1RDUA

Nmr structure of a putative nifb protein from thermotoga (tm1290), which belongs to the duf35 family
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
MARVAIPSVGKDLSSMVSDRFARAEYFIIYDTESGNVEVVENTIADAHGTGPKVVQSLVSKGVEYLIASNVGRNAFETLKAAGVKVYRFEGGTVQEAIDAFSEGRLEELTTFTREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title NMR Structure Determination of the Hypothetical Protein TM1290 from Thermotoga Maritima using Automated NOESY Analysis.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Biosynthetic protein
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1rduA00
2KLAA 1EO1A 2YX6A 2WFBA 2QTDA 1RDUA 1T3VA 1P90A 1O13A 2RE2A
chains in the Genus database with same CATH superfamily
4DB3A 2YX6A 3CYMA 4JKHA 4LFBK 4CGHA 5GAEP 1RT7A 4N5SA 4KTZA 5BREA 3VPZA 2UUCK 1E4GT 3D2EB 2IVPA 5M1OA 1KLMA 5C15A 3LP1A 1NGJA 4JK8A 5FLXO 4IZ9A 5I42A 2PYJA 1DEJA 3C6UA 4DTJA 4F3TA 3VETA 3VTIA 1TV6A 2D0BA 3M1FA 5LMNK 1K6YA 4NB4A 3HT3A 3VQCA 2CH6A 3L8BA 2VYPA 1C1AA 1WOQA 4GVEA 3VEZA 1YVNA 3P83D 1ZXOA 3J7AP 3ZSQA 3ENBA 4BR0A 3BEXA 4E89A 3G6EN 5BRFA 3PV8A 1MU2A 3CG7A 3THYB 1A5VA 1EWQA 1NWKA 3L4IA 3DWLA 5M1KA 4Z94A 3SUQA 1JLBA 1U2VB 2YHAA 5F2RA 4CW7B 3AVHA 2DPNA 4CZHA 4DSJA 3TSQA 4FJJA 5AQJA 3OYLA 2PFUA 5K14A 4FPBA 4C23A 3VERA 3CIPA 3U3GA 1YITN 3VMFB 2ETJA 3A5NC 1NGGA 2I5JA 1K9MO 3J80O 5C24A 1J9AA 4DQPA 4BRMA 3WNHA 3QEPA 2NUBA 4BC4A 4NXNK 4OJRA 3P39A 3CQXA 5CZ2A 1EQYA 2YNFA 1RT3A 4QOZB 3TPQA 3L2UA 2A1SA 3M8RA 2YHWA 4FW2A 4DTMA 5M1NA 1BU6O 4DU1A 4C8LA 1G15A 3THVA 3P1GA 5ADXH 1P8ZA 4BWMA 1TK5A 2GWKA 3OBYA 4JI7K 1N8RO 1CZ9A 1JXBA 4X64K 5FROA 3LZIA 2UXCK 5FDLA 4M63C 4AM7A 3O9UA 4N56A 5E84A 1NGEA 4AILC 3A5OC 3CHWA 4AM6A 3KK1A 2BTFA 4LSLA 1KAXA 4OPAA 3SAGA 5GINA 3MCAB 5EOYA 2UXDK 4BRHA 1S6QA 2UU9K 3QBWA 3EO3A 1IBLK 4KREA 2HB5A 4M7XA 3FZFA 5EY4A 3KWIA 4CZJA 3KHYA 5M1QA 3AVFA 4WFBL 1EP4A 3WQUA 1E3MA 4B1VA 2YI1A 3CCRN 1WBDA 1HNZK 4M42A 2HHXA 2HBJA 2OA8A 4GY2B 2FXUA 1Q9YA 1HX1A 4KV8A 4B9MA 2HBKA 3ZT1A 1NMDA 3OS2A 4JI3K 3F73A 5M1PA 3QLHA 4IFYA 5CR4A 4A2AA 3AVJA 4F9OA 3LDNA 4IJNA 5SZTA 1NNEA 1N5YA 4FWPA 4BDPA 2GUPA 3CERA 3WT0A 2Q97A 3OYDA 3VF2A 4G1QA 4Z4CA 3G4SN 4AHUA 3HZ6A 4F2SA 4FJHA 1EETA 3TTCA 2PAVA 4DMNA 2WONA 2D1KA 3U6FA 1MWKA 1J6ZA 3ZT3A 4DSLA 2GV9A 1ILYA 2DY4A 4A5AA 1QVGM 4B9LA 4BG8A 5JLFA 3TAMA 4CGDA 1N33K 5KQDA 3CC7N 2QWOA 1ZBIA 2H3GX 2A42A 2GUIA 3QIOA 3SQ1A 3CCUN 5GAGP 5JVGL 2OANA 2WC9A 3VEYA 3NH0A 4FZYA 5I9EB 4FW1A 4CCHA 4DKWA 1BA0A 3PX4A 3LPTA 5FRMA 3O9TA 1BGXT 4JKAA 1RTJA 1GOAA 4N47A 3K5OA 4DQ8A 1VQLN 3CCSN 2ZJRL 3OS1A 1Z05A 4DQSA 2QWNA 3NMUA 3DM2A 2UXBK 2F9TA 4ISEA 2OZSA 3IDHA 1S5JA 4DFMA 1XC9A 3ZETB 1HYVA 2RN2A 4C1NI 4XH1A 3E9PA 4ELVA 1Q18A 4FM0A 3ULEA 1OH8A 2J4RA 4CJ3A 1KCFA 4CZIA 2FC0A 3ID8A 2YHBA 1IKYA 5AZIB 3ZX0A 4CI6A 2O8EA 3SQ2A 2E2OA 3FZLA 1TAQA 3EKSA 4QS9A 3QFPA 2QW9A 4M3WA 1RT1A 4BGAA 3RR7A 3HL8A 2BGGA 1NGHA 5BR8K 2D0AA 1LWCA 3J81O 3NH2A 4DTRA 1VSEA 4C8KA 1WSIA 2FSKA 2HHWA 2D5RA 1TKTA 3AARA 1TYQA 1DTQA 3HP9A 3WXIA 1BO5O 3I0RA 1Q8IA 2P9LB 5C42A 3V1OA 1YT3A 1RBVA 3WQTA 1WAFA 4JK9A 2Z1HA 3EKUA 3E9OA 3KWGA 1QZ5A 4G9ZA 4E1MA 4H4MA 2F9WA 4B9QA 4Z4EA 4KHUA 4BGBA 1QQOA 3DLRA 4WE1A 3V9UA 3D45A 1B9DA 1D4XA 3AO5A 4DQQA 1IG9A 2NRXA 5BPMA 3LP0A 4IDHA 1A5WA 4OKEA 3RRHA 3ZEUA 3GOIA 1NKEA 1IG8A 5CE3A 1Q86O 4FK2A 4DV1K 2O8DA 2LSNA 4J2AA 3AVBA 4JKBA 3ZSRA 4DTOA 1ZBLA 4JHDA 2E2PA 4YNQA 4ZTJA 2E5LK 5TKYA 4DUYK 2P5GA 2GBZA 3CQYA 3KD5E 3ENHA 4RWTA 2NLXA 2KFNA 3RR8A 1VSKA 2ZQBA 2HVIA 4FWQA 2PYLA 3MWTA 2HHHK 2ZJQL 4A61A 1P90A 4DV7K 3CPWM 4CHNA 2Y1IA 2FLOA 3VGKA 3RWUA 3OHRA 2X6NA 4MDAA 4I9LA 3SQ4A 4IKFA 1OH7A 2QWMA 4CEDA 3CFPA 3JYTA 5CY4A 3A5MC 3F9KA 3DOKA 2FSNA 1KSPA 2EHGA 4CZKA 1V4SA 1H1VA 2ZE2A 3NFAA 1BWFO 4EZ9A 2G8FA 3SYZA 4Y1DA 2ASMA 1OVQA 5KGWA 4C8OA 2YJEA 4DQIA 3HVTA 2OPRA 1TVRA 2QWPA 4BRIA 1XMOK 1NOYA 4WQ5C 3EN9A 2Z1IA 2QEXN 4Z4GA 1HKGA 3KLGA 3MX5A 1YAGA 3SPYA 2KLAA 4LF4K 1FKOA 4WCEL 4Y0WA 3VESA 1S1XA 3G71N 3O9SA 4H0YB 3MEEA 3OYBA 3G0ZA 1WB9A 3K59A 3IFRA 1NK7A 3OYJA 3GE1A 4JI2K 3H45C 3OYFA 1RT2A 1RBUA 3I33A 4DSEA 3T1HK 1JL2A 3TAQA 2IC3A 4XH5A 1RCHA 3R1XA 1VRUA 4KH4A 3C94A 1ZBUA 3WUHA 3CETA 1NKCA 1VAZA 3VEXA 4DS4A 3OA9A 2ASPA 3CQ8A 1G99A 3S9HA 3EE9A 1KLNA 1QQMA 5AQGA 1D9FA 3K5NA 3OYGA 2PY5A 4JD2B 3S3OA 3PUFA 3C6TA 2YCHA 4DR1K 3AO4A 3H1VX 5EU7A 4CGGA 2YNHA 3TAPA 4H03B 3CMEN 4BRKA 4IO9L 3SNNA 1ATSA 4DV2K 4DWIA 3VF6A 2A6AA 1U47A 4DTNA 1GLBG 4C1NK 5J2MA 3D2EA 3AGRA 3V9WA 4DLGA 1NK6A 4H0XB 3C65A 2P9IB 3LZJA 1XWLA 3K2PA 4FL9A 1HQUA 2GEMA 1X3NA 2ZGYA 3B6OA 1C0GA 1KTQA 5C2DA 1T8EA 1OH5A 4LSNA 1WBBA 1TL1A 4QCLA 1SZ2A 2W40A 2OZMA 1VRTA 1MA9B 2VWKA 5GIOA 2HSTA 3IKMA 2OTLN 2O8BB 3L2QA 2FBXA 1S1WA 1KFDA 3L3VA 3I8BA 4FWOA 5KI6A 4CERA 4EIAA 4IO8A 1XQSC 2VQEK 5EXWA 3G25A 1U2VA 3WXKA 3CCVN 1NK5A 4FJIA 2VG7A 3KJVA 3P4IA 5JMVA 4JKCA 3BZKA 2IVNA 3NCIA 1T44A 3HM8A 3CPEA 3AAQA 1LW2A 4BROA 3ISNC 4L8RB 1JLFA 4E1JA 2ATQA 2NZTA 2F8SA 4UQGA 4Z0UA 3FE1A 4DG1A 4B1UB 4LF7K 4DFJA 2VGMA 1QSSA 4MO5A 4FPAA 3CMAN 4DV5K 2HF4A 3O5BA 1C0FA 3THXB 3O6WA 3KTQA 1VQMN 4Z4HA 1ZBHA 4XEIA 1YTAA 4EHUA 4NO7A 1REVA 4DLEA 3BY5A 1SQKA 4DR6K 2P9UA 4A2BA 4DV4K 2F7TA 2FBYA 5AQNA 4NCAA 3ID6A 1IO2A 2QXFA 2W42A 1S1UA 5AZJB 1GLFO 3SAFA 3OYHA 3HPOA 1T6DA 2X6SA 5JS1A 4RW4A 2O8FB 3KK2A 2IGIA 5AQWA 3HP6A 1KAYA 1WN7A 4KPYA 4KI6A 2X74A 3FLCO 3SLCA 4H5NA 1JLAA 4B3OA 4ILGB 4IBNA 3BP8A 3U3YA 3LP3A 4LF9K 3HOSA 4X65K 4KBOA 1ZBSA 3KKSA 4QAGA 3KLEA 3K5MA 3DLHA 4BVOA 4O55A 2VWBA 4CEZA 4JRQA 4DF8A 3ATVA 4CEEA 3GG4A 3MEGA 3SI6A 3E66A 4O0JA 2WTUA 3DRRA 3SJJA 1TL3A 4YDUC 3EE8A 2Q3SA 1DKGD 5JLHA 4CE9A 3K9KA 3O1BA 1VHXA 4E7HA 4W5RA 3QICA 3HJFA 3MCPA 3VOVA 4BR2A 2NRVA 3TAGA 1S1VA 1NK9A 4F4KA 4CJFA 4V19S 2P9KB 3VEWA 1SL0A 1EX4A 2JGUA 2YHYA 4C8NA 4XH4A 3R9PA 4M3YA 1VQNN 1YHQN 1L3TA 2ASOA 4IDKA 2JWKA 5AQMA 2HNZA 5JICA 2KFZA 2FBVA 4FOIA 4JI0K 5DM7L 1IV0A 4DTXA 3NE6A 3NDKA 4HTUA 3ZSXA 3WNGA 3V81A 2FSJA 2NNWA 3TI0A 3OYKA 3KZBA 2DFFA 2HHSA 2HOEA 3DLBA 1NGCA 3DMJA 3QERA 4BQZA 4IFEA 4O5FA 4B9NA 3DYAA 3Q7CA 5M1FA 5AQTA 3ZYYX 4CVNE 5AQLA 3BF3A 4GV9A 4JK7A 3RVCA 4CZFA 1NGAA 1VQ9N 3OJSA 5AQPA 3VQEA 3CJCA 3A0IX 1BG3A 3CM5A 1F21A 3O4NA 3WXLA 4CFDA 2P9UB 1YXQA 1VQ4N 4FLTA 4W5TA 3O3GA 3IS9A 1CZAN 3AA3A 3ZETA 4FJNA 3ZT4A 1RDWX 1QSYA 4H5TA 3AY9A 1C0UA 3SMSA 4IOAL 4ILJA 1GOCA 4CD3A 4KTQA 3CCMN 3FZMA 5AZIA 4DTUA 2E2QA 4CJQA 2NRTA 2OYQA 4BDZA 1VQ6N 1QE1A 2NRZA 4KTWA 2UUAK 4PKIA 2OPPA 4F3OA 2D4WA 3LDPA 3SK3A 4BACA 1N32K 1NJZA 2E6MA 4BRDA 3DLKA 1VQKN 2HNDA 5AQKA 4BRCA 2P1JA 3UB5A 4B3TK 4DR4K 2XY5A 2KKZA 3PX0A 1SL2A 1HYZA 4BR5A 2EWSA 1S3XA 1HPZA 2P9LA 1NK8A 2QWQA 1GLAG 1XC3A 4KI4A 4W5NA 1SKSA 1Z25A 1KVCA 4CFBA 5H1SQ 3HK2A 2RKIA 5KRSA 1EWRA 3H6EA 3HBTA 2IAJA 2X78A 2AA4A 3VGLA 2WUSA 3VQ6A 5B8HA 2G8IA 3N4QA 3NBPA 3AVGA 3R8EA 3W0LA 4FJ5A 1T6CA 2P9SB 2QXLA 1VSDA 4CF8A 1JLQA 3AVNA 4OVLA 3U8XA 3MWPA 3CJ7A 2RHKA 4H5WA 2DTUA 1KVBA 4N76A 1RT6A 1M1KO 2D0PA 2QA4N 4DSFA 1YI2N 3LDQA 3T7ZA 3D0PA 1T05A 4PUOA 5CYMA 1U48A 1UA0A 4W5OA 3WNEA 1IKXA 3ZSWA 4CHQA 3SUPA 2E8AA 4CF0A 5GAHP 3HOTA 5BN8A 3O4QA 5HRRA 1RTHA 3RMCA 4CK1A 2IIRA 4E0DA 4FLXA 5EVZA 1N34K 3THWA 1S1TA 3VQDA 4A5BA 4ZHRA 4IG3A 2HMIA 1TK0A 5AQQA 4PWDA 3C7NB 1HR0K 4CEBA 3QNNA 4ELTA 3D7EO 3CCEN 3HI0A 3H1QA 3F5TA 4CJSA 4WQ4A 5F0XA 4FM1A 3GL1A 3NGIA 3VQQA 2JWLA 5J2PA 4FVUA 5CHIA 5LJVA 2RE2A 4BC2A 5BR9A 4YOYA 1Q81O 4FJ9A 3O3FA 1KD1O 2KZZA 1W2BM 2A3ZA 2QI2A 3CJBA 4A59A 2B5JA 4LF5K 1VSIA 1BCMA 3ZT0A 4BE1A 3O3HA 2GWJA 2XHBA 5AQRA 5FPEA 1Q9XA 4H4OA 3UIQA 1TAUA 4OGEA 4Z4FA 1NOZA 3LAMA 1B92A 3QB0A 4GVMA 4MDBA 4HCCA 3F9MA 4BC3A 1JJ2M 1X9SA 4AHTA 2P5OA 1HNWK 1HUXA 5GADP 2HBMA 4HVJA 3CC2N 1MDUB 4OPKA 1GLEG 3VQ5A 4CJRA 1NM1A 3MN7A 5HRSA 1C0TA 1TUYA 4M3XA 4JD2A 3KK3A 4B3RK 4LH4A 3TARA 3B6PA 4CECA 1L3SA 4JS4A 1S72N 5C10A 1LWEA 4DTSA 4J2BA 1XI1A 1D9DA 2E1YA 1LW0A 4JI8K 4O4GA 2HMPA 3HXMA 3C0BA 3WNFA 2P9IA 4AF1A 4I6MB 4CZGA 3JXUA 1J5EK 3AVLA 3BZCA 3M8QA 3IG1A 3OYIA 4BG9A 3NF9A 5BPLA 3OYNA 2VGNA 4PQUA 4CHPA 3QETA 3UKUB 1WSEA 2O8BA 4M3TA 2UYTA 4FM2A 1VSMA 3T1AA 3C6AA 3VQ4A 3I55N 4K41A 3A8YA 5BRHA 5KPTA 5HROA 4JN4A 5FPDA 1L3VA 3G10A 2KQ2A 1HKBA 4IXCA 4O44A 4IFVA 1HNVA 4YOXA 3THWB 4KKOA 4PL7A 4M41A 2Q0UA 2YJFA 4ICLA 1VSLA 3RRGA 4JS5A 4JEPA 3NGYA 3TR8A 3WEEB 1KQSM 1Z26A 1ITGA 4CFCA 1ATRA 1TKZA 3VQ9A 5HRNA 1WSFA 4CK3A 4E7KA 3DOLA 2PBDA 2Z1GA 2ZD1A 3LM2A 4LC9B 4I7FA 3THXA 5AQHA 3SBTA 4BRAA 3ZSYA 3O08A 3PSIA 4DHYA 1OH6A 4CJUA 1K8KB 3CJ1A 1VQ8N 5JS2A 4RW6A 1QVFM 3IRXA 4PKHA 3LM9A 2V7ZA 4B3SK 3CCJN 5JVHL 3CM6A 4CIFA 5FPNA 1ZC6A 5AZJA 3TANA 3AVMA 3K0SA 4JKGB 5MLCQ 2YHXA 3TWHA 4HUEA 3FFIA 1WNSA 4CJPA 3M5RA 1BL3A 3WXMB 1NMNA 4BC5A 3AA2A 4O0IA 2O8FA 2WOMA 5LMUK 3KVGA 1BI4B 1DLOA 1VSFA 3L6QA 1BIZA 4F2RA 4B9SA 4FWNA 2A1RA 4RW8A 4U7BA 1JXEA 3CF5L 3TABA 4YOVA 2E88A 1V4TA 3DI6A 1QHAA 3LDSA 1O13A 2GX9A 1KAZA 1RTDA 2KZMA 2WBNA 4GKKK 4NCGA 3AAPA 1KVAA 2CGLA 2XY8A 3AV9A 3VA0A 5LL6Z 1R59O 4BRPA 3NHGA 3D6RA 2KHOA 1ASVA 1S9GA 4FJGA 1CXQA 3TTFA 3PO5A 4DR7K 4MO4A 3PIOL 3AGKA 2QK9A 2D0OA 4IJAA 3A2FA 2P9KA 3LWLA 2V7YA 1I3AA 4R79A 4DTPA 3MN6A 3ZSZA 2FF3B 1LCUA 4LH5A 4IOCL 3HM9A 4AHVA 1WUAA 1S6PA 4K0KK 3OVNA 2ITGA 4M7YA 4CBXA 4E7LA 3RMDA 4IG0A 3GDQA 3PIPL 3TAFA 1ASUA 4CBUA 2E20A 5ELZA 3KKRA 2ZGZA 3IAYA 4DR2K 4H0VB 4E7IA 2GTDA 4KB1A 3OW2M 1XHXA 4K25A 4N41A 1QZ6A 1BHLA 3JSMA 1GLLO 4EP5A 3OS0A 1X9WA 3SJHA 2Q2RA 3P5JA 3ALYA 4DF4A 4H0PA 4H5RA 3T19A 3EZWA 3O8MA 4CJWA 1KXPA 3ZSVA 1S22A 1BDGA 1NBWA 2HVHA 5KRTA 1C6VA 5AQFA 2BUPA 3U9DA 3DXKA 3KK7A 1W7AA 5AQOA 3SMPA 4YOUA 4B8AB 3H46O 4JI1K 4O8KA 3QNOA 3QIPA 3K5LA 4FJMA 4Q5VA 3SV4A 2W6LA 3VQPA 1HMVA 2O4GA 3K57A 2F8TA 1J54A 3MN5A 4YORA 1U04A 5HLFA 2YNGA 1VSJA 4WFNL 2VQFK 4DSIA 4KHPK 1WSJA 4DFKA 2E2NA 3ZX3A 4M3UA 1IJJA 1LAVA 4CHOA 3CCLN 1RILA 4PA1A 1HNIA 2FF6A 3PSFA 2QTDA 4CHZA 5HRPA 4BR9A 2UUBK 2CGJA 1VQ5N 2HW3A 4M45A 4WYBA 3LP2A 5AFUH 5KPZA 4FJ7A 4GKJK 4ELUA 3V1QA 4RTFD 4FJXA 1GLJO 4BVPA 4B8CA 2D0CA 3GBTA 1M90O 3KLFA 1U6ZA 2WFBA 1NGFA 3R6MA 4NCBA 4GW6A 1SV5A 3V6DA 2DFEA 4KFBA 5DK5A 2AJQA 3NF7A 4JAXA 3D2FB 4OKJA 3KIOA 4OKKA 3OTOK 4BE2A 3TU5A 3S41A 4M3ZA 1HJRA 1RBSA 3NVMA 3C95A 3ULDA 5A2QO 4JNEA 2P9SA 1NLVA 4XIUA 4B1WB 1WSGA 5AQYA 2Z1JA 5AFUA 3A5LC 3L2VA 4K42A 3MXMA 4E1NA 2I7NA 4K8XA 3SZ2A 4LFCK 5KPRA 1YTUA 4I2QA 1IKWA 3JS6A 5C12A 4FYDA 4JI6K 4CZEA 4CESA 4LY7A 4FK4A 3ZT2A 4L3QA 3LL3A 2P9NB 2IDOA 4KH6A 2O8CB 3UKRA 2P9PB 3C7NA 1Q82O 3RTVA 2VG6A 3FFKB 4CEFA 4CF9A 3M8SA 4OGCA 4ID1A 2G8UA 1JKHA 4J2DA 1JCFA 3ZCMA 1D8YA 3QMLA 4OO1J 1NGDA 4WFAL 2HHVA 2ZJPL 3I0SA 4MLHA 4PL8A 3HSTB 4B08A 2G8VA 4CJ7A 3DXKB 4KHQA 1U4BA 3DRPA 3TSPA 5F1XA 5C2FA 4BQLA 1T7PA 3K9JA 1LWFA 1NJWA 4CF1A 1LV5A 3PY8A 2OTJN 4CJ5A 3UE5A 2F96A 4U67L 2XY7A 1O1WA 4OPJA 3VQBA 1ASWA 4HTLA 2HHUA 4X66K 3ENOA 3QFUA 3M8PA 4FLVA 4B9UA 1S9EA 3LDOA 5AQUA 3S3MA 2QWRA 4JKFA 3V9XA 4H8KA 2VG5A 4KHSA 5HOOA 3RSEA 4MFBA 4GMJB 2E1ZA 5I3UA 1W97L 5CYQA 3VGMA 2HHQA 3N4PA 3OYCA 4H0TB 1LAWA 4WQ4C 4YDUA 1BIUA 3DXMA 1RNHA 4IEIA 3VF4A 2G8HA 4PKGA 1RT4A 1JLCA 2ITMA 1GOBA 1RT5A 4DU4A 2W6KA 2YKMA 4BY9C 1ZYQA 5AQZA 3FR0A 4FOEA 2I7PA 3MXIA 1IBMK 2BDPA 3HPHA 3KD1E 3HRGA 3MXJA 4PY5A 2R7YA 4KHNA 3QDKA 4CZMA 5ADXA 3TSUA 2OPQA 1SS6A 4AHRA 1QQNA 1X1PA 2ZWHA 1N36K 5KGXA 3QEXA 1OVYA 4I6MA 4B3MK 3BUZB 1SUQA 1LOTB 4LD0A 2KW4A 4MQ3A 2HHTA 3MX2A 4OX9K 1Y64A 4ILHA 4CHYA 1TK8A 3OYEA 4KHYA 1ESVA 3EL2A 1NGBA 1NK4A 4NLCA 4CJTA 1VQ7N 3MN9A 1QSLA 1RDUA 4LF6K 3UKUA 3B8AX 2NRWA 3DJCA 1RBTA 1VSHA 1I94K 2E6LA 3SCXA 2V51B 3L4QA 3S3NA 1B9FA 1EKEA 1JL1A 4FCYA 4CK2A 3DAWA 1Q7YO 3UKRB 2E4LA 4BWJA 3VN5A 1SKWA 3L2RA 4FWKA 4W5QA 4QS8A 4AH9A 5AQXA 5DM6L 4JI4K 3VQ8A 3WEEA 4DR5K 3MDQA 4JLHA 4JRPA 2YV0X 1A5XA 5LY3A 3I8DA 1SKRA 1BUPA 3P38A 5AQIA 4WF9L 5J2QA 3QESA 1XMQK 5EX5A 3LWMA 1HRHA 3O80A 5T7BA 2XY6A 4B1ZA 4C8MA 3QO9A 1K8KA 3O1WA 4HWIA 2BE2A 3CFOA 1J53A 5FPMA 5BPNA 1RFQA 2FBTA 4HHTA 1VQON 3H3OB 4PHTX 3KLIA 3HYFA 4A62A 3CCQN 1WAJA 1X9JA 1Y97A 4EAHD 3M3ZA 3HVRA 4RW7A 4JKGA 4IOXA 1KFSA 4BR4A 4EFHA 1XUPO 2W41A 4R5PA 1YJ9N 4HCBA 3RSEB 1YUWA 5KQ8A 1FXXA 4KH5A 3QBXA 1YVUA 3DRSA 1BI4A 4DV0K 4O8UA 3MK6A 3IUCA 2HBLA 3DXMB 1W0HA 1GLDG 5SWMA 4DV6K 3H3NO 3L3UA 1U45A 1C1BA 5KTQA 1JCEA 3HPGA 2YKNA 4FK0A 3T1YK 1TKDA 4CJLA 1EXQA 2Q36A 2ZM6K 3RMAA 4IEEA 1RBRA 1OKJA 3LANA 3SV3A 5BN9A 4CF2A 4IWVA 3BDPA 2VWJA 1XHZA 4K43A 3I56N 2KTQA 3PO4A 4NLBA 3E01A 3HTVA 4B9VA 4ZTFA 4UY8O 3AA5X 4OLBA 3HSCA 1HKCA 4TSXA 1EO1A 2CH5A 1NK0A 3P31A 1R0AA 4OPHA 4BRGA 3SAHA 2QWLA 2RPIA 1JLGA 1X3MA 4YY3K 1YJWN 2EX3A 1X9MA 4FZZA 3RMBA 1UWBA 1RDCA 4RG8A 4HUFA 4YOWA 4MLEA 1RDAA 1FJGK 1RGIA 1BCOA 2NRHA 4RCHA 2A5XA 5E41A 3ITHA 5IT9O 3JAMO 4CJ4A 4FO0A 3ZLJA 1E4FT 3T3FA 4FVMA 4GV6A 4AHCA 4FZXC 4DV3K 3NAEA 4I2PA 3U4LA 3VQ7A 4H0OA 4GV3A 3WXJA 4J2EA 3FZHA 4YHHK 1KC8O 1WSHA 5D3GA 1HLUA 1ZBFA 3AVIA 3NF8A 1SAZA 4BDYA 4I9QA 2OPSA 4DCHA 2Q0RA 4H5VA 3MECA 1VQPN 4BE0A 3HO1A 3AO2A 1YF5L 3V4IA 4CJEA 3TAEA 4YOTA 5HP1A 4KB0A 4FWSA 4FLWA 5GIPA 3V9SA 3CC4N 4KAZA 3QEVA 3MAQA 2VCPA 4FWLA 3NVKA 3DLEA 3VEVA 4CBWA 3CJAA 4B1XB 4FJ8A 1W9HA 2CGKA 3L0QA 3ATUA 4F8RA 4CD1A 4QS7A 3H08A 3C6HA 1FW6A 1NKBA 3AO1A 1C0MA 4DQRA 4HUGA 3ZSOA 2F4VK 1JLEA 4CIGA 1RTIA 4CGJA 4EZ6A 3DLLL 4BRNA 1FKPA 3FZKA 1QQCA 4BRFA 2GELA 5AQVA 3VA3A 3ULEB 3VQAA 5C25A 2O8EB 2P51A 1TGOA 3O9QA 5J2NA 3EYZA 1QTMA 2IS3A 4EP4A 3QEIA 3AO3A 4CEOA 4DU3A 1HQEA 3QEWA 3TTDA 2PZSA 3NGZA 3CI5A 3OY9A 1HJOA 3MMVA 1K8AO 1HYSA 2YNIA 4Y1CA 2IVOA 4B9TA 2JLEA 3CXCM 1IBKK 4J8FA 2DFHA 1BISA 4CEQA 1T3VA 1TYQB 4CZLA 2G8WA 3OYMA 4K8ZA 4E19A 3VEOA 1QHTA 4CGIA 3IMXA 3E1YA 3D2FA 3J7ZO 4JV5K 3AVCA 4DR3K 1CLQA 1U49A 1UAXA 2ZF5O 2O4IA 3NF6A 4CFAA 1C1CA 1NJIO 4FLYA 5TKWA 4FXDA 5LJWA 1UOCA 1T03A 4FJLA 3PLAA 2BANA 4ID5A 4RW9A 5CZ1A 3E9LA 1L3UA 4ISGA 3ZEUB 3LPUA 1IH7A 3CFRA 1XNQK 1TUUA 1CZBA 4FWRA 2O8DB 1J5OA 3OJUA 3KLHA 3BF1A 4E7JA 4JHDB 4BR7A 1NJYA 3Q7BA 2XRIA 3L2WA 2XO7A 1Z6RA 3O9RA 1BQMA 3QINA 4JKEA 3SUOA 4WQ5A 1BA1A 1YIJN 4OLAA 2P9NA 3THYA 1NGIA 2IOCA 1RDBA 2O8CA 1JCGA 3AVAA 4DS5A 3T69A 1DGKN 2G8KA 4E3SA 1K73O 2B6AA 2A41A 4JKDA 2P9PA 5AJ3K 4CGFA 1BOTO 1HNXK 4DSKA 4NXMK 4ISFA 4CJVA 5IWAK 2RF2A 5AR0A 1MWMA 4B1YB 3BGRA 2Y1JA 1IKVA 3OYAA 5J1EA 3M6GA 1N6QA 4BRLA 3R3LA 4M3RA 2OCEA 1QS4A 4FSVA 2V52B 3VTHA 4FWMA 4NYNA 3EZ5A 3J7YP 3K58A 4LFAK 3W3DA 2BH1A 1GLCG 3EEQA 4CEAA 1CXUA 1KRPA 5HBMA 1RDDA 3OBWA 1UA1A 4BREA 3V9ZA 4YFUA 5E26A 3NH1A 3AVKA 1D5AA 4AHSA 4Q0BA 1HPMA 4CJKA 2QKKA 3V1RA 4A57A 4BRQA 3J8AA 4KRFA 1BQNA 3SUNA 3CD6N 4X62K 4DUZK 1I39A 3DLGA 3CJ9A 1NG9A 5AQSA 5DMRA 2AP1A 4JYAK 3MEDA 4O5BA 1XNRK 4GNIA 1DT9A 3LDLA 1ATNA 2B4JA 3VENA 1NU0A 1VK0A 4FJKA 3SQ0A 4FLUA 4KHWA 3U9ZA 4FLZA 4DFPA 3FGUA 3EY1A 5C0YA 4JI5K 3ASMA 3O4WA 5BRDA 2QKBA 1NJXA 2QM1A 4EHTA 4NYFA 4AQYK 3ZX2A 1SL1A 2NRRA 3PX6A 1WLJA 5FRNA 3LALA 3SBGA 1DTTA 3F2KA 2HNYA 4CIEA 2A40A 5HL7L 4KO0A 3SPZA 2HF3A 2Q31A 3AA4A 1YJNN 1L5UA 1TKXA 4LF8K 4Z4IA 2Q1NA 3LAKA 1FK9A
chains in the Genus database with same CATH topology
4DB3A 1OVYA 2YX6A 2HMPA 4JKHA 1GLBG 4I6MA 3C0BA 4C1NK 2P9IA 3BUZB 5GAEP 3D2EA 1LOTB 3AGRA 4H0XB 4AF1A 5BREA 3C65A 4I6MB 3VPZA 4CZGA 2P9IB 3JXUA 1E4GT 3D2EB 2IVPA 3MX2A 5M1OA 1Y64A 5C15A 4FL9A 1NGJA 4JK8A 4BG9A 4ILHA 2GEMA 1X3NA 2ZGYA 4IZ9A 1C0GA 5C2DA 3I55N 1ESVA 3EL2A 1DEJA 1NGBA 5BPLA 4NLCA 3VETA 3VTIA 1VQ7N 3MN9A 1RDUA 1SZ2A 3M1FA 3UKUA 2W40A 3B8AX 2VGNA 4NB4A 2NRWA 3DJCA 2CH6A 1MA9B 2VYPA 3UKUB 5GIOA 2HSTA 1WOQA 2UYTA 4GVEA 3VEZA 3IKMA 2OTLN 1YVNA 2V51B 1ZXOA 3C6AA 3I8BA 3ENBA 4FWOA 3BEXA 3L4QA 4IO8A 4K41A 4BR0A 4EIAA 1XQSC 5BRFA 3G6EN 5EXWA 1NWKA 3L4IA 3A8YA 5BRHA 3DWLA 1U2VA 3G25A 3WXKA 5KPTA 4JN4A 4Z94A 5M1KA 3CCVN 3DAWA 5FPDA 1Q7YO 1U2VB 3UKRB 1HKBA 4IXCA 3P4IA 5F2RA 5JMVA 4JKCA 4YOXA 2DPNA 4FWKA 2IVNA 4PL7A 4CZHA 2Q0UA 4QS8A 2YJFA 1T44A 3HM8A 5AQXA 5DM6L 3CPEA 3AAQA 3TSQA 4JEPA 3WEEA 4BROA 3MDQA 5AQJA 4E1JA 2PFUA 3WEEB 4FPBA 1KQSM 1ATRA 5LY3A 2NZTA 4C23A 1BUPA 3P38A 5AQIA 4WF9L 3VERA 3CIPA 2PBDA 3FE1A 1YITN 3VMFB 4LC9B 3LM2A 5EX5A 3A5NC 1NGGA 4B1UB 1K9MO 3O80A 2VGMA 4MO5A 4FPAA 5AQHA 4B1ZA 3CMAN 2HF4A 3O5BA 1C0FA 3SBTA 4BRMA 3O6WA 4BRAA 3O08A 1K8KA 3O1WA 4BC4A 4HWIA 4DHYA 1VQMN 3P39A 3CQXA 1K8KB 1EQYA 3CJ1A 1VQ8N 5FPMA 4XEIA 5BPNA 1RFQA 1VQON 4EHUA 3H3OB 1QVFM 4NO7A 4PHTX 4PKHA 3TPQA 1SQKA 3LM9A 2V7ZA 4A62A 3CCQN 3CCJN 1X9JA 2P9UA 4EAHD 5JVHL 2YHWA 3M3ZA 4A2BA 2F7TA 5AQNA 5FPNA 3ID6A 5M1NA 1BU6O 4JKGA 1ZC6A 5AZJA 4IOXA 4JKGB 4BR4A 4EFHA 2YHXA 5AZJB 5MLCQ 5ADXH 1GLFO 1XUPO 2W41A 1P8ZA 1YJ9N 2GWKA 3OBYA 3RSEB 3SAFA 1N8RO 1YUWA 3M5RA 1T6DA 5KQ8A 3WXMB 4KH5A 3QBXA 4BC5A 4M63C 4O8UA 3MK6A 4AM7A 3IUCA 2HBLA 3O9UA 3KVGA 3DXMB 1GLDG 5AQWA 1KAYA 3H3NO 5E84A 3L6QA 1NGEA 3A5OC 3CHWA 3FLCO 4AM6A 1JCEA 4FWNA 3SLCA 2BTFA 4H5NA 1KAXA 4ILGB 4OPAA 3SAGA 4U7BA 3BP8A 5GINA 3MCAB 2Q36A 5EOYA 4IEEA 4BRHA 1OKJA 3CF5L 5BN9A 4IWVA 3QBWA 3EO3A 4YOVA 3HOSA 2E88A 1V4TA 4K43A 1QHAA 4KBOA 1ZBSA 1O13A 4M7XA 3FZFA 5EY4A 3I56N 2GX9A 3KWIA 4BVOA 3KHYA 4NLBA 1KAZA 5M1QA 4CZJA 2VWBA 3HTVA 4WFBL 3WQUA 4B1VA 2YI1A 3CCRN 3ATVA 4UY8O 2WBNA 3AAPA 3HSCA 1HKCA 3GG4A 2CGLA 1EO1A 2CH5A 2HBJA 3E66A 1R59O 4GY2B 2FXUA 1HX1A 4BRPA 3D6RA 2KHOA 3EE8A 3P31A 2HBKA 4YDUC 1NMDA 1DKGD 4OPHA 4BRGA 5M1PA 5JLHA 3K9KA 3TTFA 3SAHA 3O1BA 5CR4A 4MO4A 4A2AA 3PIOL 3AGKA 3QICA 2QWLA 2D0OA 4F9OA 3MCPA 4IJAA 3LDNA 2NRVA 3VOVA 4BR2A 4IJNA 1X3MA 1YJWN 2P9KA 2V7YA 2P9KB 3VEWA 4R79A 4FWPA 3MN6A 2GUPA 2YHYA 4YOWA 2FF3B 3CERA 4MLEA 4XH4A 3R9PA 3WT0A 2Q97A 1VQNN 1YHQN 1LCUA 4IOCL 1WUAA 1RGIA 4RCHA 2NRHA 2A5XA 2ASOA 3VF2A 2JWKA 5AQMA 3G4SN 4FO0A 1E4FT 4GV6A 4M7YA 4CBXA 5JICA 4FOIA 3HZ6A 3GDQA 5DM7L 3U4LA 3PIPL 4H0OA 3TTCA 2PAVA 4GV3A 3WXJA 4CBUA 3FZHA 2D1KA 2E20A 5ELZA 1MWKA 1HLUA 1J6ZA 1KC8O 2FSJA 2ZGZA 2NNWA 1ILYA 3KZBA 4A5AA 1SAZA 1QVGM 4H0VB 4DCHA 4BG8A 2GTDA 2Q0RA 4H5VA 5JLFA 3OW2M 5KQDA 2HOEA 1NGCA 4K25A 1VQPN 3CC7N 2QWOA 4BQZA 2H3GX 4IFEA 4O5FA 2A42A 1YF5L 1QZ6A 3Q7CA 5M1FA 3CCUN 1GLLO 5GAGP 5AQTA 3ZYYX 5JVGL 5AQLA 4YOTA 3SJHA 2OANA 2WC9A 3BF3A 3VEYA 4GV9A 2Q2RA 4JK7A 5I9EB 4H0PA 4FWSA 4H5RA 3RVCA 4DKWA 4CZFA 5GIPA 3CC4N 1NGAA 1VQ9N 3EZWA 1BA0A 3O8MA 3O9TA 2VCPA 4FWLA 5AQPA 1KXPA 3NVKA 4JKAA 3VEVA 3CJCA 4CBWA 3CJAA 4B1XB 1S22A 3A0IX 2CGKA 1BDGA 1BG3A 1NBWA 3L0QA 4DQ8A 3ATUA 1VQLN 4CD1A 4QS7A 3WXLA 2ZJRL 3CCSN 5AQFA 2BUPA 3C6HA 1Z05A 3DXKA 3KK7A 3U9DA 2QWNA 5AQOA 3NMUA 3SMPA 4YOUA 2P9UB 3H46O 1YXQA 4O8KA 1VQ4N 2F9TA 4ISEA 1CZAN 3IDHA 3ZETA 1RDWX 3ZETB 4BRNA 3DLLL 4H5TA 4C1NI 3AY9A 3MN5A 4YORA 3SMSA 4IOAL 4ILJA 4XH1A 3FZKA 3E9PA 4CD3A 1Q18A 3CCMN 3FZMA 5AZIA 3ULEA 4BRFA 2E2QA 2GELA 2J4RA 5AQVA 2NRTA 4WFNL 4CZIA 5AZIB 3ID8A 3ULEB 4CI6A 3ZX0A 1VQ6N 2NRZA 2E2OA 3FZLA 2E2NA 3ZX3A 4PKIA 1IJJA 3EKSA 2D4WA 3LDPA 4QS9A 3SK3A 3CCLN 3O9QA 3QFPA 2QW9A 4BRDA 1VQKN 2FF6A 4BGAA 2QTDA 5AQKA 4BRCA 4BR9A 2CGJA 3UB5A 1NGHA 1VQ5N 3TTDA 2KKZA 3CI5A 4WYBA 1K8AO 1HJOA 3MMVA 5AFUH 5KPZA 2FSKA 2IVOA 4BR5A 2EWSA 1S3XA 3AARA 2P9LA 1TYQA 3CXCM 3WXIA 4J8FA 4RTFD 1BO5O 1GLJO 4BVPA 1T3VA 2P9LB 1GLAG 1TYQB 1XC3A 2QWQA 3GBTA 4CZLA 1M90O 1U6ZA 2WFBA 3WQTA 3VEOA 5H1SQ 1NGFA 3IMXA 3R6MA 3E1YA 3D2FA 3H6EA 3HBTA 3J7ZO 2AA4A 4JK9A 3EKUA 3D2FB 4JAXA 3VGLA 3E9OA 2WUSA 3KWGA 3TU5A 3S41A 5B8HA 1QZ5A 2ZF5O 4G9ZA 2F9WA 4B9QA 3N4QA 4BGBA 3NVMA 1NJIO 3R8EA 1QQOA 4JNEA 2P9SA 3W0LA 1NLVA 1T6CA 5TKWA 5LJWA 4B1WB 2P9SB 5AQYA 2QXLA 1D4XA 3PLAA 5AFUA 2NRXA 5BPMA 4IDHA 3U8XA 3MWPA 3CJ7A 3A5LC 3ZEUA 4K42A 3GOIA 1IG8A 2I7NA 5CE3A 1Q86O 2RHKA 3E9LA 4H5WA 4ISGA 3ZEUB 5KPRA 4JKBA 1TUUA 4JHDA 2E2PA 4FWRA 1M1KO 2D0PA 5TKYA 3JS6A 2QA4N 3BF1A 4JHDB 1YI2N 3LDQA 3T7ZA 4BR7A 5C12A 3CQYA 3Q7BA 3ENHA 4RWTA 4CZEA 1Z6RA 2NLXA 3O9RA 4JKEA 2E8AA 4WQ5A 1BA1A 5GAHP 3HOTA 4L3QA 1YIJN 3LL3A 4FWQA 2P9NA 5BN8A 1NGIA 3MWTA 2P9NB 1JCGA 2IIRA 3T69A 1DGKN 2ZJQL 4KH6A 1P90A 4A61A 1K73O 2A41A 5EVZA 3UKRA 4JKDA 2P9PA 3CPWM 2FLOA 3VGKA 1BOTO 2P9PB 4A5BA 3OHRA 3C7NA 1Q82O 4ISFA 4MDAA 5AQQA 3FFKB 2QWMA 3C7NB 5AR0A 1MWMA 4B1YB 3D7EO 3CCEN 3HI0A 1JCFA 3M6GA 3A5MC 4BRLA 2FSNA 3H1QA 3QMLA 3F5TA 3R3LA 1NGDA 4WQ4A 4WFAL 4CZKA 2ZJPL 4OO1J 1V4SA 4FSVA 4MLHA 1H1VA 2V52B 5F0XA 1BWFO 3GL1A 4PL8A 3VTHA 2JWLA 2ASMA 4FWMA 4FVUA 5CHIA 4CJ7A 2YJEA 3DXKB 5LJVA 2RE2A 3TSPA 5F1XA 4BC2A 5BR9A 3W3DA 5C2FA 4YOYA 2BH1A 1GLCG 4BQLA 1Q81O 2QWPA 3K9JA 3OBWA 1KD1O 4BRIA 4BREA 1W2BM 4WQ5C 2OTJN 3EN9A 2A3ZA 2QI2A 2QEXN 1HKGA 3UE5A 3CJBA 5E26A 4U67L 3MX5A 4A59A 1YAGA 1HPMA 2KLAA 4HTLA 4WCEL 3ENOA 4Y0WA 3QFUA 4A57A 3VESA 4BRQA 3G71N 3J8AA 5AQUA 3LDOA 2QWRA 3O9SA 4H0YB 4JKFA 2GWJA 3CD6N 3IFRA 5AQRA 5FPEA 3CJ9A 3GE1A 5HOOA 3H45C 5AQSA 3RSEA 2E1ZA 2AP1A 1W97L 3VGMA 3I33A 3N4PA 4H0TB 3QB0A 4MDBA 3F9MA 4WQ4C 4XH5A 4BC3A 3R1XA 4GNIA 1JJ2M 4KH4A 1DT9A 3LDLA 4YDUA 1ATNA 3DXMA 3VENA 4IEIA 3WUHA 1HUXA 3VF4A 4PKGA 3CETA 5GADP 2HBMA 1VAZA 3VEXA 3U9ZA 3CC2N 3OA9A 1MDUB 2ITMA 1GLEG 2ASPA 3FGUA 1G99A 5C0YA 5BRDA 3O4WA 2QM1A 4BY9C 1NM1A 3MN7A 3EE9A 1QQMA 5AQZA 1TUYA 4EHTA 5AQGA 4JD2A 3FR0A 4FOEA 2I7PA 3ZX2A 2NRRA 4JD2B 2YCHA 3HRGA 3H1VX 3SBGA 3F2KA 3QDKA 4CZMA 1S72N 2A40A 3TSUA 5ADXA 4H03B 5HL7L 3CMEN 4BRKA 5C10A 2HF3A 1SS6A 2Q31A 4IO9L 1ATSA 1QQNA 1YJNN 2ZWHA 3VF6A 2A6AA 2E1YA 2Q1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLA A;  1EO1 A;  2YX6 A;  2WFB A;  2QTD A;  1RDU A;  1T3V A;  1P90 A;  1O13 A;  2RE2 A; 
#chains in the Genus database with same CATH topology
 4DB3 A;  2YX6 A;  3CYM A;  4JKH A;  4LFB K;  4CGH A;  5GAE P;  1RT7 A;  4N5S A;  4KTZ A;  5BRE A;  3VPZ A;  2UUC K;  1E4G T;  3D2E B;  2IVP A;  5M1O A;  1KLM A;  5C15 A;  3LP1 A;  1NGJ A;  4JK8 A;  5FLX O;  4IZ9 A;  5I42 A;  2PYJ A;  1DEJ A;  3C6U A;  4DTJ A;  4F3T A;  3VET A;  3VTI A;  1TV6 A;  2D0B A;  3M1F A;  5LMN K;  1K6Y A;  4NB4 A;  3HT3 A;  3VQC A;  2CH6 A;  3L8B A;  2VYP A;  1C1A A;  1WOQ A;  4GVE A;  3VEZ A;  1YVN A;  3P83 D;  1ZXO A;  3J7A P;  3ZSQ A;  3ENB A;  4BR0 A;  3BEX A;  4E89 A;  3G6E N;  5BRF A;  3PV8 A;  1MU2 A;  3CG7 A;  3THY B;  1A5V A;  1EWQ A;  1NWK A;  3L4I A;  3DWL A;  5M1K A;  4Z94 A;  3SUQ A;  1JLB A;  1U2V B;  2YHA A;  5F2R A;  4CW7 B;  3AVH A;  2DPN A;  4CZH A;  4DSJ A;  3TSQ A;  4FJJ A;  5AQJ A;  3OYL A;  2PFU A;  5K14 A;  4FPB A;  4C23 A;  3VER A;  3CIP A;  3U3G A;  1YIT N;  3VMF B;  2ETJ A;  3A5N C;  1NGG A;  2I5J A;  1K9M O;  3J80 O;  5C24 A;  1J9A A;  4DQP A;  4BRM A;  3WNH A;  3QEP A;  2NUB A;  4BC4 A;  4NXN K;  4OJR A;  3P39 A;  3CQX A;  5CZ2 A;  1EQY A;  2YNF A;  1RT3 A;  4QOZ B;  3TPQ A;  3L2U A;  2A1S A;  3M8R A;  2YHW A;  4FW2 A;  4DTM A;  5M1N A;  1BU6 O;  4DU1 A;  4C8L A;  1G15 A;  3THV A;  3P1G A;  5ADX H;  1P8Z A;  4BWM A;  1TK5 A;  2GWK A;  3OBY A;  4JI7 K;  1N8R O;  1CZ9 A;  1JXB A;  4X64 K;  5FRO A;  3LZI A;  2UXC K;  5FDL A;  4M63 C;  4AM7 A;  3O9U A;  4N56 A;  5E84 A;  1NGE A;  4AIL C;  3A5O C;  3CHW A;  4AM6 A;  3KK1 A;  2BTF A;  4LSL A;  1KAX A;  4OPA A;  3SAG A;  5GIN A;  3MCA B;  5EOY A;  2UXD K;  4BRH A;  1S6Q A;  2UU9 K;  3QBW A;  3EO3 A;  1IBL K;  4KRE A;  2HB5 A;  4M7X A;  3FZF A;  5EY4 A;  3KWI A;  4CZJ A;  3KHY A;  5M1Q A;  3AVF A;  4WFB L;  1EP4 A;  3WQU A;  1E3M A;  4B1V A;  2YI1 A;  3CCR N;  1WBD A;  1HNZ K;  4M42 A;  2HHX A;  2HBJ A;  2OA8 A;  4GY2 B;  2FXU A;  1Q9Y A;  1HX1 A;  4KV8 A;  4B9M A;  2HBK A;  3ZT1 A;  1NMD A;  3OS2 A;  4JI3 K;  3F73 A;  5M1P A;  3QLH A;  4IFY A;  5CR4 A;  4A2A A;  3AVJ A;  4F9O A;  3LDN A;  4IJN A;  5SZT A;  1NNE A;  1N5Y A;  4FWP A;  4BDP A;  2GUP A;  3CER A;  3WT0 A;  2Q97 A;  3OYD A;  3VF2 A;  4G1Q A;  4Z4C A;  3G4S N;  4AHU A;  3HZ6 A;  4F2S A;  4FJH A;  1EET A;  3TTC A;  2PAV A;  4DMN A;  2WON A;  2D1K A;  3U6F A;  1MWK A;  1J6Z A;  3ZT3 A;  4DSL A;  2GV9 A;  1ILY A;  2DY4 A;  4A5A A;  1QVG M;  4B9L A;  4BG8 A;  5JLF A;  3TAM A;  4CGD A;  1N33 K;  5KQD A;  3CC7 N;  2QWO A;  1ZBI A;  2H3G X;  2A42 A;  2GUI A;  3QIO A;  3SQ1 A;  3CCU N;  5GAG P;  5JVG L;  2OAN A;  2WC9 A;  3VEY A;  3NH0 A;  4FZY A;  5I9E B;  4FW1 A;  4CCH A;  4DKW A;  1BA0 A;  3PX4 A;  3LPT A;  5FRM A;  3O9T A;  1BGX T;  4JKA A;  1RTJ A;  1GOA A;  4N47 A;  3K5O A;  4DQ8 A;  1VQL N;  3CCS N;  2ZJR L;  3OS1 A;  1Z05 A;  4DQS A;  2QWN A;  3NMU A;  3DM2 A;  2UXB K;  2F9T A;  4ISE A;  2OZS A;  3IDH A;  1S5J A;  4DFM A;  1XC9 A;  3ZET B;  1HYV A;  2RN2 A;  4C1N I;  4XH1 A;  3E9P A;  4ELV A;  1Q18 A;  4FM0 A;  3ULE A;  1OH8 A;  2J4R A;  4CJ3 A;  1KCF A;  4CZI A;  2FC0 A;  3ID8 A;  2YHB A;  1IKY A;  5AZI B;  3ZX0 A;  4CI6 A;  2O8E A;  3SQ2 A;  2E2O A;  3FZL A;  1TAQ A;  3EKS A;  4QS9 A;  3QFP A;  2QW9 A;  4M3W A;  1RT1 A;  4BGA A;  3RR7 A;  3HL8 A;  2BGG A;  1NGH A;  5BR8 K;  2D0A A;  1LWC A;  3J81 O;  3NH2 A;  4DTR A;  1VSE A;  4C8K A;  1WSI A;  2FSK A;  2HHW A;  2D5R A;  1TKT A;  3AAR A;  1TYQ A;  1DTQ A;  3HP9 A;  3WXI A;  1BO5 O;  3I0R A;  1Q8I A;  2P9L B;  5C42 A;  3V1O A;  1YT3 A;  1RBV A;  3WQT A;  1WAF A;  4JK9 A;  2Z1H A;  3EKU A;  3E9O A;  3KWG A;  1QZ5 A;  4G9Z A;  4E1M A;  4H4M A;  2F9W A;  4B9Q A;  4Z4E A;  4KHU A;  4BGB A;  1QQO A;  3DLR A;  4WE1 A;  3V9U A;  3D45 A;  1B9D A;  1D4X A;  3AO5 A;  4DQQ A;  1IG9 A;  2NRX A;  5BPM A;  3LP0 A;  4IDH A;  1A5W A;  4OKE A;  3RRH A;  3ZEU A;  3GOI A;  1NKE A;  1IG8 A;  5CE3 A;  1Q86 O;  4FK2 A;  4DV1 K;  2O8D A;  2LSN A;  4J2A A;  3AVB A;  4JKB A;  3ZSR A;  4DTO A;  1ZBL A;  4JHD A;  2E2P A;  4YNQ A;  4ZTJ A;  2E5L K;  5TKY A;  4DUY K;  2P5G A;  2GBZ A;  3CQY A;  3KD5 E;  3ENH A;  4RWT A;  2NLX A;  2KFN A;  3RR8 A;  1VSK A;  2ZQB A;  2HVI A;  4FWQ A;  2PYL A;  3MWT A;  2HHH K;  2ZJQ L;  4A61 A;  1P90 A;  4DV7 K;  3CPW M;  4CHN A;  2Y1I A;  2FLO A;  3VGK A;  3RWU A;  3OHR A;  2X6N A;  4MDA A;  4I9L A;  3SQ4 A;  4IKF A;  1OH7 A;  2QWM A;  4CED A;  3CFP A;  3JYT A;  5CY4 A;  3A5M C;  3F9K A;  3DOK A;  2FSN A;  1KSP A;  2EHG A;  4CZK A;  1V4S A;  1H1V A;  2ZE2 A;  3NFA A;  1BWF O;  4EZ9 A;  2G8F A;  3SYZ A;  4Y1D A;  2ASM A;  1OVQ A;  5KGW A;  4C8O A;  2YJE A;  4DQI A;  3HVT A;  2OPR A;  1TVR A;  2QWP A;  4BRI A;  1XMO K;  1NOY A;  4WQ5 C;  3EN9 A;  2Z1I A;  2QEX N;  4Z4G A;  1HKG A;  3KLG A;  3MX5 A;  1YAG A;  3SPY A;  2KLA A;  4LF4 K;  1FKO A;  4WCE L;  4Y0W A;  3VES A;  1S1X A;  3G71 N;  3O9S A;  4H0Y B;  3MEE A;  3OYB A;  3G0Z A;  1WB9 A;  3K59 A;  3IFR A;  1NK7 A;  3OYJ A;  3GE1 A;  4JI2 K;  3H45 C;  3OYF A;  1RT2 A;  1RBU A;  3I33 A;  4DSE A;  3T1H K;  1JL2 A;  3TAQ A;  2IC3 A;  4XH5 A;  1RCH A;  3R1X A;  1VRU A;  4KH4 A;  3C94 A;  1ZBU A;  3WUH A;  3CET A;  1NKC A;  1VAZ A;  3VEX A;  4DS4 A;  3OA9 A;  2ASP A;  3CQ8 A;  1G99 A;  3S9H A;  3EE9 A;  1KLN A;  1QQM A;  5AQG A;  1D9F A;  3K5N A;  3OYG A;  2PY5 A;  4JD2 B;  3S3O A;  3PUF A;  3C6T A;  2YCH A;  4DR1 K;  3AO4 A;  3H1V X;  5EU7 A;  4CGG A;  2YNH A;  3TAP A;  4H03 B;  3CME N;  4BRK A;  4IO9 L;  3SNN A;  1ATS A;  4DV2 K;  4DWI A;  3VF6 A;  2A6A A;  1U47 A;  4DTN A;  1GLB G;  4C1N K;  5J2M A;  3D2E A;  3AGR A;  3V9W A;  4DLG A;  1NK6 A;  4H0X B;  3C65 A;  2P9I B;  3LZJ A;  1XWL A;  3K2P A;  4FL9 A;  1HQU A;  2GEM A;  1X3N A;  2ZGY A;  3B6O A;  1C0G A;  1KTQ A;  5C2D A;  1T8E A;  1OH5 A;  4LSN A;  1WBB A;  1TL1 A;  4QCL A;  1SZ2 A;  2W40 A;  2OZM A;  1VRT A;  1MA9 B;  2VWK A;  5GIO A;  2HST A;  3IKM A;  2OTL N;  2O8B B;  3L2Q A;  2FBX A;  1S1W A;  1KFD A;  3L3V A;  3I8B A;  4FWO A;  5KI6 A;  4CER A;  4EIA A;  4IO8 A;  1XQS C;  2VQE K;  5EXW A;  3G25 A;  1U2V A;  3WXK A;  3CCV N;  1NK5 A;  4FJI A;  2VG7 A;  3KJV A;  3P4I A;  5JMV A;  4JKC A;  3BZK A;  2IVN A;  3NCI A;  1T44 A;  3HM8 A;  3CPE A;  3AAQ A;  1LW2 A;  4BRO A;  3ISN C;  4L8R B;  1JLF A;  4E1J A;  2ATQ A;  2NZT A;  2F8S A;  4UQG A;  4Z0U A;  3FE1 A;  4DG1 A;  4B1U B;  4LF7 K;  4DFJ A;  2VGM A;  1QSS A;  4MO5 A;  4FPA A;  3CMA N;  4DV5 K;  2HF4 A;  3O5B A;  1C0F A;  3THX B;  3O6W A;  3KTQ A;  1VQM N;  4Z4H A;  1ZBH A;  4XEI A;  1YTA A;  4EHU A;  4NO7 A;  1REV A;  4DLE A;  3BY5 A;  1SQK A;  4DR6 K;  2P9U A;  4A2B A;  4DV4 K;  2F7T A;  2FBY A;  5AQN A;  4NCA A;  3ID6 A;  1IO2 A;  2QXF A;  2W42 A;  1S1U A;  5AZJ B;  1GLF O;  3SAF A;  3OYH A;  3HPO A;  1T6D A;  2X6S A;  5JS1 A;  4RW4 A;  2O8F B;  3KK2 A;  2IGI A;  5AQW A;  3HP6 A;  1KAY A;  1WN7 A;  4KPY A;  4KI6 A;  2X74 A;  3FLC O;  3SLC A;  4H5N A;  1JLA A;  4B3O A;  4ILG B;  4IBN A;  3BP8 A;  3U3Y A;  3LP3 A;  4LF9 K;  3HOS A;  4X65 K;  4KBO A;  1ZBS A;  3KKS A;  4QAG A;  3KLE A;  3K5M A;  3DLH A;  4BVO A;  4O55 A;  2VWB A;  4CEZ A;  4JRQ A;  4DF8 A;  3ATV A;  4CEE A;  3GG4 A;  3MEG A;  3SI6 A;  3E66 A;  4O0J A;  2WTU A;  3DRR A;  3SJJ A;  1TL3 A;  4YDU C;  3EE8 A;  2Q3S A;  1DKG D;  5JLH A;  4CE9 A;  3K9K A;  3O1B A;  1VHX A;  4E7H A;  4W5R A;  3QIC A;  3HJF A;  3MCP A;  3VOV A;  4BR2 A;  2NRV A;  3TAG A;  1S1V A;  1NK9 A;  4F4K A;  4CJF A;  4V19 S;  2P9K B;  3VEW A;  1SL0 A;  1EX4 A;  2JGU A;  2YHY A;  4C8N A;  4XH4 A;  3R9P A;  4M3Y A;  1VQN N;  1YHQ N;  1L3T A;  2ASO A;  4IDK A;  2JWK A;  5AQM A;  2HNZ A;  5JIC A;  2KFZ A;  2FBV A;  4FOI A;  4JI0 K;  5DM7 L;  1IV0 A;  4DTX A;  3NE6 A;  3NDK A;  4HTU A;  3ZSX A;  3WNG A;  3V81 A;  2FSJ A;  2NNW A;  3TI0 A;  3OYK A;  3KZB A;  2DFF A;  2HHS A;  2HOE A;  3DLB A;  1NGC A;  3DMJ A;  3QER A;  4BQZ A;  4IFE A;  4O5F A;  4B9N A;  3DYA A;  3Q7C A;  5M1F A;  5AQT A;  3ZYY X;  4CVN E;  5AQL A;  3BF3 A;  4GV9 A;  4JK7 A;  3RVC A;  4CZF A;  1NGA A;  1VQ9 N;  3OJS A;  5AQP A;  3VQE A;  3CJC A;  3A0I X;  1BG3 A;  3CM5 A;  1F21 A;  3O4N A;  3WXL A;  4CFD A;  2P9U B;  1YXQ A;  1VQ4 N;  4FLT A;  4W5T A;  3O3G A;  3IS9 A;  1CZA N;  3AA3 A;  3ZET A;  4FJN A;  3ZT4 A;  1RDW X;  1QSY A;  4H5T A;  3AY9 A;  1C0U A;  3SMS A;  4IOA L;  4ILJ A;  1GOC A;  4CD3 A;  4KTQ A;  3CCM N;  3FZM A;  5AZI A;  4DTU A;  2E2Q A;  4CJQ A;  2NRT A;  2OYQ A;  4BDZ A;  1VQ6 N;  1QE1 A;  2NRZ A;  4KTW A;  2UUA K;  4PKI A;  2OPP A;  4F3O A;  2D4W A;  3LDP A;  3SK3 A;  4BAC A;  1N32 K;  1NJZ A;  2E6M A;  4BRD A;  3DLK A;  1VQK N;  2HND A;  5AQK A;  4BRC A;  2P1J A;  3UB5 A;  4B3T K;  4DR4 K;  2XY5 A;  2KKZ A;  3PX0 A;  1SL2 A;  1HYZ A;  4BR5 A;  2EWS A;  1S3X A;  1HPZ A;  2P9L A;  1NK8 A;  2QWQ A;  1GLA G;  1XC3 A;  4KI4 A;  4W5N A;  1SKS A;  1Z25 A;  1KVC A;  4CFB A;  5H1S Q;  3HK2 A;  2RKI A;  5KRS A;  1EWR A;  3H6E A;  3HBT A;  2IAJ A;  2X78 A;  2AA4 A;  3VGL A;  2WUS A;  3VQ6 A;  5B8H A;  2G8I A;  3N4Q A;  3NBP A;  3AVG A;  3R8E A;  3W0L A;  4FJ5 A;  1T6C A;  2P9S B;  2QXL A;  1VSD A;  4CF8 A;  1JLQ A;  3AVN A;  4OVL A;  3U8X A;  3MWP A;  3CJ7 A;  2RHK A;  4H5W A;  2DTU A;  1KVB A;  4N76 A;  1RT6 A;  1M1K O;  2D0P A;  2QA4 N;  4DSF A;  1YI2 N;  3LDQ A;  3T7Z A;  3D0P A;  1T05 A;  4PUO A;  5CYM A;  1U48 A;  1UA0 A;  4W5O A;  3WNE A;  1IKX A;  3ZSW A;  4CHQ A;  3SUP A;  2E8A A;  4CF0 A;  5GAH P;  3HOT A;  5BN8 A;  3O4Q A;  5HRR A;  1RTH A;  3RMC A;  4CK1 A;  2IIR A;  4E0D A;  4FLX A;  5EVZ A;  1N34 K;  3THW A;  1S1T A;  3VQD A;  4A5B A;  4ZHR A;  4IG3 A;  2HMI A;  1TK0 A;  5AQQ A;  4PWD A;  3C7N B;  1HR0 K;  4CEB A;  3QNN A;  4ELT A;  3D7E O;  3CCE N;  3HI0 A;  3H1Q A;  3F5T A;  4CJS A;  4WQ4 A;  5F0X A;  4FM1 A;  3GL1 A;  3NGI A;  3VQQ A;  2JWL A;  5J2P A;  4FVU A;  5CHI A;  5LJV A;  2RE2 A;  4BC2 A;  5BR9 A;  4YOY A;  1Q81 O;  4FJ9 A;  3O3F A;  1KD1 O;  2KZZ A;  1W2B M;  2A3Z A;  2QI2 A;  3CJB A;  4A59 A;  2B5J A;  4LF5 K;  1VSI A;  1BCM A;  3ZT0 A;  4BE1 A;  3O3H A;  2GWJ A;  2XHB A;  5AQR A;  5FPE A;  1Q9X A;  4H4O A;  3UIQ A;  1TAU A;  4OGE A;  4Z4F A;  1NOZ A;  3LAM A;  1B92 A;  3QB0 A;  4GVM A;  4MDB A;  4HCC A;  3F9M A;  4BC3 A;  1JJ2 M;  1X9S A;  4AHT A;  2P5O A;  1HNW K;  1HUX A;  5GAD P;  2HBM A;  4HVJ A;  3CC2 N;  1MDU B;  4OPK A;  1GLE G;  3VQ5 A;  4CJR A;  1NM1 A;  3MN7 A;  5HRS A;  1C0T A;  1TUY A;  4M3X A;  4JD2 A;  3KK3 A;  4B3R K;  4LH4 A;  3TAR A;  3B6P A;  4CEC A;  1L3S A;  4JS4 A;  1S72 N;  5C10 A;  1LWE A;  4DTS A;  4J2B A;  1XI1 A;  1D9D A;  2E1Y A;  1LW0 A;  4JI8 K;  4O4G A;  2HMP A;  3HXM A;  3C0B A;  3WNF A;  2P9I A;  4AF1 A;  4I6M B;  4CZG A;  3JXU A;  1J5E K;  3AVL A;  3BZC A;  3M8Q A;  3IG1 A;  3OYI A;  4BG9 A;  3NF9 A;  5BPL A;  3OYN A;  2VGN A;  4PQU A;  4CHP A;  3QET A;  3UKU B;  1WSE A;  2O8B A;  4M3T A;  2UYT A;  4FM2 A;  1VSM A;  3T1A A;  3C6A A;  3VQ4 A;  3I55 N;  4K41 A;  3A8Y A;  5BRH A;  5KPT A;  5HRO A;  4JN4 A;  5FPD A;  1L3V A;  3G10 A;  2KQ2 A;  1HKB A;  4IXC A;  4O44 A;  4IFV A;  1HNV A;  4YOX A;  3THW B;  4KKO A;  4PL7 A;  4M41 A;  2Q0U A;  2YJF A;  4ICL A;  1VSL A;  3RRG A;  4JS5 A;  4JEP A;  3NGY A;  3TR8 A;  3WEE B;  1KQS M;  1Z26 A;  1ITG A;  4CFC A;  1ATR A;  1TKZ A;  3VQ9 A;  5HRN A;  1WSF A;  4CK3 A;  4E7K A;  3DOL A;  2PBD A;  2Z1G A;  2ZD1 A;  3LM2 A;  4LC9 B;  4I7F A;  3THX A;  5AQH A;  3SBT A;  4BRA A;  3ZSY A;  3O08 A;  3PSI A;  4DHY A;  1OH6 A;  4CJU A;  1K8K B;  3CJ1 A;  1VQ8 N;  5JS2 A;  4RW6 A;  1QVF M;  3IRX A;  4PKH A;  3LM9 A;  2V7Z A;  4B3S K;  3CCJ N;  5JVH L;  3CM6 A;  4CIF A;  5FPN A;  1ZC6 A;  5AZJ A;  3TAN A;  3AVM A;  3K0S A;  4JKG B;  5MLC Q;  2YHX A;  3TWH A;  4HUE A;  3FFI A;  1WNS A;  4CJP A;  3M5R A;  1BL3 A;  3WXM B;  1NMN A;  4BC5 A;  3AA2 A;  4O0I A;  2O8F A;  2WOM A;  5LMU K;  3KVG A;  1BI4 B;  1DLO A;  1VSF A;  3L6Q A;  1BIZ A;  4F2R A;  4B9S A;  4FWN A;  2A1R A;  4RW8 A;  4U7B A;  1JXE A;  3CF5 L;  3TAB A;  4YOV A;  2E88 A;  1V4T A;  3DI6 A;  1QHA A;  3LDS A;  1O13 A;  2GX9 A;  1KAZ A;  1RTD A;  2KZM A;  2WBN A;  4GKK K;  4NCG A;  3AAP A;  1KVA A;  2CGL A;  2XY8 A;  3AV9 A;  3VA0 A;  5LL6 Z;  1R59 O;  4BRP A;  3NHG A;  3D6R A;  2KHO A;  1ASV A;  1S9G A;  4FJG A;  1CXQ A;  3TTF A;  3PO5 A;  4DR7 K;  4MO4 A;  3PIO L;  3AGK A;  2QK9 A;  2D0O A;  4IJA A;  3A2F A;  2P9K A;  3LWL A;  2V7Y A;  1I3A A;  4R79 A;  4DTP A;  3MN6 A;  3ZSZ A;  2FF3 B;  1LCU A;  4LH5 A;  4IOC L;  3HM9 A;  4AHV A;  1WUA A;  1S6P A;  4K0K K;  3OVN A;  2ITG A;  4M7Y A;  4CBX A;  4E7L A;  3RMD A;  4IG0 A;  3GDQ A;  3PIP L;  3TAF A;  1ASU A;  4CBU A;  2E20 A;  5ELZ A;  3KKR A;  2ZGZ A;  3IAY A;  4DR2 K;  4H0V B;  4E7I A;  2GTD A;  4KB1 A;  3OW2 M;  1XHX A;  4K25 A;  4N41 A;  1QZ6 A;  1BHL A;  3JSM A;  1GLL O;  4EP5 A;  3OS0 A;  1X9W A;  3SJH A;  2Q2R A;  3P5J A;  3ALY A;  4DF4 A;  4H0P A;  4H5R A;  3T19 A;  3EZW A;  3O8M A;  4CJW A;  1KXP A;  3ZSV A;  1S22 A;  1BDG A;  1NBW A;  2HVH A;  5KRT A;  1C6V A;  5AQF A;  2BUP A;  3U9D A;  3DXK A;  3KK7 A;  1W7A A;  5AQO A;  3SMP A;  4YOU A;  4B8A B;  3H46 O;  4JI1 K;  4O8K A;  3QNO A;  3QIP A;  3K5L A;  4FJM A;  4Q5V A;  3SV4 A;  2W6L A;  3VQP A;  1HMV A;  2O4G A;  3K57 A;  2F8T A;  1J54 A;  3MN5 A;  4YOR A;  1U04 A;  5HLF A;  2YNG A;  1VSJ A;  4WFN L;  2VQF K;  4DSI A;  4KHP K;  1WSJ A;  4DFK A;  2E2N A;  3ZX3 A;  4M3U A;  1IJJ A;  1LAV A;  4CHO A;  3CCL N;  1RIL A;  4PA1 A;  1HNI A;  2FF6 A;  3PSF A;  2QTD A;  4CHZ A;  5HRP A;  4BR9 A;  2UUB K;  2CGJ A;  1VQ5 N;  2HW3 A;  4M45 A;  4WYB A;  3LP2 A;  5AFU H;  5KPZ A;  4FJ7 A;  4GKJ K;  4ELU A;  3V1Q A;  4RTF D;  4FJX A;  1GLJ O;  4BVP A;  4B8C A;  2D0C A;  3GBT A;  1M90 O;  3KLF A;  1U6Z A;  2WFB A;  1NGF A;  3R6M A;  4NCB A;  4GW6 A;  1SV5 A;  3V6D A;  2DFE A;  4KFB A;  5DK5 A;  2AJQ A;  3NF7 A;  4JAX A;  3D2F B;  4OKJ A;  3KIO A;  4OKK A;  3OTO K;  4BE2 A;  3TU5 A;  3S41 A;  4M3Z A;  1HJR A;  1RBS A;  3NVM A;  3C95 A;  3ULD A;  5A2Q O;  4JNE A;  2P9S A;  1NLV A;  4XIU A;  4B1W B;  1WSG A;  5AQY A;  2Z1J A;  5AFU A;  3A5L C;  3L2V A;  4K42 A;  3MXM A;  4E1N A;  2I7N A;  4K8X A;  3SZ2 A;  4LFC K;  5KPR A;  1YTU A;  4I2Q A;  1IKW A;  3JS6 A;  5C12 A;  4FYD A;  4JI6 K;  4CZE A;  4CES A;  4LY7 A;  4FK4 A;  3ZT2 A;  4L3Q A;  3LL3 A;  2P9N B;  2IDO A;  4KH6 A;  2O8C B;  3UKR A;  2P9P B;  3C7N A;  1Q82 O;  3RTV A;  2VG6 A;  3FFK B;  4CEF A;  4CF9 A;  3M8S A;  4OGC A;  4ID1 A;  2G8U A;  1JKH A;  4J2D A;  1JCF A;  3ZCM A;  1D8Y A;  3QML A;  4OO1 J;  1NGD A;  4WFA L;  2HHV A;  2ZJP L;  3I0S A;  4MLH A;  4PL8 A;  3HST B;  4B08 A;  2G8V A;  4CJ7 A;  3DXK B;  4KHQ A;  1U4B A;  3DRP A;  3TSP A;  5F1X A;  5C2F A;  4BQL A;  1T7P A;  3K9J A;  1LWF A;  1NJW A;  4CF1 A;  1LV5 A;  3PY8 A;  2OTJ N;  4CJ5 A;  3UE5 A;  2F96 A;  4U67 L;  2XY7 A;  1O1W A;  4OPJ A;  3VQB A;  1ASW A;  4HTL A;  2HHU A;  4X66 K;  3ENO A;  3QFU A;  3M8P A;  4FLV A;  4B9U A;  1S9E A;  3LDO A;  5AQU A;  3S3M A;  2QWR A;  4JKF A;  3V9X A;  4H8K A;  2VG5 A;  4KHS A;  5HOO A;  3RSE A;  4MFB A;  4GMJ B;  2E1Z A;  5I3U A;  1W97 L;  5CYQ A;  3VGM A;  2HHQ A;  3N4P A;  3OYC A;  4H0T B;  1LAW A;  4WQ4 C;  4YDU A;  1BIU A;  3DXM A;  1RNH A;  4IEI A;  3VF4 A;  2G8H A;  4PKG A;  1RT4 A;  1JLC A;  2ITM A;  1GOB A;  1RT5 A;  4DU4 A;  2W6K A;  2YKM A;  4BY9 C;  1ZYQ A;  5AQZ A;  3FR0 A;  4FOE A;  2I7P A;  3MXI A;  1IBM K;  2BDP A;  3HPH A;  3KD1 E;  3HRG A;  3MXJ A;  4PY5 A;  2R7Y A;  4KHN A;  3QDK A;  4CZM A;  5ADX A;  3TSU A;  2OPQ A;  1SS6 A;  4AHR A;  1QQN A;  1X1P A;  2ZWH A;  1N36 K;  5KGX A;  3QEX A;  1OVY A;  4I6M A;  4B3M K;  3BUZ B;  1SUQ A;  1LOT B;  4LD0 A;  2KW4 A;  4MQ3 A;  2HHT A;  3MX2 A;  4OX9 K;  1Y64 A;  4ILH A;  4CHY A;  1TK8 A;  3OYE A;  4KHY A;  1ESV A;  3EL2 A;  1NGB A;  1NK4 A;  4NLC A;  4CJT A;  1VQ7 N;  3MN9 A;  1QSL A;  1RDU A;  4LF6 K;  3UKU A;  3B8A X;  2NRW A;  3DJC A;  1RBT A;  1VSH A;  1I94 K;  2E6L A;  3SCX A;  2V51 B;  3L4Q A;  3S3N A;  1B9F A;  1EKE A;  1JL1 A;  4FCY A;  4CK2 A;  3DAW A;  1Q7Y O;  3UKR B;  2E4L A;  4BWJ A;  3VN5 A;  1SKW A;  3L2R A;  4FWK A;  4W5Q A;  4QS8 A;  4AH9 A;  5AQX A;  5DM6 L;  4JI4 K;  3VQ8 A;  3WEE A;  4DR5 K;  3MDQ A;  4JLH A;  4JRP A;  2YV0 X;  1A5X A;  5LY3 A;  3I8D A;  1SKR A;  1BUP A;  3P38 A;  5AQI A;  4WF9 L;  5J2Q A;  3QES A;  1XMQ K;  5EX5 A;  3LWM A;  1HRH A;  3O80 A;  5T7B A;  2XY6 A;  4B1Z A;  4C8M A;  3QO9 A;  1K8K A;  3O1W A;  4HWI A;  2BE2 A;  3CFO A;  1J53 A;  5FPM A;  5BPN A;  1RFQ A;  2FBT A;  4HHT A;  1VQO N;  3H3O B;  4PHT X;  3KLI A;  3HYF A;  4A62 A;  3CCQ N;  1WAJ A;  1X9J A;  1Y97 A;  4EAH D;  3M3Z A;  3HVR A;  4RW7 A;  4JKG A;  4IOX A;  1KFS A;  4BR4 A;  4EFH A;  1XUP O;  2W41 A;  4R5P A;  1YJ9 N;  4HCB A;  3RSE B;  1YUW A;  5KQ8 A;  1FXX A;  4KH5 A;  3QBX A;  1YVU A;  3DRS A;  1BI4 A;  4DV0 K;  4O8U A;  3MK6 A;  3IUC A;  2HBL A;  3DXM B;  1W0H A;  1GLD G;  5SWM A;  4DV6 K;  3H3N O;  3L3U A;  1U45 A;  1C1B A;  5KTQ A;  1JCE A;  3HPG A;  2YKN A;  4FK0 A;  3T1Y K;  1TKD A;  4CJL A;  1EXQ A;  2Q36 A;  2ZM6 K;  3RMA A;  4IEE A;  1RBR A;  1OKJ A;  3LAN A;  3SV3 A;  5BN9 A;  4CF2 A;  4IWV A;  3BDP A;  2VWJ A;  1XHZ A;  4K43 A;  3I56 N;  2KTQ A;  3PO4 A;  4NLB A;  3E01 A;  3HTV A;  4B9V A;  4ZTF A;  4UY8 O;  3AA5 X;  4OLB A;  3HSC A;  1HKC A;  4TSX A;  1EO1 A;  2CH5 A;  1NK0 A;  3P31 A;  1R0A A;  4OPH A;  4BRG A;  3SAH A;  2QWL A;  2RPI A;  1JLG A;  1X3M A;  4YY3 K;  1YJW N;  2EX3 A;  1X9M A;  4FZZ A;  3RMB A;  1UWB A;  1RDC A;  4RG8 A;  4HUF A;  4YOW A;  4MLE A;  1RDA A;  1FJG K;  1RGI A;  1BCO A;  2NRH A;  4RCH A;  2A5X A;  5E41 A;  3ITH A;  5IT9 O;  3JAM O;  4CJ4 A;  4FO0 A;  3ZLJ A;  1E4F T;  3T3F A;  4FVM A;  4GV6 A;  4AHC A;  4FZX C;  4DV3 K;  3NAE A;  4I2P A;  3U4L A;  3VQ7 A;  4H0O A;  4GV3 A;  3WXJ A;  4J2E A;  3FZH A;  4YHH K;  1KC8 O;  1WSH A;  5D3G A;  1HLU A;  1ZBF A;  3AVI A;  3NF8 A;  1SAZ A;  4BDY A;  4I9Q A;  2OPS A;  4DCH A;  2Q0R A;  4H5V A;  3MEC A;  1VQP N;  4BE0 A;  3HO1 A;  3AO2 A;  1YF5 L;  3V4I A;  4CJE A;  3TAE A;  4YOT A;  5HP1 A;  4KB0 A;  4FWS A;  4FLW A;  5GIP A;  3V9S A;  3CC4 N;  4KAZ A;  3QEV A;  3MAQ A;  2VCP A;  4FWL A;  3NVK A;  3DLE A;  3VEV A;  4CBW A;  3CJA A;  4B1X B;  4FJ8 A;  1W9H A;  2CGK A;  3L0Q A;  3ATU A;  4F8R A;  4CD1 A;  4QS7 A;  3H08 A;  3C6H A;  1FW6 A;  1NKB A;  3AO1 A;  1C0M A;  4DQR A;  4HUG A;  3ZSO A;  2F4V K;  1JLE A;  4CIG A;  1RTI A;  4CGJ A;  4EZ6 A;  3DLL L;  4BRN A;  1FKP A;  3FZK A;  1QQC A;  4BRF A;  2GEL A;  5AQV A;  3VA3 A;  3ULE B;  3VQA A;  5C25 A;  2O8E B;  2P51 A;  1TGO A;  3O9Q A;  5J2N A;  3EYZ A;  1QTM A;  2IS3 A;  4EP4 A;  3QEI A;  3AO3 A;  4CEO A;  4DU3 A;  1HQE A;  3QEW A;  3TTD A;  2PZS A;  3NGZ A;  3CI5 A;  3OY9 A;  1HJO A;  3MMV A;  1K8A O;  1HYS A;  2YNI A;  4Y1C A;  2IVO A;  4B9T A;  2JLE A;  3CXC M;  1IBK K;  4J8F A;  2DFH A;  1BIS A;  4CEQ A;  1T3V A;  1TYQ B;  4CZL A;  2G8W A;  3OYM A;  4K8Z A;  4E19 A;  3VEO A;  1QHT A;  4CGI A;  3IMX A;  3E1Y A;  3D2F A;  3J7Z O;  4JV5 K;  3AVC A;  4DR3 K;  1CLQ A;  1U49 A;  1UAX A;  2ZF5 O;  2O4I A;  3NF6 A;  4CFA A;  1C1C A;  1NJI O;  4FLY A;  5TKW A;  4FXD A;  5LJW A;  1UOC A;  1T03 A;  4FJL A;  3PLA A;  2BAN A;  4ID5 A;  4RW9 A;  5CZ1 A;  3E9L A;  1L3U A;  4ISG A;  3ZEU B;  3LPU A;  1IH7 A;  3CFR A;  1XNQ K;  1TUU A;  1CZB A;  4FWR A;  2O8D B;  1J5O A;  3OJU A;  3KLH A;  3BF1 A;  4E7J A;  4JHD B;  4BR7 A;  1NJY A;  3Q7B A;  2XRI A;  3L2W A;  2XO7 A;  1Z6R A;  3O9R A;  1BQM A;  3QIN A;  4JKE A;  3SUO A;  4WQ5 A;  1BA1 A;  1YIJ N;  4OLA A;  2P9N A;  3THY A;  1NGI A;  2IOC A;  1RDB A;  2O8C A;  1JCG A;  3AVA A;  4DS5 A;  3T69 A;  1DGK N;  2G8K A;  4E3S A;  1K73 O;  2B6A A;  2A41 A;  4JKD A;  2P9P A;  5AJ3 K;  4CGF A;  1BOT O;  1HNX K;  4DSK A;  4NXM K;  4ISF A;  4CJV A;  5IWA K;  2RF2 A;  5AR0 A;  1MWM A;  4B1Y B;  3BGR A;  2Y1J A;  1IKV A;  3OYA A;  5J1E A;  3M6G A;  1N6Q A;  4BRL A;  3R3L A;  4M3R A;  2OCE A;  1QS4 A;  4FSV A;  2V52 B;  3VTH A;  4FWM A;  4NYN A;  3EZ5 A;  3J7Y P;  3K58 A;  4LFA K;  3W3D A;  2BH1 A;  1GLC G;  3EEQ A;  4CEA A;  1CXU A;  1KRP A;  5HBM A;  1RDD A;  3OBW A;  1UA1 A;  4BRE A;  3V9Z A;  4YFU A;  5E26 A;  3NH1 A;  3AVK A;  1D5A A;  4AHS A;  4Q0B A;  1HPM A;  4CJK A;  2QKK A;  3V1R A;  4A57 A;  4BRQ A;  3J8A A;  4KRF A;  1BQN A;  3SUN A;  3CD6 N;  4X62 K;  4DUZ K;  1I39 A;  3DLG A;  3CJ9 A;  1NG9 A;  5AQS A;  5DMR A;  2AP1 A;  4JYA K;  3MED A;  4O5B A;  1XNR K;  4GNI A;  1DT9 A;  3LDL A;  1ATN A;  2B4J A;  3VEN A;  1NU0 A;  1VK0 A;  4FJK A;  3SQ0 A;  4FLU A;  4KHW A;  3U9Z A;  4FLZ A;  4DFP A;  3FGU A;  3EY1 A;  5C0Y A;  4JI5 K;  3ASM A;  3O4W A;  5BRD A;  2QKB A;  1NJX A;  2QM1 A;  4EHT A;  4NYF A;  4AQY K;  3ZX2 A;  1SL1 A;  2NRR A;  3PX6 A;  1WLJ A;  5FRN A;  3LAL A;  3SBG A;  1DTT A;  3F2K A;  2HNY A;  4CIE A;  2A40 A;  5HL7 L;  4KO0 A;  3SPZ A;  2HF3 A;  2Q31 A;  3AA4 A;  1YJN N;  1L5U A;  1TKX A;  4LF8 K;  4Z4I A;  2Q1N A;  3LAK A;  1FK9 A; 
#chains in the Genus database with same CATH homology
 4DB3 A;  1OVY A;  2YX6 A;  2HMP A;  4JKH A;  1GLB G;  4I6M A;  3C0B A;  4C1N K;  2P9I A;  3BUZ B;  5GAE P;  3D2E A;  1LOT B;  3AGR A;  4H0X B;  4AF1 A;  5BRE A;  3C65 A;  4I6M B;  3VPZ A;  4CZG A;  2P9I B;  3JXU A;  1E4G T;  3D2E B;  2IVP A;  3MX2 A;  5M1O A;  1Y64 A;  5C15 A;  4FL9 A;  1NGJ A;  4JK8 A;  4BG9 A;  4ILH A;  2GEM A;  1X3N A;  2ZGY A;  4IZ9 A;  1C0G A;  5C2D A;  3I55 N;  1ESV A;  3EL2 A;  1DEJ A;  1NGB A;  5BPL A;  4NLC A;  3VET A;  3VTI A;  1VQ7 N;  3MN9 A;  1RDU A;  1SZ2 A;  3M1F A;  3UKU A;  2W40 A;  3B8A X;  2VGN A;  4NB4 A;  2NRW A;  3DJC A;  2CH6 A;  1MA9 B;  2VYP A;  3UKU B;  5GIO A;  2HST A;  1WOQ A;  2UYT A;  4GVE A;  3VEZ A;  3IKM A;  2OTL N;  1YVN A;  2V51 B;  1ZXO A;  3C6A A;  3I8B A;  3ENB A;  4FWO A;  3BEX A;  3L4Q A;  4IO8 A;  4K41 A;  4BR0 A;  4EIA A;  1XQS C;  5BRF A;  3G6E N;  5EXW A;  1NWK A;  3L4I A;  3A8Y A;  5BRH A;  3DWL A;  1U2V A;  3G25 A;  3WXK A;  5KPT A;  4JN4 A;  4Z94 A;  5M1K A;  3CCV N;  3DAW A;  5FPD A;  1Q7Y O;  1U2V B;  3UKR B;  1HKB A;  4IXC A;  3P4I A;  5F2R A;  5JMV A;  4JKC A;  4YOX A;  2DPN A;  4FWK A;  2IVN A;  4PL7 A;  4CZH A;  2Q0U A;  4QS8 A;  2YJF A;  1T44 A;  3HM8 A;  5AQX A;  5DM6 L;  3CPE A;  3AAQ A;  3TSQ A;  4JEP A;  3WEE A;  4BRO A;  3MDQ A;  5AQJ A;  4E1J A;  2PFU A;  3WEE B;  4FPB A;  1KQS M;  1ATR A;  5LY3 A;  2NZT A;  4C23 A;  1BUP A;  3P38 A;  5AQI A;  4WF9 L;  3VER A;  3CIP A;  2PBD A;  3FE1 A;  1YIT N;  3VMF B;  4LC9 B;  3LM2 A;  5EX5 A;  3A5N C;  1NGG A;  4B1U B;  1K9M O;  3O80 A;  2VGM A;  4MO5 A;  4FPA A;  5AQH A;  4B1Z A;  3CMA N;  2HF4 A;  3O5B A;  1C0F A;  3SBT A;  4BRM A;  3O6W A;  4BRA A;  3O08 A;  1K8K A;  3O1W A;  4BC4 A;  4HWI A;  4DHY A;  1VQM N;  3P39 A;  3CQX A;  1K8K B;  1EQY A;  3CJ1 A;  1VQ8 N;  5FPM A;  4XEI A;  5BPN A;  1RFQ A;  1VQO N;  4EHU A;  3H3O B;  1QVF M;  4NO7 A;  4PHT X;  4PKH A;  3TPQ A;  1SQK A;  3LM9 A;  2V7Z A;  4A62 A;  3CCQ N;  3CCJ N;  1X9J A;  2P9U A;  4EAH D;  5JVH L;  2YHW A;  3M3Z A;  4A2B A;  2F7T A;  5AQN A;  5FPN A;  3ID6 A;  5M1N A;  1BU6 O;  4JKG A;  1ZC6 A;  5AZJ A;  4IOX A;  4JKG B;  4BR4 A;  4EFH A;  2YHX A;  5AZJ B;  5MLC Q;  5ADX H;  1GLF O;  1XUP O;  2W41 A;  1P8Z A;  1YJ9 N;  2GWK A;  3OBY A;  3RSE B;  3SAF A;  1N8R O;  1YUW A;  3M5R A;  1T6D A;  5KQ8 A;  3WXM B;  4KH5 A;  3QBX A;  4BC5 A;  4M63 C;  4O8U A;  3MK6 A;  4AM7 A;  3IUC A;  2HBL A;  3O9U A;  3KVG A;  3DXM B;  1GLD G;  5AQW A;  1KAY A;  3H3N O;  5E84 A;  3L6Q A;  1NGE A;  3A5O C;  3CHW A;  3FLC O;  4AM6 A;  1JCE A;  4FWN A;  3SLC A;  2BTF A;  4H5N A;  1KAX A;  4ILG B;  4OPA A;  3SAG A;  4U7B A;  3BP8 A;  5GIN A;  3MCA B;  2Q36 A;  5EOY A;  4IEE A;  4BRH A;  1OKJ A;  3CF5 L;  5BN9 A;  4IWV A;  3QBW A;  3EO3 A;  4YOV A;  3HOS A;  2E88 A;  1V4T A;  4K43 A;  1QHA A;  4KBO A;  1ZBS A;  1O13 A;  4M7X A;  3FZF A;  5EY4 A;  3I56 N;  2GX9 A;  3KWI A;  4BVO A;  3KHY A;  4NLB A;  1KAZ A;  5M1Q A;  4CZJ A;  2VWB A;  3HTV A;  4WFB L;  3WQU A;  4B1V A;  2YI1 A;  3CCR N;  3ATV A;  4UY8 O;  2WBN A;  3AAP A;  3HSC A;  1HKC A;  3GG4 A;  2CGL A;  1EO1 A;  2CH5 A;  2HBJ A;  3E66 A;  1R59 O;  4GY2 B;  2FXU A;  1HX1 A;  4BRP A;  3D6R A;  2KHO A;  3EE8 A;  3P31 A;  2HBK A;  4YDU C;  1NMD A;  1DKG D;  4OPH A;  4BRG A;  5M1P A;  5JLH A;  3K9K A;  3TTF A;  3SAH A;  3O1B A;  5CR4 A;  4MO4 A;  4A2A A;  3PIO L;  3AGK A;  3QIC A;  2QWL A;  2D0O A;  4F9O A;  3MCP A;  4IJA A;  3LDN A;  2NRV A;  3VOV A;  4BR2 A;  4IJN A;  1X3M A;  1YJW N;  2P9K A;  2V7Y A;  2P9K B;  3VEW A;  4R79 A;  4FWP A;  3MN6 A;  2GUP A;  2YHY A;  4YOW A;  2FF3 B;  3CER A;  4MLE A;  4XH4 A;  3R9P A;  3WT0 A;  2Q97 A;  1VQN N;  1YHQ N;  1LCU A;  4IOC L;  1WUA A;  1RGI A;  4RCH A;  2NRH A;  2A5X A;  2ASO A;  3VF2 A;  2JWK A;  5AQM A;  3G4S N;  4FO0 A;  1E4F T;  4GV6 A;  4M7Y A;  4CBX A;  5JIC A;  4FOI A;  3HZ6 A;  3GDQ A;  5DM7 L;  3U4L A;  3PIP L;  4H0O A;  3TTC A;  2PAV A;  4GV3 A;  3WXJ A;  4CBU A;  3FZH A;  2D1K A;  2E20 A;  5ELZ A;  1MWK A;  1HLU A;  1J6Z A;  1KC8 O;  2FSJ A;  2ZGZ A;  2NNW A;  1ILY A;  3KZB A;  4A5A A;  1SAZ A;  1QVG M;  4H0V B;  4DCH A;  4BG8 A;  2GTD A;  2Q0R A;  4H5V A;  5JLF A;  3OW2 M;  5KQD A;  2HOE A;  1NGC A;  4K25 A;  1VQP N;  3CC7 N;  2QWO A;  4BQZ A;  2H3G X;  4IFE A;  4O5F A;  2A42 A;  1YF5 L;  1QZ6 A;  3Q7C A;  5M1F A;  3CCU N;  1GLL O;  5GAG P;  5AQT A;  3ZYY X;  5JVG L;  5AQL A;  4YOT A;  3SJH A;  2OAN A;  2WC9 A;  3BF3 A;  3VEY A;  4GV9 A;  2Q2R A;  4JK7 A;  5I9E B;  4H0P A;  4FWS A;  4H5R A;  3RVC A;  4DKW A;  4CZF A;  5GIP A;  3CC4 N;  1NGA A;  1VQ9 N;  3EZW A;  1BA0 A;  3O8M A;  3O9T A;  2VCP A;  4FWL A;  5AQP A;  1KXP A;  3NVK A;  4JKA A;  3VEV A;  3CJC A;  4CBW A;  3CJA A;  4B1X B;  1S22 A;  3A0I X;  2CGK A;  1BDG A;  1BG3 A;  1NBW A;  3L0Q A;  4DQ8 A;  3ATU A;  1VQL N;  4CD1 A;  4QS7 A;  3WXL A;  2ZJR L;  3CCS N;  5AQF A;  2BUP A;  3C6H A;  1Z05 A;  3DXK A;  3KK7 A;  3U9D A;  2QWN A;  5AQO A;  3NMU A;  3SMP A;  4YOU A;  2P9U B;  3H46 O;  1YXQ A;  4O8K A;  1VQ4 N;  2F9T A;  4ISE A;  1CZA N;  3IDH A;  3ZET A;  1RDW X;  3ZET B;  4BRN A;  3DLL L;  4H5T A;  4C1N I;  3AY9 A;  3MN5 A;  4YOR A;  3SMS A;  4IOA L;  4ILJ A;  4XH1 A;  3FZK A;  3E9P A;  4CD3 A;  1Q18 A;  3CCM N;  3FZM A;  5AZI A;  3ULE A;  4BRF A;  2E2Q A;  2GEL A;  2J4R A;  5AQV A;  2NRT A;  4WFN L;  4CZI A;  5AZI B;  3ID8 A;  3ULE B;  4CI6 A;  3ZX0 A;  1VQ6 N;  2NRZ A;  2E2O A;  3FZL A;  2E2N A;  3ZX3 A;  4PKI A;  1IJJ A;  3EKS A;  2D4W A;  3LDP A;  4QS9 A;  3SK3 A;  3CCL N;  3O9Q A;  3QFP A;  2QW9 A;  4BRD A;  1VQK N;  2FF6 A;  4BGA A;  2QTD A;  5AQK A;  4BRC A;  4BR9 A;  2CGJ A;  3UB5 A;  1NGH A;  1VQ5 N;  3TTD A;  2KKZ A;  3CI5 A;  4WYB A;  1K8A O;  1HJO A;  3MMV A;  5AFU H;  5KPZ A;  2FSK A;  2IVO A;  4BR5 A;  2EWS A;  1S3X A;  3AAR A;  2P9L A;  1TYQ A;  3CXC M;  3WXI A;  4J8F A;  4RTF D;  1BO5 O;  1GLJ O;  4BVP A;  1T3V A;  2P9L B;  1GLA G;  1TYQ B;  1XC3 A;  2QWQ A;  3GBT A;  4CZL A;  1M90 O;  1U6Z A;  2WFB A;  3WQT A;  3VEO A;  5H1S Q;  1NGF A;  3IMX A;  3R6M A;  3E1Y A;  3D2F A;  3H6E A;  3HBT A;  3J7Z O;  2AA4 A;  4JK9 A;  3EKU A;  3D2F B;  4JAX A;  3VGL A;  3E9O A;  2WUS A;  3KWG A;  3TU5 A;  3S41 A;  5B8H A;  1QZ5 A;  2ZF5 O;  4G9Z A;  2F9W A;  4B9Q A;  3N4Q A;  4BGB A;  3NVM A;  1NJI O;  3R8E A;  1QQO A;  4JNE A;  2P9S A;  3W0L A;  1NLV A;  1T6C A;  5TKW A;  5LJW A;  4B1W B;  2P9S B;  5AQY A;  2QXL A;  1D4X A;  3PLA A;  5AFU A;  2NRX A;  5BPM A;  4IDH A;  3U8X A;  3MWP A;  3CJ7 A;  3A5L C;  3ZEU A;  4K42 A;  3GOI A;  1IG8 A;  2I7N A;  5CE3 A;  1Q86 O;  2RHK A;  3E9L A;  4H5W A;  4ISG A;  3ZEU B;  5KPR A;  4JKB A;  1TUU A;  4JHD A;  2E2P A;  4FWR A;  1M1K O;  2D0P A;  5TKY A;  3JS6 A;  2QA4 N;  3BF1 A;  4JHD B;  1YI2 N;  3LDQ A;  3T7Z A;  4BR7 A;  5C12 A;  3CQY A;  3Q7B A;  3ENH A;  4RWT A;  4CZE A;  1Z6R A;  2NLX A;  3O9R A;  4JKE A;  2E8A A;  4WQ5 A;  1BA1 A;  5GAH P;  3HOT A;  4L3Q A;  1YIJ N;  3LL3 A;  4FWQ A;  2P9N A;  5BN8 A;  1NGI A;  3MWT A;  2P9N B;  1JCG A;  2IIR A;  3T69 A;  1DGK N;  2ZJQ L;  4KH6 A;  1P90 A;  4A61 A;  1K73 O;  2A41 A;  5EVZ A;  3UKR A;  4JKD A;  2P9P A;  3CPW M;  2FLO A;  3VGK A;  1BOT O;  2P9P B;  4A5B A;  3OHR A;  3C7N A;  1Q82 O;  4ISF A;  4MDA A;  5AQQ A;  3FFK B;  2QWM A;  3C7N B;  5AR0 A;  1MWM A;  4B1Y B;  3D7E O;  3CCE N;  3HI0 A;  1JCF A;  3M6G A;  3A5M C;  4BRL A;  2FSN A;  3H1Q A;  3QML A;  3F5T A;  3R3L A;  1NGD A;  4WQ4 A;  4WFA L;  4CZK A;  2ZJP L;  4OO1 J;  1V4S A;  4FSV A;  4MLH A;  1H1V A;  2V52 B;  5F0X A;  1BWF O;  3GL1 A;  4PL8 A;  3VTH A;  2JWL A;  2ASM A;  4FWM A;  4FVU A;  5CHI A;  4CJ7 A;  2YJE A;  3DXK B;  5LJV A;  2RE2 A;  3TSP A;  5F1X A;  4BC2 A;  5BR9 A;  3W3D A;  5C2F A;  4YOY A;  2BH1 A;  1GLC G;  4BQL A;  1Q81 O;  2QWP A;  3K9J A;  3OBW A;  1KD1 O;  4BRI A;  4BRE A;  1W2B M;  4WQ5 C;  2OTJ N;  3EN9 A;  2A3Z A;  2QI2 A;  2QEX N;  1HKG A;  3UE5 A;  3CJB A;  5E26 A;  4U67 L;  3MX5 A;  4A59 A;  1YAG A;  1HPM A;  2KLA A;  4HTL A;  4WCE L;  3ENO A;  4Y0W A;  3QFU A;  4A57 A;  3VES A;  4BRQ A;  3G71 N;  3J8A A;  5AQU A;  3LDO A;  2QWR A;  3O9S A;  4H0Y B;  4JKF A;  2GWJ A;  3CD6 N;  3IFR A;  5AQR A;  5FPE A;  3CJ9 A;  3GE1 A;  5HOO A;  3H45 C;  5AQS A;  3RSE A;  2E1Z A;  2AP1 A;  1W97 L;  3VGM A;  3I33 A;  3N4P A;  4H0T B;  3QB0 A;  4MDB A;  3F9M A;  4WQ4 C;  4XH5 A;  4BC3 A;  3R1X A;  4GNI A;  1JJ2 M;  4KH4 A;  1DT9 A;  3LDL A;  4YDU A;  1ATN A;  3DXM A;  3VEN A;  4IEI A;  3WUH A;  1HUX A;  3VF4 A;  4PKG A;  3CET A;  5GAD P;  2HBM A;  1VAZ A;  3VEX A;  3U9Z A;  3CC2 N;  3OA9 A;  1MDU B;  2ITM A;  1GLE G;  2ASP A;  3FGU A;  1G99 A;  5C0Y A;  5BRD A;  3O4W A;  2QM1 A;  4BY9 C;  1NM1 A;  3MN7 A;  3EE9 A;  1QQM A;  5AQZ A;  1TUY A;  4EHT A;  5AQG A;  4JD2 A;  3FR0 A;  4FOE A;  2I7P A;  3ZX2 A;  2NRR A;  4JD2 B;  2YCH A;  3HRG A;  3H1V X;  3SBG A;  3F2K A;  3QDK A;  4CZM A;  1S72 N;  2A40 A;  3TSU A;  5ADX A;  4H03 B;  5HL7 L;  3CME N;  4BRK A;  5C10 A;  2HF3 A;  1SS6 A;  2Q31 A;  4IO9 L;  1ATS A;  1QQN A;  1YJN N;  2ZWH A;  3VF6 A;  2A6A A;  2E1Y A;  2Q1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...