1RDUA

Nmr structure of a putative nifb protein from thermotoga (tm1290), which belongs to the duf35 family
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
MARVAIPSVGKDLSSMVSDRFARAEYFIIYDTESGNVEVVENTIADAHGTGPKVVQSLVSKGVEYLIASNVGRNAFETLKAAGVKVYRFEGGTVQEAIDAFSEGRLEELTTFTREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title NMR Structure Determination of the Hypothetical Protein TM1290 from Thermotoga Maritima using Automated NOESY Analysis.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Biosynthetic protein
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1rduA00
2WFBA 1T3VA 1O13A 2QTDA 1RDUA 2KLAA 1EO1A 1P90A 2YX6A 2RE2A
chains in the Genus database with same CATH superfamily
3CM6A 3QEPA 4CD1A 1NK7A 3D2FB 3O4WA 1U45A 3M6GA 4B3OA 3C6UA 3TU5A 4OPJA 4IO9L 5I42A 2OZSA 1N36K 1NGEA 1RDCA 4JKCA 2WUSA 5HP1A 4FM0A 3IDHA 1L3VA 3J81O 3O3HA 5JVGL 4N76A 4FW1A 5AR0A 3BF3A 5BRDA 5M1OA 3WNHA 4Z4FA 1DKGD 1RT5A 5DM6L 2FSKA 2PFUA 5AQZA 5BRFA 2G8VA 5FPMA 3MN5A 2KHOA 4PUOA 3KZBA 3SUPA 3ASMA 3FGUA 4XH5A 1HLUA 2RKIA 2WBNA 4DSJA 2A1SA 1VQ7N 5SWMA 4DQSA 3FZFA 2HVHA 3ZT3A 4E7HA 1QSYA 4A61A 4J8FA 5E41A 1EX4A 4JI2K 1T03A 4FJNA 3TSPA 3VERA 4CZKA 2IOCA 1KQSM 3A8YA 4H0PA 3KKSA 2YX6A 4IZ9A 1VQ5N 4IEEA 3PX6A 1Q7YO 4CEEA 3TPQA 4BR7A 4H0XB 4ZTFA 3S3OA 1NBWA 4EHUA 4OPAA 3QNNA 3L2VA 1WUAA 4E1MA 3KLIA 2P9SA 4E0DA 3T1AA 4Z94A 4OJRA 2F8TA 4ZHRA 3E1YA 3TAMA 1XI1A 4DUZK 3AVIA 3CJAA 3MCPA 4K43A 5AQHA 2O8FB 4H4OA 4BRGA 4TSXA 4MLHA 3VN5A 4KAZA 3CM5A 3K9KA 3V9XA 4LF4K 2P9IB 4FXDA 3LP0A 3D2EA 3KTQA 4FJXA 1QHAA 3F73A 3EN9A 2HBJA 3ATUA 1RILA 3L2QA 2G8FA 1C0FA 3ZX0A 1E4GT 5C25A 1JL1A 4K8ZA 1VSMA 4Z4IA 1IG8A 3HXMA 1NKEA 5KI6A 2PZSA 4JRPA 3MX2A 3GOIA 3ZEUB 1KLMA 3OYAA 4NLBA 1QVGM 5AQWA 4KFBA 4I6MA 1HPMA 3GG4A 4HHTA 3AO4A 1GLLO 3RRHA 3K57A 1OH5A 2OPRA 1LWFA 4JD2A 5HL7L 2NRWA 5BPMA 3O9RA 1Q9YA 4BACA 4JI7K 1VK0A 2NRRA 3SJJA 4YORA 5AZJB 3NGZA 2YKNA 5GADP 4DV3K 3K5NA 3QEXA 4J2BA 4A5BA 4DSFA 1YUWA 2D0PA 5GAHP 2KLAA 4H03B 3QBXA 4MLEA 1ZBFA 3K0SA 4LF9K 3M5RA 5ELZA 4DSIA 3NF7A 4GVEA 1ZBIA 4RW7A 3ZSRA 1C1BA 1GLEG 4WFAL 3GBTA 1NJWA 4GVMA 2E2NA 3ZT4A 4B1UB 5ADXH 3M8SA 4EAHD 4DLGA 5AJ3K 4CD3A 2I7PA 3I8BA 3NH1A 4IXCA 5I9EB 3DLEA 3PY8A 3IKMA 1NK9A 4DQIA 2FBXA 1S1UA 3LPTA 3M3ZA 3CCLN 5M1QA 2ITMA 4CFBA 1N34K 2O4IA 1M90O 5BRHA 2YCHA 3G0ZA 5HBMA 4BR2A 4H5TA 4KO0A 3SK3A 5GIOA 1X9WA 5GAEP 3FZLA 2FBYA 2V7YA 3O08A 2ZQBA 2Z1HA 1TUYA 1J5OA 2WONA 4XH1A 1C0UA 1JXBA 1VQ8N 3KVGA 2E8AA 5D3GA 2WC9A 4FZXC 3RR7A 1TAQA 3ZSVA 4M3XA 2A3ZA 1BI4A 2GUIA 2HB5A 3LP1A 1VQMN 1KFSA 5BR8K 1BO5O 3BUZB 3U8XA 3NMUA 1IKXA 3OTOK 4CJLA 4DTOA 4RW9A 2ASOA 2P9LA 4XIUA 4BRKA 3AA4A 5BREA 4JHDA 2GX9A 1TL1A 3VQ4A 3AVGA 2YHBA 4AHRA 1TGOA 2QI2A 4CGJA 3KHYA 2OANA 1KC8O 1ZBHA 2PYJA 4EP5A 2XRIA 3NH2A 2VWJA 3OVNA 4IFEA 4FOIA 5MLCQ 1QSLA 4L8RB 1YT3A 3MX5A 2XY6A 5E84A 4DTPA 4JK8A 4KH6A 5SZTA 3E9LA 4QS7A 3CI5A 5EX5A 1GOAA 4IWVA 3DI6A 3OYNA 3SQ4A 3C6HA 3FLCO 4CF2A 3LP2A 1CXQA 1Q81O 3VEZA 4BE1A 3ZSWA 3THWB 4FW2A 3HSTB 1CZBA 2GTDA 3SUOA 4CHQA 3MMVA 2A42A 5I3UA 2F7TA 3IUCA 5KPZA 1DT9A 3IMXA 1U49A 1SL2A 3H6EA 3RMDA 2VGNA 3CERA 1X3NA 5C42A 3CD6N 2VG6A 1XQSC 3R9PA 2KFZA 3LAKA 4C8NA 3EY1A 2NRTA 2KQ2A 3AAQA 4RTFD 4FK2A 3JS6A 2E20A 1A5WA 4CESA 1D9DA 2HBKA 1NOYA 2P9NA 4HWIA 4O55A 3T3FA 4CBUA 1Q9XA 2A41A 1RDDA 3SPYA 4XH4A 5LY3A 3MEEA 4KHWA 2BGGA 3NF6A 1NGAA 3ENBA 1VQ6N 3CCUN 2UXBK 1BCMA 3L2RA 1D9FA 1EP4A 1J53A 2GEMA 4JI4K 2OCEA 4LSNA 4DR5K 3MWPA 4WQ5A 3LPUA 1C0TA 4GV9A 2VWBA 5F1XA 1BCOA 1RT4A 1DTTA 3HPGA 4M41A 4JN4A 3WUHA 1ASUA 3R1XA 2P51A 4X65K 4PKGA 3HPOA 3TTDA 2P9SB 3C6TA 1UA1A 3CQYA 4AHUA 1EETA 4JI0K 1WNSA 3ZT0A 4ELTA 1VQPN 3CPWM 4CF8A 2GV9A 5KRSA 1C1CA 2RE2A 3HTVA 3SBGA 3OBYA 4JI3K 4U67L 2IAJA 3NE6A 3D2EB 5BPNA 4RG8A 4MDBA 4CEOA 1ATSA 3VQ9A 1KSPA 3M8RA 3VQ6A 3AA2A 3QICA 3OYEA 2UXDK 3H1VX 1EWQA 2VYPA 3KLGA 2NNWA 2RHKA 4CHYA 2AJQA 4YDUC 3SCXA 1XC9A 1OH6A 3W0LA 1FW6A 1NGGA 4BRAA 1LOTB 1YHQN 2D0BA 3B8AX 3OHRA 2ZM6K 3LP3A 1QQNA 4E1JA 1RDUA 1XMOK 1OH7A 4I6MB 4OX9K 4OGCA 4NYNA 4IDKA 1NNEA 2W41A 4JD2B 3ID6A 3LL3A 2HOEA 4CI6A 4FWPA 4BVPA 2P1JA 4BREA 4CEAA 5CYMA 2Z1IA 4B8CA 4IG0A 5FLXO 5M1FA 4BDZA 2FLOA 2DFFA 4DMNA 3KWIA 2BDPA 3EEQA 3I33A 2AA4A 3FZHA 4FLYA 4BQZA 2IVOA 3TAPA 2HVIA 4FWMA 3V1RA 1NMDA 1T8EA 4OGEA 1LV5A 4CGFA 3L4QA 3C94A 2NUBA 2WOMA 1KAZA 3E9PA 2W6KA 3KKRA 2PY5A 4JV5K 4CERA 4QOZB 4FLVA 4PKIA 3E9OA 1TKTA 3CJCA 4FLTA 4DU3A 3V4IA 3CJ7A 4DTRA 3K58A 3MWTA 1J6ZA 3FE1A 2QTDA 2OYQA 3L3UA 1UWBA 1IBLK 4LY7A 2E1ZA 2HHHK 3R8EA 2NLXA 3S41A 2ITGA 1YF5L 5DMRA 1SUQA 4DU1A 4AHSA 1QQOA 1ATNA 4NCGA 1CLQA 4DQRA 4CEQA 1KXPA 2UYTA 3O3GA 1QHTA 2EX3A 4DU4A 2E4LA 2ATQA 4K41A 2KFNA 3CMEN 4BQLA 5J2NA 4QS9A 3WXJA 3EKSA 3DMJA 2HMPA 1NGIA 5AQQA 1D5AA 2NRXA 3SBTA 3DYAA 3VOVA 5AQFA 2QWMA 4HUEA 4DTMA 5FPEA 2G8HA 4DR3K 1TL3A 1OVQA 1K8AO 2GUPA 3CCMN 2QW9A 4JEPA 2YJEA 2KW4A 1BI4B 4ILHA 3KLEA 3KK7A 1I3AA 3EZ5A 1WN7A 3BDPA 4BC2A 3MN7A 3OYLA 3ENHA 1EQYA 4CF9A 2P9LB 3L4IA 3Q7BA 4JKHA 3H45C 4A5AA 3LDQA 2B4JA 4JHDB 2KTQA 3DXMB 4BRIA 4C8KA 3A5NC 5JS2A 1YXQA 4EIAA 1JJ2M 1JLQA 1ZXOA 4CJVA 3VF2A 4ICLA 1S5JA 4BRLA 1KLNA 4AH9A 3EYZA 4DQQA 3JXUA 3AV9A 4HCBA 3PIPL 5F0XA 4O8UA 3KD5E 1K73O 3T69A 5TKYA 1BG3A 3K5LA 1RBRA 1RBVA 4FPBA 3OYKA 1HRHA 3C65A 3SQ0A 1HNVA 4DKWA 4K25A 3GL1A 3Q7CA 1YI2N 4FJ5A 4C1NK 4R79A 3E01A 4CK2A 1QS4A 3VF4A 1KRPA 1HR0K 4FOEA 5FPDA 1BA0A 1LCUA 2P9KA 2Q1NA 3RSEA 1VQ9N 3MXMA 1Q86O 4BRNA 1YJ9N 1RT1A 1BA1A 4CE9A 3HP6A 3WQTA 2YNIA 4CJ3A 3O3FA 4HVJA 4BR4A 5J2QA 3ATVA 4LH4A 4YOTA 1O13A 1RTJA 2P9NB 3EKUA 1L3UA 1HMVA 4JI1K 2YV0X 1F21A 3VENA 3O1WA 4FVMA 2D5RA 1RBSA 3MXIA 2HBLA 4E89A 4WQ4C 3OS0A 4GV6A 5KQDA 1NGJA 2XY5A 2QWRA 1HUXA 1QQMA 1S1VA 3MAQA 2DY4A 4JKFA 4CJFA 4CHPA 4DTSA 4LF6K 4FWOA 3SQ2A 1EKEA 1UOCA 1UAXA 3DLLL 4LF7K 3L2UA 3PIOL 1A5XA 3LDPA 4YNQA 3CQ8A 2DFHA 1HNXK 2F8SA 2NRZA 3G10A 3CC7N 4IO8A 4EP4A 4AHCA 4W5NA 1IKYA 4B3SK 3WXKA 1CZAN 4JI8K 2HNYA 1NK6A 2GWJA 4KTQA 1VRTA 1FKOA 3VQCA 4DFMA 3VQ8A 3D0PA 1K9MO 4KREA 1XNQK 1VRUA 4KTZA 4KV8A 4FZZA 4AM6A 1Z05A 4L3QA 4FWLA 3HP9A 4GV3A 3VQEA 2OPSA 1FK9A 1KFDA 4IDHA 3UKRA 2X6NA 5HRPA 3VMFB 1JLCA 1L5UA 4IOXA 5AQMA 3J80O 3PLAA 3PX4A 3NVKA 1C0MA 4IEIA 4FLZA 3MECA 3LZJA 4KH4A 1RDAA 3ZLJA 2D0CA 3AVHA 4CJ5A 4Z4EA 3SPZA 3DXKA 5EU7A 1OVYA 3M1FA 1HYVA 1WSFA 2ZGZA 4F3OA 2HMIA 4KPYA 3CC2N 2AP1A 4YOUA 4LF8K 3P38A 3SNNA 1EWRA 5C15A 3OYFA 3ITHA 2HNZA 3SYZA 2IVNA 4O0IA 3RTVA 3DRSA 3CFRA 3BP8A 1X1PA 2ZF5O 3G71N 4F8RA 4B3TK 4Z4CA 1FXXA 1YJWN 1Z25A 2RPIA 4Y1CA 3MEGA 4JK9A 2B5JA 3DWLA 4CGDA 4WYBA 4J2EA 3RR8A 3S9HA 3QIOA 3ZSZA 5KRTA 4I7FA 3J7YP 3OYDA 3H3NO 2ZJQL 4DFJA 4DV4K 4A2BA 4LSLA 4E7KA 3LDLA 3AY9A 1P90A 3ALYA 4B9UA 2B6AA 4V19S 4CW7B 4FLXA 4FJMA 3IAYA 3SMSA 5GAGP 3LDNA 3VTIA 2YHYA 4IKFA 2KZZA 4B9SA 3TAFA 1IV0A 4M3ZA 3WEEB 3AGRA 1S3XA 4YOYA 1N32K 1RTHA 3CMAN 1KVAA 2E1YA 3KD1E 3O9SA 4DUYK 3EE8A 2UUAK 3J7AP 3AVNA 3F5TA 4KH5A 1HKCA 3HL8A 4DF8A 1HQUA 3SQ1A 5FROA 1S9GA 4F2RA 4J2DA 1ZYQA 3RMBA 3FZKA 3BGRA 1WLJA 4K8XA 3LM9A 4B8AB 3CCRN 2GWKA 4DTUA 1T6CA 4C23A 3LZIA 4CECA 2UUCK 4IBNA 2QKKA 1P8ZA 4H5VA 4WFBL 2YKMA 2OPPA 3ZSYA 4JI6K 4DSKA 2UU9K 3HM9A 4BRMA 2R7YA 3T1HK 3E66A 1BHLA 3ZSOA 4BRQA 3VQPA 1XUPO 5LJWA 5LMUK 5KTQA 4CZGA 4FWQA 2X74A 1VSEA 3DOKA 3WNFA 4PL8A 3NGIA 1TYQA 4B1ZA 1RT6A 2Z1JA 4NO7A 3DRPA 1XWLA 1WB9A 5C12A 3L3VA 3SAGA 3A0IX 4N56A 3V81A 4BGBA 5LJVA 3CCQN 3T7ZA 3LANA 3RSEB 2P9KB 5C10A 3OYHA 1H1VA 5AQPA 3CFOA 1X9SA 4KI6A 5CZ1A 5J1EA 4B3MK 5AQXA 1QTMA 1TK8A 2P5GA 2DTUA 2PBDA 4BR9A 4HTUA 4ELVA 5JLFA 1KVBA 4WF9L 1NKCA 2A40A 3OJSA 1TUUA 4CGHA 3AO2A 2Y1JA 5HLFA 4DWIA 4MQ3A 1Q8IA 2IS3A 2O8BA 3TABA 3LAMA 4DV0K 4MO4A 2VCPA 3L6QA 1X9JA 1KVCA 4BG9A 3V9WA 2E6LA 4LF5K 1TAUA 1NGHA 4JNEA 3I56N 2RN2A 4CIGA 3GDQA 3V1QA 2YNGA 1S9EA 2EHGA 3OYIA 4PA1A 3MK6A 1YTUA 1NOZA 1C1AA 3MDQA 3QIPA 5LL6Z 1KCFA 3H08A 3HBTA 2O8CA 3C95A 1G99A 3P4IA 4FZYA 4KHSA 3AGKA 2D4WA 3SAFA 1LW0A 1SKRA 1OKJA 2G8KA 4CEDA 4BVOA 4I2PA 4BE2A 3VEVA 2WTUA 1NGBA 1BISA 3PUFA 3AAPA 4CZLA 3OYGA 3OY9A 5FDLA 3HK2A 3IRXA 2P9UA 1HKGA 3IG1A 1W2BM 4CK1A 5JICA 1NK4A 1E3MA 2P9PA 3V9SA 4BC3A 5BR9A 5BN8A 1RT3A 3LALA 3TAEA 1V4TA 3O6WA 4O4GA 3V9UA 3WNGA 2HHSA 3VEYA 4DV2K 3UKRB 1UA0A 4W5OA 4DR4K 5FPNA 3OS1A 4GW6A 1HKBA 3DAWA 1VSFA 4JKBA 4CZHA 4OO1J 1GOBA 2QM1A 3PSFA 1R59O 2QEXN 4CJPA 4BG8A 3SI6A 1Y97A 4H0TB 2QWLA 3H46O 4FWNA 5AQUA 4E7LA 4OLBA 1HYSA 4BRHA 1TVRA 4C8LA 3JSMA 2QK9A 5IWAK 3O9UA 4RW6A 2O8EA 3AVMA 3WXLA 3HOTA 3A5LC 4FJGA 3T19A 3S3NA 3AA3A 4BRFA 1T05A 5CZ2A 2QXLA 3RMCA 1RDBA 1SZ2A 4N5SA 2Q36A 3CJBA 4DTXA 3QEVA 4F3TA 1W9HA 3P39A 1VSLA 4CJ7A 4GKKK 3GE1A 4C1NI 4BWJA 5F2RA 1NK8A 1WSHA 3TARA 3AVFA 1VSHA 1J54A 3U3YA 1BL3A 2QWNA 3K5MA 3TR8A 1BOTO 3FFKB 5T7BA 2VQFK 4FLUA 5KPRA 1RBTA 2DFEA 4E3SA 1ASWA 1MU2A 4CHZA 5AFUA 4DV7K 2P9IA 2O8DA 4KRFA 5AQVA 4O0JA 1WAJA 3TTCA 2W42A 3L0QA 3MN6A 4AM7A 1J5EK 2KKZA 1BQNA 3K9JA 1GLBG 4F9OA 1TV6A 3AO5A 4WQ4A 1C6VA 4B1YB 3HSCA 3VQ7A 2HSTA 4E7JA 3B6OA 3ULEA 1B92A 2JGUA 3VF6A 3JAMO 1X9MA 4IFVA 1QSSA 4I2QA 1RNHA 1IBMK 2A5XA 2FF6A 4KHYA 4ID1A 3VQBA 3OA9A 3M8QA 3QMLA 4QCLA 3HVTA 4PKHA 1XNRK 1U6ZA 3QERA 2QKBA 1ATRA 3P1GA 1RBUA 1NK5A 4JKAA 2F9TA 3AARA 3TTFA 3HJFA 1WAFA 2WFBA 1B9FA 4CGIA 1TKZA 1O1WA 3NVMA 4YFUA 4CZFA 4N41A 1RFQA 1SKWA 3CIPA 5AZIA 5GINA 3QFUA 3MEDA 1RCHA 3ZT2A 1RT2A 4CHOA 2E2PA 3CQXA 4O5BA 4DF4A 5AQJA 4ILGB 4J2AA 3FZMA 3HO1A 4JS4A 2G8UA 2V7ZA 4PWDA 1NGFA 2X6SA 1SL1A 1NU0A 4CBWA 1TYQB 3WNEA 2CGLA 2OA8A 4CJKA 1GLCG 1RDWX 4O8KA 4K0KK 1HNWK 1BUPA 3ZCMA 4HUGA 3SV4A 4OPKA 4FJIA 4NLCA 5TKWA 3ENOA 1FJGK 2V51B 4Z0UA 3CF5L 4AILC 4BC5A 4FJ8A 2OTLN 2JWKA 1BDGA 1CXUA 4JS5A 4OKJA 1VHXA 1DLOA 1ASVA 3HRGA 3P83D 2YHWA 2ZJRL 1OH8A 2FSNA 4KHNA 2F4VK 3TSQA 3L2WA 2QXFA 1ZBUA 1W0HA 2YNFA 3HZ6A 1REVA 4A57A 5KGXA 2IGIA 2O8BB 3VTHA 1QVFM 3CFPA 2BH1A 5HROA 3SMPA 1SL0A 4X66K 1HQEA 4YY3K 4RW8A 3FFIA 1VSKA 3LWMA 1QZ5A 4DFPA 2NRVA 2EWSA 3CHWA 3DLHA 4CZIA 1VSJA 4H0VB 1YAGA 3VETA 5M1PA 3KWGA 4CEBA 1L3SA 1XHXA 5C24A 4CJQA 3M8PA 5JLHA 2O8CB 3CJ9A 1SQKA 5DK5A 5AQKA 4JYAK 1K6YA 1NM1A 2FBTA 3QLHA 3ISNC 4I9QA 2BTFA 2ASMA 4CF1A 4X62K 3TWHA 4M63C 4UQGA 3K2PA 4DV1K 1HJRA 5ADXA 3THWA 5KGWA 2Y1IA 5EVZA 2P9UB 4ISGA 1JCGA 3CETA 1K8KA 1N8RO 2P9PB 4LFCK 4CJUA 2E88A 4FWSA 1YVNA 1GLFO 3N4PA 1N33K 3ZSXA 4DHYA 4IJNA 1IO2A 4HCCA 4Y0WA 4FM1A 3BEXA 3O5BA 3QNOA 2W6LA 2JWLA 4FPAA 3HPHA 3ZX2A 1Z6RA 4FJKA 4Z4HA 3B6PA 2GELA 1E4FT 4CBXA 4RW4A 3VA3A 2E5LK 1JL2A 3AVJA 3DLKA 1KTQA 3VEXA 4CZJA 4IOAL 2Q2RA 1QZ6A 2ETJA 3J8AA 4CFAA 1NKBA 3MXJA 2HHUA 4RCHA 3CPEA 5HRSA 1EXQA 1A5VA 1G15A 4DTNA 2NRHA 4LD0A 2O8EB 1DTQA 2IDOA 2UXCK 5AQLA 4DR7K 4JLHA 4PL7A 4Q5VA 1VSDA 4N47A 2ZWHA 1ZC6A 1RTDA 3S3MA 5CY4A 4B1XB 5J2PA 3C6AA 3OS2A 3A5OC 4CJTA 1TKXA 4U7BA 5BPLA 3FR0A 4KKOA 4EHTA 4FWRA 3TI0A 3SLCA 1JXEA 3KK1A 3C7NA 3NCIA 3D7EO 1CZ9A 1WSGA 4KTWA 4XEIA 4IJAA 5KQ8A 3NH0A 3QEIA 2VG7A 4NCAA 3BY5A 3LM2A 3ZT1A 5AQRA 2IC3A 3AVCA 1S1XA 2O8DB 4KB1A 4FJJA 4DR6K 1GLAG 4BRDA 2XY7A 3CJ1A 4O44A 3AVBA 3NBPA 1GOCA 1D8YA 4DSEA 1VQNN 2F96A 3PV8A 2ASPA 4MDAA 3QESA 4FM2A 4X64K 1TK0A 4B1WB 3CYMA 1IKVA 4BE0A 1N5YA 2XHBA 1WOQA 4GKJK 1SKSA 1IJJA 1ITGA 4CJSA 3WXMB 4NB4A 4CZMA 1LW2A 3OW2M 2HBMA 4LC9B 3TAQA 3ULEB 2E2QA 4NCBA 1HYZA 4F2SA 4E19A 4H0OA 4A2AA 1J9AA 4BR5A 3VQ5A 3DM2A 4B9MA 4DS5A 3OYJA 4BROA 3A5MC 3K5OA 3HYFA 4W5RA 3DLGA 2ZGYA 4CCHA 4M3RA 4DTJA 1VAZA 3CG7A 2ZJPL 1BU6O 4EFHA 1WSEA 1U4BA 4FJ9A 2BUPA 3D6RA 5AZIB 4M42A 4H4MA 3KLFA 1S6QA 4CFDA 3O9QA 5AQNA 4CFCA 1S6PA 4OVLA 2OTJN 3EE9A 4ISFA 3QBWA 2P5OA 3CC4N 1RT7A 4EZ6A 1YJNN 2Q0RA 3I8DA 4F4KA 5FRMA 4FK4A 3DOLA 2CGJA 5HRRA 4KHUA 1I94K 2A6AA 5HRNA 1B9DA 2HHVA 1NGDA 1U2VA 3KK3A 3RWUA 3V6DA 3KK2A 2HHTA 5HOOA 5EOYA 4M3WA 5JMVA 3DLBA 4CHNA 2Q97A 4BY9C 3U9ZA 1RTIA 4A62A 3LWLA 2PAVA 1VSIA 4M45A 3PX0A 4W5QA 3NF8A 3KLHA 2OZMA 3ULDA 4MFBA 4PHTX 5DM7L 4YOWA 2HHQA 3THXA 2E6MA 5AQOA 4YHHK 4B9LA 1JLEA 1XC3A 1HNZK 4DSLA 1MA9B 2RF2A 4YDUA 3THYA 4YOXA 4CEFA 2VG5A 3ID8A 3AVAA 4MO5A 2JLEA 2YJFA 4GNIA 4B08A 5GIPA 1N6QA 4JKEA 2J4RA 3AVLA 1NG9A 2GBZA 3UE5A 4DLEA 4HUFA 1C0GA 3DXMA 1HX1A 3SZ2A 1VQKN 3LDSA 1LAWA 2VGMA 3EO3A 4B9TA 4FJLA 4AHVA 3ZETA 1NLVA 3QFPA 3ZX3A 5AQYA 2CH5A 1X3MA 3VEWA 3NDKA 2G8WA 4DR1K 1VQLN 1DEJA 1WSJA 3IFRA 1GLDG 3MCAB 2W40A 3UKUA 5JVHL 4C8OA 3A2FA 2I7NA 2I5JA 3PO5A 5AQGA 4FJHA 2BE2A 3F9KA 1QQCA 4KB0A 2QA4N 4CF0A 5B8HA 4DQPA 1WSIA 4DFKA 3QEWA 4AQYK 1NK0A 4H8KA 1NMNA 3UIQA 3SV3A 1SV5A 2LSNA 3VQDA 3O4NA 1K8KB 5C0YA 3AO1A 3TANA 1TK5A 4CGGA 1S22A 3SUQA 2CGKA 2BANA 4B3RK 1KAXA 5J2MA 4WCEL 4JKGA 4WFNL 1NJZA 4W5TA 2VWKA 3T1YK 3PSIA 1MWMA 1YIJN 1U48A 4CJEA 3SUNA 1JLFA 3CCEN 1YVUA 4LFBK 3QB0A 4G9ZA 3D2FA 4H5WA 3AVKA 2NZTA 2UUBK 4ELUA 2XO7A 5AQTA 4BR0A 3EZWA 5AQIA 3BZKA 1T6DA 4AF1A 4OKKA 4KI4A 3U3GA 3NHGA 3CCSN 3NAEA 3CCVN 1WBDA 3AO3A 1HNIA 1Y64A 1XMQK 1NJYA 4BGAA 1JCFA 4FYDA 3U9DA 3O8MA 5M1KA 5KPTA 3RVCA 3DXKB 1MWKA 2ZD1A 3V9ZA 4IOCL 3LDOA 1W97L 3H3OB 4M7YA 1BIUA 3U4LA 4FL9A 3C7NB 4GY2B 4H0YB 3HI0A 5A2QO 1R0AA 3O4QA 4HTLA 4E1NA 3QETA 4KHPK 2O4GA 1WBBA 4DQ8A 2YI1A 4LFAK 4ILJA 1S72N 1YITN 4QAGA 3TSUA 5C2FA 5FRNA 1W7AA 3KIOA 4KHQA 3OYCA 1NJXA 4PY5A 4FLWA 4CVNE 2KZMA 3THVA 1TKDA 4EZ9A 3QINA 3EL2A 4B9NA 3NF9A 4OLAA 3IS9A 1SAZA 3D45A 3HVRA 1HPZA 2O8FA 3VGLA 1VQON 5LMNK 1VQ4N 1MDUB 3KJVA 5M1NA 1HJOA 3RRGA 5CHIA 3O9TA 3V1OA 4UY8O 2G8IA 4NXNK 4JAXA 1NJIO 2HHXA 1V4SA 4JKDA 3JYTA 1BQMA 1D4XA 1BGXT 2FBVA 4FO0A 4A59A 1DGKN 3R6MA 1SS6A 4C8MA 4AHTA 1IBKK 2Q0UA 4IG3A 3ZEUA 4Q0BA 4CIEA 4RWTA 1U04A 3VGKA 5CE3A 4ISEA 3SAHA 4WE1A 2D1KA 3MN9A 3J7ZO 1ESVA 2D0AA 1LAVA 4ID5A 4CIFA 3VESA 3L8BA 1NGCA 4B9QA 5H1SQ 4FSVA 1KAYA 4O5FA 4I9LA 4PQUA 2YHAA 3G6EN 3RMAA 4G1QA 2QWPA 5AZJA 3HT3A 3QO9A 1U2VB 3UB5A 1Z26A 5E26A 4OPHA 2FC0A 3AA5X 3VEOA 2HHWA 1L3TA 3OBWA 1S1TA 3BF1A 2IIRA 2FSJA 4H5RA 5JS1A 2D0OA 1Q82O 2HW3A 4NXMK 4CK3A 2A1RA 3P31A 4JI5K 3R3LA 1T3VA 3F9MA 2H3GX 3BZCA 2FXUA 3G25A 5C2DA 1FKPA 3VPZA 4FWKA 2VQEK 4GMJB 3THXB 1BWFO 3PO4A 4FK0A 2Q31A 5K14A 3WEEA 4ZTJA 1JCEA 3VGMA 2IVPA 2Q3SA 2PYLA 2ZE2A 2HF4A 4YOVA 1YTAA 2YHXA 3THYB 4WQ5C 4LH5A 3F2KA 3DLRA 4CJRA 5IT9O 3ZYYX 4DS4A 1ZBSA 3I0RA 3NFAA 3P5JA 3NGYA 4H5NA 4DR2K 4BDPA 4JK7A 1LWCA 1IG9A 2CH6A 3C0BA 3H1QA 4FJ7A 3VA0A 2HNDA 5EY4A 4OKEA 3K59A 2DPNA 1BIZA 4QS8A 2F9WA 2Z1GA 3WT0A 3TAGA 1IH7A 3W3DA 2X78A 3ZETB 2V52B 1GLJO 4Z4GA 1S1WA 1ZBLA 4DV5K 3G4SN 1T7PA 4KBOA 1M1KO 5EXWA 3WQUA 1XHZA 3DRRA 3WXIA 2QWQA 3UKUB 4BDYA 3U6FA 3O1BA 4BRPA 2FF3B 3OYMA 2HF3A 3N4QA 3O80A 3OYBA 3CXCM 4BWMA 1EO1A 4CEZA 4K42A 4DB3A 1U47A 5CR4A 5AQSA 1NWKA 5CYQA 4M3TA 3I0SA 1Q18A 4B9VA 3HOSA 4M7XA 4DG1A 1KD1O 3ZSQA 3I55N 2YNHA 4FCYA 1JKHA 4BC4A 4BRCA 1T44A 4B1VA 4DV6K 4NYFA 4M3UA 1I39A 3VQAA 4JRQA 3HM8A 4CZEA 3SJHA 2OPQA 4R5PA 4E7IA 1IKWA 5BN9A 4CJWA 1QE1A 1JLGA 1JLAA 1RGIA 4CJ4A 3OJUA 2QWOA 4DCHA 4JKGB 3VQQA 3CCJN 4IFYA 5AFUH 3DJCA 4FVUA 3QDKA 2XY8A 1LWEA 1JLBA 1ILYA 2E2OA 4M3YA 4Y1DA
chains in the Genus database with same CATH topology
3CJCA 2ZGYA 3HBTA 4CD1A 3D2FB 3O4WA 3M6GA 3TU5A 3CJ7A 1G99A 3MWTA 3P4IA 1J6ZA 1VAZA 3FE1A 2ZJPL 2QTDA 4IO9L 1BU6O 1NGEA 4JKCA 3AGKA 4EFHA 2D4WA 2E1ZA 3R8EA 2NLXA 2WUSA 3S41A 3SAFA 2BUPA 1YF5L 3D6RA 5AZIB 1OKJA 3IDHA 4BVOA 3VEVA 1QQOA 3O9QA 1ATNA 5AQNA 5JVGL 5AR0A 2OTJN 1NGBA 1KXPA 3BF3A 3EE9A 5M1OA 5BRDA 3QBWA 1DKGD 4ISFA 5DM6L 2UYTA 2FSKA 2PFUA 3CC4N 5AQZA 3AAPA 4CZLA 5BRFA 1YJNN 4K41A 2Q0RA 5FPMA 3CMEN 4BQLA 3MN5A 4QS9A 3WXJA 3EKSA 2KHOA 2P9UA 1HKGA 2CGJA 3KZBA 1W2BM 5JICA 2A6AA 2P9PA 3FGUA 4XH5A 1NGDA 1U2VA 4BC3A 5BR9A 2HMPA 5BN8A 1HLUA 2WBNA 1V4TA 3O6WA 1NGIA 5AQQA 5HOOA 5EOYA 2NRXA 3SBTA 1VQ7N 3FZFA 3VOVA 5AQFA 2QWMA 5JMVA 3VEYA 5FPEA 3UKRB 2Q97A 4BY9C 4A61A 1K8AO 3U9ZA 2GUPA 5FPNA 4J8FA 2QW9A 4JEPA 3CCMN 2YJEA 4A62A 2PAVA 4ILHA 3KK7A 3TSPA 1HKBA 3VERA 4CZKA 4PHTX 3DAWA 4BC2A 3MN7A 4JKBA 4CZHA 3ENHA 1KQSM 3A8YA 4OO1J 1EQYA 4H0PA 2QM1A 2P9LB 3L4IA 2YX6A 3Q7BA 4IZ9A 4JKHA 1VQ5N 3H45C 4A5AA 5DM7L 4YOWA 1R59O 4IEEA 2QEXN 3LDQA 1Q7YO 3TPQA 4JHDB 5AQOA 3DXMB 4BG8A 4BRIA 4BR7A 4H0TB 2QWLA 3A5NC 4H0XB 3H46O 1XC3A 4FWNA 1NBWA 4EHUA 5AQUA 1MA9B 1YXQA 4YDUA 4OPAA 4EIAA 1WUAA 4YOXA 1JJ2M 4BRHA 2P9SA 1ZXOA 3ID8A 4Z94A 3VF2A 3E1YA 3O9UA 4MO5A 3WXLA 4BRLA 3CJAA 3MCPA 3HOTA 4K43A 3A5LC 3JXUA 5AQHA 2YJFA 4GNIA 5GIPA 4JKEA 3PIPL 2J4RA 5F0XA 4BRFA 4BRGA 4O8UA 3UE5A 4MLHA 1C0GA 2QXLA 3DXMA 1HX1A 1K73O 1VQKN 3T69A 3K9KA 5TKYA 1BG3A 2P9IB 1SZ2A 2VGMA 3D2EA 3EO3A 2Q36A 3CJBA 3ZETA 1NLVA 3QFPA 3ZX3A 4FPBA 1ILYA 5AQYA 3C65A 3P39A 2CH5A 1X3MA 3VEWA 4DKWA 4K25A 4CJ7A 1VQLN 1DEJA 1QHAA 3GE1A 3GL1A 3Q7CA 3EN9A 4C1NI 1YI2N 3IFRA 2HBJA 1GLDG 3ATUA 3MCAB 5F2RA 2W40A 4C1NK 4R79A 1C0FA 3ZX0A 1E4GT 3VF4A 1IG8A 3UKUA 5JVHL 2I7NA 2QWNA 3MX2A 4FOEA 5FPDA 1BA0A 3GOIA 5AQGA 1BOTO 1LCUA 2P9KA 2Q1NA 3FFKB 3RSEA 5KPRA 1VQ9N 1Q86O 3ZEUB 4BRNA 1YJ9N 5AFUA 4NLBA 1BA1A 2P9IA 2QA4N 5B8HA 1QVGM 5AQWA 5AQVA 3WQTA 3TTCA 4I6MA 4BR4A 1HPMA 3GG4A 3L0QA 3MN6A 3ATVA 1GLLO 4AM7A 2KKZA 4JD2A 5HL7L 2NRWA 4YOTA 5BPMA 3K9JA 3O9RA 1GLBG 4F9OA 1O13A 2NRRA 4YORA 2P9NB 1K8KB 3EKUA 5AZJB 4WQ4A 5C0YA 4B1YB 3HSCA 2HSTA 5GADP 3VENA 1S22A 2CGKA 3ULEA 3O1WA 3VF6A 4A5BA 1KAXA 1YUWA 2D0PA 5GAHP 2KLAA 4WCEL 4H03B 3QBXA 4JKGA 4WFNL 2HBLA 4MLEA 4WQ4C 2A5XA 2FF6A 4GV6A 3OA9A 3M5RA 3QMLA 5ELZA 5KQDA 1NGJA 4GVEA 4PKHA 1U6ZA 2QWRA 1MWMA 1YIJN 1HUXA 1ATRA 1QQMA 1GLEG 4JKAA 2F9TA 3CCEN 4WFAL 3GBTA 3QB0A 3AARA 4G9ZA 2E2NA 3D2FA 4H5WA 3TTFA 4JKFA 4B1UB 2NZTA 5ADXH 2WFBA 4EAHD 4FWOA 5AQTA 4BR0A 4CD3A 3EZWA 3DLLL 2I7PA 3I8BA 3LDPA 3NVMA 5AQIA 3PIOL 4CZFA 1RFQA 4IXCA 5I9EB 2NRZA 3CIPA 3IKMA 5AZIA 5GINA 1T6DA 3QFUA 3CC7N 3M3ZA 4AF1A 3CCLN 5M1QA 2ITMA 4IO8A 2E2PA 3CCSN 3CQXA 3CCVN 5AQJA 4ILGB 5BRHA 1M90O 3WXKA 3FZMA 2YCHA 1CZAN 1Y64A 2GWJA 2V7ZA 4BR2A 4H5TA 4BGAA 1JCFA 3U9DA 3SK3A 1K9MO 3O8MA 5M1KA 1NGFA 5GIOA 5GAEP 5KPTA 3FZLA 4AM6A 4CBWA 1TYQB 2CGLA 1Z05A 2V7YA 4L3QA 3O08A 4FWLA 3RVCA 3DXKB 1MWKA 4GV3A 1GLCG 1RDWX 1TUYA 4O8KA 1BUPA 4IOCL 3LDOA 4XH1A 1W97L 1VQ8N 3KVGA 4IDHA 3H3OB 2E8AA 4M7YA 3U4LA 3UKRA 4FL9A 2WC9A 3C7NB 4GY2B 4H0YB 3HI0A 4NLCA 5TKWA 3ENOA 4HTLA 2A3ZA 3VMFB 2V51B 3CF5L 4IOXA 4BC5A 5AQMA 1VQMN 3PLAA 3NVKA 2OTLN 4DQ8A 1BO5O 1BDGA 2JWKA 2YI1A 3BUZB 4IEIA 3U8XA 3NMUA 2ASOA 4ILJA 2P9LA 3HRGA 4KH4A 1S72N 2YHWA 4BRKA 1YITN 3TSUA 5BREA 4JHDA 2ZJRL 2GX9A 2FSNA 3DXKA 5C2FA 3TSQA 1OVYA 2QI2A 3M1FA 3KHYA 2OANA 1KC8O 3HZ6A 2ZGZA 4A57A 4IFEA 4FOIA 3CC2N 2AP1A 4YOUA 5MLCQ 3P38A 3VTHA 1QVFM 2BH1A 5C15A 3EL2A 3MX5A 3SMPA 1SAZA 2IVNA 3VGLA 5E84A 4JK8A 1VQON 4KH6A 1VQ4N 1MDUB 3E9LA 4QS7A 5M1NA 1HJOA 3CI5A 5EX5A 4IWVA 3BP8A 5CHIA 3O9TA 4UY8O 2ZF5O 1QZ5A 3G71N 4JAXA 1NJIO 2NRVA 2EWSA 3C6HA 3CHWA 3FLCO 1YJWN 1Q81O 4CZIA 4H0VB 4JK9A 1V4SA 1YAGA 3DWLA 3VETA 4WYBA 5M1PA 4JKDA 3KWGA 3VEZA 1D4XA 5JLHA 4FO0A 4A59A 1DGKN 2GTDA 3CJ9A 3R6MA 1SQKA 3MMVA 2A42A 1SS6A 5AQKA 2Q0UA 2F7TA 3IUCA 3ZEUA 1NM1A 3H3NO 5KPZA 1DT9A 2ZJQL 3IMXA 4RWTA 4A2BA 3H6EA 3VGKA 2VGNA 3CERA 4ISEA 3LDLA 5CE3A 3SAHA 1X3NA 2ASMA 2BTFA 2D1KA 1ESVA 3AY9A 3MN9A 1XQSC 1P90A 3J7ZO 3CD6N 3R9PA 4M63C 2NRTA 3VESA 3AAQA 5ADXA 1NGCA 4RTFD 3SMSA 4B9QA 5GAGP 5H1SQ 3LDNA 3VTIA 3JS6A 1KAYA 4FSVA 4O5FA 2E20A 5EVZA 2P9UB 2YHYA 4ISGA 3G6EN 2QWPA 1JCGA 2HBKA 3CETA 2P9NA 1K8KA 5AZJA 1N8RO 4HWIA 2P9PB 1U2VB 3UB5A 4CBUA 5E26A 4OPHA 3WEEB 2A41A 3AGRA 3VEOA 1S3XA 4YOYA 2E88A 3OBWA 4FWSA 4XH4A 5LY3A 1YVNA 3CMAN 2E1YA 3BF1A 3O9SA 1NGAA 3ENBA 1GLFO 3EE8A 2IIRA 3N4PA 2FSJA 4H5RA 1VQ6N 2D0OA 1Q82O 4DHYA 3CCUN 3F5TA 4IJNA 4Y0WA 4KH5A 1HKCA 3P31A 2GEMA 3BEXA 3O5BA 3R3LA 1T3VA 3F9MA 2H3GX 2JWLA 2FXUA 3G25A 5C2DA 4FPAA 3MWPA 3VPZA 3FZKA 4WQ5A 4FWKA 3ZX2A 1Z6RA 4GV9A 2VWBA 1BWFO 2GELA 1E4FT 5F1XA 2Q31A 4CBXA 3WEEA 5C10A 1JCEA 3LM9A 3CCRN 4JN4A 3WUHA 2GWKA 2IVPA 3VGMA 3R1XA 3VEXA 4CZJA 2Q2RA 4IOAL 1T6CA 1QZ6A 2HF4A 4C23A 4YOVA 2YHXA 3J8AA 4PKGA 4WQ5C 3F2KA 3TTDA 4RCHA 3CPEA 2P9SB 1P8ZA 4H5VA 4WFBL 3CQYA 2NRHA 3ZYYX 1ZBSA 4H5NA 5AQLA 4BRMA 4JK7A 4PL7A 3E66A 1VQPN 3CPWM 4BRQA 1XUPO 2CH6A 2ZWHA 5LJWA 1ZC6A 4CZGA 3C0BA 3H1QA 2RE2A 4FWQA 3HTVA 3SBGA 3OBYA 4PL8A 4U67L 5EY4A 1TYQA 4B1XB 2DPNA 4B1ZA 4QS8A 3C6AA 2F9WA 3A5OC 3D2EB 3WT0A 5BPNA 3W3DA 4MDBA 3ZETB 4U7BA 5BPLA 2V52B 1GLJO 1ATSA 3FR0A 4NO7A 4EHTA 4FWRA 3QICA 3SLCA 3G4SN 3C7NA 3H1VX 4KBOA 1M1KO 5EXWA 3WQUA 2VYPA 5C12A 2NNWA 3SAGA 3WXIA 3A0IX 2QWQA 2RHKA 3D7EO 3UKUB 4YDUC 4BGBA 5LJVA 3O1BA 3CCQN 4BRPA 4XEIA 4IJAA 3T7ZA 3W0LA 2FF3B 5KQ8A 2HF3A 2P9KB 3RSEB 3LM2A 1NGGA 1H1VA 3N4QA 3O80A 5AQPA 5AQRA 4BRAA 1LOTB 3CXCM 1YHQN 1EO1A 4K42A 4DB3A 3B8AX 3OHRA 1GLAG 5CR4A 1NWKA 5AQXA 5AQSA 1QQNA 3CJ1A 1Q18A 4BRDA 4E1JA 1RDUA 3HOSA 4I6MB 2PBDA 4M7XA 4BR9A 1VQNN 5JLFA 1KD1O 4WF9L 3I55N 2A40A 2ASPA 4MDAA 2W41A 4BC4A 1TUUA 4BRCA 1T44A 4JD2B 3ID6A 3LL3A 2HOEA 4CI6A 4FWPA 4B1VA 4BVPA 4BREA 4B1WB 1WOQA 1IJJA 4MO4A 2VCPA 3HM8A 3L6QA 3WXMB 4NB4A 3SJHA 4CZEA 4CZMA 5M1FA 2FLOA 1X9JA 4BG9A 3OW2M 3KWIA 2HBMA 4LC9B 5BN9A 3ULEB 3I33A 2E2QA 1NGHA 4JNEA 2AA4A 3I56N 3FZHA 4BQZA 1RGIA 2IVOA 4H0OA 2QWOA 3GDQA 4FWMA 4DCHA 1NMDA 4JKGB 3CCJN 4FVUA 4A2AA 5AFUH 3DJCA 4BR5A 3QDKA 3L4QA 3MK6A 3E9PA 1KAZA 3MDQA 4BROA 3A5MC 2E2OA 4PKIA 3E9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WFB A;  1T3V A;  1O13 A;  2QTD A;  1RDU A;  2KLA A;  1EO1 A;  1P90 A;  2YX6 A;  2RE2 A; 
#chains in the Genus database with same CATH topology
 3CM6 A;  3QEP A;  4CD1 A;  1NK7 A;  3D2F B;  3O4W A;  1U45 A;  3M6G A;  4B3O A;  3C6U A;  3TU5 A;  4OPJ A;  4IO9 L;  5I42 A;  2OZS A;  1N36 K;  1NGE A;  1RDC A;  4JKC A;  2WUS A;  5HP1 A;  4FM0 A;  3IDH A;  1L3V A;  3J81 O;  3O3H A;  5JVG L;  4N76 A;  4FW1 A;  5AR0 A;  3BF3 A;  5BRD A;  5M1O A;  3WNH A;  4Z4F A;  1DKG D;  1RT5 A;  5DM6 L;  2FSK A;  2PFU A;  5AQZ A;  5BRF A;  2G8V A;  5FPM A;  3MN5 A;  2KHO A;  4PUO A;  3KZB A;  3SUP A;  3ASM A;  3FGU A;  4XH5 A;  1HLU A;  2RKI A;  2WBN A;  4DSJ A;  2A1S A;  1VQ7 N;  5SWM A;  4DQS A;  3FZF A;  2HVH A;  3ZT3 A;  4E7H A;  1QSY A;  4A61 A;  4J8F A;  5E41 A;  1EX4 A;  4JI2 K;  1T03 A;  4FJN A;  3TSP A;  3VER A;  4CZK A;  2IOC A;  1KQS M;  3A8Y A;  4H0P A;  3KKS A;  2YX6 A;  4IZ9 A;  1VQ5 N;  4IEE A;  3PX6 A;  1Q7Y O;  4CEE A;  3TPQ A;  4BR7 A;  4H0X B;  4ZTF A;  3S3O A;  1NBW A;  4EHU A;  4OPA A;  3QNN A;  3L2V A;  1WUA A;  4E1M A;  3KLI A;  2P9S A;  4E0D A;  3T1A A;  4Z94 A;  4OJR A;  2F8T A;  4ZHR A;  3E1Y A;  3TAM A;  1XI1 A;  4DUZ K;  3AVI A;  3CJA A;  3MCP A;  4K43 A;  5AQH A;  2O8F B;  4H4O A;  4BRG A;  4TSX A;  4MLH A;  3VN5 A;  4KAZ A;  3CM5 A;  3K9K A;  3V9X A;  4LF4 K;  2P9I B;  4FXD A;  3LP0 A;  3D2E A;  3KTQ A;  4FJX A;  1QHA A;  3F73 A;  3EN9 A;  2HBJ A;  3ATU A;  1RIL A;  3L2Q A;  2G8F A;  1C0F A;  3ZX0 A;  1E4G T;  5C25 A;  1JL1 A;  4K8Z A;  1VSM A;  4Z4I A;  1IG8 A;  3HXM A;  1NKE A;  5KI6 A;  2PZS A;  4JRP A;  3MX2 A;  3GOI A;  3ZEU B;  1KLM A;  3OYA A;  4NLB A;  1QVG M;  5AQW A;  4KFB A;  4I6M A;  1HPM A;  3GG4 A;  4HHT A;  3AO4 A;  1GLL O;  3RRH A;  3K57 A;  1OH5 A;  2OPR A;  1LWF A;  4JD2 A;  5HL7 L;  2NRW A;  5BPM A;  3O9R A;  1Q9Y A;  4BAC A;  4JI7 K;  1VK0 A;  2NRR A;  3SJJ A;  4YOR A;  5AZJ B;  3NGZ A;  2YKN A;  5GAD P;  4DV3 K;  3K5N A;  3QEX A;  4J2B A;  4A5B A;  4DSF A;  1YUW A;  2D0P A;  5GAH P;  2KLA A;  4H03 B;  3QBX A;  4MLE A;  1ZBF A;  3K0S A;  4LF9 K;  3M5R A;  5ELZ A;  4DSI A;  3NF7 A;  4GVE A;  1ZBI A;  4RW7 A;  3ZSR A;  1C1B A;  1GLE G;  4WFA L;  3GBT A;  1NJW A;  4GVM A;  2E2N A;  3ZT4 A;  4B1U B;  5ADX H;  3M8S A;  4EAH D;  4DLG A;  5AJ3 K;  4CD3 A;  2I7P A;  3I8B A;  3NH1 A;  4IXC A;  5I9E B;  3DLE A;  3PY8 A;  3IKM A;  1NK9 A;  4DQI A;  2FBX A;  1S1U A;  3LPT A;  3M3Z A;  3CCL N;  5M1Q A;  2ITM A;  4CFB A;  1N34 K;  2O4I A;  1M90 O;  5BRH A;  2YCH A;  3G0Z A;  5HBM A;  4BR2 A;  4H5T A;  4KO0 A;  3SK3 A;  5GIO A;  1X9W A;  5GAE P;  3FZL A;  2FBY A;  2V7Y A;  3O08 A;  2ZQB A;  2Z1H A;  1TUY A;  1J5O A;  2WON A;  4XH1 A;  1C0U A;  1JXB A;  1VQ8 N;  3KVG A;  2E8A A;  5D3G A;  2WC9 A;  4FZX C;  3RR7 A;  1TAQ A;  3ZSV A;  4M3X A;  2A3Z A;  1BI4 A;  2GUI A;  2HB5 A;  3LP1 A;  1VQM N;  1KFS A;  5BR8 K;  1BO5 O;  3BUZ B;  3U8X A;  3NMU A;  1IKX A;  3OTO K;  4CJL A;  4DTO A;  4RW9 A;  2ASO A;  2P9L A;  4XIU A;  4BRK A;  3AA4 A;  5BRE A;  4JHD A;  2GX9 A;  1TL1 A;  3VQ4 A;  3AVG A;  2YHB A;  4AHR A;  1TGO A;  2QI2 A;  4CGJ A;  3KHY A;  2OAN A;  1KC8 O;  1ZBH A;  2PYJ A;  4EP5 A;  2XRI A;  3NH2 A;  2VWJ A;  3OVN A;  4IFE A;  4FOI A;  5MLC Q;  1QSL A;  4L8R B;  1YT3 A;  3MX5 A;  2XY6 A;  5E84 A;  4DTP A;  4JK8 A;  4KH6 A;  5SZT A;  3E9L A;  4QS7 A;  3CI5 A;  5EX5 A;  1GOA A;  4IWV A;  3DI6 A;  3OYN A;  3SQ4 A;  3C6H A;  3FLC O;  4CF2 A;  3LP2 A;  1CXQ A;  1Q81 O;  3VEZ A;  4BE1 A;  3ZSW A;  3THW B;  4FW2 A;  3HST B;  1CZB A;  2GTD A;  3SUO A;  4CHQ A;  3MMV A;  2A42 A;  5I3U A;  2F7T A;  3IUC A;  5KPZ A;  1DT9 A;  3IMX A;  1U49 A;  1SL2 A;  3H6E A;  3RMD A;  2VGN A;  3CER A;  1X3N A;  5C42 A;  3CD6 N;  2VG6 A;  1XQS C;  3R9P A;  2KFZ A;  3LAK A;  4C8N A;  3EY1 A;  2NRT A;  2KQ2 A;  3AAQ A;  4RTF D;  4FK2 A;  3JS6 A;  2E20 A;  1A5W A;  4CES A;  1D9D A;  2HBK A;  1NOY A;  2P9N A;  4HWI A;  4O55 A;  3T3F A;  4CBU A;  1Q9X A;  2A41 A;  1RDD A;  3SPY A;  4XH4 A;  5LY3 A;  3MEE A;  4KHW A;  2BGG A;  3NF6 A;  1NGA A;  3ENB A;  1VQ6 N;  3CCU N;  2UXB K;  1BCM A;  3L2R A;  1D9F A;  1EP4 A;  1J53 A;  2GEM A;  4JI4 K;  2OCE A;  4LSN A;  4DR5 K;  3MWP A;  4WQ5 A;  3LPU A;  1C0T A;  4GV9 A;  2VWB A;  5F1X A;  1BCO A;  1RT4 A;  1DTT A;  3HPG A;  4M41 A;  4JN4 A;  3WUH A;  1ASU A;  3R1X A;  2P51 A;  4X65 K;  4PKG A;  3HPO A;  3TTD A;  2P9S B;  3C6T A;  1UA1 A;  3CQY A;  4AHU A;  1EET A;  4JI0 K;  1WNS A;  3ZT0 A;  4ELT A;  1VQP N;  3CPW M;  4CF8 A;  2GV9 A;  5KRS A;  1C1C A;  2RE2 A;  3HTV A;  3SBG A;  3OBY A;  4JI3 K;  4U67 L;  2IAJ A;  3NE6 A;  3D2E B;  5BPN A;  4RG8 A;  4MDB A;  4CEO A;  1ATS A;  3VQ9 A;  1KSP A;  3M8R A;  3VQ6 A;  3AA2 A;  3QIC A;  3OYE A;  2UXD K;  3H1V X;  1EWQ A;  2VYP A;  3KLG A;  2NNW A;  2RHK A;  4CHY A;  2AJQ A;  4YDU C;  3SCX A;  1XC9 A;  1OH6 A;  3W0L A;  1FW6 A;  1NGG A;  4BRA A;  1LOT B;  1YHQ N;  2D0B A;  3B8A X;  3OHR A;  2ZM6 K;  3LP3 A;  1QQN A;  4E1J A;  1RDU A;  1XMO K;  1OH7 A;  4I6M B;  4OX9 K;  4OGC A;  4NYN A;  4IDK A;  1NNE A;  2W41 A;  4JD2 B;  3ID6 A;  3LL3 A;  2HOE A;  4CI6 A;  4FWP A;  4BVP A;  2P1J A;  4BRE A;  4CEA A;  5CYM A;  2Z1I A;  4B8C A;  4IG0 A;  5FLX O;  5M1F A;  4BDZ A;  2FLO A;  2DFF A;  4DMN A;  3KWI A;  2BDP A;  3EEQ A;  3I33 A;  2AA4 A;  3FZH A;  4FLY A;  4BQZ A;  2IVO A;  3TAP A;  2HVI A;  4FWM A;  3V1R A;  1NMD A;  1T8E A;  4OGE A;  1LV5 A;  4CGF A;  3L4Q A;  3C94 A;  2NUB A;  2WOM A;  1KAZ A;  3E9P A;  2W6K A;  3KKR A;  2PY5 A;  4JV5 K;  4CER A;  4QOZ B;  4FLV A;  4PKI A;  3E9O A;  1TKT A;  3CJC A;  4FLT A;  4DU3 A;  3V4I A;  3CJ7 A;  4DTR A;  3K58 A;  3MWT A;  1J6Z A;  3FE1 A;  2QTD A;  2OYQ A;  3L3U A;  1UWB A;  1IBL K;  4LY7 A;  2E1Z A;  2HHH K;  3R8E A;  2NLX A;  3S41 A;  2ITG A;  1YF5 L;  5DMR A;  1SUQ A;  4DU1 A;  4AHS A;  1QQO A;  1ATN A;  4NCG A;  1CLQ A;  4DQR A;  4CEQ A;  1KXP A;  2UYT A;  3O3G A;  1QHT A;  2EX3 A;  4DU4 A;  2E4L A;  2ATQ A;  4K41 A;  2KFN A;  3CME N;  4BQL A;  5J2N A;  4QS9 A;  3WXJ A;  3EKS A;  3DMJ A;  2HMP A;  1NGI A;  5AQQ A;  1D5A A;  2NRX A;  3SBT A;  3DYA A;  3VOV A;  5AQF A;  2QWM A;  4HUE A;  4DTM A;  5FPE A;  2G8H A;  4DR3 K;  1TL3 A;  1OVQ A;  1K8A O;  2GUP A;  3CCM N;  2QW9 A;  4JEP A;  2YJE A;  2KW4 A;  1BI4 B;  4ILH A;  3KLE A;  3KK7 A;  1I3A A;  3EZ5 A;  1WN7 A;  3BDP A;  4BC2 A;  3MN7 A;  3OYL A;  3ENH A;  1EQY A;  4CF9 A;  2P9L B;  3L4I A;  3Q7B A;  4JKH A;  3H45 C;  4A5A A;  3LDQ A;  2B4J A;  4JHD B;  2KTQ A;  3DXM B;  4BRI A;  4C8K A;  3A5N C;  5JS2 A;  1YXQ A;  4EIA A;  1JJ2 M;  1JLQ A;  1ZXO A;  4CJV A;  3VF2 A;  4ICL A;  1S5J A;  4BRL A;  1KLN A;  4AH9 A;  3EYZ A;  4DQQ A;  3JXU A;  3AV9 A;  4HCB A;  3PIP L;  5F0X A;  4O8U A;  3KD5 E;  1K73 O;  3T69 A;  5TKY A;  1BG3 A;  3K5L A;  1RBR A;  1RBV A;  4FPB A;  3OYK A;  1HRH A;  3C65 A;  3SQ0 A;  1HNV A;  4DKW A;  4K25 A;  3GL1 A;  3Q7C A;  1YI2 N;  4FJ5 A;  4C1N K;  4R79 A;  3E01 A;  4CK2 A;  1QS4 A;  3VF4 A;  1KRP A;  1HR0 K;  4FOE A;  5FPD A;  1BA0 A;  1LCU A;  2P9K A;  2Q1N A;  3RSE A;  1VQ9 N;  3MXM A;  1Q86 O;  4BRN A;  1YJ9 N;  1RT1 A;  1BA1 A;  4CE9 A;  3HP6 A;  3WQT A;  2YNI A;  4CJ3 A;  3O3F A;  4HVJ A;  4BR4 A;  5J2Q A;  3ATV A;  4LH4 A;  4YOT A;  1O13 A;  1RTJ A;  2P9N B;  3EKU A;  1L3U A;  1HMV A;  4JI1 K;  2YV0 X;  1F21 A;  3VEN A;  3O1W A;  4FVM A;  2D5R A;  1RBS A;  3MXI A;  2HBL A;  4E89 A;  4WQ4 C;  3OS0 A;  4GV6 A;  5KQD A;  1NGJ A;  2XY5 A;  2QWR A;  1HUX A;  1QQM A;  1S1V A;  3MAQ A;  2DY4 A;  4JKF A;  4CJF A;  4CHP A;  4DTS A;  4LF6 K;  4FWO A;  3SQ2 A;  1EKE A;  1UOC A;  1UAX A;  3DLL L;  4LF7 K;  3L2U A;  3PIO L;  1A5X A;  3LDP A;  4YNQ A;  3CQ8 A;  2DFH A;  1HNX K;  2F8S A;  2NRZ A;  3G10 A;  3CC7 N;  4IO8 A;  4EP4 A;  4AHC A;  4W5N A;  1IKY A;  4B3S K;  3WXK A;  1CZA N;  4JI8 K;  2HNY A;  1NK6 A;  2GWJ A;  4KTQ A;  1VRT A;  1FKO A;  3VQC A;  4DFM A;  3VQ8 A;  3D0P A;  1K9M O;  4KRE A;  1XNQ K;  1VRU A;  4KTZ A;  4KV8 A;  4FZZ A;  4AM6 A;  1Z05 A;  4L3Q A;  4FWL A;  3HP9 A;  4GV3 A;  3VQE A;  2OPS A;  1FK9 A;  1KFD A;  4IDH A;  3UKR A;  2X6N A;  5HRP A;  3VMF B;  1JLC A;  1L5U A;  4IOX A;  5AQM A;  3J80 O;  3PLA A;  3PX4 A;  3NVK A;  1C0M A;  4IEI A;  4FLZ A;  3MEC A;  3LZJ A;  4KH4 A;  1RDA A;  3ZLJ A;  2D0C A;  3AVH A;  4CJ5 A;  4Z4E A;  3SPZ A;  3DXK A;  5EU7 A;  1OVY A;  3M1F A;  1HYV A;  1WSF A;  2ZGZ A;  4F3O A;  2HMI A;  4KPY A;  3CC2 N;  2AP1 A;  4YOU A;  4LF8 K;  3P38 A;  3SNN A;  1EWR A;  5C15 A;  3OYF A;  3ITH A;  2HNZ A;  3SYZ A;  2IVN A;  4O0I A;  3RTV A;  3DRS A;  3CFR A;  3BP8 A;  1X1P A;  2ZF5 O;  3G71 N;  4F8R A;  4B3T K;  4Z4C A;  1FXX A;  1YJW N;  1Z25 A;  2RPI A;  4Y1C A;  3MEG A;  4JK9 A;  2B5J A;  3DWL A;  4CGD A;  4WYB A;  4J2E A;  3RR8 A;  3S9H A;  3QIO A;  3ZSZ A;  5KRT A;  4I7F A;  3J7Y P;  3OYD A;  3H3N O;  2ZJQ L;  4DFJ A;  4DV4 K;  4A2B A;  4LSL A;  4E7K A;  3LDL A;  3AY9 A;  1P90 A;  3ALY A;  4B9U A;  2B6A A;  4V19 S;  4CW7 B;  4FLX A;  4FJM A;  3IAY A;  3SMS A;  5GAG P;  3LDN A;  3VTI A;  2YHY A;  4IKF A;  2KZZ A;  4B9S A;  3TAF A;  1IV0 A;  4M3Z A;  3WEE B;  3AGR A;  1S3X A;  4YOY A;  1N32 K;  1RTH A;  3CMA N;  1KVA A;  2E1Y A;  3KD1 E;  3O9S A;  4DUY K;  3EE8 A;  2UUA K;  3J7A P;  3AVN A;  3F5T A;  4KH5 A;  1HKC A;  3HL8 A;  4DF8 A;  1HQU A;  3SQ1 A;  5FRO A;  1S9G A;  4F2R A;  4J2D A;  1ZYQ A;  3RMB A;  3FZK A;  3BGR A;  1WLJ A;  4K8X A;  3LM9 A;  4B8A B;  3CCR N;  2GWK A;  4DTU A;  1T6C A;  4C23 A;  3LZI A;  4CEC A;  2UUC K;  4IBN A;  2QKK A;  1P8Z A;  4H5V A;  4WFB L;  2YKM A;  2OPP A;  3ZSY A;  4JI6 K;  4DSK A;  2UU9 K;  3HM9 A;  4BRM A;  2R7Y A;  3T1H K;  3E66 A;  1BHL A;  3ZSO A;  4BRQ A;  3VQP A;  1XUP O;  5LJW A;  5LMU K;  5KTQ A;  4CZG A;  4FWQ A;  2X74 A;  1VSE A;  3DOK A;  3WNF A;  4PL8 A;  3NGI A;  1TYQ A;  4B1Z A;  1RT6 A;  2Z1J A;  4NO7 A;  3DRP A;  1XWL A;  1WB9 A;  5C12 A;  3L3V A;  3SAG A;  3A0I X;  4N56 A;  3V81 A;  4BGB A;  5LJV A;  3CCQ N;  3T7Z A;  3LAN A;  3RSE B;  2P9K B;  5C10 A;  3OYH A;  1H1V A;  5AQP A;  3CFO A;  1X9S A;  4KI6 A;  5CZ1 A;  5J1E A;  4B3M K;  5AQX A;  1QTM A;  1TK8 A;  2P5G A;  2DTU A;  2PBD A;  4BR9 A;  4HTU A;  4ELV A;  5JLF A;  1KVB A;  4WF9 L;  1NKC A;  2A40 A;  3OJS A;  1TUU A;  4CGH A;  3AO2 A;  2Y1J A;  5HLF A;  4DWI A;  4MQ3 A;  1Q8I A;  2IS3 A;  2O8B A;  3TAB A;  3LAM A;  4DV0 K;  4MO4 A;  2VCP A;  3L6Q A;  1X9J A;  1KVC A;  4BG9 A;  3V9W A;  2E6L A;  4LF5 K;  1TAU A;  1NGH A;  4JNE A;  3I56 N;  2RN2 A;  4CIG A;  3GDQ A;  3V1Q A;  2YNG A;  1S9E A;  2EHG A;  3OYI A;  4PA1 A;  3MK6 A;  1YTU A;  1NOZ A;  1C1A A;  3MDQ A;  3QIP A;  5LL6 Z;  1KCF A;  3H08 A;  3HBT A;  2O8C A;  3C95 A;  1G99 A;  3P4I A;  4FZY A;  4KHS A;  3AGK A;  2D4W A;  3SAF A;  1LW0 A;  1SKR A;  1OKJ A;  2G8K A;  4CED A;  4BVO A;  4I2P A;  4BE2 A;  3VEV A;  2WTU A;  1NGB A;  1BIS A;  3PUF A;  3AAP A;  4CZL A;  3OYG A;  3OY9 A;  5FDL A;  3HK2 A;  3IRX A;  2P9U A;  1HKG A;  3IG1 A;  1W2B M;  4CK1 A;  5JIC A;  1NK4 A;  1E3M A;  2P9P A;  3V9S A;  4BC3 A;  5BR9 A;  5BN8 A;  1RT3 A;  3LAL A;  3TAE A;  1V4T A;  3O6W A;  4O4G A;  3V9U A;  3WNG A;  2HHS A;  3VEY A;  4DV2 K;  3UKR B;  1UA0 A;  4W5O A;  4DR4 K;  5FPN A;  3OS1 A;  4GW6 A;  1HKB A;  3DAW A;  1VSF A;  4JKB A;  4CZH A;  4OO1 J;  1GOB A;  2QM1 A;  3PSF A;  1R59 O;  2QEX N;  4CJP A;  4BG8 A;  3SI6 A;  1Y97 A;  4H0T B;  2QWL A;  3H46 O;  4FWN A;  5AQU A;  4E7L A;  4OLB A;  1HYS A;  4BRH A;  1TVR A;  4C8L A;  3JSM A;  2QK9 A;  5IWA K;  3O9U A;  4RW6 A;  2O8E A;  3AVM A;  3WXL A;  3HOT A;  3A5L C;  4FJG A;  3T19 A;  3S3N A;  3AA3 A;  4BRF A;  1T05 A;  5CZ2 A;  2QXL A;  3RMC A;  1RDB A;  1SZ2 A;  4N5S A;  2Q36 A;  3CJB A;  4DTX A;  3QEV A;  4F3T A;  1W9H A;  3P39 A;  1VSL A;  4CJ7 A;  4GKK K;  3GE1 A;  4C1N I;  4BWJ A;  5F2R A;  1NK8 A;  1WSH A;  3TAR A;  3AVF A;  1VSH A;  1J54 A;  3U3Y A;  1BL3 A;  2QWN A;  3K5M A;  3TR8 A;  1BOT O;  3FFK B;  5T7B A;  2VQF K;  4FLU A;  5KPR A;  1RBT A;  2DFE A;  4E3S A;  1ASW A;  1MU2 A;  4CHZ A;  5AFU A;  4DV7 K;  2P9I A;  2O8D A;  4KRF A;  5AQV A;  4O0J A;  1WAJ A;  3TTC A;  2W42 A;  3L0Q A;  3MN6 A;  4AM7 A;  1J5E K;  2KKZ A;  1BQN A;  3K9J A;  1GLB G;  4F9O A;  1TV6 A;  3AO5 A;  4WQ4 A;  1C6V A;  4B1Y B;  3HSC A;  3VQ7 A;  2HST A;  4E7J A;  3B6O A;  3ULE A;  1B92 A;  2JGU A;  3VF6 A;  3JAM O;  1X9M A;  4IFV A;  1QSS A;  4I2Q A;  1RNH A;  1IBM K;  2A5X A;  2FF6 A;  4KHY A;  4ID1 A;  3VQB A;  3OA9 A;  3M8Q A;  3QML A;  4QCL A;  3HVT A;  4PKH A;  1XNR K;  1U6Z A;  3QER A;  2QKB A;  1ATR A;  3P1G A;  1RBU A;  1NK5 A;  4JKA A;  2F9T A;  3AAR A;  3TTF A;  3HJF A;  1WAF A;  2WFB A;  1B9F A;  4CGI A;  1TKZ A;  1O1W A;  3NVM A;  4YFU A;  4CZF A;  4N41 A;  1RFQ A;  1SKW A;  3CIP A;  5AZI A;  5GIN A;  3QFU A;  3MED A;  1RCH A;  3ZT2 A;  1RT2 A;  4CHO A;  2E2P A;  3CQX A;  4O5B A;  4DF4 A;  5AQJ A;  4ILG B;  4J2A A;  3FZM A;  3HO1 A;  4JS4 A;  2G8U A;  2V7Z A;  4PWD A;  1NGF A;  2X6S A;  1SL1 A;  1NU0 A;  4CBW A;  1TYQ B;  3WNE A;  2CGL A;  2OA8 A;  4CJK A;  1GLC G;  1RDW X;  4O8K A;  4K0K K;  1HNW K;  1BUP A;  3ZCM A;  4HUG A;  3SV4 A;  4OPK A;  4FJI A;  4NLC A;  5TKW A;  3ENO A;  1FJG K;  2V51 B;  4Z0U A;  3CF5 L;  4AIL C;  4BC5 A;  4FJ8 A;  2OTL N;  2JWK A;  1BDG A;  1CXU A;  4JS5 A;  4OKJ A;  1VHX A;  1DLO A;  1ASV A;  3HRG A;  3P83 D;  2YHW A;  2ZJR L;  1OH8 A;  2FSN A;  4KHN A;  2F4V K;  3TSQ A;  3L2W A;  2QXF A;  1ZBU A;  1W0H A;  2YNF A;  3HZ6 A;  1REV A;  4A57 A;  5KGX A;  2IGI A;  2O8B B;  3VTH A;  1QVF M;  3CFP A;  2BH1 A;  5HRO A;  3SMP A;  1SL0 A;  4X66 K;  1HQE A;  4YY3 K;  4RW8 A;  3FFI A;  1VSK A;  3LWM A;  1QZ5 A;  4DFP A;  2NRV A;  2EWS A;  3CHW A;  3DLH A;  4CZI A;  1VSJ A;  4H0V B;  1YAG A;  3VET A;  5M1P A;  3KWG A;  4CEB A;  1L3S A;  1XHX A;  5C24 A;  4CJQ A;  3M8P A;  5JLH A;  2O8C B;  3CJ9 A;  1SQK A;  5DK5 A;  5AQK A;  4JYA K;  1K6Y A;  1NM1 A;  2FBT A;  3QLH A;  3ISN C;  4I9Q A;  2BTF A;  2ASM A;  4CF1 A;  4X62 K;  3TWH A;  4M63 C;  4UQG A;  3K2P A;  4DV1 K;  1HJR A;  5ADX A;  3THW A;  5KGW A;  2Y1I A;  5EVZ A;  2P9U B;  4ISG A;  1JCG A;  3CET A;  1K8K A;  1N8R O;  2P9P B;  4LFC K;  4CJU A;  2E88 A;  4FWS A;  1YVN A;  1GLF O;  3N4P A;  1N33 K;  3ZSX A;  4DHY A;  4IJN A;  1IO2 A;  4HCC A;  4Y0W A;  4FM1 A;  3BEX A;  3O5B A;  3QNO A;  2W6L A;  2JWL A;  4FPA A;  3HPH A;  3ZX2 A;  1Z6R A;  4FJK A;  4Z4H A;  3B6P A;  2GEL A;  1E4F T;  4CBX A;  4RW4 A;  3VA3 A;  2E5L K;  1JL2 A;  3AVJ A;  3DLK A;  1KTQ A;  3VEX A;  4CZJ A;  4IOA L;  2Q2R A;  1QZ6 A;  2ETJ A;  3J8A A;  4CFA A;  1NKB A;  3MXJ A;  2HHU A;  4RCH A;  3CPE A;  5HRS A;  1EXQ A;  1A5V A;  1G15 A;  4DTN A;  2NRH A;  4LD0 A;  2O8E B;  1DTQ A;  2IDO A;  2UXC K;  5AQL A;  4DR7 K;  4JLH A;  4PL7 A;  4Q5V A;  1VSD A;  4N47 A;  2ZWH A;  1ZC6 A;  1RTD A;  3S3M A;  5CY4 A;  4B1X B;  5J2P A;  3C6A A;  3OS2 A;  3A5O C;  4CJT A;  1TKX A;  4U7B A;  5BPL A;  3FR0 A;  4KKO A;  4EHT A;  4FWR A;  3TI0 A;  3SLC A;  1JXE A;  3KK1 A;  3C7N A;  3NCI A;  3D7E O;  1CZ9 A;  1WSG A;  4KTW A;  4XEI A;  4IJA A;  5KQ8 A;  3NH0 A;  3QEI A;  2VG7 A;  4NCA A;  3BY5 A;  3LM2 A;  3ZT1 A;  5AQR A;  2IC3 A;  3AVC A;  1S1X A;  2O8D B;  4KB1 A;  4FJJ A;  4DR6 K;  1GLA G;  4BRD A;  2XY7 A;  3CJ1 A;  4O44 A;  3AVB A;  3NBP A;  1GOC A;  1D8Y A;  4DSE A;  1VQN N;  2F96 A;  3PV8 A;  2ASP A;  4MDA A;  3QES A;  4FM2 A;  4X64 K;  1TK0 A;  4B1W B;  3CYM A;  1IKV A;  4BE0 A;  1N5Y A;  2XHB A;  1WOQ A;  4GKJ K;  1SKS A;  1IJJ A;  1ITG A;  4CJS A;  3WXM B;  4NB4 A;  4CZM A;  1LW2 A;  3OW2 M;  2HBM A;  4LC9 B;  3TAQ A;  3ULE B;  2E2Q A;  4NCB A;  1HYZ A;  4F2S A;  4E19 A;  4H0O A;  4A2A A;  1J9A A;  4BR5 A;  3VQ5 A;  3DM2 A;  4B9M A;  4DS5 A;  3OYJ A;  4BRO A;  3A5M C;  3K5O A;  3HYF A;  4W5R A;  3DLG A;  2ZGY A;  4CCH A;  4M3R A;  4DTJ A;  1VAZ A;  3CG7 A;  2ZJP L;  1BU6 O;  4EFH A;  1WSE A;  1U4B A;  4FJ9 A;  2BUP A;  3D6R A;  5AZI B;  4M42 A;  4H4M A;  3KLF A;  1S6Q A;  4CFD A;  3O9Q A;  5AQN A;  4CFC A;  1S6P A;  4OVL A;  2OTJ N;  3EE9 A;  4ISF A;  3QBW A;  2P5O A;  3CC4 N;  1RT7 A;  4EZ6 A;  1YJN N;  2Q0R A;  3I8D A;  4F4K A;  5FRM A;  4FK4 A;  3DOL A;  2CGJ A;  5HRR A;  4KHU A;  1I94 K;  2A6A A;  5HRN A;  1B9D A;  2HHV A;  1NGD A;  1U2V A;  3KK3 A;  3RWU A;  3V6D A;  3KK2 A;  2HHT A;  5HOO A;  5EOY A;  4M3W A;  5JMV A;  3DLB A;  4CHN A;  2Q97 A;  4BY9 C;  3U9Z A;  1RTI A;  4A62 A;  3LWL A;  2PAV A;  1VSI A;  4M45 A;  3PX0 A;  4W5Q A;  3NF8 A;  3KLH A;  2OZM A;  3ULD A;  4MFB A;  4PHT X;  5DM7 L;  4YOW A;  2HHQ A;  3THX A;  2E6M A;  5AQO A;  4YHH K;  4B9L A;  1JLE A;  1XC3 A;  1HNZ K;  4DSL A;  1MA9 B;  2RF2 A;  4YDU A;  3THY A;  4YOX A;  4CEF A;  2VG5 A;  3ID8 A;  3AVA A;  4MO5 A;  2JLE A;  2YJF A;  4GNI A;  4B08 A;  5GIP A;  1N6Q A;  4JKE A;  2J4R A;  3AVL A;  1NG9 A;  2GBZ A;  3UE5 A;  4DLE A;  4HUF A;  1C0G A;  3DXM A;  1HX1 A;  3SZ2 A;  1VQK N;  3LDS A;  1LAW A;  2VGM A;  3EO3 A;  4B9T A;  4FJL A;  4AHV A;  3ZET A;  1NLV A;  3QFP A;  3ZX3 A;  5AQY A;  2CH5 A;  1X3M A;  3VEW A;  3NDK A;  2G8W A;  4DR1 K;  1VQL N;  1DEJ A;  1WSJ A;  3IFR A;  1GLD G;  3MCA B;  2W40 A;  3UKU A;  5JVH L;  4C8O A;  3A2F A;  2I7N A;  2I5J A;  3PO5 A;  5AQG A;  4FJH A;  2BE2 A;  3F9K A;  1QQC A;  4KB0 A;  2QA4 N;  4CF0 A;  5B8H A;  4DQP A;  1WSI A;  4DFK A;  3QEW A;  4AQY K;  1NK0 A;  4H8K A;  1NMN A;  3UIQ A;  3SV3 A;  1SV5 A;  2LSN A;  3VQD A;  3O4N A;  1K8K B;  5C0Y A;  3AO1 A;  3TAN A;  1TK5 A;  4CGG A;  1S22 A;  3SUQ A;  2CGK A;  2BAN A;  4B3R K;  1KAX A;  5J2M A;  4WCE L;  4JKG A;  4WFN L;  1NJZ A;  4W5T A;  2VWK A;  3T1Y K;  3PSI A;  1MWM A;  1YIJ N;  1U48 A;  4CJE A;  3SUN A;  1JLF A;  3CCE N;  1YVU A;  4LFB K;  3QB0 A;  4G9Z A;  3D2F A;  4H5W A;  3AVK A;  2NZT A;  2UUB K;  4ELU A;  2XO7 A;  5AQT A;  4BR0 A;  3EZW A;  5AQI A;  3BZK A;  1T6D A;  4AF1 A;  4OKK A;  4KI4 A;  3U3G A;  3NHG A;  3CCS N;  3NAE A;  3CCV N;  1WBD A;  3AO3 A;  1HNI A;  1Y64 A;  1XMQ K;  1NJY A;  4BGA A;  1JCF A;  4FYD A;  3U9D A;  3O8M A;  5M1K A;  5KPT A;  3RVC A;  3DXK B;  1MWK A;  2ZD1 A;  3V9Z A;  4IOC L;  3LDO A;  1W97 L;  3H3O B;  4M7Y A;  1BIU A;  3U4L A;  4FL9 A;  3C7N B;  4GY2 B;  4H0Y B;  3HI0 A;  5A2Q O;  1R0A A;  3O4Q A;  4HTL A;  4E1N A;  3QET A;  4KHP K;  2O4G A;  1WBB A;  4DQ8 A;  2YI1 A;  4LFA K;  4ILJ A;  1S72 N;  1YIT N;  4QAG A;  3TSU A;  5C2F A;  5FRN A;  1W7A A;  3KIO A;  4KHQ A;  3OYC A;  1NJX A;  4PY5 A;  4FLW A;  4CVN E;  2KZM A;  3THV A;  1TKD A;  4EZ9 A;  3QIN A;  3EL2 A;  4B9N A;  3NF9 A;  4OLA A;  3IS9 A;  1SAZ A;  3D45 A;  3HVR A;  1HPZ A;  2O8F A;  3VGL A;  1VQO N;  5LMN K;  1VQ4 N;  1MDU B;  3KJV A;  5M1N A;  1HJO A;  3RRG A;  5CHI A;  3O9T A;  3V1O A;  4UY8 O;  2G8I A;  4NXN K;  4JAX A;  1NJI O;  2HHX A;  1V4S A;  4JKD A;  3JYT A;  1BQM A;  1D4X A;  1BGX T;  2FBV A;  4FO0 A;  4A59 A;  1DGK N;  3R6M A;  1SS6 A;  4C8M A;  4AHT A;  1IBK K;  2Q0U A;  4IG3 A;  3ZEU A;  4Q0B A;  4CIE A;  4RWT A;  1U04 A;  3VGK A;  5CE3 A;  4ISE A;  3SAH A;  4WE1 A;  2D1K A;  3MN9 A;  3J7Z O;  1ESV A;  2D0A A;  1LAV A;  4ID5 A;  4CIF A;  3VES A;  3L8B A;  1NGC A;  4B9Q A;  5H1S Q;  4FSV A;  1KAY A;  4O5F A;  4I9L A;  4PQU A;  2YHA A;  3G6E N;  3RMA A;  4G1Q A;  2QWP A;  5AZJ A;  3HT3 A;  3QO9 A;  1U2V B;  3UB5 A;  1Z26 A;  5E26 A;  4OPH A;  2FC0 A;  3AA5 X;  3VEO A;  2HHW A;  1L3T A;  3OBW A;  1S1T A;  3BF1 A;  2IIR A;  2FSJ A;  4H5R A;  5JS1 A;  2D0O A;  1Q82 O;  2HW3 A;  4NXM K;  4CK3 A;  2A1R A;  3P31 A;  4JI5 K;  3R3L A;  1T3V A;  3F9M A;  2H3G X;  3BZC A;  2FXU A;  3G25 A;  5C2D A;  1FKP A;  3VPZ A;  4FWK A;  2VQE K;  4GMJ B;  3THX B;  1BWF O;  3PO4 A;  4FK0 A;  2Q31 A;  5K14 A;  3WEE A;  4ZTJ A;  1JCE A;  3VGM A;  2IVP A;  2Q3S A;  2PYL A;  2ZE2 A;  2HF4 A;  4YOV A;  1YTA A;  2YHX A;  3THY B;  4WQ5 C;  4LH5 A;  3F2K A;  3DLR A;  4CJR A;  5IT9 O;  3ZYY X;  4DS4 A;  1ZBS A;  3I0R A;  3NFA A;  3P5J A;  3NGY A;  4H5N A;  4DR2 K;  4BDP A;  4JK7 A;  1LWC A;  1IG9 A;  2CH6 A;  3C0B A;  3H1Q A;  4FJ7 A;  3VA0 A;  2HND A;  5EY4 A;  4OKE A;  3K59 A;  2DPN A;  1BIZ A;  4QS8 A;  2F9W A;  2Z1G A;  3WT0 A;  3TAG A;  1IH7 A;  3W3D A;  2X78 A;  3ZET B;  2V52 B;  1GLJ O;  4Z4G A;  1S1W A;  1ZBL A;  4DV5 K;  3G4S N;  1T7P A;  4KBO A;  1M1K O;  5EXW A;  3WQU A;  1XHZ A;  3DRR A;  3WXI A;  2QWQ A;  3UKU B;  4BDY A;  3U6F A;  3O1B A;  4BRP A;  2FF3 B;  3OYM A;  2HF3 A;  3N4Q A;  3O80 A;  3OYB A;  3CXC M;  4BWM A;  1EO1 A;  4CEZ A;  4K42 A;  4DB3 A;  1U47 A;  5CR4 A;  5AQS A;  1NWK A;  5CYQ A;  4M3T A;  3I0S A;  1Q18 A;  4B9V A;  3HOS A;  4M7X A;  4DG1 A;  1KD1 O;  3ZSQ A;  3I55 N;  2YNH A;  4FCY A;  1JKH A;  4BC4 A;  4BRC A;  1T44 A;  4B1V A;  4DV6 K;  4NYF A;  4M3U A;  1I39 A;  3VQA A;  4JRQ A;  3HM8 A;  4CZE A;  3SJH A;  2OPQ A;  4R5P A;  4E7I A;  1IKW A;  5BN9 A;  4CJW A;  1QE1 A;  1JLG A;  1JLA A;  1RGI A;  4CJ4 A;  3OJU A;  2QWO A;  4DCH A;  4JKG B;  3VQQ A;  3CCJ N;  4IFY A;  5AFU H;  3DJC A;  4FVU A;  3QDK A;  2XY8 A;  1LWE A;  1JLB A;  1ILY A;  2E2O A;  4M3Y A;  4Y1D A; 
#chains in the Genus database with same CATH homology
 3CJC A;  2ZGY A;  3HBT A;  4CD1 A;  3D2F B;  3O4W A;  3M6G A;  3TU5 A;  3CJ7 A;  1G99 A;  3MWT A;  3P4I A;  1J6Z A;  1VAZ A;  3FE1 A;  2ZJP L;  2QTD A;  4IO9 L;  1BU6 O;  1NGE A;  4JKC A;  3AGK A;  4EFH A;  2D4W A;  2E1Z A;  3R8E A;  2NLX A;  2WUS A;  3S41 A;  3SAF A;  2BUP A;  1YF5 L;  3D6R A;  5AZI B;  1OKJ A;  3IDH A;  4BVO A;  3VEV A;  1QQO A;  3O9Q A;  1ATN A;  5AQN A;  5JVG L;  5AR0 A;  2OTJ N;  1NGB A;  1KXP A;  3BF3 A;  3EE9 A;  5M1O A;  5BRD A;  3QBW A;  1DKG D;  4ISF A;  5DM6 L;  2UYT A;  2FSK A;  2PFU A;  3CC4 N;  5AQZ A;  3AAP A;  4CZL A;  5BRF A;  1YJN N;  4K41 A;  2Q0R A;  5FPM A;  3CME N;  4BQL A;  3MN5 A;  4QS9 A;  3WXJ A;  3EKS A;  2KHO A;  2P9U A;  1HKG A;  2CGJ A;  3KZB A;  1W2B M;  5JIC A;  2A6A A;  2P9P A;  3FGU A;  4XH5 A;  1NGD A;  1U2V A;  4BC3 A;  5BR9 A;  2HMP A;  5BN8 A;  1HLU A;  2WBN A;  1V4T A;  3O6W A;  1NGI A;  5AQQ A;  5HOO A;  5EOY A;  2NRX A;  3SBT A;  1VQ7 N;  3FZF A;  3VOV A;  5AQF A;  2QWM A;  5JMV A;  3VEY A;  5FPE A;  3UKR B;  2Q97 A;  4BY9 C;  4A61 A;  1K8A O;  3U9Z A;  2GUP A;  5FPN A;  4J8F A;  2QW9 A;  4JEP A;  3CCM N;  2YJE A;  4A62 A;  2PAV A;  4ILH A;  3KK7 A;  3TSP A;  1HKB A;  3VER A;  4CZK A;  4PHT X;  3DAW A;  4BC2 A;  3MN7 A;  4JKB A;  4CZH A;  3ENH A;  1KQS M;  3A8Y A;  4OO1 J;  1EQY A;  4H0P A;  2QM1 A;  2P9L B;  3L4I A;  2YX6 A;  3Q7B A;  4IZ9 A;  4JKH A;  1VQ5 N;  3H45 C;  4A5A A;  5DM7 L;  4YOW A;  1R59 O;  4IEE A;  2QEX N;  3LDQ A;  1Q7Y O;  3TPQ A;  4JHD B;  5AQO A;  3DXM B;  4BG8 A;  4BRI A;  4BR7 A;  4H0T B;  2QWL A;  3A5N C;  4H0X B;  3H46 O;  1XC3 A;  4FWN A;  1NBW A;  4EHU A;  5AQU A;  1MA9 B;  1YXQ A;  4YDU A;  4OPA A;  4EIA A;  1WUA A;  4YOX A;  1JJ2 M;  4BRH A;  2P9S A;  1ZXO A;  3ID8 A;  4Z94 A;  3VF2 A;  3E1Y A;  3O9U A;  4MO5 A;  3WXL A;  4BRL A;  3CJA A;  3MCP A;  3HOT A;  4K43 A;  3A5L C;  3JXU A;  5AQH A;  2YJF A;  4GNI A;  5GIP A;  4JKE A;  3PIP L;  2J4R A;  5F0X A;  4BRF A;  4BRG A;  4O8U A;  3UE5 A;  4MLH A;  1C0G A;  2QXL A;  3DXM A;  1HX1 A;  1K73 O;  1VQK N;  3T69 A;  3K9K A;  5TKY A;  1BG3 A;  2P9I B;  1SZ2 A;  2VGM A;  3D2E A;  3EO3 A;  2Q36 A;  3CJB A;  3ZET A;  1NLV A;  3QFP A;  3ZX3 A;  4FPB A;  1ILY A;  5AQY A;  3C65 A;  3P39 A;  2CH5 A;  1X3M A;  3VEW A;  4DKW A;  4K25 A;  4CJ7 A;  1VQL N;  1DEJ A;  1QHA A;  3GE1 A;  3GL1 A;  3Q7C A;  3EN9 A;  4C1N I;  1YI2 N;  3IFR A;  2HBJ A;  1GLD G;  3ATU A;  3MCA B;  5F2R A;  2W40 A;  4C1N K;  4R79 A;  1C0F A;  3ZX0 A;  1E4G T;  3VF4 A;  1IG8 A;  3UKU A;  5JVH L;  2I7N A;  2QWN A;  3MX2 A;  4FOE A;  5FPD A;  1BA0 A;  3GOI A;  5AQG A;  1BOT O;  1LCU A;  2P9K A;  2Q1N A;  3FFK B;  3RSE A;  5KPR A;  1VQ9 N;  1Q86 O;  3ZEU B;  4BRN A;  1YJ9 N;  5AFU A;  4NLB A;  1BA1 A;  2P9I A;  2QA4 N;  5B8H A;  1QVG M;  5AQW A;  5AQV A;  3WQT A;  3TTC A;  4I6M A;  4BR4 A;  1HPM A;  3GG4 A;  3L0Q A;  3MN6 A;  3ATV A;  1GLL O;  4AM7 A;  2KKZ A;  4JD2 A;  5HL7 L;  2NRW A;  4YOT A;  5BPM A;  3K9J A;  3O9R A;  1GLB G;  4F9O A;  1O13 A;  2NRR A;  4YOR A;  2P9N B;  1K8K B;  3EKU A;  5AZJ B;  4WQ4 A;  5C0Y A;  4B1Y B;  3HSC A;  2HST A;  5GAD P;  3VEN A;  1S22 A;  2CGK A;  3ULE A;  3O1W A;  3VF6 A;  4A5B A;  1KAX A;  1YUW A;  2D0P A;  5GAH P;  2KLA A;  4WCE L;  4H03 B;  3QBX A;  4JKG A;  4WFN L;  2HBL A;  4MLE A;  4WQ4 C;  2A5X A;  2FF6 A;  4GV6 A;  3OA9 A;  3M5R A;  3QML A;  5ELZ A;  5KQD A;  1NGJ A;  4GVE A;  4PKH A;  1U6Z A;  2QWR A;  1MWM A;  1YIJ N;  1HUX A;  1ATR A;  1QQM A;  1GLE G;  4JKA A;  2F9T A;  3CCE N;  4WFA L;  3GBT A;  3QB0 A;  3AAR A;  4G9Z A;  2E2N A;  3D2F A;  4H5W A;  3TTF A;  4JKF A;  4B1U B;  2NZT A;  5ADX H;  2WFB A;  4EAH D;  4FWO A;  5AQT A;  4BR0 A;  4CD3 A;  3EZW A;  3DLL L;  2I7P A;  3I8B A;  3LDP A;  3NVM A;  5AQI A;  3PIO L;  4CZF A;  1RFQ A;  4IXC A;  5I9E B;  2NRZ A;  3CIP A;  3IKM A;  5AZI A;  5GIN A;  1T6D A;  3QFU A;  3CC7 N;  3M3Z A;  4AF1 A;  3CCL N;  5M1Q A;  2ITM A;  4IO8 A;  2E2P A;  3CCS N;  3CQX A;  3CCV N;  5AQJ A;  4ILG B;  5BRH A;  1M90 O;  3WXK A;  3FZM A;  2YCH A;  1CZA N;  1Y64 A;  2GWJ A;  2V7Z A;  4BR2 A;  4H5T A;  4BGA A;  1JCF A;  3U9D A;  3SK3 A;  1K9M O;  3O8M A;  5M1K A;  1NGF A;  5GIO A;  5GAE P;  5KPT A;  3FZL A;  4AM6 A;  4CBW A;  1TYQ B;  2CGL A;  1Z05 A;  2V7Y A;  4L3Q A;  3O08 A;  4FWL A;  3RVC A;  3DXK B;  1MWK A;  4GV3 A;  1GLC G;  1RDW X;  1TUY A;  4O8K A;  1BUP A;  4IOC L;  3LDO A;  4XH1 A;  1W97 L;  1VQ8 N;  3KVG A;  4IDH A;  3H3O B;  2E8A A;  4M7Y A;  3U4L A;  3UKR A;  4FL9 A;  2WC9 A;  3C7N B;  4GY2 B;  4H0Y B;  3HI0 A;  4NLC A;  5TKW A;  3ENO A;  4HTL A;  2A3Z A;  3VMF B;  2V51 B;  3CF5 L;  4IOX A;  4BC5 A;  5AQM A;  1VQM N;  3PLA A;  3NVK A;  2OTL N;  4DQ8 A;  1BO5 O;  1BDG A;  2JWK A;  2YI1 A;  3BUZ B;  4IEI A;  3U8X A;  3NMU A;  2ASO A;  4ILJ A;  2P9L A;  3HRG A;  4KH4 A;  1S72 N;  2YHW A;  4BRK A;  1YIT N;  3TSU A;  5BRE A;  4JHD A;  2ZJR L;  2GX9 A;  2FSN A;  3DXK A;  5C2F A;  3TSQ A;  1OVY A;  2QI2 A;  3M1F A;  3KHY A;  2OAN A;  1KC8 O;  3HZ6 A;  2ZGZ A;  4A57 A;  4IFE A;  4FOI A;  3CC2 N;  2AP1 A;  4YOU A;  5MLC Q;  3P38 A;  3VTH A;  1QVF M;  2BH1 A;  5C15 A;  3EL2 A;  3MX5 A;  3SMP A;  1SAZ A;  2IVN A;  3VGL A;  5E84 A;  4JK8 A;  1VQO N;  4KH6 A;  1VQ4 N;  1MDU B;  3E9L A;  4QS7 A;  5M1N A;  1HJO A;  3CI5 A;  5EX5 A;  4IWV A;  3BP8 A;  5CHI A;  3O9T A;  4UY8 O;  2ZF5 O;  1QZ5 A;  3G71 N;  4JAX A;  1NJI O;  2NRV A;  2EWS A;  3C6H A;  3CHW A;  3FLC O;  1YJW N;  1Q81 O;  4CZI A;  4H0V B;  4JK9 A;  1V4S A;  1YAG A;  3DWL A;  3VET A;  4WYB A;  5M1P A;  4JKD A;  3KWG A;  3VEZ A;  1D4X A;  5JLH A;  4FO0 A;  4A59 A;  1DGK N;  2GTD A;  3CJ9 A;  3R6M A;  1SQK A;  3MMV A;  2A42 A;  1SS6 A;  5AQK A;  2Q0U A;  2F7T A;  3IUC A;  3ZEU A;  1NM1 A;  3H3N O;  5KPZ A;  1DT9 A;  2ZJQ L;  3IMX A;  4RWT A;  4A2B A;  3H6E A;  3VGK A;  2VGN A;  3CER A;  4ISE A;  3LDL A;  5CE3 A;  3SAH A;  1X3N A;  2ASM A;  2BTF A;  2D1K A;  1ESV A;  3AY9 A;  3MN9 A;  1XQS C;  1P90 A;  3J7Z O;  3CD6 N;  3R9P A;  4M63 C;  2NRT A;  3VES A;  3AAQ A;  5ADX A;  1NGC A;  4RTF D;  3SMS A;  4B9Q A;  5GAG P;  5H1S Q;  3LDN A;  3VTI A;  3JS6 A;  1KAY A;  4FSV A;  4O5F A;  2E20 A;  5EVZ A;  2P9U B;  2YHY A;  4ISG A;  3G6E N;  2QWP A;  1JCG A;  2HBK A;  3CET A;  2P9N A;  1K8K A;  5AZJ A;  1N8R O;  4HWI A;  2P9P B;  1U2V B;  3UB5 A;  4CBU A;  5E26 A;  4OPH A;  3WEE B;  2A41 A;  3AGR A;  3VEO A;  1S3X A;  4YOY A;  2E88 A;  3OBW A;  4FWS A;  4XH4 A;  5LY3 A;  1YVN A;  3CMA N;  2E1Y A;  3BF1 A;  3O9S A;  1NGA A;  3ENB A;  1GLF O;  3EE8 A;  2IIR A;  3N4P A;  2FSJ A;  4H5R A;  1VQ6 N;  2D0O A;  1Q82 O;  4DHY A;  3CCU N;  3F5T A;  4IJN A;  4Y0W A;  4KH5 A;  1HKC A;  3P31 A;  2GEM A;  3BEX A;  3O5B A;  3R3L A;  1T3V A;  3F9M A;  2H3G X;  2JWL A;  2FXU A;  3G25 A;  5C2D A;  4FPA A;  3MWP A;  3VPZ A;  3FZK A;  4WQ5 A;  4FWK A;  3ZX2 A;  1Z6R A;  4GV9 A;  2VWB A;  1BWF O;  2GEL A;  1E4F T;  5F1X A;  2Q31 A;  4CBX A;  3WEE A;  5C10 A;  1JCE A;  3LM9 A;  3CCR N;  4JN4 A;  3WUH A;  2GWK A;  2IVP A;  3VGM A;  3R1X A;  3VEX A;  4CZJ A;  2Q2R A;  4IOA L;  1T6C A;  1QZ6 A;  2HF4 A;  4C23 A;  4YOV A;  2YHX A;  3J8A A;  4PKG A;  4WQ5 C;  3F2K A;  3TTD A;  4RCH A;  3CPE A;  2P9S B;  1P8Z A;  4H5V A;  4WFB L;  3CQY A;  2NRH A;  3ZYY X;  1ZBS A;  4H5N A;  5AQL A;  4BRM A;  4JK7 A;  4PL7 A;  3E66 A;  1VQP N;  3CPW M;  4BRQ A;  1XUP O;  2CH6 A;  2ZWH A;  5LJW A;  1ZC6 A;  4CZG A;  3C0B A;  3H1Q A;  2RE2 A;  4FWQ A;  3HTV A;  3SBG A;  3OBY A;  4PL8 A;  4U67 L;  5EY4 A;  1TYQ A;  4B1X B;  2DPN A;  4B1Z A;  4QS8 A;  3C6A A;  2F9W A;  3A5O C;  3D2E B;  3WT0 A;  5BPN A;  3W3D A;  4MDB A;  3ZET B;  4U7B A;  5BPL A;  2V52 B;  1GLJ O;  1ATS A;  3FR0 A;  4NO7 A;  4EHT A;  4FWR A;  3QIC A;  3SLC A;  3G4S N;  3C7N A;  3H1V X;  4KBO A;  1M1K O;  5EXW A;  3WQU A;  2VYP A;  5C12 A;  2NNW A;  3SAG A;  3WXI A;  3A0I X;  2QWQ A;  2RHK A;  3D7E O;  3UKU B;  4YDU C;  4BGB A;  5LJV A;  3O1B A;  3CCQ N;  4BRP A;  4XEI A;  4IJA A;  3T7Z A;  3W0L A;  2FF3 B;  5KQ8 A;  2HF3 A;  2P9K B;  3RSE B;  3LM2 A;  1NGG A;  1H1V A;  3N4Q A;  3O80 A;  5AQP A;  5AQR A;  4BRA A;  1LOT B;  3CXC M;  1YHQ N;  1EO1 A;  4K42 A;  4DB3 A;  3B8A X;  3OHR A;  1GLA G;  5CR4 A;  1NWK A;  5AQX A;  5AQS A;  1QQN A;  3CJ1 A;  1Q18 A;  4BRD A;  4E1J A;  1RDU A;  3HOS A;  4I6M B;  2PBD A;  4M7X A;  4BR9 A;  1VQN N;  5JLF A;  1KD1 O;  4WF9 L;  3I55 N;  2A40 A;  2ASP A;  4MDA A;  2W41 A;  4BC4 A;  1TUU A;  4BRC A;  1T44 A;  4JD2 B;  3ID6 A;  3LL3 A;  2HOE A;  4CI6 A;  4FWP A;  4B1V A;  4BVP A;  4BRE A;  4B1W B;  1WOQ A;  1IJJ A;  4MO4 A;  2VCP A;  3HM8 A;  3L6Q A;  3WXM B;  4NB4 A;  3SJH A;  4CZE A;  4CZM A;  5M1F A;  2FLO A;  1X9J A;  4BG9 A;  3OW2 M;  3KWI A;  2HBM A;  4LC9 B;  5BN9 A;  3ULE B;  3I33 A;  2E2Q A;  1NGH A;  4JNE A;  2AA4 A;  3I56 N;  3FZH A;  4BQZ A;  1RGI A;  2IVO A;  4H0O A;  2QWO A;  3GDQ A;  4FWM A;  4DCH A;  1NMD A;  4JKG B;  3CCJ N;  4FVU A;  4A2A A;  5AFU H;  3DJC A;  4BR5 A;  3QDK A;  3L4Q A;  3MK6 A;  3E9P A;  1KAZ A;  3MDQ A;  4BRO A;  3A5M C;  2E2O A;  4PKI A;  3E9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...