1RDRA

Poliovirus 3d polymerase
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
450
structure length
316
Chain Sequence
b'VGYPIINAPSKTKLEPSAFHYVFEGVITEVDEYMKEAVDHYAGQLMSLDINTEQMCLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALLLPEYSTLYRRWLDSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS 3D POLYMERASE
publication title Structure of the RNA-dependent RNA polymerase of poliovirus.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Nucleotidyltransferase
total genus 96
structure length 316
sequence length 450
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1998-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1rdrA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rdrA02
4.10.880.10 Few Secondary Structures Irregular Poliovirus 3D polymerase; domain 1 (Nucleotidyltransferase) Poliovirus 3D polymerase Domain 1 (Nucleotidyltransferase) 1rdrA01
4RW7A 2J6TA 1TL3B 4WFZA 2XWYA 1RT4A 4YMEA 4RW8B 2JEFA 3KLIA 3KLGA 3V6KA 4H54A 4IFVA 1HNVB 5DGBA 3MEGB 5HP1A 2R8KA 1S1UB 2OPSB 1XR6A 1C0TB 1LWCA 3DYAA 4K4XA 3DLKA 3I0RA 1RTHA 4Q44A 4QWEA 4WE1A 1RTDB 1HYSB 1R0AB 3ITHA 1SH2A 1TKZA 4ZVEA 4DG1B 3RAQA 1IM4A 4LQ9A 3C6TA 2YNIB 3DI6A 3QLHB 3CDUA 2IM2A 4I2PB 4FS2A 1RTJA 4QWCA 4IR1A 1SV5A 3DLGA 2XI2A 4R5PB 1JLFA 2BANB 3M8QA 3FFIB 5I3UB 4ECZA 1J5OA 5F8HA 2VG6A 3KK2B 1T05A 1HQEA 2YNHA 1QAJA 3RB4A 1NNDA 1KHVA 4RUAA 1FKOA 3Q8RB 4EBCA 5KFRA 3TAMB 5KG6A 4URGA 3N6NA 2HNZB 3GV5B 2D41A 5J2NA 4EO8A 4RU9A 2OPRA 3HKWA 5DQIA 2I5JA 4XPCA 3PR4A 5KFCA 3CO9A 2BR0A 2B6AA 2RF2A 4XO0A 3DMJB 1HQUB 2R2TA 4U6PA 1S9GB 3VQSA 3G6YA 1S6PA 4DL3A 4O44A 5J2PA 3I5CA 1C1BB 4WYLA 2ASLA 3QYYA 1TL1B 4MK9A 2E9ZA 1C0UA 3DOKA 4H4MB 4RW7B 1BQMA 3TVKA 1HPZA 1RT4B 5KFPA 1Z4UA 2ATLA 1JLAA 2WK4A 4IG0B 3H4BA 1MMLA 3M9MB 3FDSA 2AX1A 5DLGA 2IAJA 3NL0A 2R2RA 2FJXA 3OHAA 1TKTB 3DLKB 4NLPA 3I0RB 3OHBA 5KFQA 3MR2A 3BQ1A 1FKPA 4Q0BA 4G3IA 3UR0A 3MR3A 1RTIA 3LAKA 3D5MA 4F4XA 3IS9A 1S6QA 2XGQA 3C6TB 4KFBB 2AGQA 1RTJB 2C22A 1SV5B 4KV8A 4I2QA 5KFUA 4ED0A 1JLFB 2JEIA 4RZRA 3M8QB 4ZMMA 5EDWA 2RKIA 1JLCB 5DLFA 3KNAA 1J5OB 5HROB 1HQEB 3PW5A 1RDRA 2UVVA 4IQXA 4IRDA 1XR5A 3T5KA 5KFLA 3ISNC 4DL7A 4NLYA 3KHRA 2IC3B 4K4SA 3IG1A 5F8GA 4KKOA 1U09A 1DTTA 2AX0A 5KT6A 3BJYA 3OSPA 3QIDA 2IMWP 2YKNA 4ZP7A 3LP1B 3PW0A 4PQUB 2OPRB 4EO6A 5F9LA 2I5JB 5CYQB 4RNMA 4NRUA 2B6AB 3HVTA 5J2QA 4RNFA 5D3GA 4PWDA 1K1QA 3H2LA 4RW8A 1S6PB 5DG8A 3KMSA 4O44B 4QW8A 5J2PB 1IKXB 3KLHB 4EBDA 2VA3A 2VG7A 2ZD1A 3BGRA 4DL6A 1N56A 3T5HA 3CWJA 3DOKB 1C0UB 1RT3A 2ASDA 2J6SA 5DG7A 1RTDA 1HPZB 2BRLA 5KFWA 4IRCA 4IRKA 5C25A 3PZPA 3DRPA 2FVSA 4Q8FA 2JC0A 3H5XA 4DG1A 2W9AA 3QLHA 1S4FA 2YNIA 4I2PA 5JUMA 2OH2A 4J9OA 4K50A 4F50A 1S9FA 4Q0BB 1IKVA 4KO0B 4R5PA 2BANA 1FKPB 4ED8A 5KFFA 5I3UA 2DPJA 1T94A 1RTIB 4FBUA 4MKAA 2R8HA 3IS9B 1S6QB 4ZHRB 2FLNA 1JXLA 5KFVA 2R2UA 1RYRA 1QUVA 4KV8B 5EUHA 3BSCA 4WFYA 2RKIB 3KMQA 5KFTA 4Y34A 3CJ0A 2F8EX 4EBEA 5I42A 2JEGA 1SUQA 1JX4A 4KSEB 4LSLA 1NHVA 3BR9A 1DLOB 1IKWA 1JLEB 2QV6A 5KG1A 5C42A 5KFNA 2V4RA 1DTTB 1KLMB 3CDWA 3E51A 1TV6A 4Q45A 3DMJA 3GIKA 2YKNB 1LW2A 1S1VA 3QZ8A 3GIIA 3PW2A 4B3OA 2IJNA 2J6UA 2E9RX 2V9WA 1C1BA 2WRMA 5C5JA 2IM1A 3QGHA 1TL1A 2OPQA 3HVTB 4IFYA 5J2QB 4H4MA 3RB3A 2C28A 4PWDB 5D3GB 5KFZA 1JIHA 4LQ3A 4ECSA 3PR5B 4IG0A 2XCPA 3GIMA 4NLQA 3V6DA 2W8LA 2BQUA 4O3NA 2VG7B 2ZD1B 3BGRB 4QWAA 4ECUA 5HBMA 1TKTA 4IR9A 4ZPDA 2YNFA 1RT3B 4K4WA 2GIQA 1IKYA 4WZQA 2UUWA 5C25B 1S9EB 3DRPB 1HNIA 4NLRA 1HARA 4KFBA 3GILA 4K4YA 5J1EA 4ZP6A 3H98A 5KG7A 1IKVB 5KT7A 4TN2A 2XCAA 1JLCA 4ICLB 4MK8A 5HROA 4RW6B 1CSJA 4J9QA 3OSNA 2D3UA 1SH0A 3GV7B 1S48A 1RT6B 1LW0B 1EETB 5KFJA 2IC3A 2CKWA 5KFEA 5KT3A 3JYTB 1GX6A 3CJ5A 5KG0A 3MEEA 5I42B 1SUQB 2FVRA 2AQ4A 3OL7A 3LP1A 4LSLB 3Q8SB 2UVUA 4PQUA 3BSAA 4ED7A 1IKWB 5CYQA 4IG3B 4TQSA 1S1TA 1VRUA 4I7FB 5C42B 4KB7A 1LWFA 1TV6B 2ZKUA 5KFMA 2DPIA 4NLWA 3H4DA 2W7OA 4O3OA 4NLVA 3T1AA 3DDKA 1LW2B 1S1VB 2ZE2A 4B3OB 1GX5A 5KG4A 4ZP8A 1C1CA 1RT7B 1IKXA 3CIZA 3I5AA 4RNOA 2YNGB 1VRTB 3KLHA 5C24A 3FSIA 4ECYA 2OPQB 3OL8A 4IFYB 4TY9A 2R8GA 1S97A 2W9CB 3KOAA 3E01A 4F4WA 3V6DB 5DGAA 3RAXA 2BRKA 1N6QA 5HBMB 3G86A 2RDIA 2YNFB 4KO0A 3KK1A 4NYZA 1IKYB 3CDEA 5DQHA 4ECXA 4MKBA 1HNIB 4ZHRA 5FDLB 5KFHA 3MTKA 5J1EB 3V6HA 4U7CA 4NCGB 4ED6A 3DM2A 3MEDA 3DOLA 3LAMA 1KHWA 3BREA 1MU2A 2YKMA 2R8IA 5KFBA 4ZVHA 3LANA 1RT2B 4GC6A 4KE5A 3KHGA 1DLOA 1JLEA 1TVRA 1KLMA 1S1XA 5KFDA 5L1LA 3MEEB 2XGPA 3GQCA 3V4IB 2ALZA 1ZETA 1FK9A 5KFOA 2JEJA 3CJ4A 2VG5A 3BQ0A 4GC7A 1S1TB 4K4VA 1VRUB 4TYAA 5DG9A 2IA6A 1LWFB 2W7PA 3UQSA 2BQ3A 4MK7A 5KT2A 4M94A 1RT5B 2ZE2B 1C1CB 4ECTA 2FLLA 1RYSA 5C24B 3M9NB 2WB4A 1TQLA 3LP2B 4OL8A 3IGVA 3NBPB 2VA2A 5J2MB 4F4ZA 3OLBA 5HLFA 3FQLA 4KHMA 4JUZA 1S9EA 2JC1A 4YR2A 2XI3A 3E01B 4RW4B 3BSNA 4HYKA 2C2DA 5KG2A 1N48A 3MECA 1N6QB 5F8MA 1LWEA 2FVCA 5F9NA 2FVPA 3KK1B 4X2BA 2FLPA 3ISND 4TQRA 5F8JA 4ICLA 4PUOA 4RW6A 3NAHA 1RAJA 1UWBA 2HWHA 4ZVGA 3EPIA 4ED3A 3RB0A 4O3RA 1RT6A 1LW0A 1EETA 4DEZA 3JYTA 4TXSA 4K4UA 3DM2B 2GIRA 3DOLB 3MEDB 3KLVA 4WXOA 3G6VA 1MU2B 2YKMB 2BE2A 4QW9A 4JV1A 3QO9A 5KG5A 4J9MA 2FVQA 5KT4A 4IG3A 3GIJA 1TVRB 4I7FA 4TY8B 3BSOA 4RW9B 1S1XB 3EPGA 1DTQB 4IOBA 3QIPB 2HNYB 4RNNA 4EYHB 1FK9B 4HKQA 5CYMA 1RT7A 3KK3A 2VG5B 1VRTA 2YNGA 3D28A 3PVXA 5L1KA 2O5DA 1S1WA 3KHHA 4IKAA 2FJWA 4K4TA 2W8KA 2CJQA 2HAIA 4O3SA 2HWIA 3H40A 1JLBA 3DRRA 3OL6A 3IRXA 4NLDA 2W9CA 3HVAA 2HNDB 2BQRA 1TP7A 3DRSA 3PJWA 3T19A 3RB6A 3V81A 3DLEB 1SH3A 4J9RA 5HLFB 2E9TA 3KJVB 3Q8QB 2RDJA 1HMVB 5FDLA 3OLAA 1S0NA 2AGPA 1TKXB 3MECB 3JSMB 1LWEB 2WTFA 4NCGA 3T5LA 4RNHA 5DQGA 4PUOB 5KFGA 4WZMA 1UWBB 1RT2A 2WHOA 3T5JA 3M8PA 4ECWA 2ASJA 4J9SA 1S0MA 1RA6A 2IM0A 2OPPB 3HHKA 4IH6A 3SFGA 1EP4A 1XR7A 2BE2B 4IH5A 3V4IA 4KHRA 5KFIA 3QO9B 3KLEA 4O3PA 1K1SA 4Q8EA 3LALA 5F8LA 4RUCA 4MFBA 4NLXA 1RT5A 5CYMB 3KK3B 1YVFA 2B5JB 3V6JA 5T14A 4G1QA 4ECQA 4ZPCA 1S1WB 2W9BA 4ED1A 3LP2A 3KLFA 1JLGB 3NBPA 5F8NA 5K14B 2C2EA 5J2MA 4YR0A 5KG3A 2I1RA 1JLBB 3DRRB 3H5SA 3IRXB 2R8JA 1S49A 4RW4A 1D0EA 1W25A 2D3ZA 4H4OB 1JKHA 1RA7A 4R8UA 3DRSB 2R2SA 2V4QA 3V81B 1QE1A 2IJFA 3CVKA 3ICLA 3IGNA 3M9OB 4NLSA 2AWZA 4LSNA 3G6XA 4IDKA 4O4GB 3I0SA 2QE5A 4DL2A 4YR3A 3RBEA 4FS1A 4K4ZA 3FRZA 3QGIA 1C2PA 3NAIA 1NHUA 4ZVFA 4EYIB 1N5YB 3PW4A 3M8PB 4ZP9A 1ZTTA 2HMIA 3KLIB 2IM3A 2B43A 4MIAA 3KLGB 4IH7A 4IFVB 4TY8A 4O3QA 5HP1B 4RW9A 3DYAB 1LWCB 5KFXA 4YP3A 1DTQA 1EP4B 1RTHB 3QIPA 4Y2CA 2HNYA 2ILYA 4WE1B 2AGOA 3KLEB 3ITHB 4Q43A 4WYWA 2UVRA 1TKZB 4XPEA 1RT1A 3C6UA 3DI6B 4KBIA 1BQNA 2XC9A 4TYBA 4MFBB 3MR6A 1T03A 1QAIA 4JV2A 3DLGB 4EEYA 3GYNA 3HVWA 2UUTA 4NLOA 1S10A 1OS5A 4ID5A 1T05B 2VG6B 2FJVA 2HNDA 2YNHB 2WONA 3LP0A 1REVA 3PW7A 4G1QB 2W9BB 3CJ2A 4ZPAA 3KLFB 5EWEA 1FKOB 3DLEA 4J9NA 5KFYA 4WXWA 5EWFA 3KJVA 4ECRA 3MFIA 2WOMA 3NKYA 1HMVA 5L9XA 3MR5A 1JLQA 3NMAA 3OL9A 5KFAA 3UPFA 1JKHB 1TKXA 5J2NB 4R8UB 3JSMA 3N6MA 4ZPBA 3PHEA 1QE1B 3QGGA 4NLTA 2RF2B 4LSNB 4NRTA 4NLUA 1TL3A 4IDKB 2ILZA 3I0SB 4URQU 3UDLA 4J9KA 3IN5A 3SI8A 4Y3CA 4MIBA 4KAIA 4F4YA 4DL4A 4M95A 4QWDA 3RBDA 1HNVA 1I6JA 3MEGA 2IBKA 5KFSA 5JXSA 1WNEA 1S1UA 1C0TA 2OPPA 2OPSA 5F8IA 4FBTA 1BQMB 4ED2A 5L1JA 1HYSA 3CJ3A 3I5BA 2GC8A 1R0AA 3H5UA 1JLAB 2HMIB 3BQ2A 2IAJB 2AU0A 4NLGA 4NZ0A 4WFXA 2WCXA 5EWGA 2C2RA 2EC0A 2D7SA 3FFIA 5KFKA 3MFHA 2B5JA 3SFUA 4URSA 3KK2A 1T3NA 1RT1B 3C6UB 3NGDA 3KHLA 1BQNB 4J9LA 1JLGA 5L1IA 1T03B 5K14A 4I2QB 2JLEA 3TAMA 4ECVA 3N6LA 5KT5A 4ID5B 1S0OA 4Y2AA 2HNZA 2WONB 3LP0B 1REVB 3GV8B 3PJXA 4H4OA 3Q8PB 1N4LA 4DL5A 4J9PA 1ZTWA 4QPXA 3IG1B 4KKOB 4QWBA 4R0EA 2WOMB 4JV0A 1D1UA 3MF5A 1HQUA 4O4GA 3H5YA 4YQWA 1JLQB 1S9GA 3TQ1A 4O4RA 3EZUA 4TLRA 3QZ7A 3H59A 2UVWA 3FQKA 2V0NA 1N5YA 4MH8A
chains in the Genus database with same CATH superfamily
3OTDA 1WG4A 1RT4A 4YMEA 2P6TA 3MEGB 2E5GA 5DM7Q 4FS2A 1R0CB 2IM2A 1RTJA 4QWCA 2XI2A 3LWMA 4ECZA 3RB4A 3QWPA 5BR8J 1FKOA 5A8RA 4CTAB 4QR1A 1B0VA 4X4NA 3W2VB 2IA0A 3SV4A 2HGMA 1JXEA 1YI2S 3I5CA 2F8MA 4NA1A 4F7VA 2FZCB 1RT4B 3N9UC 5D0HA 4M1KA 2FJXA 2R2RA 4F04B 3AX5A 4NLPA 2IVMA 3OHBA 3DLLQ 3M8SA 1HW9A 1RTJB 3C46A 2C22A 3ZTQA 5EDWA 2CRLA 4LRFA 3ISNC 1A6LA 4WIQA 2XSFA 3UVJB 2KFYA 1ELOA 5CYQB 3D1QA 2BKOA 1KQSR 4TU7A 3L4BC 2BRLA 5RUBA 4OHVA 2CNNB 2Z57B 3J80U 2BDPA 5B0GA 2AYMA 2YXLA 2EFGA 4ZHRB 1Y5LB 1KVJA 2R2UA 2V8VA 2PEBA 3AA8A 1DFDA 2X1AA 3BO4A 2JEGA 3MWBA 2HVZA 1N32J 2AP6A 2H1YA 4UOGA 2HHXA 1H98A 3CDWA 2LMIA 4Q45A 1OSDA 4YB1P 4CT8A 2EFQA 1UCNA 1JK9B 1JIHA 3AXMA 2BOAA 1SL0A 3V6DA 3EUNA 1ACMB 2YNFA 3KG0A 1ZA2B 2E1PA 2E66A 1MLAA 2XTJP 2VC1A 1EETB 1GX6A 4PR6A 5KG0A 3PRVA 4C98A 2Z56B 4TQSA 1GX5A 2H9ZA 1VRTB 3MZIA 2RQCA 3ILOA 5GVQA 1RSCA 3V6DB 2DGTA 3OVBA 2YNFB 3EXCX 4KO0A 4CLYA 2NS1B 2YQ0A 2PMWA 1VLOA 3DM2A 2CG4A 1FNMA 3CCSS 1AZSA 4DV0F 4F0HA 4KE5A 3OR1A 5JJBA 1TVRA 3IA0A 1M90T 3M30A 1ZETA 2KXNB 1WG5A 1V3RA 1C4CA 1CQMA 2V2VA 1AA1B 2VA2A 3A3OB 1NMEB 3HFKA 1N88A 2FHMA 3FSYA 4OZJA 4LF2A 1PJ6A 4NMLA 4DEZA 3CCMS 2F9DA 3DM2B 1AZSB 4DL0C 5EHHA 2GW8A 4NCBA 1TVRB 3LPYA 3M30B 2FJAB 2EFNA 5CYMA 4ZVOB 2UXCJ 3GYXB 3MM5A 2HWIA 4B3TJ 1OPZA 3UDCA 1Q8LA 3Q8QB 2HSEB 1U4BA 2BW7A 2V2KA 1X4BA 3UNGC 6FD1A 3AQOA 5CZVA 2XS7A 2Y1LB 3HHKA 4HLBA 1L3KA 2CZVC 3LALA 4PWWA 2RHSB 1RBAA 4JI5F 3HX9A 5CYMB 4ZPCA 2V4JA 3MM5B 3JB9k 1J27A 1S49A 1D0EA 1RA7A 3GB0A 2VDHA 3RRHA 4NZ6A 3L95X 4OI1A 4K4ZA 3MUTP 1NHUA 4FF1A 1RP5A 1XBWA 3ZNJ1 1LWCB 4YP3A 3JTOA 2YH1A 2DJWA 4WYWA 1XN9A 1Y5IB 2DNYA 4JOUA 3M32B 1T03A 2Q43A 4BS2A 1FE0A 3VAFA 3QFHA 3VTIA 5EWFA 3MFIA 2B9WA 3VGTA 4FNIA 4P71A 1SL2A 3A13A 4URQU 3UDLA 3SI8A 4Y3CA 1RKIA 2BJDA 3RBDA 4DU7A 1EARA 1RAIB 2OPPA 3QNWB 5L1JA 2CWKA 4X4QA 3SFUA 2LQBA 1T03B 4I2QB 1OPIA 3R6LB 3GV8B 3Q8PB 2AV5A 1VI7A 4QPXA 1NK7A 2J7KA 2UUAJ 1VC5A 1FDNA 2RD5C 2PDAA 3MCOA 4JI6F 1F6TA 3CXCR 4NEYA 4DFJA 5E2QA 3KLIA 3RJMB 5DGBA 1XR6A 2GMHA 1TKDA 3HO1A 3I0RA 3R5JB 1RTHA 2U2FA 3KJFB 3UFCX 5KOXA 1NM2A 5A8KA 3DLGA 3BYRA 1BXNA 4R5PB 2DCUB 2V8GA 4EBCA 2V8PA 3N6NA 2KI2A 1SKSA 2BR0A 1NCLA 5B0FA 2H5IB 1S6PA 2B56A 2OEMA 4G6VB 2CQHA 3DLHA 1VIOA 4N5SA 3M9MB 1I3OB 2RUGA 3NL0A 4WU3A 5B0CA 3I0RB 1FJGJ 1IUJA 1KNZA 4ILRA 3KUEA 4KFBB 1TUGB 5A8KB 1XMQJ 2LA4A 1WSVA 4P73A 4ED0A 4OZLA 2AJ2A 2CXEA 4DSFA 9RUBA 1M5KC 3PW5A 3A4TA 2W7AA 4CH7A 1UEVA 5G0RA 3LP1B 1YG0A 5F9LA 1I94F 3M8ZA 5HATA 2OP5A 1S6PB 4BWJA 2ADBA 1Q53A 1JQGA 1FI4A 2NLWA 1APSA 3SXLA 2DRDA 2I0XA 4F50A 1FNXH 3HSJA 2BANA 2MHNA 4CCHA 3FEYB 5H9FJ 4FBUA 4WIIA 5LM7E 1QUVA 4WFYA 5HL7Q 2V1TA 1HKAA 1X9MA 5D77A 4KGMA 1UJ5A 3AY0A 3MGJA 2ZOGA 1DARA 4C8MA 4HH0A 1T11A 5MAOA 2QSFA 2VASA 2W8LA 4ECUA 4OV6A 3QQCD 4K4WA 1FD2A 3CDBA 1FD8A 3MPVA 5D8HB 2CPDA 4LF5F 4HDHA 4DR7F 1JLCA 2HHTA 4ICLB 1SL1A 1V3ZA 3DHXA 4B9MA 4ES2A 4USVA 4PQUA 3BSAA 4DV1J 5IV4A 2W7OA 4C3KA 3KLHA 3LA0A 2QL9B 2HFUA 2EPIA 2HHQA 4ZCIA 1D8ZA 3SZ2A 1RWKB 4DCOB 4DQSA 3TZYA 3QWUA 3DGPA 2DR9A 4C11B 1DQ9A 3IMQJ 2UU9F 2K7JA 4PWUA 2X1BA 2LFVA 4MMOA 1KTQA 5L1LA 1KQGB 2ALZA 3ETMA 1RWNB 2JEJA 5DG9A 2IA6A 3C16B 4ECTA 1RYSA 4DBQA 4U7UK 1NK9A 1KKHA 2HHVA 4OL8A 2R4FA 2HS3A 2FPHX 1RE1B 1TMMA 4TKTA 1HIYA 3Q83A 4W92B 1HI1A 2QRRA 4WJBA 3VZIA 5F8MA 2DNGA 3DGPB 4QCLA 2BZ2A 1GNKA 4KTQA 3NMRA 2VB6A 5IT9U 2ZBPA 1YTYA 2D1CA 3NGUA 1HWJA 4YY3F 4IG3A 1QLNA 5ETRA 3DFEA 4LBIA 3MMCA 1DTQB 4ED4A 1NEEA 1RT7A 3KHHA 2FJWA 2R7OA 3SSQA 2W8KA 1Q81T 3DRSA 5LMUF 1OQ6A 3FCHA 2RT3A 2QMXA 2CPYA 4RNHA 1Z2ZA 1I5OB 3T5JA 4CLSA 2AEFA 4NYPA 1XWLA 1ZS6A 4UUWA 1W7WA 3M05A 1GTHA 3G87A 3V6JA 4OYMA 1YJWS 4ECQA 4K2XA 4OFZA 2EBEA 2MEWA 1X8DA 2FC9A 4F25A 3DRSB 3DXSX 3CVKA 3VWSA 1B7YB 1WUUA 1VBYA 1UFLA 2F40A 4K8RA 3NAIA 3I87A 3ZTRA 5K5MA 2QIFA 4TNOA 4KR0B 3WX8A 1BQNA 3CMQA 3EVOA 2JJ4D 1U2RA 5D4LA 3DLEA 3TA1A 5LL6d 2CDRB 1S59A 1SJFA 5IQQA 2XEXA 1H6KX 2BACA 2ZH3A 2XZ2A 2FJEB 5KFSA 3ILLA 4ZS6A 4MKVA 4KYZA 2GMJA 3M4XA 1U0HA 4F2SA 1TFWA 1H7WA 4NZ0A 1S7IA 3FFIA 4URSA 1BQNB 2AEMA 4USUA 1YRXA 2GO8A 5K14A 1U1MA 5E3AA 2ZWPA 2AW0A 3ISZA 3PJXA 2XMAA 3M1VA 1FWKA 2YKOA 2HS4A 3P5TL 4KGZB 3FQKA 3M2RA 2V0NA 4MH8A 1DZ5A 3WIUA 3PNIA 3AAWB 1U0HB 2N3LA 2W25A 3FFIB 3M2VA 1QAJA 5JVGQ 3NS5A 1UP1A 2D41A 4DV0J 2HZAA 2XZTB 3M1VB 2RF2A 2Z4PA 2H65B 4O44A 5J2PA 5G4DA 3M2RB 8RUCA 3VALA 3B82A 3PEHA 2DNNA 1N52B 1ZBTA 2ZKTA 1T9XA 3LGHA 1U45A 2Z0GA 3OUYA 1X4DA 3LAKA 4ZJOA 2XGQA 1XJWB 2VPXB 1OIAA 4C8KA 3FRYA 4ZMMA 3M2VB 2XNQA 1YJVA 2CPIA 3BJYA 3QSIA 2VONA 4ZIVA 3QIDA 2CPFA 3C14A 4TVAB 3MURP 2XS2A 3EMTA 4FPIA 2BV3A 4O44B 5J2PB 2ZD1A 1N0UA 1VK8A 4NI2B 7FD1A 4NA3A 4B08A 3TO8A 3L7OA 5JUMA 3D1OA 4DV2F 1A9NB 5DRKA 1IKVA 3GSDA 4ED8A 3OUYB 1AW0A 5I3UA 3TUZC 4EMDA 4ZCLA 5H9EK 1AFIA 4K59A 5D15A 4DR2F 5I42A 5KG1A 5KFNA 4KH1B 2QG9B 3Q2SC 1UVMA 1Q78A 3C14B 2V9WA 3IFEA 2WVEA 4WKRA 1OJ4A 4F3QA 2MQOA 2CZ9A 3RB3A 4OYIA 4JI5J 2ZD1B 4BC7A 2PO4A 3RBXA 1S9EB 3TYTA 3Q22A 4NLRA 1UA0A 1IKVB 3OQ2A 5KT7A 3UD5A 1CSJA 3EX7B 3OSNA 2XB2D 2PFFB 2P9CA 5I42B 3CIMA 3CMAS 3T1AA 3CC7S 1FRLA 3W8GA 2YNGB 1K47A 4NOHA 1KS2A 1HBNA 4I67A 3EDRB 2CQBA 5ETNA 4U7CA 1PGZA 3BREA 2R8IA 3T9NA 2K1RA 3V4IB 4F36A 3EGNA 5ETTA 1JB0C 4M94A 4ANDA 2FC8A 4M5KA 2WZ1A 2OKQA 1NLKL 1HBNB 5J2MB 3OLBA 3RAMA 2DGUA 4X4UA 1LWEA 3T9ZA 4IO1A 3M2UB 1RT6A 3L7PA 2DR5A 4JI6J 3HM9A 1GT8A 4I6AA 1XIQA 4I7FA 3D66A 1BHNA 1WOOA 4IOBA 5CD4H 1IBCB 1ZAWA 2HNDB 2FD2A 1WSRA 5ETLA 1LWEB 4CO2A 5IV3A 1IBMF 3OFFA 4LR9A 3DU5A 1O8BA 2ROPA 3PX0A 1U49A 2BABA 3D6FB 4P9SA 3ENQA 3TZZA 4XK8C 4E8UA 1OSCA 1A7GE 5AE1A 4YR0A 2RAQA 2RIJA 1R7IA 4O4GB 4YR3A 4FS1A 4DX5A 1NSQA 1LNQA 3FEZA 3W64A 1ZTTA 2HMIA 3KLGB 4IFVB 3DYAB 3G9CA 4PPZA 1R8CA 4EEYA 1VQ7S 2UUTA 3LP0A 2JWNA 3CTRA 2ZWOA 5J2NB 1D9DA 2HFSA 1FTRA 1ULRA 2A1BA 1NBEB 3GG0A 2ZITA 4L73A 3VQTA 3NG8A 2HMIB 3BQ2A 2AU0A 4X4RA 4LF5J 2MLYA 2X1FA 2UV8G 4ECVA 4YB6A 2BBEA 4B3SF 5KT5A 4Y2AA 3N5FA 4DR7J 3LP0B 2BKNA 5CAAA 5HMZA 3TQEA 4TU8A 3R2CJ 2YKQA 2D9OA 1V3SA 3H59A 1HHTP 4UW2A 4UQTA 4P52A 3HK2A 4K4XA 4Q44A 1RTDB 5SZTA 5DJBA 1T05A 4J9UE 1QSLA 2VICA 4ENOA 1KHVA 3K89A 4P74A 2UU9J 5HMXA 1WC1A 4DV5F 2U1AA 1WDDA 1X4GA 4LF9J 4QU6A 2C2MB 4CQ1A 1WC4A 2W2QP 4NWBA 1Y10A 2QFIA 1SIWB 3OV7A 1CULA 1ITPA 1OM2A 1HPZA 1ZA1B 3NCRA 2AX1A 5DLGA 2XMVA 4F4XA 2QX0A 3POTA 2G0JA 1RQ0A 2RKIA 3HMJG 2UVVA 4IQXA 4NLYA 1CS4B 1HBMA 1GXTA 2WAQD 4KKOA 4WPAA 4ZVSB 3D1HA 5K9FA 3KKFA 1K73T 4RNMA 4YY3J 4NRUA 6AT1B 2DCLA 4UOHA 2HHHF 2VG7A 1CULB 3FMWA 4OX7A 2UXDJ 5DG7A 1HPZB 1SI9A 2JC0A 1S4FA 2OLWA 2DY1A 5KFFA 3QBCA 2G13A 3UN5A 1KONA 3POTB 1L3UA 3Q8VA 3W5XA 2YY3A 2RKIB 4DCJB 4EBEA 1JX4A 5D6GA 4X84A 1HBMB 3KTQA 1LW2A 3QZ8A 3CF5Q 2HGNA 2G2ZA 5KFZA 4WK3A 3PX6A 2VG7B 2WBMA 4P2FA 5LXRA 3P96A 2GIQA 4WZQA 3K5OA 1HARA 4K4YA 3K8WA 2K7KA 4TN2A 2ZNZA 3CC4S 1S6OA 5HROA 1EJ7L 2D3UA 1Q7LB 2LECA 4L72B 2FVRA 1U2FA 3MM9A 4O23A 2UVUA 2MQLA 2LA6A 1WC0A 2DNLA 3H4DA 2GGPA 4IYQA 5AXLA 1LW2B 1UMJA 3CJKB 1S97A 2D74B 4Y2MA 1PC5A 4CO0A 3MD1A 2C1EB 4DSEA 3D0GE 3V6HA 1NH7A 4NCGB 4NPOA 1NDCA 3EE3A 1RT2B 3J7ZT 1FVQA 3VAKA 4YB7A 1KLMA 5CCMA 4X64F 3GP9A 3LPEA 4C0OC 3MM9B 3QT6A 4I56A 2GGPB 2QFJA 4DFKA 2RRAA 2NUUG 4DR4J 4GKKF 1RACB 4NX9A 4AYBD 4DV7F 2E5JA 3ZTOA 1RAAB 3W3SA 5A0YA 3OR2A 1ZPVA 2B9YA 3W7BA 4QW9A 5CD4A 3TANA 4DWIA 4RW9B 2K8GA 4PG5A 1IWAA 1GXLA 5FLXY 4DS4A 3IRXA 4CLWA 3K5NA 2DR6A 2LKZA 2AYGA 3V81A 2NCKL 2AYBA 1F9FA 3TP2A 1HLWA 2Y1JA 3X1LB 3RG6A 2LDYA 3OTBA 3EVWA 3FZ2A 2O3DA 2WHOA 5A0YB 1CC7A 2ACYA 3OR2B 1VQLS 2QO3A 2V69A 5AJ3F 4IH6A 3NGSA 3SFGA 3AX3A 4K5SA 4O3PA 2YWEA 5F8LA 3H90A 3PXGa 3M6UA 3D7SB 2UZAA 3OFHA 2UUBF 1HBUA 4HACA 3NBPA 1UA1A 3IRXB 1URRA 2GJFA 4DI6A 3VAJA 3V81B 2GJ2A 3OD2A 2ZC4A 3MUMP 4XAKA 1VBKA 2LVWA 1NUEA 1Q8KA 3HHLC 4UT4A 4DUTA 4ZP9A 5E7OB 2ACMA 4TY8A 3RGIA 2VPZB 2J9CA 3PW7A 3GTYX 1VCTA 1HBUB 4HACB 2IRXA 3TR5A 1RXOB 3PJ9A 1VISA 2LCWA 3MR5A 3JSBA 4DR2J 3UW1A 4ZPBA 4OMFG 2LQ5A 3JXOA 4EK2A 1NB7A 2PA3A 1WNEA 1JLAB 5ITHA 4OZ3A 4M5MA 2WSEC 2O66A 3GFHA 3KK2A 5IXUA 3J81U 3R8YA 2K3IA 3US5A 3ZNUA 3MXHP 2N82B 3G71S 1VQ9S 4CLPA 1HQUA 2MY8A 4O4RA 3NGTA 3N0VA 4OLPA 1E6YA 2LQJA 4WE1A 3BYPA 3S1TA 2ALYB 1P1LA 3DI6A 1P8GA 3C19A 3KK2B 3C66A 2JRSA 3VAHA 2AJQA 1NK0A 2OPRA 2R7UA 3GLJA 1HQUB 2M3DA 1S7HA 4X4SA 1FJCA 2W2NP 4PG6A 1C0UA 1H3DA 1E6YB 3C8YA 3UR0A 1S76D 3IBCB 1UVJA 4QIWD 2A18A 3JAMU 2OPRB 2OFGX 2L9NA 5IOLA 1KFSA 2VFRA 1X5SA 1XC9A 4RW8A 1TAUA 1RLCL 2PA8D 1GQEA 4X66F 1C0UB 5KFWA 2DXEA 2HFNA 4PYAA 1B0TA 1OYDA 3W61A 4HT5A 1J2VA 3U27A 1F60B 4ETXA 2G9OA 1KN6A 2GJIA 1VQYA 5IT9Y 1IBMJ 4ZPVR 4ZVUB 1SUQA 1JLEB 5F0UA 5C42A 1GMUA 4IUFA 2Q79A 3JTNA 2OTJS 2GHVC 3EZ5A 3P6YC 1TL1A 2OPQA 2G2OA 3SDEA 4LJMA 3GIMA 2H3EB 3DCAA 1CJKA 4V19X 2EFVA 1ZZFA 3AA9A 4ZP6A 1FKAF 3G6ES 2XCAA 1XERA 4Y65A 2ZHBA 3T6BA 4C8YA 3CJ5A 1SUQB 4DUYF 2VFVA 5C42B 3SYZA 4KB7A 1NO8A 2ZM6F 4NLWA 4I64A 2KM8C 1H72C 2JLGA 4C8NA 2VQEF 3CULA 2OPQB 4PXEA 1I51B 3ENVA 5D4PA 4BLGA 3SDEB 2KO1A 3AJDA 1BQXA 3LF0A 4OJ1A 9ATCB 2KVIA 2VODA 4CNYA 5FDLB 5K8NA 5HVGA 5B0AA 1U1PA 1YJ9S 1NK4A 1VHFA 5KFBA 1KD1T 1JNRB 4OI2A 4JI2F 4YDDB 2PC6A 4DR6F 3GWCA 2EG2A 3UQSA 3MPUB 2FJDB 3OTCA 3BGUA 4CO4A 4EZ6A 5ETMA 4CM2A 2M9KA 4C3MA 3L3CA 1R27B 3A8EA 3DGVA 2DGWA 1RZMA 3MECA 1SJRA 1PCAA 4PUOA 1RWWB 4RW6A 1LW0A 5AXNA 4DF4A 2KT3A 4KPYA 4KH0B 2CFXA 1PAUB 2NXNA 2J7WA 1SBRA 4O3SA 2M7SA 4CDIA 4J9RA 2YTCA 4YDXA 1FX4A 1MN7A 3OLAA 1TKXB 3MECB 1SVDA 4DV5J 2HG4A 3ONQA 1YQHA 1HI8A 3T5LA 3B54A 4PUOB 4N8OA 4XTTA 4MAKA 2GCFA 2MQNA 2YKAA 1EP4A 3CC2S 2VF3A 1K1SA 2DGQA 5ETPA 1JJCB 4HTIA 3HHNB 3MPWA 4HI1A 1GTEA 3LP2A 5F8NA 2HRUA 3SEOA 1JJ4A 1JKHA 3NGKA 3PM9A 4DX7A 3ICLA 3IGNA 5HSPA 3I0SA 4DL2A 2V67A 1QY7A 2C3MA 3FBBA 5JVHQ 1H38A 1WORA 3J7Z5 2HHHJ 2P9GA 1FFSB 1EP4B 3GR0A 1FESA 1QVFR 1S10A 1WC3A 4BDPA 4J9NA 4P7TA 4OYWA 1JKHB 2DO0A 2MKHA 3PO5A 2L08A 1A0OB 1TL4A 2ILZA 3I0SB 4MIBA 4ZLPA 1HNVA 3R3TA 4DQPA 3I5BA 2GC8A 1SKRA 1VOMA 3WDOA 1MG7A 1F5BA 3ZZOA 4JI1J 3MFHA 2B5JA 1T3NA 1Q16B 5DZ6A 2WVBA 4X4PA 1DAXA 1SQGA 4PG4A 3M8RA 4DDFA 1FNOA 2DNOA 1TUWA 1N5YA 3CCLS 2YPYA 1JJ2R 2HBYB 3V6KA 1RLDA 1HNVB 3CCQS 3P45B 4UZBA 1QAXA 4A8FA 2VG6A 3PYEA 1HQEA 4USHA 3PFOA 3PX4A 2R7TA 3HKWA 2MKIA 2HKEA 4X64J 4XO0A 2JVRA 3PYDA 3ZC4A 1RB0A 4QIGA 3MEKA 3RTVA 2EK1A 2NSCA 3QYYA 3DOKA 3QRQA 3TVKA 3R5GA 2ATLA 1XMOF 3WC2A 1TKTB 2EXUA 5F0WA 3BQ1A 4JBCA 3MR3A 1RTIA 4GKKJ 1S6QA 1NK8A 4DV7J 1M5SA 4C2MA 1HQEB 3T6JA 3I55S 5DDPC 1FDAA 2B51A 2B4PA 2IMWP 2UP1A 4ZP7A 4DJBA 3ILJA 5J2QA 4D3GA 2XQCA 2HBZB 2O01C 4DUZF 2VFTA 1N56A 3DOKB 2RS8A 5HMYA 2W9AA 3MM7B 4J9OA 4N56A 1LK5A 1PYTA 2IDLA 1RTIB 2R8HA 2ZUAA 1S6QB 2CQPA 2HVEA 5EUHA 4RU2A 3KMQA 2D3OR 5GAEU 1UETA 2QV6A 2XY7A 1GMVA 3E51A 2M88A 1U6FA 4QZVB 5AJ3J 2CNLB 2NXEA 2GV1A 1C1BA 3JSRA 4AUKA 5J2QB 4Z2XA 3K57A 4LQ3A 3TUPA 1VC0A 1I1GA 3QPIA 2UUBJ 1H73A 3K59A 2XM3A 1BE4A 2KT5A 2M5YA 5HJXA 1VQNS 2BW2A 5KT3A 3JYTB 1LXNA 2H4WB 2HQCA 3FUYA 3PTWA 3AODA 3I5AA 1U6ZA 1WF1A 4ECYA 7AT1B 1IR0A 1EQ0A 3CUNA 4A4JA 2BVZA 3OJSA 3TAQA 4HT7A 3FEXB 2JX2A 5GMDA 3KHGA 4WFBQ 4DPWA 3ZFVA 1Q79A 1F3FA 2IMOA 1SJ1A 5KFDA 4FF4A 2NXJA 2E1CA 5KFOA 3CEDA 4KPCA 2B9XA 1NU4A 2DNQA 4OYOA 2RUSA 2GQ2A 2R42A 2R7VA 4ELVA 3NNAA 1SXLA 1Y11A 2WB4A 2RVJA 2XI3A 4RW4B 3BSNA 1AXQA 4KIAA 2CQ1A 2KL8A 4X2BA 1N54B 2R7XA 2DGXA 3NAHA 1UWBA 4OX9F 4ZVGA 4O3RA 4ED3A 4R25A 2DISA 1JWWA 2XTCA 2HHUA 3N79A 1X5OA 2RJZA 5L1KA 4CLUA 2AZ1A 2IJRA 3PDNA 3EYZA 4RWXA 1JLBA 4D3HA 3CMES 2BQRA 2UXBF 3RB6A 1HMVB 3S7RA 1S0NA 1BWEA 2MQQA 3JTPA 1N33F 2ADCA 4AQYF 3BPSP 1UWBB 1NSAA 3KNGA 5D0EA 4DPXA 2W01A 4PRFA 2QYGA 4RUCA 5H1SV 4OI4A 4H4KC 1JLBB 2DNKA 1GMWA 2E5LF 1XNQF 1QE1A 1YIJS 4OX8A 2AWZA 2NSBA 2Q6BA 4Z7CA 1VQ6S 4C7QA 2QLFB 2VOOA 3LQVA 4ERDA 4ZVFA 1RWXB 2FGCA 2VDIA 2IM3A 4Q2LA 1YJ7A 3QIPA 2HNYA 3BKUA 3C6UA 2CQ2A 3TA0A 3BBBA 3MAAB 3HVWA 2ZZNA 1RWVB 4P72A 2HBQB 4UTGA 3SQGA 1BMQB 5L9XA 3W66A 4LF8F 3JSMA 3PHEA 1FX2A 1QE1B 4QYRA 2D69A 4NLTA 2C3PA 2KJWA 2CPXA 4DL4A 2V8HA 1HYSA 4L3NA 1BUXA 5E33A 3G4SS 3ZZYA 1WTFA 5B09A 3C6UB 2XMMA 1XNRF 3HLUA 4LT6A 3I31A 5IT0A 2BM1A 3OXFA 3SQGB 4QWBA 2RQKA 1D1UA 1VQSA 1TELA 3RRKA 3EM1A 1EKRA 4OZNA 4WU2A 2X3GA 4H54A 2HYIB 2CJ9A 1RU1A 2ASYA 1HYSB 4FF2A 2BJ9A 3G2XA 1SH2A 4N76A 1IM4A 3CO0P 4I2PB 2V2ZA 2C3UA 4LFBF 4N8NA 2WW8A 2UV8A 4JI0F 4URGA 3UDVA 3GYGA 3PR4A 5KFCA 4FDFA 4QU7A 2GO9A 1RHJB 3VQSA 4JV5F 4DR6J 2ASLA 4MK9A 2E9ZA 2POKA 4K7QA 1BQMA 2MJUA 1MMLA 3G82B 3RBZA 3THPA 1WI6A 3CCRS 3KWMA 4OJHA 3EDQB 4DHVA 4XDDA 1X4FA 5AE3A 3HHLA 5E5NA 4JI8F 2AJ0A 4IRDA 1Z2LA 4BCAA 3SV3A 2IC3B 2WVFA 3SCLE 1U7LA 4AD6A 1RBOB 3SQOP 1UJ4A 1SJ4P 1J5EJ 2MYFA 3I32A 1IKXB 4DL6A 3RUBL 4WP9A 3CCES 3DRPA 5C2CA 3QLHA 5FIIA 4LRBA 3W60A 2ZH2A 2B4VA 2RU9A 3R7SB 5GAEI 1JXLA 5KFVA 3VHQA 5LSOA 1NXIA 1O6XA 3HHLB 5CABA 4UF4A 5D4NA 1TV6A 3UR3C 3GIIA 5CZXA 2BM0A 4IFYA 1WDTA 4ZJQA 1FFWB 2C28A 2WSFC 1SJQA 1WHYA 4QBUA 4LR8A 5HBMA 4IR9A 4M5LA 3DRPB 2QJ3A 4A8YA 1X4AA 3IR6B 5J1EA 1ZAVA 2AD9A 1FRXA 3TI0A 5J1PA 2LU1A 1VK3A 1SH0A 3GV7B 2CKWA 3N5BA 3Q8SB 3DLBA 4AXIA 4LFAF 3BDEA 1TV6B 4ZA1A 4CP5A 1DRZA 3DDKA 1C1CA 4CM0A 1FJ7A 4A8QA 2FYXA 4IFYB 2PSZA 2JVOA 4F67A 1AROP 4DSLA 2W9CB 5HI7A 2K2PA 4USKA 3RAXA 5HBMB 3HKZD 3BKFA 3H2UB 4PQAA 4ECXA 2HVDA 1CVJA 3MTKA 5J1EB 1MW7A 2J76E 1EKSA 3MEDA 1QUPA 4V1Ak 2OSQA 4ZVHA 1DLOA 1AT1B 4P75A 1LKZA 4B9TA 3ET6A 1G2EA 2XGPA 4JYAF 1RJJA 3P8BB 1FK9A 4GC7A 3SIPB 2XYGB 2VD3A 3EZOA 4G1IA 3D68A 1YRTA 2D68A 1RAOA 4DFPA 1C1CB 2I2YA 2KXFA 2ZH4A 1R8BA 3R5CA 4CLZA 4USWA 2KZMA 1CJTA 3M6XA 2J8SA 1IR2A 3MPDA 2EEYA 4TXSA 3ZO7A 4C97A 4WXOA 1AUDA 3MEDB 3NOCA 1EIYB 1T95A 3UN2A 3ET6B 2JZ5A 4RNNA 3BB5A 1FK9B 1VLYA 4ETZA 3ILIA 3J81Y 1X5PA 4NLDA 2K06A 4WFAQ 4WF9Q 3TEHB 1SH3A 2E9TA 3KJVB 2ZH9A 4ZCMA 4LSZB 2AGPA 3K8VA 1CJTB 2MZQA 1RI7A 1QVGR 4R0JA 2LU2A 2X3DA 4WZMA 2J0QD 5AXMA 2ASJA 4CYUA 1FXRA 1VJQA 3KLEA 1H7XA 2BJ7A 1UPMB 1XMOJ 2ROEA 1RT5A 1YVFA 2VJVA 3IXQA 3KLFA 3GFYA 1CEZA 2I1RA 2VQFF 3IR7B 2D3ZA 3RRGA 4AT1B 3KUGA 2Z58B 3GIRA 2NR0A 3R9LA 3BGFA 3QGIA 3FMBA 2BJ8A 1GFWB 4DV6F 3IAS9 2MZTA 4PPDA 4CYUB 4LREA 4DUZJ 4O3QA 3KLEB 4XPEA 2CNKB 4TYBA 1FWLA 3MR6A 3EICA 1X0FA 2RQMA 2WONA 4A48A 1LQ9A 1U2CA 3KLFB 5EWEA 1VMBA 1FKOB 5IS2A 1IBLF 2J9EA 2FY8A 4WXWA 5A8RB 2EBGA 4USMA 2WW4A 3PCOB 5KFAA 4OI6A 3JAMY 1WELA 4LF6F 3OXGA 4J37A 2DR7A 1QM9A 1ZH5A 4F0MA 4YHHF 4AFFA 2CIMA 1ZZNA 4JI7F 1UVNA 1Q8IA 4WK1A 4EWTA 2HVHA 2ZH5A 5DO2A 3WHIA 2ZJQQ 3N6LA 2WONB 3ULHA 3O1LA 1N4LA 1ZTWA 3SCJE 4AL6A 4EI2A 1MWZA 3AB2B 4JV0A 3HVRA 3MF5A 2PI4A 2F9JA 4YQWA 1W2BR 4DR3F 3FK4A 2FZGB 1OY6A 2YPZA 3QMQA 1FJEB 3WZ0A 4ZLJA 1F5AA 3NP5A 5GAGU 5ETKA 4GKJF 1M1HA 3I4PA 1CBKA 4FYYB 2IRYA 5T7LA 2F65A 3TAPA 2P2CB 4WFNQ 4EO8A 1RADB 3WIVA 4M5IA 5F3ZA 1FHTA 2R2TA 2YWFA 4WYLA 2PGCA 3LGNA 1RWPB 2XZWA 3CDAA 2IAJA 5KFQA 3M7VA 1H2VZ 3BDPA 5BYQA 2MKSA 2A3JA 1HWUA 4RZRA 5ETQA 3KJQB 5KFLA 4OX9J 1OY9A 5F8GA 2AX0A 4PYDA 2AHOB 3PRBA 2PMZD 3N01A 1D9FA 5DS7A 3T5HA 4IRCA 1PYSB 1SKWA 3GE9A 4DG1A 2YNIA 3RW7A 3HULA 2IVYA 2NYHA 1F9HA 4KO0B 2UXBJ 1HFEL 4J9VA 3W63A 2XWXA 2O67A 3IM9A 3BSCA 1N33J 3QRPA 3VVUA 4AQYJ 4LRAA 3OR1B 2A2CA 4Y0FA 3DMJA 4M5HA 4DCPB 4KGVB 1UWAA 2DHXA 3IRWP 3HD2A 4CLKA 2FUG9 2IM1A 3QGHA 3GSIA 3EWGA 3ZTPA 3QT7A 4NLQA 1RWMB 2L9DA 1VIXA 3O3LA 1AYEA 1X0PA 4J9QA 1E6VA 2B4OA 4FN5A 1FO1A 5KFEA 3NWRA 4AL7A 3J7A1 1VRUA 2DNZA 1M5PC 1WKJA 2IY5B 4O3OA 4NLVA 4EUVA 2XMJA 5GADU 1EAYC 4TY9A 1KR4A 4A8XA 4M8LA 4I69A 1N6QA 1HWIA 4W4MA 1UTAA 4MKBA 2YKPA 4UZCA 5KFHA 4WTOB 3IWLA 2OD4A 1JNZB 2X7IA 3K58A 3FSXA 5H9EJ 4Q2MA 1S1XA 5L9NA 1YZ6A 5BYSA 4J5OA 1O0PA 4UQGA 1VRUB 3TVYA 3B8HA 2G0CA 3RZAA 1XNRJ 5LSRA 2V4JB 4F4ZA 2HW3A 2JC1A 4YR2A 2C2DA 1N6QB 1RWOB 4Y2IA 2FVCA 3RR8A 2FVPA 4TQRA 3NXZA 3KXDA 1RWUA 3A8IA 3TJAA 4DU8A 4PG8A 4JI3F 3R97A 3G6VA 4U67Q 4FXVA 2FVQA 1BWVA 2AJ4A 2Y3YA 1S1XB 2A6OA 4AE5A 4IKAA 1UZDA 4U95A 3H40A 2CQIA 1Q5YA 1P9QC 4JI0J 2OMOA 1KRPA 3R6GB 4DMZA 3TA2A 3P49B 4J9SA 4JV5J 3EGZA 2OPPB 3B4MA 1U1LA 1F1BB 1OO0B 4F02A 4I6YA 3THTA 1MSWD 4FVCA 4JI8J 4RUBA 2YX7A 3C15A 2CPJA 4F8RA 1WJ9A 3FRZA 2GX8A 4B9SA 1LEOA 3KLIB 4MIAA 3PKYA 1RTHB 2ILYA 2Q6CA 2UVRA 4JV2A 3DLGB 3GYNA 2F5GA 3RW6A 3MOZA 2VZ9A 1NDPA 2CJXB 1FXLA 1PC4A 3TX0A 1LV5A 3C15B 3QJLA 2ABYA 3UO0A 1SC1B 1KQKA 2NQPA 3BEGB 2DHAA 1IR1A 3R5AA 2KN4A 1LWXA 2J0SD 2E1RA 4QYZJ 3BM7A 1JLGA 2HURA 2JLEA 5HAOA 4LF7F 3CCWA 3F73A 2M8DB 3HDSA 2UUCJ 3DN9A 3MMAA 4TLRA 3CGIA 5G0RB 2LEAA 2DITA 2V50A 2PT0A 4KC5A 4LFAJ 2FHOB 2JEFA 2PMHA 3F41A 4OHYA 5GAGI 2HBRB 3HT3A 3WQPA 4ES1A 3ITHA 2DH7A 2APOA 1TKZA 1U1KA 3RAQA 2DNRA 4LQ9A 1K0VA 1WHXA 1T0TV 2WVDA 3CSKA 2BANB 2GAGC 2NXUA 2V34A 2DRBA 2IHR1 1VQPS 2YNHA 3VAIA 2L48A 2MLXA 1F2GA 4HTJA 3MCSA 2XY6A 1WD6A 4JYAJ 2MGZA 3IBWA 3PFEA 4H4KA 1U1QA 2Z30B 4Q5VA 4ZPWR 3FDSA 4A47A 5B0EA 1URNA 3MR2A 1KSPA 3MI7X 1TL7A 3ETOA 5LXYA 4GO7X 4FKYA 2BYCA 5KFUA 1RHQB 1JLCB 2FY1A 3I4HX 3IG1A 3OSPA 3MCNA 2FB0A 4PQUB 2GZOA 1SC6A 3KMSA 2QMUB 4QW8A 3KLHB 2VA3A 2QC3A 1B64A 4ZVPB 3HSDA 2PFDA 1KC8T 4HL9A 2DPJA 1TL7B 4OX6A 2GVZA 3MM8A 1YBTA 4DOZA 4OZ0A 3W1YC 1T7PA 5KFTA 3RU0A 1ZM9A 4LSLA 4HI2A 1IKWA 2V4RA 3Q8UA 1R8AA 3OTEA 1NJWA 1S1VA 3MM6A 2IJNA 2EW9A 4H4MA 4IG0A 2XCPA 2P5VA 4QQBA 2V2QA 4GRSA 3TJ9A 2EFOA 1IKYA 1S0VA 2VQFJ 4DSKA 4B3TF 3K2YA 1WF2A 2HFOA 2GVZB 3MM8B 2Y1IA 1IM6A 3G8SA 4DV6J 3DOMA 4LSLB 2YX1A 3A8JA 4ED7A 1IKWB 4IG3B 3MMCB 1G4CA 5GADI 2Z8QA 1S1VB 4CH1A 4ZP8A 1TTHB 1RT7B 4RNOA 2EVZA 5BXIA 1KDNA 2C3YA 1Q95G 3E01A 2AZ3A 2RDIA 4YEAA 1IKYB 2NREA 2ZJRQ 1IBLJ 4LF6J 2FTRA 2MQ8A 2BJ1A 2QGFB 4YHHJ 3ZZPA 3P3DA 5KAKA 3DOMB 3D67A 4IOAQ 1HL6A 3HT0A 2BX6A 2HHWA 3M9NB 1PBAA 5B08A 1UUJA 3E01B 2PD1A 5KG2A 2CQDA 4A8OA 5F8JA 2R7RA 4DR3J 2RS2A 1FA0A 2JFDA 2KHDA 4J9MA 3W9JA 1M1GA 2IIHA 3W8PA 2H54B 1Q1KA 2KHCA 2QA4S 5IC4B 1U24A 3PVXA 3F44A 3KJNB 4FP9A 4GKJJ 2CQGA 1TP7A 3CB4A 2QA1A 3DLEB 1X4EA 4WP8A 2YWKA 1D9AA 1FVSA 1L3SA 2C2KB 4P2SA 1RA6A 1Y7PA 3TRGA 4YFUA 1HNWF 3FZBA 4DLEA 4PKDB 4M5NA 2OJ3A 3QATA 5CXTA 5K14B 2C2EA 2CJBA 2DH8A 1W25A 1M1KT 5CHCB 3IAM9 2ZH1A 3OXLA 1R8PA 2JL9A 2QE5A 4RPFA 1X4CA 1QSYA 1PILA 2PI5A 3I9ZA 3E2EA 2B43A 2DIUA 4Y2CA 5IFMA 1ROFA 4BHQA 4TU9A 2AIRB 1P9YA 2O1PA 2FJVA 4FVMA 1HR0F 2ROGA 2BMBA 5KFYA 1G7CB 2VOPA 1JLQA 2DNHA 3V5RA 2RF2B 3GJSB 1NAQA 4NLUA 4KAIA 4M95A 3D0IE 1C0TA 3CJ3A 1R0AA 1CPZA 5IWAF 1O5JA 3TARA 2KTQA 1PKUA 2ZVSA 4ZVTB 4H4OA 4NL5A 1JLQB 1S9GA 2BA9A 2M2BA 2RRNA 4W98A 2J6TA 4TLQA 2ZZTA 5AE2A 2MSSA 1FEEA 3HZEA 2C2OB 5HP1A 1C0TB 3Q23A 2KFNA 1R0AB 4QR2A 3GMGA 3MUVP 1X4HA 5I3UB 5DDRC 1J5OA 1WWHA 1NNDA 2OELA 2DB1A 4C8LA 2I5JA 4DFMA 3OW2R 2A2DA 4N47A 1S9GB 1W26A 4X65F 3UWTA 2J8AA 1MWQA 4MYUA 2LXFA 3H4BA 1NK6A 4B3MF 1GH8A 4HHHA 3F56A 3DC2A 3D5MA 2XBPA 1J5OB 3ZZRA 4P2XA 4K4SA 1S57A 4JI3J 4U7UD 2OHDA 2GVDA 1T9UA 4A8KA 2I5JB 4GVBA 1WKKA 2ZBRA 1K1QA 1HW8A 5DG8A 4EBDA 1Y5NB 3KUHA 2W24A 2R7SA 4BC9A 1KFDA 1YLXA 2DGSA 2X51A 2XMKA 1VBXA 2FLNA 2VBYA 4PXBA 4RL1A 4Y34A 4CTAA 1FRMA 3HPOA 2KZZA 4E2FB 2K1RB 2GVDB 1WACA 3PR5B 2CNOB 1CQNA 1TL5A 1R0BG 3MD3A 1K0TA 4LBPA 2B7BB 1KBRA 2VJUA 1S48A 1RT6B 5KFJA 3CJQA 1U8SA 1VDHA 4NCAA 3UVJA 3VCDA 5CYQA 4KHPF 4I7FB 2N4CA 5KTQA 5LOQA 5SUHA 2LDIA 3SBMA 4FXDA 2ZOMA 4DLGA 1WEZA 2QLJB 3IR5B 2R8GA 1FRJA 4NXMF 5IT4A 2L41A 1MROA 2QL5B 4NYZA 3VGSA 3T41A 4ZHRA 4MIWA 4LVOP 3BGLA 4GMKA 1I94J 2J7UA 3LTOA 2KG1A 2M4MA 5E41A 1AUSL 1G1XA 1MN9A 3DHWC 2KRBA 3JS9A 3BQ0A 4N41A 4QOTA 3X3UA 2FLLA 5HLFA 3FQLA 4JUZA 3CJ8A 2FHKA 2JOQA 7FDRA 1MROB 4LF7J 2B3TB 5D78A 2DHGA 1PYOB 3F0NA 1EETA 3CD7A 1NSKL 3PO4A 3KFWX 3NCQA 3QJJA 4JI4F 2HZVA 1Q86T 2BE7D 3BBCA 3J80Y 1TK8A 4EYHB 4YS2A 3FCWA 1VRTA 3TEGA 2VPYB 2VBXA 3EJMA 3HVAA 4RUHA 1H0HB 3T19A 3Q89A 5HLFB 2Y8WA 4LIWA 2BE9B 3K7RA 2F1FA 1YITS 5DQGA 3PHTA 2RNEA 1T9WA 2Q1LA 2IM0A 4IH5A 4KHRA 2P8IA 1NDKA 2B8QA 2HHPA 1NRKA 3GJTB 4DV4F 4A8SA 2NZ4A 5T14A 3MR7A 2XG8A 3D2WA 2R8JA 1NB2A 4PG7A 3M9OB 3E3XA 1K44A 1C2PA 1UL3A 3NY0A 3UD4P 4LMZA 4ZLNA 3HHEA 2KYZA 1Q82T 1QAIA 4ID5A 5M2PA 2W2MP 1T05B 2M52A 4CO3A 2V94A 4F2RA 4ZPAA 2DHSA 2XTDA 2Y0BB 2L3MA 3MAHA 5IM0A 1V6HA 4F4YA 3I82A 2NPIA 2OPSA 5F8IA 2E1AA 3CCZA 2QLXA 2OGUA 2D7SA 5LMUJ 2V63A 2ZUGA 3ZXWA 2PN6A 1UFKA 4ID5B 2HNZA 4ER8A 2ZDPA 2D9PA 1RHRB 4KKOB 4LF4F 1WOSA 2F8HA 3D3CJ 2XLKA 2QYCA 1IN0A 3IP0A 5IM0B 1IWGA 4CIOA 1LFPA 2OPSB 1LWCA 3NRBA 4Y28C 3JQMA 3PIOQ 2KXHA 1OMSA 3BBFA 3M32A 3TZWA 2XLJA 3M8QA 2MQPA 1TK5A 3RR7A 3AH6A 2PE8A 2HNZB 1PBUA 3ENAA 4QIEA 1TK0A 4RU9A 1OQ3A 2B6AA 2JDJA 4G65A 4U6PA 1JJHA 2J9DA 4DL3A 4S0MA 1GMWD 5GMKa 5KFPA 1Z4UA 4FYXB 4QIFA 2WBRA 3I96A 3PY8A 1FKPA 2V5HG 1R6VA 5HQLA 3PEJA 2GHPA 2N7CA 4KV8A 1HHSA 4I2QA 3M8QB 3KNAA 1WG1A 5HROB 3TJ8A 2QL7B 2ZH6A 4CRJA 3ZZZA 3U7JA 2MLZA 4C0HA 1CG2A 4DQRA 4F3OA 3PW0A 1Q0NA 2M0GB 2B6AB 3HVTA 5D3GA 4OI3A 2RU3A 1KQFB 2N3OA 1FT8A 3W65A 4DS5A 3CW2C 2JSXA 5DDQC 3PACA 4Y2KA 4R5PA 1FKPB 2P6SA 3PRDA 5FLXU 2MJNA 4RKUC 4KV8B 3GJRB 2BUNA 3CJ0A 3GFZA 1WEXA 1L3TA 1KLMB 4DR1F 5L8RC 1N5VA 4B3OA 1HNWJ 1WKLA 2FHJD 5E3RA 3HVTB 5D3GB 1S4EA 4ECSA 2ZHOA 2BQUA 4O3NA 1VQKS 2WVCA 4X62F 2UUWA 3TNVA 4KFBA 3W62A 5KG7A 1YDLA 3HFZB 2GQCA 3TOQA 2ZVIA 1HHQA 3PG9A 4NMXA 4A8MP 3OL7A 3LP1A 3M8WA 1YKWA 3W9IA 4V19J 4PXDA 2LQ8A 2HK2A 2DPIA 1LWFA 4CO5A 4B3OB 2AKWB 1T3OA 5C24A 2Z2LA 2VU5A 2YWHA 3H7HB 2J0XA 5DGAA 1HR0J 3HI9A 3SSSA 3KK1A 1H2TZ 4CLTA 2GHWA 4X4OA 1YSJA 3O8WA 1KHWA 1PJ7A 1JMTA 1B0PA 3HHLD 4K4VA 2FLOA 1LWFB 2W7PA 2J5AA 6FDRA 4ID8A 4DV2J 2BQ3A 5IWAJ 1B7FA 5IC6B 1S77D 3NGRA 5F41A 5C24B 3NBPB 4KHMA 4HYKA 1X5TA 3KK1B 4GO5X 4ICLA 2IFXA 3I6PA 1RK8A 4USJC 3OVSA 3Q86A 1Y9OA 1UEUA 4TY8B 1ZM2A 1RHMB 4B3RF 5K8OA 2AMCB 4HKQA 4OQJA 1NKCA 1VQ4S 5C7PA 4HDGA 2CJQA 2HAIA 4LFCF 3OL6A 3M6WA 2B7CB 1DBDA 4N77A 2IDEA 3NOGA 4C11A 2XNRA 4ANEA 3VAMA 3BS9A 4UY8T 5GAHU 2LP4A 4B9UA 1S0MA 1XR7A 4X65J 4C6AA 3KG4A 4CT9A 1BLUA 3C16A 4B3MJ 2A10A 3K17A 2QZ8A 2VC0A 5KG3A 4B9VA 5CH7B 4MTPA 4CH0S 2LYVA 5EN1A 3FBEA 2R7WA 3TZXA 3G6XA 3UNYA 4U8YA 1DQ8A 4OZ2A 4M63A 4LF9F 2CPZA 1DTQA 2MKJA 4WE1B 2NPFA 1X9WA 3DI6B 1XMBA 1VBZA 3AWRA 1REGX 3IWNC 1U8WA 4PAAA 2HRTA 2XMUA 2C42A 3VGVA 4ITSA 4FXWA 2DXDA 1R6YA 2DGOA 2MZRA 4DSIA 2I38A 1KVKA 4RBUA 1UZHA 5K8PA 4ED2A 3AD7C 2R9LA 4B02A 4PABA 4NLGA 2WCXA 1RAGB 3FVYA 3KHLA 1QSSA 2UXDF 1T02A 4RBVA 1S0OA 1TU0B 1NJYA 4USTA 2XMTA 4AL5A 4KGKA 4OJGA 3TQ1A 3AB4B 4Z7YA 1M5VC 4KHPJ 2FQQB 2FGOA 2HQFA 4RW7A 4WFZA 2XWYA 4RW8B 4MT1A 3NGDA 1LFWA 1B70B 1CC8A 2DNMA 1UEKA 2M70A 4NXMJ 2OEJA 1JLFA 2VIHA 1TZ0A 2HQGA 3CCVS 4RUAA 2C2ZB 4WCEQ 1SCJB 3GV5B 3BZQA 3CO9A 1SQEA 2BJ3A 2HAFA 1TL1B 1IXKA 4RW7B 3BO3A 1CJKB 2Z2YB 4QR0A 2IVFB 2G1HA 1JLFB 1UPPA 5DLFA 3C2PA 3CJTA 5E0OA 4NA2A 1VQMS 2HHSA 1DTTA 4JI4J 3GJQB 2XLIA 2F3JA 4A46A 1PG5B 3T3FA 1N8RT 3VV2B 1QTNB 1RT3A 3FCVA 5C25A 3Q24A 4B3SJ 1X7VA 1S9FA 3W5YA 2GFFA 1U1OA 4CNZA 4DR4F 3I56S 5M2UA 1RYRA 5HQ8A 1B3TA 5CQGA 1F3VA 3ZZ0A 3BR9A 1B4SA 1Y0HA 2CJYB 5HVHA 1DTTB 2QLBB 2KDOA 2FIUA 1HNXF 5C5JA 1FFGB 4LBHA 1GEHA 2ZOFA 4DXLA 1KWMA 4DV4J 4U96A 3AJ1A 1RT3B 5C25B 3L7UA 3GILA 5HANA 4RW6B 2GNKA 1LW0B 3EXYA 2DEJA 1UJ6A 3T1HF 2W4CA 2AQ4A 2DIVA 1S1TA 4NZ7A 2Z2ZA 3R27A 2FZKB 5IZHA 3AD8C 2ZE2A 2DTJA 4MYTA 3AHPA 1MMDA 2B8PA 3FSIA 2CADA 4BBYA 4NI2A 1FE4A 2B9EA 2AEJA 1S5ZA 4FNHA 5DQHA 1FCAA 4LIRA 1MU2A 2YKMA 3VVTA 4GC6A 4NXNF 2GS8A 1S6UA 4HHJA 3SSRA 3HJVA 4J7CA 2BJEA 1S1TB 2WSCC 4C3LA 5FJ4A 4L3KA 1X9SA 2ZE2B 4OJ3A 3NLCA 3KYLA 3LP2B 4ILLA 4YOEA 1JXVA 1D8YA 2BKPA 2G2YA 1S9EA 3GCXP 5F9NA 3J7YU 1UFWA 1Z1ZA 4LF4J 3WBZA 3EPIA 2VPWB 3RB0A 3MTJA 1M5OC 2GIFA 1MU2B 2YKMB 2CYYA 1WOPA 3UI3A 2JNJA 3CD5A 2YWWA 3BSOA 4ZN3A 2YNGA 2E7XA 3MOJB 3DRRA 4C48A 5ETSA 2RILA 2CPHA 5GAHI 3FGVA 5C2GA 2MXYA 2XYPB 1YWXA 2XHWA 4ZIWA 2DY9A 2DGVA 3V4IA 2G0IA 5KFIA 1T9TA 1BD6A 1PAEX 2XULA 2B5JB 4ED1A 1SPBP 5J2MA 3DRRB 2F4VF 4R8UA 3KDOA 1V5IB 4L75A 2G4BA 2WB1D 3UN3A 1HI0P 3RBEA 3M2UA 2W4PA 1N5YB 4ZOSA 3UDEA 3ELHA 1SC3B 3FBCA 3N4WA 1KP6A 1N0VC 4NEZA 5L46A 4EZ9A 4DSJA 3GFXA 4RBTA 2HZCA 2VG6B 3OPKA 2HNDA 4ZVRB 3JQKA 2RHQB 2OSRA 4OYZA 1EB0A 3R2DJ 4R8UB 4ZCKA 1NJZA 2D3O1 5I3PA 3QT8A 4DR1J 4O0IA 1RAEB 3BN7A 4RJVA 1WTBA 1S1UA 1RBLA 3H5UA 4HH1A 2DYAA 2C2RA 3LH2S 3BR8A 4X62J 4RO0A 2LXUA 5KFKA 1U47A 4J9LA 4ANCA 4RLEA 5L1IA 4L74A 2VKZG 1P6TA 4J9PA 4OI0A 1DQAA 1NSPA 4O4GA 1OYEA 3MMBA 3HFVA 4UY85 3KLGA 3CD0A 4IFVA 3G96A 1S1UB 1VR6A 3DYAA 3LUYA 4QWEA 3DLJA 3K5PA 5H9FK 4QYZK 1R43A 2HS0A 3TUIC 2HQ3A 2RRBA 4G1PA 3AOCA 3PV8A 3NEKA 2R7QA 3Q8RB 3THVA 4FYWB 5J2NA 4USIA 3VAGA 1WHVA 3LGMA 4XPCA 2NXCA 3KG1A 1FRHA 1MMNA 3NNHA 1UW9A 3J7AN 1C1BB 1NKEA 3C3LA 2QT7A 3MMBB 5I4MA 1QTMA 3HF5A 4G3IA 3BPDA 2LXIA 1B99A 2HLTA 1YJUA 1HA1A 3H8YA 2IYGA 4ED5A 1XR5A 5D0RA 3D9BA 1DJ0A 2HGLA 4EO6A 3JSYA 4P10A 4IOCQ 4B3RJ 2IPOB 3AT1B 1UAWA 3D6HB 2J6SA 1RTDA 2FVSA 5U47A 3H5XA 4LFCJ 2ZZMA 1NJXA 2OEKA 4AXJA 5CYJA 1NHKL 1KOHA 1VFJA 5IQ6A 1U02A 2F63A 3QGPA 1U25A 1FEHA 2OD6A 1ICEB 4DN0A 1PO6A 2B4UA 3FNNA 3GIKA 2ZBCA 3PW2A 3GCWP 1BGXT 2W2OP 1XQIA 4FF3A 2RH3A 4ZVQB 1M0SA 1KTVA 2HFVA 1RCXB 2MSTA 1TAQA 3W5ZA 2LEBA 4OHXA 4OHZA 2YX4A 2KB2A 1Q5VA 1QDUB 3DNCA 1CS4A 4UOFA 3AX2A 2CJKA 2NUHA 2DKOB 4KGXB 3T1YF 5KG4A 4CWBA 2OUGA 2GA7A 3JQJA 3KOAA 2VH7A 1FDBA 2AJ1A 3QRRA 1G3OA 4EGLA 1WI8A 2I6WA 3OTOF 2R3VA 2CQCA 3NWGA 2OTLS 4X66J 4LRCA 3R1LA 4CLLA 4KRWA 4UUXA 5DZ7A 5CA5A 1HNZF 1L5UA 4M5GA 5A6WA 2MZJA 2JLFA 3A1YG 1U26A 1WHWA 3J7YI 8ATCB 3GG1A 1X31C 1RAJA 3MAQA 2HWHA 2KU7A 3MMJA 1YBUA 5BYRA 3KLVA 1SQFA 5HN0A 2BE2A 1WF0A 4JV1A 5KG5A 2HK3A 1S12A 3EPGA 3QIPB 2HNYB 3CJKA 2O5DA 3AD9C 4K4TA 3B6BA 2CZ4A 3TVZA 2QA2A 4JI1F 2Y1RI 1D09B 5A2QU 5B7WA 3JSMB 4DUYJ 4NCGA 2F4FA 2ZM6J 1RT2A 2VV5A 4OYAA 2JFKA 2MKKA 2VQEJ 1LXJA 2BE2B 1FRIA 3GPAA 4Q8EA 1RABB 1N5QA 3NS6A 4G1QA 2W9BA 1YK9A 3EGWB 4HEA9 2DNPA 3H5SA 3HCXA 3UCUP 3AOAA 4YUDA 1IJEB 4JI2J 4DX8H 1TUVA 1T8EA 4KT0C 2CQ4A 2FJBB 2ERRA 5BJRA 2C2NA 3G8QA 4LR7A 4RW9A 2AGOA 4Q43A 4LRDA 1IVZA 5LJ3Y 2CQ0A 5HMWA 1REVA 4G1QB 3EGVA 2W9BB 3CJ2A 1U6BA 3OL9A 3N6MA 4M5JA 1P27B 2GQQA 2RB7A 1HNXJ 2YWGA 2VHGA 3CCJS 2QA4G 1BQMB 3WX4A 1FF2A 4ELTA 4WFXA 2V1SA 2ZBQA 2DD8S 3IWXA 5LT5A 2CWXA 2QMWA 1RHKB 1REVB 4DL5A 4R0EA 3T1HJ 3H5YA 4ALZA 2UVWA 2YQ1A 1NZ8A 1V5VA 2CA9A 3O2IA 3KDNA 3AQPA 5ADZA 2R8KA 3U1NA 2ZBIA 3O5TB 1BY9A 3C6TA 3QLHB 3MPYA 1L3VA 5F8HA 4I0WA 4DPTA 2AJFE 2QSWA 4RX6A 1TR0A 2MKYA 1VC6A 4WP3A 5DQIA 4NXNJ 3FKBA 3LWLA 3G6YA 3O44A 1RHUB 2MZ1A 1JLAA 2WK4A 3UCZP 2XSJA 2VFUA 3C6TB 2JEIA 3IM8A 3T5KA 1XK8A 5E3QA 4F3MA 2HQDA 1U09A 2ZDOA 5KT6A 2XZDB 4PEOA 2X1GA 1VJWA 2ZNYA 5L38A 3NNCA 3DDIA 3HJFA 3H2LA 3U02A 4E0DA 1EX8A 2IBOA 4L6V3 2NYIA 2OH2A 2XSJB 4ES3A 1T94A 2XTEA 4DZDA 5M2RA 3PKMA 3OVAA 3D4JA 4LUBA 2F8EX 2DT9A 3S01A 1DLOB 2EK6A 3E8OA 2DO4A 4WBFA 2EFPA 4OYBA 3VGUA 1G6BA 2WRMA 2J9DE 1N36F 2B0GA 2K3KA 4J91A 4X4TA 2RE1A 4QIVA 3D6TB 3LW5C 2VL1A 1EHWA 4ZPDA 3PIPQ 3AXKA 1HNIA 3BGOP 2RSQA 2F4VJ 2XO7A 1YBAA 3A3PB 1ZM4A 1S99A 4OHWA 2Q3PA 3MEEA 1T9YA 2N4DA 2EI5A 3VZHA 5CCLA 3CD6S 3DRXA 4CLFA 1NPRA 1LOUA 1SIZA 2KT2A 1AB8A 3H20A 2ZH8A 4P6QA 1FRKA 1HNIB 3NCPA 4LF1A 1CLFA 4DN9A 4ATNA 3LAMA 4P7VA 3P5BP 1CJVA 2ATCB 2IYIA 4ELUA 3LANA 1JLEA 3L9ZA 4EU0A 3MEEB 4CO1A 2EC2A 4TYAA 4DV3F 4BWMA 1RT5B 2E7WA 1NJIT 1TQLA 3IGVA 4WKYA 1YX2A 2DHHA 3ZTSA 3ISND 3QJPA 1HD0A 3S6EA 5LMNF 3LO3A 2KM8B 4FPRA 2M8HA 2BOPA 3QFWA 1IQTA 1CJVB 8AT1B 1RAHB 3GIJA 4B9LA 5LSLA 5D4OA 3KK3A 1TFYA 4GVLA 1S1WA 2Z2MA 2BEFA 3QAEA 3HZGA 1NKBA 2HEKA 1OWXA 1NZAA 5FDLA 3TW0A 1UW4A 2CQ3A 1R8HA 3ZZUA 1VQOS 4FZVA 5D0GA 3WC0A 4O0NA 2EWHA 3UD3P 4EFAC 3KK3B 4FYDA 2EKYA 1S1WB 4P2MA 2I9SA 4QPTA 1X60A 3W2WA 3U1MA 4XIUA 2V4QA 4M5DA 2DRAA 2HVIA 2QN6B 3DRYA 3D3BJ 1PSDA 2DBBA 3DU6A 1XEZA 2DVIA 5A8WA 5KFXA 3DKDA 3MDFA 1N34F 4KBIA 5HJYA 4PCQA 3CT9A 2MHEA 4ECRA 3OT9A 5T7LB 3W2WB 1TKXA 2Q66A 3QT5A 4M5DB 2VBWA 1TL3A 4J9KA 1XTZA 2LQ9A 4QWDA 4DF8A 1YJTA 4DPUA 3BO2A 4ZJLA 2IAJB 1J5EF 1F2HA 5A8WB 5EWGA 2EC0A 2PIIA 4OYPA 4I68A 5B0BA 2MDAA 3TAMA 3I9V9 3OFGA 3HSZA 3CCUS 1RU2A 3QZ7A 4B9NA 2VKRA 2H5JB 2Y0SD 1TL3B 2OMLA 1SC4B 3T1YJ 1YJRA 3DLKA 4ZVEA 4DG1B 2YNIB 3H0PA 2E5LJ 2C3OA 1XNQJ 3RYLA 2QLWA 1HD1A 3TAMB 4K0KF 4Q7AA 5T41A 4F4AA 3TWZA 4YB5A 4HR2A 3OTOJ 5DDOC 4X4VA 3K5LA 3DMJB 5A6PA 4DQIA 1IBKF 2L9WA 1GXUA 3A8KA 1HNZJ 2W1BA 3W9HA 3LOUA 1ZOTA 3OHAA 3DLKB 4Q0BA 2EKNA 4LF8J 1S79A 3UE2A 5AXKA 4MKYA 2GAHC 4DR5F 1RCOB 1E6VB 5J1NA 3BF4A 4K2JA 4WTYA 5ETVA 4F0KA 5HK4A 2YKNA 1SB6A 4PWDA 1P1TA 4DPYA 3BGRA 1RTZA 2ASDA 3B78A 3PYFA 3NS7B 4RR5A 2ZH7A 4Q0BB 4MKAA 2QTWA 1O51A 3QAUA 4KSEB 2V68A 1NHVA 1DY3A 3FBFA 2YKNB 1Q8BA 3Q8YA 3S8SA 1Q7YT 5GMEA 4PWDB 3AOBA 3CJSA 1FTCA 2MPUA 4LFBJ 1KVIA 4OIXA 3BGRB 1TKTA 5LJ5Y 2I8EA 2MMYA 1W2IA 4DX6A 2YBVA 2E29A 4MK8A 3QSYB 3V2UC 2G1DA 2E1MC 1WC6A 3OJUA 2ZKUA 4IQMA 4QJVA 1SJ3P 1U1RA 3CIZA 4Y00A 5A76A 3EVMA 4F4WA 2A0FB 2F7VA 3MM7A 2FDNA 3G86A 1AFJA 3CE8A 2CJAA 5BR8F 2QEXS 3FJ2A 2JHEA 5FD1A 2DK2A 4Y6IA 4KQZA 3CJ4A 3V4MA 2CPEA 5ETOA 4ZPTR 3D0HE 2KFZA 4MK7A 1TMJA 4PXCA 1NPKA 2HFZA 3R5DA 4RWWA 1N48A 1RKJA 1YRUA 2FLPA 1MWYA 1F9EB 2H51B 3SCKE 1NH8A 3JYTA 3G8TA 2MQMA 4K4UA 1M5HA 2E44A 2VUGA 4DZ6A 5KT4A 3D28A 2MY7A 3R7NB 2HWTA 2RDJA 1H2UX 3HXMA 1N32F 2BXJA 1U0SA 3CCTA 3M8PA 1WC5A 1FWPA 4WWSA 4I4BA 4ZDNA 1QD1A 4MFBA 4I6WA 4F4KA 1VRQC 2LEPA 3R5BA 4I1TA 5B0DA 3K0JA 1JLGB 2OAUA 1VQ5S 1FERA 4RW4A 3IC1A 2R2SA 1HBOA 2IJFA 1LK7A 3A3NB 4DQQA 4NLSA 2KRRA 2XY5A 2CVEA 1ZAXA 1FDDA 3MMAB 4YN3B 4C9DA 3TX8A 3M8PB 2H48B 4IH7A 4Z37A 3ITHB 1TKZB 3GONA 2H5EA 2XC9A 4MFBB 2P9EA 4NLOA 1OS5A 4DPOA 2YNHB 2RMLA 4F26A 2RQ4A 3NKYA 1HMVA 3NMAA 1RISA 2LLZA 3UPFA 2ZJPQ 1HBOB 1V9OA 2CG8A 3QGGA 4NRTA 4IO9Q 3IN5A 3IO1A 5EX3A 1CJUA 1I6JA 2MGZB 5JXSA 3K5MA 4FBTA 1N36J 4KJIA 2OIHA 2DH9A 2CDQA 2YH0A 1KOOA 3CJRA 4HHUA 1R31A 2KH9A 5HO4A 4OYXA 1U1NA 3DXBA 1RGVA 2MKCA 1UKUA 3IG1B 1Y3JA 4NYOA 1K8AT 2DXFA 3CNQP 3BH7B 4U9RA 3M6VA 5THWA 2CUYA 1CJUB 4N7TA 2UXCF 2XYHB 4IR1A 3CDUA 3MAAA 3D6MB 3AFGA 1SV5A 3O6QA 3J81j 4J90A 1UVKA 1NK5A 2E7VA 2OI2A 5KFRA 5KG6A 2VBZA 3OFEA 3ZZTA 3VR1A 4JB8B 1GK8A 2YQ3A 3GR1A 4KY3A 3MM6B 4HVZA 1VQ8S 4OZ1A 4H4MB 4DV3J 2XO6A 4IG0B 3BV8A 2XHCA 4JP8A 4LVNP 2Y9HA 3OBIA 3IS9A 2AGQA 1UVIA 1SV5B 3P4UB 1ZM3A 2E5IA 1Y00A 1RDRA 4NE9C 3SMZA 3PYGA 5LMNJ 1Y4ZB 1VYAA 5EX0A 4DL7A 3KHRA 1N5SA 1VHIA 1UVLA 3M8YA 3CPWR 4W90B 4JI7J 2VFSA 1RUSA 4RNFA 4NASA 3VF0B 3Q0AA 3CWJA 4FKXA 2COLA 1R89A 1K9MT 2H4YB 4IRKA 3BH6B 3PZPA 4Q8FA 4A8WA 2AF6A 2HLUA 4I2PA 1KEKA 4K50A 1YHQS 1MNEA 5L39A 3IS9B 2J0WA 2CVIA 2KJVA 3U1LA 2FHJA 2CAJA 1S72S 2MTLA 2OO4A 2XMWA 3AJ2A 4C8ZA 3HD1A 2J6UA 2E9RX 2HQIA 3G82A 4QWAA 1DURA 5K20B 1OY8A 5A2QY 3H98A 2ZEJA 3R1HA 2A6MA 1PJ5A 1NPPA 1DHMA 2ZHAA 1RAFB 2UUAF 2IC3A 3R7BB 2ZFHA 2HPUA 5KFMA 3FC9A 2HRYA 3TUJC 1IKXA 4ZN1A 4U8VA 1N34J 2JH3A 3OL8A 2W2PP 4K5RA 4C0BA 2HIYA 4CI0B 2BRKA 3CDEA 3N28A 1F5CA 1HWLA 1SKUB 4PZVA 4OZ5A 4ED6A 3DOLA 1U48A 3IBFB 2EG1A 3D54A 5AT1B 3HSGA 3GQCA 2HIQA 2ZC3A 4ZITA 2VG5A 1FXDA 5KT2A 3A12A 2NZCA 1QAYA 3H42A 2AYEA 1FJGF 2DEIA 5K8MA 5HVFA 5I3QA 2MB0B 3GU0A 1XMQF 2V8DA 1IJFB 4C8OA 2GMLA 2RDDA 3DDNA 5JMNA 3ADAC 3Q2TC 2GIRA 3DOLB 3QO9A 3MCMA 4C4WA 1H74A 2V9KA 4ZK7M 2YVSA 2W4DA 1ZYQA 2VG5B 4ZKAA 2E5HA 4E98A 1WEYA 5EGYA 2W9CA 4CZCA 1Q4RA 1R3NA 3PJWA 1VGYA 1HQ2A 4K0KJ 3SCIE 2WTFA 3HHDA 1GAOA 1NDLA 5KFGA 3HP6A 1IQZA 1IBKJ 4ECWA 4FYVB 2UUCF 1QJHA 1F0XA 3B4DA 5HQMA 3QO9B 4ZLLA 2OFHX 3H25A 4NLXA 2KVQE 1BC6A 2MZSA 4DR5J 5E3CA 2V6AA 1VS3A 4H4OB 1N5TA 5F3TA 4LSNA 4IDKA 5MLCV 4OLOA 2KKHA 4MJKA 2AT1B 4EYIB 3PW4A 4DV1F 3UCGA 2SXLA 5HP1B 1D3WA 4ILMA 5KOWA 1RT1A 1KLNA 2XS5A 5E3PA 2KYXA 1EQMA 3H2VE 3KJVA 2WOMA 3ENWA 1PIEA 1YZ7A 2Y8YA 4B17A 3BN4A 1YGYA 4LSNB 4IDKB 4L76A 3MEGA 2IBKA 5DETA 4XDCA 5DM6Q 1ZPWX 1Y3KA 3GZ7A 3BKTA 1C4AA 1YJNS 1RT1B 2IRUA 4UOCA 1T9VA 1EZZB 2KG0A 4OV1A 3W2VA 2PEHA 2WOMB 2DR8A 2N7YA 3EZUA 3L09A 4GVBB 3MHYA 1HWKA
chains in the Genus database with same CATH topology
3OTDA 3MMBA 1WG4A 1RT4A 2FHOB 4YMEA 2JEFA 3N0VA 2P6TA 4UY85 2PMHA 3KLGA 3CD0A 3F41A 4IFVA 4OHYA 3G96A 3MEGB 5GAGI 1S1UB 3DYAA 3HT3A 2E5GA 4OLPA 1E6YA 3LUYA 2LQJA 4WE1A 4QWEA 5DM7Q 3DLJA 3K5PA 4ES1A 3ITHA 2DH7A 2APOA 1TKZA 3S1TA 1U1KA 1P1LA 2DNRA 4LQ9A 3DI6A 4FS2A 3RAQA 1K0VA 2IM2A 1R43A 1RTJA 1WHXA 2HS0A 4QWCA 3TUIC 1P8GA 2HQ3A 2XI2A 3LWMA 3CSKA 2BANB 2RRBA 2NXUA 4G1PA 4ECZA 2IHR1 2DRBA 3KK2B 1VQPS 2YNHA 3VAIA 3C66A 2L48A 3RB4A 3QWPA 3PV8A 1FKOA 2R7QA 3Q8RB 2JRSA 5A8RA 3THVA 1F2GA 3VAHA 2AJQA 4CTAB 4QR1A 1B0VA 4HTJA 5J2NA 4USIA 4X4NA 1NK0A 2OPRA 3W2VB 3VAGA 1WHVA 2IA0A 3SV4A 3LGMA 2R7UA 4XPCA 3MCSA 2XY6A 3KG1A 1FRHA 1MMNA 2HGMA 1HQUB 2M3DA 1JXEA 1WD6A 1YI2S 3NNHA 3I5CA 2F8MA 1S7HA 4NA1A 1C1BB 4X4SA 1FJCA 1NKEA 3C3LA 2MGZA 3IBWA 4PG6A 2QT7A 1C0UA 3PFEA 3MMBB 4H4KA 1RT4B 3N9UC 1U1QA 4M1KA 4Q5VA 4ZPWR 1H3DA 3FDSA 2FJXA 2R2RA 4A47A 5B0EA 1URNA 5I4MA 4NLPA 2IVMA 1E6YB 3OHBA 3MR2A 3M8SA 1QTMA 3HF5A 3C8YA 1KSPA 3UR0A 4G3IA 3MI7X 3ETOA 1HW9A 4GO7X 5LXYA 2LXIA 1RTJB 3C46A 1S76D 2BYCA 2C22A 5KFUA 1UVJA 4QIWD 2HLTA 1YJUA 5EDWA 1JLCB 1HA1A 3H8YA 2FY1A 2IYGA 2CRLA 4ED5A 1XR5A 3ISNC 3I4HX 1A6LA 3IG1A 4Q0BB 2XSFA 3OSPA 1DJ0A 2FB0A 2A18A 2KFYA 4PQUB 1ELOA 2OPRB 2OFGX 2HGLA 2L9NA 4EO6A 5CYQB 1SC6A 3JSYA 1KFSA 2VFRA 1X5SA 4IOCQ 1XC9A 4RW8A 3KMSA 4QW8A 3KLHB 2VA3A 1TAUA 3D1QA 2PA8D 1GQEA 1UAWA 4X66F 1C0UB 1KQSR 4TU7A 2J6SA 1RTDA 2BRLA 5KFWA 1B64A 4OHVA 2FVSA 2HFNA 3H5XA 5B0GA 5U47A 2BDPA 2ZZMA 2AYMA 1NJXA 1B0TA 4AXJA 1KC8T 4HL9A 2DPJA 5CYJA 2EFGA 4OX6A 4ZHRB 4HT5A 3MM8A 1Y5LB 1KVJA 1J2VA 1KOHA 1VFJA 1F60B 3U27A 4ETXA 2G9OA 2V8VA 5IQ6A 4DOZA 4OZ0A 2R2UA 2GJIA 1KN6A 3AA8A 1VQYA 3QGPA 1T7PA 5KFTA 1DFDA 3RU0A 1ZM9A 1U25A 4ZPVR 2X1AA 3BO4A 1SUQA 2JEGA 3MWBA 5IT9Y 2HVZA 4LSLA 2AP6A 4HI2A 1JLEB 1IKWA 5F0UA 1FEHA 2V4RA 5C42A 2OD6A 2HHXA 1H98A 4DN0A