BDIA 3W8QA 5DNRA 3WF5A 4PTCA 1M7NA 3MA3A 2IVSA 3QUPA 4YSMA 3VWAA 4IZ7A 2C69A 4F9AA 2QU5A 4RG0A 3VO3A 3VW8A 4N70A 3FZTA 3OF0A 3E8DA 4IANA 5ANOA 4YP8A 5TT7A 2CNUA 3L9LA 2ERKA 3OC1A 3VQHA 3QUDA 4XP2A 1SVHA 5M07A 5HTCA 3R9DA 3AMAA 4KKGA 3HAMA 4X2KA 2XARA 1YXVA 2JKOA 4F6SA 4EH5A 3VBTA 3EQGA 3PJ8A 4FTLA 4ZS4A 2DWBA 4FV2A 1MQBA 4TWNA 4QTEA 3KL8A 3VS2A 5LQFA 3DKFA 5AR8A 5AUWA 4MD8E 2B9HA 4L53A 3MFSA 5HORA 4FZFB 4MKCA 3ERKA 3QRJA 5K5NA 2CPKE 3ZYAA 1VYWA 3NCZA 4UWCA 3GCSA 3B8QA 3HAVA 3IDPA 1OKVA 2C5YA 3FV8A 2QOCA 4W4XA 4DYMA 3PXFA 5DYJA 1SM2A 3TL8A 4BI2A 4E20A 4MX9A 4LOPA 1K9AA 4NUSA 3PE1A 3JY0A 2UW9A 4LM5A 5HBJA 2J0IA 3NUXA 3ZOSA 4KNBA 2E9UA 3TNIA 3G15A 4RX8A 5M08A 2C4GA 4G5PA 3V5QA 4AXFA 3A60A 3HYHA 3KN6A 4EHZA 4I6BA 2Y4PA 4NW5A 5CVHA 3A2CA 3MY1A 4YZBA 3O51A 1XWSA 2VWZA 4I0TA 3DZQA 3PZEA 3A8WA 5HGIA 5C03A 3UZRA 2P55A 4C34A 3FY2A 4UMQA 2W5HA 5HG7A 3ZO2A 2GTMA 4GVAA 2C3LA 3CC6A 3VC4A 2OF2A 2W1CA 5J9ZA 4C4IA 4EJ7A 2WB8A 2R3FA 4OT5A 3VVHA 2J5EA 3QHRA 1K2PA 2Y4IB 2QR7A 3F69A 2GS7A 3KC3A 1R1WA 4D1ZA 3QYZA 5I4NA 3C51A 4JDKA 3CTJA 4Z9LA 3N9XA 2WQOA 3ENMA 1YDTE 2XNBA 5D10A 5CNNA 4ARKA 3HUCA 3TNWA 5IUGA 2O5KA 2XIYA 4KBCA 4NCTC 4W9XA 2OFVA 2AEGA 4G2FA 3LQ5A 3V51A 5DR9A 2QR8A 2DS1A 5I9UA 4UMTA 5IUHA 2C6IA 5IUIA 4G34A 3MN3A 4FNZA 4UWYA 2BDJA 3DB8A 4ZJIA 4NYEA 3OCTA 4GS6A 3FKOA 4XJ0A 4EH8A 1OITA 4MBLA 4W4WA 3RK9A 5DT3A 1M17A 2F7XE 4MH7A 4ACCA 3LLAA 4CT2A 4QMOA 3VNTA 4DH8A 1H24A 1PXJA 3FPQA 2EU9A 4YJQA 3SC1A 4U43A 2OO8X 3GCQA 4BDDA 3W32A 3POZA 4I6QA 3OY1A 1XH6A 1RDQE 2ONLA 1OBDA 2BILB 1FVRA 1APME 2IJMA 4JX3A 3BHTA 5AP1A 4X21A 5ETAA 3VS7A 3QBNA 5E4HA 4ZTSA 5EM6A 4MBJA 3SOAA 3KVWA 4IX6A 3V5PA 4C3RA 2ONLC 3I6UA 4AXCA 2ZV2A 2O0UA 4LRMA 4MEDA 5FP5A 4I3ZA 3PLAE 2ITWA 5H8BA 1Q41A 1KWPA 2XEYA 5C27A 4FYOA 3FMDA 4FKGA 4JLCA 4WUNA 4R5SA 1FINA 4QTCA 1W8CA 4NFMA 5AA9A 4R1YA 2GSFA 3DBDA 3AGLA 4TZRA 3ZU7A 5IA4A 3KXGA 5CSWA 4OTPA 5HEZA 4L9IA 4APCA 3UIUA 3UO5A 2VGOA 1OB3A 3PA5A 2CNVA 3VF9A 2CDZA 2X39A 3RHXA 3HVCA 1RJBA 3C5UA 4BCFA 2VNWA 2C5NA 3EOCA 5B2KA 5CAVA 3MV5A 4F7LA 2XS0A 4FG8A 2PE0A 3QXOA 3BI6A 4M0ZA 3Q5IA 2V55A 1JKTA 4P7EA 1YKRA 3FY0A 5D7VA 5KNJA 2R4BA 3ORXA 4EH9A 3MFRA 4WUAA 4RX5A 2W4OA 1ZY4A 4HCVA 4GYIA 3R1SA 4UXQA 4D5KA 3NR9A 2A27A 5L3AA 2J2IB 4FI1A 4GEOA 3C0IA 3ZXTA 2BKZA 4ALVA 2C0OA 4GT4A 3QC9A 4MXCA 4FEVA 4FOCA 5BMMA 1U46A 3O17A 3L8VA 3TCPA 1ND4A 4IFCA 2XRUA 1OGUA 3FHRA 3L9PA 3Q9WA 4FSYA 4H39A 3R7VA 4EZ5A 3R01A 1CTPE 2GFSA 4NKSA 4QMWA 2ITVA 3DNEA 4NZWB 3VAPA 3OG7A 1PRYA 5HNIX 3QWKA 1JBPE 4RWKA 2ZM1A 4DCAA 3P86A 3ZTXA 4EHGA 3KB7A 1ZOEA 5EQYA 4UALA 2J9MA 1BL7A 1ZAOA 3PVGA 4YHJA 3UQGA 4AZWA 3PG1A 4IX5A 1NXKA 2X2MA 3COKA 3E62A 3FLYA 4ACMA 1ZZ2A 1P5EA 3HMPA 1Y6AA 3WZEA 2VNYA 3AT4A 3D7TA 4P90A 3RWQA 2UUEA 3O96A 5ANIA 3C4XA 3C13A 4J96A 5AP6A 4A9RA 2EB3A 3IG7A 2WTJA 3EQIA 3EHAA 3ZFXA 4HW7A 5EHYA 5CX9A 1ZYSA 4CQGA 2BHHA 2UVZA 3PXYA 2AYPA 3TACA 3C4ZA 2BFXA 3UJGA 4QTBA 4GMYA 3LXLA 5A54A 3AKJA 2UZWE 4QYGA 1P14A 5DMZA 5DWRA 4AZFA 4WG4A 4AZSA 2WIHA 2C3KA 3W8LA 3DK6A 3TT0A 4FV9A 3TTJA 4A9TA 2UZBA 2WIPA 3H9FA 3KRJA 2X1NA 2F49A 4HNIA 4IC7A 3E5AA 5IH6A 4JIAA 1JSUA 4FKLA 2R3IA 5A6NA 3WARA 3CCNA 1H0WA 4UB7A 1OIYA 3O0GA 5JZJA 2YA9A 5IMEA 1Y6BA 3QQFA 3E93A 1F0QA 4O38A 5GJFA 3TTIA 3UYSA 3E64A 2CGXA 3LKMA 4DH1A 4XG4A 1ZMVA 2PMIA 3R1QA 2C6MA 2FH9A 3QQKA 4ASDA 3MVHA 4JDHA 4AT5A 4BBMA 3FEGA 4QO9A 3D5VA 4BGQA 2EXEA 3F5GA 3RCJA 1WBSA 5BPYA 1BI7A 3BE2A 4ZZMA 2PVHA 3DKOA 1PF8A 4BYIA 3E8NA 3POOA 4AW5A 2X4ZA 2GNIA 4USEA 3OS3A 2ZV8A 4DG3E 4MYGA 4QYFA 3MB6A 2YIQA 1ZMUA 4L68A 1ST4A 3K54A 4HCUA 1V0BA 4IVBA 5L2IA 2BCJA 4JBPA 2ETRA 2QNJA 3DLZA 5HE3A 3FZPA 3CBLA 3QXPA 4HCTA 4IADA 1J7LA 2JDVA 2FO0A 5AR7A 3GQLA 4XEYA 4JDIA 3U54A 3K5VA 1QMZA 3ZLXA 2CGUA 3ORNA 3DT1A 5AR2A 3KXZA 4EJNA 3PP0A 4GUEA 4QP1A 2P2IA 2CN8A 2X2KA 4I93A 5DN3A 5AP0A 4MXZA 4LMUA 2PE1A 3BWFA 1CKJA 1XH5A 1ZRZA 2B55A 4QQJA 4MWIA 2JDSA 5E8TA 4F63A 2I0VA 3KMUA 2BROA 2XNOA 1YDSE 3FMNA 3PA3A 4KBAA 5JKGA 4BDJA 3CE3A 3I60A 2I0HA 2OJJA 3EZVA 4BTMA 3CTQA 5LMKC 4E8AA 2QOLA 4ANOA 1XJDA 1T46A 4FR4A 2IF8A 3UDBA 3DBFA 4QMPA 4A06A 5EI2A 4AAAA 4ZLYA 3NEWA 3WZUA 4MNFA 2B9IA 1ERKA 5HG9A 1ZLTA 4JG7A 1Q8YA 3FLWA 3P7BA 3CKWA 4JRVA 5JT2A 5CEQA 4F78A 1W98A 3FUPA 5EM7A 3CIKA 3NYXA 3WZDA 4TYEA 4B6LA 4FV4A 2YJSA 2JDRA 4CCBA 2IW9A 1M7QA 5BQ0A 3QKKA 5A4QA 4KABA 1J1BA 4M67A 3G5DA 3ZLSA 4UMRA 4BY9E 4F1MA 4Q2AA 2Z7QA 3D5XA 4H1JA 4JT3A 3NUSA 1HCKA 4LV8A 4XP0A 4CXAA 4F70A 4EHEA 3PFYA 4HGEA 4Y95A 4I5PA 1GOLA 4M8TA 4KSPA 4OAUC 3W0OA 4PQNA 4K33A 3TDVA 2V7AA 4DTBA 4FYNA 2IVVA 2X81A 1Q24A 3F61A 5CU2A 4XNEA 3ULIA 2HXLA 4AW0A 1NVQA 1W84A 3V8TA 3F6XA 4CT1A 1ZYCA 4IAKA 4BWKA 2HW6A 2YJRA 3WOWA 1FMOE 2XH5A 3EQBA 4YPDA 3QF9A 2VX0A 3BQCA 3QTWA 5AUUA 4L45A 1H1PA 2XM8A 2XCKA 3H0ZA 4AP7A 2QOBA 3AMYA 2VO7A 3OTUA 2GCDA 4MXOA 2A1AB 4O27B 4FGRA 4AWIA 4IBMA 2WMBA 1DS5A 1SYKA 4BICA 3FLQA 5GJGA 2JKMA 4UBAA 4C33A 4OLIA 4AAYA 4AGUA 3MVLA 4HVSA 4FTCA 4NJ3A 2QKWB 4RWIA 5CAPA 2IW6A 3HMNA 4YC8A 3RHKA 4TYHA 3CXWA 4WBBB 3T3VA 3ZSGA 2FA2A 3NIZA 4ZK5A 1GAGA 3TV6A 5DE2A 1H25A 4CYIA 2QCSA 4ENYA 1FBNA 4CNHA 1Q8TA 4IM0A 3GOPA 1Q3DA 4B9DA 2V22A 5HESA 1MUOA 3I79A 2W0JA 3LCSA 3T9IA 4ACGA 4RFYA 3A7FA 5TR6A 3R28A 4XH6A 5JN2A 1PXNA 3TNHA 4L67A 1JKLA 4QTDA 4I21A 4W4VA 5FTQA 5CS6A 4O0UA 2YCRA 4L00A 1PMVA 4GT5A 4OTFA 4E3CA 3CD3A 3NW7A 3F3TA 2VWBA 4PDSA 1QPEA 4FL2A 5EI6A 4QQTA 2RFDA 2X7FA 4RMZA 4F64A 2QG7A 2E9PA 4HZSA 3PUFC 3VJNA 4FKIA 1YXXA 4O0VA 2UW0A 3GCVA 2GS2A 4U7ZA 5HE0A 4NM3A 4ZSLA 3O5AA 3LHJA 2YABA 4IM3A 3IQ7A 3TKHA 5D7AA 4ZTLA 3WIKA 4C4GA 2DUVA 3UQFA 3IOPA 4KAOA 3ZZWA 3TUDA 4D0WA 4Y8DA 2C47A 5M53A 2VAGA 2VN9A 4PPAA 4BWXA 3UZTA 4AXEA 1ZY5A 3GB2A 5BX0A 4IJPA 5AR3A 2R7IA 4DINA 4F7SA 5A9UA 4Z7HA 3LW0A 3K2LA 3NPCA 3L1SA 3RM7A 5JGAA 5KZIA 3B2TA 4L7SA 3Q04A 2PVNA 3OCSA 3NS9A 2XCHA 5CY3A 4WNPA 2WMUA 3MA6A 5F94A 5T6KA 2BRHA 1Q8WA 3MWUA 4PY1A 3SGCA 2OH0E 2P4IA 3JVSA 5H8EA 3RWPA 3TV7A 2EB2A 2JGZA 4UYNA 4YJSA 3ZC6A 3KFAA 1GIJA 5LCKA 5CLPA 2C30A 1SMHA 5L8KA 1QPJA 3Q53A 5M56A 5L2SA 4Q9ZA 2XK6A 4FEXA 4AZVA 5HTBA 2B4SB 2JD5A 5LWMA 4HVIA 1BX6A 1VEBA 3BKBA 4LRJA 5D12A 5I9ZA 1NW1A 4JR3A 2QHNA 3GP0A 4YJPA 5EW9A 4PNKA 2FVDA 3DTCA 3OMVA 4U80A 1IA8A 3A7IA 3M1SA 2HZNA 2UZEA 4TNDA 5KMMA 2V5QA 1H1WA 4ZTNA 5KZ0A 4CLJA 4DT9A 2I40A 2QQ7A 2X0PA 5HI2A 3KIOC 2O2UA 4JRNA 4GG7A 3S00A 4DEGA 4QPAA 2YFXA 4Z7GA 3AT2A 5CAOA 3FL5A 2JDTA 3DBQA 4FBXA 4QQ5A 4TYIA 4YTCA 3BELA 2C6DA 4FTOA 1MQ4A 2C1BA 3VBVA 5AV3A 2JFLA 2H6DA 3Q32A 2WO6A 4FSUA 4ASXA 1IAHA 4G6NA 3A7GA 4K9YA 2PUPA 4U6RA 5B7VA 4S33A 2GDOA 1Y57A 2OZAA 5KX8A 4RIWA 5GJDA 4NTSA 3NNVA 2OJIA 2VO0A 2FSOX 4C2WA 4RJ8A 1H27A 3P9JA 5KMNA 5AFVA 2AC5A 3RGFA 4RQVA 3UO6A 2HAKA 4BI1A 3LFCA 4ZZNA 3UP7A 4BDHA 2G1TA 2F2UA 4D4YA 3R02A 2B7AA 3KCKA 3SA0A 2XYUA 2WEIA 2BRGA 4AG8A 2C5VA 3MDYA 4QPMA 3VS3A 3ZRKA 2PULA 3NYOA 4F7NA 5CXHA 2HELA 4LQMA 3LPBA 4PMTA 4CFUA 4ZIMA 2QOHA 4W8DA 3PVWA 3QAME 4TWPA 4F6WA 4U41A 3PJCA 4LOQA 4PTGA 3UDZA 3ZO4A 2EVAA 3GC0A 4RJ7A 4E5WA 4G17A 4QT1A 1YWNA 3RAIA 1YXSA 3NUUA 1VYZA 3FSFA 5AM7A 4X3FB 1OL2A 5M4FA 4C4HA 1OVEA 4O0XA 3MY0A 5CYIA 2ZOQA 5BNJA 4FODA 4ZLZA 5J9YA 3NW6A 3G0FA 3HV3A 4KB8A 3MBLA 2F4JA 5FM3A 1OKZA 3OROA 4EQMA 4YU2A 5B0XA 4G31A 1WAKA 2W5AA 4M97A 4IZ5A 3I7CA 3UOKA 3QTXA 5M4IA 3HP2A 4FA2A 1ZZLA 3ZBXA 3AMBA 5CALA 4QP4A 1GZNA 2WQMA 3EQHA 4CCUA 3C5IA 5C26A 2CKOA 4DT8A 5KMJA 5KMOA 1YOLA 2C1AA 1PXOA 3FMHA 3QHWA 5AUYA 3DK7A 2YCSA 1U5RA 3TWJA 1FGIA 5IA0A 3WI6A 4FKRA 4WG5A 2XIXA 4BDGA 2VTMA 3IW8A 4J53A 5AUVA 4FMQA 4LGHA 2VWYA 4EHVA 3PLSA 3DAKA 4LGGA 3OWLA 2CKQA 3SAYA 4O7LA 2WXVA 5BUJA 3A7JA 4IVCA 1P2AA 4XLIA 3I0OA 3PJ3A 4F0GA 5EQEA 3W0MA 5LVNA 5CAQA 2Z60A 1ATPE 3UQCA 3BU5A 3ZLYA 1ZOHA 3NUNA 5KHXA 4BB4A 1CM8A 4IDTA 4QD6A 4J7BA 2W4JA 5L4QA 3BRBA 4FSMA 4EK3A 2W1DA 2BTRA 3LFEA 4Z55A 5CT7A 4IXPA 4K8AA 4QMTA 1KE8A 5HQ0A 1OBGA 2VWXA 3KRXA 3ORPA 3QKMA 4J71A 4O7VA 2YM8A 4CFXA 3AD4A 2OIQA 1R0EA 2BTSA 2BZKB 3BGQA 2UZVA 4JI9A 3ZDIA 2XAOA 5FUTA 3SD0A 1G8KA 2AC3A 4JBOA 3KXMA 5LMBA 3VHKA 4HPUE 3CEKA 3W1FA 4O91A 2OJ9A 3QLFA 2JITA 3R1NA 4FV3A 4PL3A 3LJ1A 4A7CA 4C62A 1RE8A 4EH3A 5DLSA 5CSPA 5JQ8A 4IW0A 4MK0A 2XK7A 4A4XA 4ZJVA 1MRVA 2PVJA 2R3HA 5GHVA 2HWOA 3E7OA 4OBOA 4DG2E 3FI4A 1LP4A 4IAYA 2BZIB 4BDCA 5HU9A 3QLGA 3RKBA 2I6LA 2CHLA 5CVGA 4GKHA 3OVVA 5CVFA 5ANJA 4RJ4A 4Y46A 4DTAA 3ROYA 3D5UA 4FV1A 2GMXA 4MUQA 3R8PA 5HLNA 2G9XA 4PTEA 2IWIA 5IEVA 4C3PA 1BUHA 4AA4A 3PXZA 3BBTB 4DEAA 4EI4A 5AAGA 2Y4IC 2W06A 5K4JA 3Q9XA 4GK2A 4PF4A 3ALNA 2V0DA 4FG9A 1Z57A 5AP5A 4I4EA 4M0YA 4EYJA 5CEPA 5JMSA 1PW2A 5EOLA 4TWCA 3PIYA 4H58A 5IEXA 3QKLA 5JQ5A 4O7RA 4RT7A 2VTRA 4Y72A 4DDGA 4XV9A 1G3NA 1YHSA 5CU4A 2ITQA 4RJ6A 3GNIB 1OIRA 4ASEA 3RTPA 1A06A 4EH2A 3HZTA 4AXAA 5IQIA 2HOGA 3FQHA 3FJQE 4PNIA 3F3VA 2QLUA 3VRZA 5CANA 2VTLA 2HY81 4JQ8A 4V01A 1R3CA 2IN6A 3JXWA 5BMSA 4DGMA 2UW3A 1DI9A 3HEGA 4R1VA 1YI6A 4GRBA 3ZMMA 4J97A 3UDTA 1ZMWA 2ITNA 2ZMCA 4CV9A 4YNOA 3FI2A 1QPCA 3O8TA 4LDTA 3MI9A 3PPKA 4AGDA 2QOOA 3IPHA 4BGHA 4R8QA 4ZY4A 5B2LA 4AFJA 3SLSA 3FZ1A 3MIYA 4MBIA 3ZONA 2J6MA 5M51A 3PRIA 4C35A 5C8KA 4FSTA 5E8SA 4JAJA 1OL5A 5GINE 3PY3A 5EKNA 3O7LD 4RC4A 4O86A 2IZRA 4DHZA 2CKPA 3R1YA 3QTQA 4QDVA 3C4EA 3HA8A 4V05A 5HVJA 4DFZE 2RIOA 5EW3A 5FDXA 2X8EA 5I9WA 5AV2A 4D9TA 1Q4LA 3FKLA 4LOOA 3RVGA 3V6SA 3ZCLA 3SW7A 2BKKA 4I6HA 3SKCA 4KSQA 5K0KA 4CMUA 1J3HA 2JBOA 4RZWA 2ETKA 3HGKA 4YTFA 3MFUA 5BV3A 2XKFA 2CSNA 3LFDA 2GQRA 5T3QA 1BI8A 2J0MB 2C68A 2R3LA 2YIYA 3BYVA 4GG5A 4MD9E 3L9NA 4A07A 4BBFA 3AC3A 5J1VA 4J52A 4R7IA 1M2PA 5DR6A 5K0XA 3Q4TA 4GV1A 4MCVA 2VUWA 5L8JA 1OL1A 3HV4A 5A46A 3C9WA 4IWOA 3H9OA 2IPXA 3ALOA 3BLRA 3BL7A 4GT3A 4L46A 3SV0A 2BVAA 3EYGA 4NIFA 5FP6A 4M68A 1KE6A 1XBCA 4P4CA 4IB3A 5FWKK 5LVMA 3V04A 2PMOX 3GBZA 2ZB1A 4CMTA 3CY3A 3AD5A 2NRUA 3GT8A 2QONA 2Y6MA 4ACDA 4MD7E 4BCIA 3VS1A 2HZ0A 4G9RA 2W7XA 3HX4A 5JH6A 4NH1A 5CU6A 2YCFA 3BQRA 1YI3A 4JG8A 4FKOA 3ROCA 3FXWA 4RSSA 4XYFA 1UV5A 3NZ0A 1JOWB 5EYDA 4UMPA 3DLSA 2B1PA 4BKJA 4O21A 3O23A 1H07A 4CZUA 5DVRA 4OTRA 4M66A 1H00A 4FT3A 4PDPA 4F6UA 1CMKE 3CSVA 5M4CA 4U8ZA 4N4SA 4A9UA 4TW9A 5ACKA 4FTMA 3S2PA 2B9FA 2C6KA 2W9ZB 3EN7A 2UV2A 3KEXA 4I94A 4QP6A 4QMXA 3C7QA 3F2AA 4I5HA 3RPOA 3V5TA 1B39A 4OTIA 2ZVAA 5AR4A 3QGWA 4BI0A 3NFFB 3FQSA 3R04A 4C02A 2CLXA 3P1AA 4CKRA 4GL9A 2W99B 3PY0A 3UIXA 5J7HA 5BVWA 4YO4A 2QOQA 3C1XA 4DFBA 3NNXA 3LOKA 4A9YA 3P08A 1M52A 2BAKA 3FZOA 4X2GA 3TZ9A 1E1VA 4FIFA 5IH4A 2J5FA 5HBHA 1FQ1B 3CTHA 5LVOA 4CTBA 3REPA 4X3JA 3NW5A 4XOYA 5M09A 1P4OA 3KMMA 4CMOA 5KHWA 3TJDA 4BDKA 3NIEA 2UW7A 2JAVA 2RFEA 2P33A 3KK8A 3QZHA 4C2VA 3K3JA 4DEIA 2QO9A 4DLJA 4BJJB 4ITIA 4BZDA 4JOAA 5L6WL 4CFNA 5BVNA 5K9IA 2UZOA 4X6QC 5CU0A 3D83A 2QHMA 1JSVA 5A4TA 3UDSA 4DH3A 1BKXA 4O2PA 4D2PA 3JY9A 2X8IA 1Q99A 4JXFA 3OEZA 4R77A 3BYOA 5HCZA 4PX6A 4EWHA 2Q0NA 2YLFA 2UZNA 3NYVA 4F1TA 2ZAZA 3E63A 2Y7JA 5AV4A 3OWPA 4L3PA 4QYEA 3DA6A 1W2FA 4AW1A 2XK8A 1IAJA 4IWDA 3RI1A 4YPSA 4F09A 3BZ3A 1EH4A 3CPCA 5EHOA 5CEKA 3RK5A 4UZHA 3F2NA 4BCQA 5E1SA 4PPBA 4IZYA 4K11A 4XBRA 3H0YA 3TJCA 2EWAA 5AP3A 4HYIA 3CR0A 1V1KA 2VTQA 2XNNA 2YM5A 3BV2A 3VBXA 5K4IA 1IEPA 4G1WA 3QL8A 5EOBA 4LV5A 4XCUA 3NSZA 3TIYA 3FMJA 2IW8A 4B8LA 4CRLA 2YIXA 3PFQA 1WMKA 3AKLA 4QRCA 4XUFA 3F7WA 4LL5A 4ZZOA 1YHWA 2GFCA 4NFNA 2Q83A 3AC1A 3K3IA 3PWDA 1JVPP 2YWVA 4MAOA 2O3PA 1URCA 2XKCA 2X0QA 4FKJA 3PA4A 4TTHB 3G2FA 3U51A 2HZIA 5K3YA 2Z7SA 3LMGA 3IONA 4FSZA 5A6OA 1VLRA 3KULB 2QD9A 4FRFA 4FTUA 3DKCA 3WE4A 3SXFA 5CEOA 2J7TA 4O7WA 4H3PA 3IW5A 5G1XA 4E73A 3GI3A 4M3QA 4DHFA 2I1MA 5CNOA 3VUGA 4Y85A 1OIUA 4O6EA 3DDQA 3AG9A 2B54A 3QRTA 2ZMDA 1JKKA 1DM2A 3SOCA 4I24A 3TKUA 4L52A 5LXMA 2W1FA 3M2WA 5J79A 3S1HA 4WT6A 3PIZA 4RJ3A 2OU7A 3DBEA 4F99A 5CXZA 3FLNC 3I4BA 3AD6A 3GCPA 3QQHA 4ALUA 4TPTA 5E8WA 1WVXA 2PYWA 3PSBA 2OXDA 3FI3A 5H2UA 3KVXA 3OOMA 2CGWA 2Y9QA 4KINA 2IO6A 2GU8A 4AX8A 4WNOA 4PDYA 4BTJA 5IQAA 1G5SA 5ANEA 2OICA 3AC4A 4PUZA 3U4UA 4N6ZA 2UZLA 2F7EE 3B2WA 4BJJA 4ANMA 3BEGA 2OXYA 1PYEA 1F3MC 3HECA 2X4FA 3QFVA 4FICA 2OZAB 4XG6A 4XP3A 2R3KA 3HDMA 4FNYA 3QA8A 4YURA 3QRUA 3A7HA 2RKUA 2HYYA 2UZTA 3RAHA 3N4TA 4YR8A 4ZSAA 1J1CA 3L8XA 3OD6X 4O0WA 1M2RA 4MTAA 4L8MA 4NKAA 5M57A 1WZYA 5C1QB 4RX9A 1WCCA 2A0CX 3TKIA 3KGAA 3VS5A 3D2KA 3C4CA 4TN6A 1BLXA 3DXQA 2ZB0A 3MJ1A 3W0QA 3H10A 3U6JA 3A8XA 2YERA 4JJRA 5T68A 3R7IA 4QOXA 3F3WA 4PP7A 2X6EA 1RW8A 2PHKA 4WHZA 4DBXA 1ZYDA 3TXOA 4C4EA 3QUEA 4L01A 4O4FA 4HPTE 3BV3A 1BYGA 3LM0A 4FV7A 3QRIA 3PWYA 4TWOA 1OL6A 3TG1A 3PVUA 1GJOA 3SW4A 3UE4A 4I23A 2W96B 4KIKA 3W18A 2V7OA 3NMUF 5B2MA 4MNEB 4WNKA 4FEUA 3THBA 3UMWA 1G8AA 3R73A 3Q3BA 4I6LA 3WZKA 3AKKA 4AT4A 5D41A 5JFVA 3R7EA 4L7FA 5AUZA 1XKKA 2R0UA 2BR1A 1W83A 3DZOA 3EYHA 1FGKA 3PPJA 4FG7A 4FT5A 3AC2A 4FTKA 3LVPA 4O83A 4HNFA 4NK9A 4EC8A 4WSYA 4WO5A 3OZ6A 4G3EA 2HXQA 3CKXA 3VQUA 4FJVA 1S9IA 1NY3A 5A14A 3KU2A 3AT3A 2WOTA 3BYMA 1WBWA 3HA6A 3TDWA 4EEVA 2PMLX 5KMKA 3HMOA 2NYAA 5F20A 4UXLA 4O1PA 4V0GB 3AXWA 1YWVA 5DH3A 4FKPA 3EKKA 4HYSA 2YCQA 4LRKA 4RFMA 2W1EA 2AQXA 5HOAA 2UZUE 1UA2A 4R3PA 3Q6WA 1Z5MA 4UV0A 3P79A 3WF8A 3HUBA 3R9NA 3G90X