1RE0A

Structure of arf1-gdp bound to sec7 domain complexed with brefeldin a
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
162
structure length
162
Chain Sequence
MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of ARF1*Sec7 complexed with Brefeldin A and its implications for the guanine nucleotide exchange mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords ADP-ribosylation factor 1
total genus 55
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2003-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1re0A00
3M1IA 1EX6A 4JL5A 3WMFA 2HCBA 2BDTA 1TADA 3CW2A 4M53A 2J5XA 1D9ZA 1KAOA 2QT0A 4LBWA 3TVDA 4AKGA 4HLUA 4O2LA 2I1QA 3QIAA 2OE2A 2ODNA 3KFVA 1ETUA 3EZ6A 4US2R 3U6KA 4CEJA 2NO7A 1XMVA 4IW3B 3P27A 3B1VA 2A2ZA 2Z5FA 4Q1DA 5AJWA 2XB2A 4P3YA 3EA0A 3PVSA 4S2EA 1Z6XA 4IOMA 4ZIRA 2JJ2D 5JI3E 3UMFA 3SOPA 1ZC3A 5DHAA 3PEUA 1BH2A 3T5GA 3TKLA 2W0SA 1EXMA 1T8TA 2AFIE 1GM5A 2WAXA 2XXAB 1WA5A 5ELXA 4TMWA 2DR3A 2YKGA 2CNWD 4OQNA 1ZU5A 5FOTA 5E7JA 2OCBA 4L9SA 1FMJA 3W3ZB 1E79A 1W0JD 2AL7A 3LBNA 2VO1A 2HF8A 4MKGA 1UF9A 2V8OA 3IKJA 5K8LA 1P2SA 3ZVNA 1SXJC 2A5FA 2QROA 1YR6A 4FMBB 2IHYA 3U2QA 1DG3A 1WE2A 4M9QA 5CLLA 5FOSA 3DPUA 4DKXA 4DSNA 1OFTA 3CF0A 1AGPA 4LYHA 4NYIQ 4Q02A 5E3HA 2QE7D 1JQJC 2OAP1 2DFNA 2DWPA 3ECCA 2OFWA 2V55B 4W5JA 2QSZA 1E79D 3CNOA 4QNRA 4KYUA 4WXRA 1UM8A 2YC4C 4Q00A 4PSAA 3NC1C 2PMKA 3VKWA 1HQYE 2CLDX 1YZLA 2PLRA 3IDQA 3P26A 3Q72A 4DVGA 2ZM5A 1MABB 3WY9A 4YQFA 3VR2A 1GL7A 4K46A 1OH8A 2WSSD 1Z0IA 2VHJA 3FMFA 4OJKA 4UXJA 1KZ7B 1RYFA 3AV0B 1AJEA 1FTSA 2PT5A 1DARA 1CS4C 3GCGA 1U94A 1OPXA 1OW3B 3QF7A 1VHTA 1S2MA 2ZUBA 2O8CB 2IYVA 1KK0A 3R7WB 2K5UA 1DG1G 4P33A 4DCSA 1AZTA 1KO1A 1ZM9A 3GQBA 1TEXA 521PA 2HYDA 3THOA 2FSIA 1W4CA 2KBFA 4CF7A 4CIDA 3QPUA 3IPXA 2H18A 3B9QA 3MWLA 1R0ZA 4F4CA 1GNQA 2OBMA 3KUDA 1T9HA 3MFYA 1P62B 3Q7PA 3RABA 1BYUA 1EFCA 1KDPA 2WJYA 3NC0C 4RFSB 4G3XA 4OQXA 3K0SA 4Z8XA 4HI0E 4KVAA 4CEIA 4BUJA 2NIPA 3RDPA 5E7MA 2G1KA 2BBTA 5TMPA 3AUXA 2IEYA 1SVLA 2FH5B 5FH9A 4IDNA 2R65A 2QM7A 2ZE6A 1F2UB 2IC5A 3FE2A 4A36A 1OH6A 3QVUA 3UKDA 1SXJD 3AVVA 5JEEA 2HV8A 3NDBB 2H17A 3LX8A 2AHOA 1D6JA 2XJ4A 4TMZA 1JAIA 4A8JB 3KQKA 5F9FA 4TLEA 2RGEA 1K8RA 3ZS8A 5CM8B 4A1FA 5GVSA 4Q1BA 5DYGA 1TU4A 3C7KA 4LV6A 3X1WA 5HCNA 3H84A 2IUUA 1J8MF 3S1AB 1CIPA 4EPVA 1Q1ZA 4F4JA 4PO1A 3EIEA 1LF5A 3X2SA 1JR3E 1ZIOA 4YDSA 1CF4A 4MYTA 3CR8A 5BN3A 4CGZA 3BORA 4ABYA 1R8SA 1E69A 3GJ4A 5AJZA 4OL0A 2VA8A 5DYIA 5JEDA 4Q47A 2YWHA 3D3QA 2D06A 5J5CA 2ODBA 1IY2A 2GA8A 1G17A 2WHXA 4OBEA 2H1LA 4TMTA 4BE7B 2EFCB 2Q0HA 5DO9A 1XP8A 5HR5A 5JWRA 5TDHA 3QKRB 2GXSA 5KNBA 1W5SA 2CXXA 2FFHA 3SNHA 1X8KA 1RYHA 4CYMA 2HCJB 2ZE8A 1JAHA 3NH9A 4JBXA 3GP8A 4F4IA 3ZVMA 4ZIRB 2QG6A 1U8AA 4XVUA 2XSZD 1W0KD 1UDWA 1U0HC 1X1RA 2V9PA 4V0ME 1D5CA 4Q48A 1G21E 1US8A 2ATXA 5C4GB 1TF7A 4NU0A 2EW1A 2QMHA 3PQCA 2LKCA 4XD7A 3LQRA 2V4ZA 1JXOA 2FPLA 2EYQA 3O47A 5FOXA 1E0AA 5CYOA 2CBZA 1RW4A 2PT7A 3BJIC 2V6JA 2C95A 3CPJB 1JPJA 3QXHA 4LRWA 3QENA 3TR5A 2H7VA 2WTUA 5JWHA 4LCBA 1II0A 3W8NA 4LJAA 1BIFA 4H1VA 5TV2A 1W0JA 2QEQA 2Z43A 1G3UA 1OYYA 2OBLA 2ONJA 1U81A 2CCGA 2ZSAA 3QF4B 2IYTA 5FTKA 1CR2A 2JJ2A 4D6PA 3EX7C 1CU1A 3Q8XB 1TAGA 2MSCB 1GFIA 4QGGA 2QBYB 4MGIR 4EUNA 4AK9A 3L0IB 1DE0A 2FE4A 2JAQA 5EXXA 1W2GA 2Z4SA 3E70C 1U0LA 1LTQA 4TT3A 1HA3A 2OXCA 4MKIA 4PANA 3GLHA 2ANCA 3GLGE 3K0AA 1NN5A 3OEHD 3B6EA 3ASYA 1Q12A 1R6BX 1HEIA 4NPHA 1JEEA 2BCJQ 4Q4HA 4ACBA 3PUWA 4WA7A 2R8RA 2FEOA 4KV9A 4B3DA 4U7DA 1P61B 3A1UA 3AGQA 1GRRA 2CE2X 4PC6A 3HPRA 2JLZA 2YOHA 1N5LA 4DZZA 1T8UA 1EK0A 1RFLA 2L0XA 3GJ5A 4PO9A 2FEMA 2A9KA 1Z2AA 1NKSA 1HV8A 1E9FA 5HCIA 2IXGA 1CP2A 3K0CA 3LNCA 1SVWA 4TTRA 1KZGB 2AD5A 5GJCA 1OH7A 2C9YA 1AS2A 1E9DA 2FFAA 4JVSB 5GJBA 1GTVA 1FOEB 1T3SA 2ZRLA 5EUMA 1FZQA 1NF3A 2ZSDA 4V03A 1ZNXA 4A9AA 1CTQA 2KJQA 4QM6A 2X2FA 1OXUA 5K8TA 1Z63A 3VTKA 1CXZA 3T15A 4NTZA 1E2PA 1KI2A 3UWKA 1ZAKA 3TSOA 2REBA 4FCTA 2GCOB 2R6AA 1KY2A 1JJ7A 1X3SA 2N1BA 5AK0A 3CWQA 2BM1A 1OXTA 1G7CA 4MDEA 1L4UA 2B8TA 4KITB 1YZUA 2CJWB 421PA 5AWFC 2O8BA 3OIYA 3T12A 1G7SA 1CJUC 3J81k 2EYUA 1TQ6A 5JHGB 4G01B 3UMSA 3BGWA 1K5GA 1MV5A 4PSVA 4X8MA 3X1YA 1RIFA 2JLSA 3I8SA 3TUIC 1KO5A 2IXFA 5BQ5A 3I72A 3CNNA 4IFEA 1JR3A 1R4AA 1I4DD 2JLQA 4QXAA 4WVFA 4UXHA 1E3MA 4JL8A 1ZCAA 1WBBA 2ECKA 2IYQA 2GCPA 1R0XA 3KQUA 1KI4A 2GETA 1KNQA 5E4FA 4DLXA 1G64A 5JJKA 1VCMA 4CT5A 4P4SB 3IO3A 1GP2A 2DWQA 2IHBA 1IY1A 3I4LA 5KU1A 1GUAA 3BE4A 4H9GA 1EG7A 2W2VA 2BV3A 4AYTA 1XJQA 1AS0A 3HR7A 1NBMD 2BMDA 2VEDA 4HLCA 4DT1B 4HDQB 3H4MA 4B74A 4ZKDA 2DWOA 3NXSA 2QM8A 2O8DA 1FP7A 2D3WA 3SJBA 4C0HA 4LOAA 4QNMA 4N0EA 1AS3A 3CRMA 1S96A 2NG1A 4ASUA 5EP3A 5FFMA 1OB5A 3VU9A 2GZDA 2WOOA 1R0YA 1I4TD 2ZJ8A 2O8CA 3K1JA 2QAJA 4TN1A 4EFLA 1JJVA 1NN3A 3IBGA 5SZJA 3AKYA 1G4AE 4Q9KA 4C2UA 3QG5A 1E2LA 1VG8A 3AB3A 4L4UA 5F98A 2W0MA 1N6IA 1YR8A 1HT2E 4M8NE 4P0TA 4HB2A 1GSIA 1WXQA 2HJVA 2I4IA 3QBVA 5L3QA 3TBKA 4C7OB 2ZJAA 5FTMA 4AC9A 2QAGC 3L0SA 2VF7A 4BLPA 1Y63A 3QOFA 5FBQB 4HB3A 1E0JA 2GF9A 2ZRPA 3I5XA 2JA1A 1Z83A 1NP6A 1NY5A 4O2RA 3QEJA 4DC9A 2JCSA 3SYLA 1VKJA 1T3LA 1ZD8A 1ZVQA 5DI9A 4RKFA 1EWRA 1XF9A 4OHZA 3W34A 4ZDKA 3O8CA 3NBXX 4EQ6B 2F1HA 1Q57A 4Q4HB 2IXEA 3BWDD 1UPTA 1GDDA 1NVUQ 1KSHA 2PX0A 2WKRA 5CJPA 2GBLA 3SJAA 3TH5A 5EJEA 3X1DA 3PFIA 3U5ZB 3SYKA 4D0GA 3KDSE 1ZNYA 1E2DA 4FI3C 4DWJA 5DH9A 4AY2A 4NBSA 2ZI9A 1XD2A 3EAQA 3ADDA 2QA5A 3QQ5A 5IDVA 2ZE7A 1KO7A 2XXAA 2IL1A 2NZJA 3RS3A 4JYCA 2F43A 2QMUA 2VLIA 1DAIA 4ZDIA 3HDTA 1TTTA 5JECA 1QDEA 2GJAA 1U98A 2YV5A 2ATVA 3HU2A 3KXIA 1XCMA 4Y0VA 2NO1A 2RGXA 3B5JA 4RD0A 2FU5C 2OUKA 4NDZA 4GZMA 4PC1A 2V54A 4Q21A 1NN0A 4QJ3A 2CHGA 3K9GA 1CEEA 3HU3A 2IF2A 3I8XA 2HT1A 3QJYA 3UG7A 3K9LA 4E07A 3PG5A 2QENA 2ZI5A 3W5JA 4C7OA 3NBYC 4C3ZA 1CJMA 5EP4A 4G5GA 1EFRA 1ESMA 2HLDD 4RD1A 2BBWA 4I1UA 3AF1A 4TTPA 2VHTA 3B7GA 2CVFA 1Z28A 5B64A 1F60A 3EZ9A 1HYQA 1UKEA 1WQ1R 3VAAA 2R9VA 1E2QA 2ZI3A 2WWHA 5IF9A 4FMDF 3IIKA 1OFUX 2FPMA 1JBKA 2QPTA 1SVOA 2QAGB 1R0WA 1VCOA 1D9XA 2FSFA 3LW8A 1E2JA 4IVRA 4OHXA 4PAOA 1N6OA 3UWOA 3L43A 4LBZA 2DFKB 1SZPA 3ETLA 4B32A 3H0KA 1AQUA 4EDHA 1G3QA 1B0UA 4ZO4A 4QBHA 2J9RA 1KJZA 5J4LA 2O0KA 4TT3D 4JBYA 2JLVA 2J7PA 1CJTC 3LW7A 4MRRA 2IS1A 2PX3A 1G20E 3BH0A 4RD6A 1M74A 3TK1A 1VG0B 1I4LD 4A8JA 2P67A 1AGRA 2BBOA 3K53A 1EESA 2G9NA 4EJSC 4B71A 1XJ0A 4V0LA 2GHIA 4Y0AA 1P9NA 3FGNA 4FN5A 1Z0AA 4OHWA 4ZCMA 3NEYA 4GOXA 4XD7D 2H16A 2PJZA 2ZUCA 3TQFA 3G5UA 2RMKA 4URWR 3L0PA 1XTKA 2NQ2C 4W5HA 1PZNA 1ZINA 1P2UA 3BB4A 3TUZC 3R9IA 3SFVA 2XNDA 4PC7A 3OIVA 4QOSA 3VHXA 1HTWA 3A1TA 4M1WA 4XVRA 1G8PA 5SZHB 3GFOA 1NBMA 4AG6A 1Y3AA 4HAWA 1Z0FA 1XZPA 3CH5A 4NZYA 1JNYA 1M6NA 5CB6A 3PITA 2GJ9A 1J70A 1T0HB 1A82A 4F93B 2XJ9A 3A37A 5KPDA 1NRJB 3LA6A 3SYNA 4XTCS 1HE8B 1Z2CA 3PUXA 2B7BA 1T0JB 3K70B 5B2ZA 3WP0A 2ZU0C 3AM1A 2GEDA 1YRAA 1GZSA 1II9A 4IJMA 1AA9A 2JDID 4MUBA 2VYFA 1NY6A 2Q3FA 3HR8A 2F7SA 3WRXC 4OI0A 3SFZA 4B2LA 1DVRA 3F0TA 2BIFA 4TL6A 2C03A 5KSOA 2OBNA 5DSZA 3AF4A 1FPMA 5IRCD 1ZM4A 2D4HA 1RJ9B 1UADA 1F2TB 1T3HA 4QBFA 3NG1A 4UNNA 3MGCA 1WDTA 5J4KA 4P31A 3TNFA 4E03A 2OV2A 2G88A 4KHZA 3NHBA 2PL3A 1L2TA 4CEHB 2RGDA 4M1TA 1E9EA 5CYPA 5KDOA 5FUWA 5LB4A 1RRGA 4OI1A 1K5DA 2IYSA 5IHPA 1KOFA 4G1UC 2J45A 3U7FB 4LJ7A 1DAHA 2P3SA 2O52A 3R20A 3W5IA 4KI0A 2ZROA 2GK7A 3JZMA 2QT1A 4US1R 3GLFB 1OF1A 5G41A 4JLNA 1F48A 4A6PA 4AG5A 4EJSA 1NJFA 3SC3A 4YMWA 2WWGA 4NCIA 5F9HA 1ZJ6A 3TR0A 3PEWA 2IS4A 3QF4A 4JVLA 4QHSA 2QI9C 2Q3HA 3P32A 2JDIA 4PC2A 3KFXA 2GJKA 1UBCA 5H68A 4ZI2A 1G8GA 4MKFA 5A4JA 1F5NA 4GT1A 4OJQA 1IM2A 5CLQA 1XEWX 4JYBA 1IOZA 2ZIAA 4HEJA 1WP9A 1E2NA 2R6FA 3NTUA 3OFNA 4KVGA 4MGYR 4A0GA 1W5TA 5FBVB 3IPYA 3BS4A 3OEHA 1U0JA 2UZ3A 2OESA 3HPQA 1IN5A 2P5TB 4Q7KA 2RH5A 1N6HA 5JMTA 4U5XA 1BMFD 4ITRC 1F6BA 1I2DA 4CRWB 4EPRA 5HZKA 3LVQE 1R5NA 1S3GA 1OSNA 2RGNA 2B7CA 4HUQA 5F3WB 3EARA 4B6FA 1J2JA 2KSQA 4GBMA 4Q9JA 2ASEA 4LDJA 4LY6A 1Z22A 1RC8A 1S9DA 4KFUA 2FMXA 5L3QB 2GWHA 2VH5R 3MAAC 1OE0A 1JECA 1OLOA 3D8BA 4EPYA 4O3MA 2FX3A 1G8YA 1UDXA 4US0R 5LBIA 1KJYA 1OFHA 2R2AA 2QNRA 2P6RA 3K70D 1LY1A 4OK5A 4GP6A 3K0FB 1N6LA 2TMKA 5D3MA 4V0NA 3WXMA 4Q4AA 2CCKA 3I62A 1CULC 4L16A 1N0UA 1YR9A 1DAMA 2ZRCA 4C0LA 1TQ2A 2VIIA 2ZS9A 3DZDA 3QNUA 3BC1A 3IHWA 1P2VA 3MWYW 4R9UC 3DL0A 4GL2A 1BYIA 3E5HA 3EZ2A 4LHYA 3SQXA 4Z54A 3N2EA 3GPLA 3QKSB 3SE0A 5JS7A 2VSOA 2W6JD 1GNRA 1BMFA 3C15C 3MUFA 2VP2A 3GJ3A 4N0DA 4ARZB 1VDZA 5HTKA 4XSHA 4WOPA 3SR0A 5HZHA 1FNMA 5C1BA 3GLIE 2GBLC 1EFHA 2I3BA 2EU8A 3GJ0A 2IK8A 3IQXA 5AR1A 2C78A 3LRPA 3B1ZA 2ZS7A 3OIWA 3WHKA 4HB0A 2IT1A 4M1KA 1WF3A 2W58A 3A36A 4XWOA 1S4QA 1WMSA 2F3RA 1IN4A 3D7MA 5KYKA 2CL7X 4DCTA 5F2EA 3KJIA 2JLYA 4HSEA 4RSGA 1OIWA 1OH5A 4C2TA 3RWOA 4PR0A 2W00A 4D0LB 2DFTA 2EWWA 4PPNA 2O5VA 2GAAA 5KHOC 5D3MB 1TEVA 2JIZA 2MMGA 3R7WA 1V5WA 5FBRB 4OK6A 3FVQA 4NH0A 1S9HA 4WZBE 4ZV4A 2MMCA 2JEOA 4N1AA 1BOFA 2GXQA 4LPSA 4M1YA 1OFIA 1Z08A 3R8FA 4Q5IA 4NYJQ 1G3MA 1G5RA 2VSXA 3K70C 4PPGA 4R71A 2B8WA 2Z4RA 4PQFA 3QBTA 2ZRAA 4C9BA 2P5SA 5KDLA 2ZYUX 4LGMA 4KSCA 5EE9A 3HYTA 2FSHA 3EIHA 3QEOA 4I1SA 3VKGA 1P5ZB 2F6RA 4Q4AB 1AKEA 3P1JA 4JL6A 3VMFA 5P21A 2O8BB 3D6TB 1E2IA 1Q3TA 3REFA 4MGKR 4HAUA 3VKHA 1MOZA 3KJEA 4B76A 1NJGA 2ONKA 5J4VA 2AK3A 3ZZ0A 1OYWA 3E1SA 3GLFE 3DMDA 1NL3A 2PCLA 3RS2A 3WHLA 3VR3A 1XRJA 1AQYA 1NVVQ 3BH7A 4MRSA 3SS8A 2ZE5A 3SBEA 1DAEA 3G0HA 4JT2A 3U61B 3K09C 2YINC 2YYZA 1Z6AA 2WICA 3CX8A 3EWAA 3Q5DA 1IJEA 2UKDA 2FNAA 1XXHE 4LX0A 1XPUA 1GITA 2JJ1D 4MA4A 1Z29A 3QUSA 4WXPA 5DN6A 3LLUA 2BJWA 3RSLA 4DDUA 4JVNA 4EJSB 1VIYA 4B48A 4M1MA 3KUCA 1XTIA 3ZYCA 2OT3B 2WWIA 1WBDA 3BIFA 3QKTA 4GSYA 5JBQA 1LS6A 3EG5A 1TQ4A 1SHKA 4FINA 3DVLA 1E4YA 1LF0A 1SKQA 1FW6A 1N3BA 3AVXA 1JEDA 2WJJA 2C8VA 4LJ8A 3SHFA 4PQYA 4N3NA 1US8B 2RGCA 5D3QA 2W2XA 3KX2A 4JLPA 3F3YA 4I4LA 4B3CA 2QMOA 4JJKA 1GIAA 1W48A 2C96A 2AXPA 4WAUA 1IQPA 4OQMA 3L8YA 1GVNB 2BHRA 4ZCIA 4IHQA 4EAQA 2CE7A 3TAHA 3RS7A 3AP3A 3NDPA 1H8HD 4JBWA 1FTNA 1RRPA 1GKYA 3SQWA 1DEKA 1KIMA 3K0CC 3SEAA 1Z6GA 5DISB 1NKTA 2C5LA 2GEUA 1DOAA 3FYHA 2ZRHA 1A2BA 4PZLA 4RCYA 2FN4A 2WKPA 3RC3A 3WNCA 2IYYA 1X1SA 2AXNA 5AUQA 3U3RA 4Q03A 1GL9B 3QE0A 4AIIA 3VX3A 4GOKA 3VU9B 4ZI3A 1QVAA 2VF8A 1F2TA 2VP4A 1E99A 5JCPA 1QHIA 2XITA 3LAWA 1Z47A 1DAFA 3I3SR 5L3SA 4ERNA 3WP1B 1UKYA 1DELA 1XX6A 4RZ2A 4JKIA 4YXWD 2WIBA 5C46F 2FFBA 5CK5A 2F9MA 1JR3D 3KQHA 2ERXA 2GJ8A 4QC2A 4NCJA 2FFQA 3MJRA 4IVQA 4CVNA 4H1UA 1IJFA 1F3OA 1XFAA 3CIOA 2GVZC 3NH6A 2B92A 2RGAA 2BKEA 3C8UA 2ZR7A 1F2UA 2AWOA 3FB4A 1ZNWA 1EWQA 1GRNA 4JLMA 4KXFB 5FTNA 3BH6A 1YU9A 4Q18A 5L3VA 4LHXA 4DEXA 2ZPTX 3N2IA 4QG7A 5LDDC 3V9PA 3QKSA 1P3JA 2HDNB 4GNKA 1SXJE 5HKKA 3B60A 4URUR 3BB1A 2RGNC 2ZJ2A 1P9WA 1N0VC 1P73A 3KKNA 1DTSA 1TF5A 2H8KA 1P72A 3EIQA 2O8DB 2REXB 4MYUA 4A0FA 3A4NA 3EC2A 1UFQA 5TB5A 4A8JC 1NI3A 2ZI7A 4LC0A 1A2KC 2QPAA 1OXSC 4IXNA 4ILEA 3IIMA 3GLIA 1KDTA 3O8RA 5CM9C 2WWWA 3VR4A 4PZZA 3W9YA 2E1RA 2D62A 1E98A 4FMCF 3UK6A 3GMTA 4BFUA 3SHWA 1QHYA 4KSBA 2QZ4A 2WWFA 4HAZA 2KWIA 2WZQA 3JVVA 5EXTA 3I5YA 5EE1A 1XTSA 5KSPA 1G16A 3K9HA 4OK3A 2I1VB 3AVYA 2VSFA 4TYQA 3RRYA 2AKAB 2OFXA 3EWSA 3L82B 3QY0A 3EASA 3AF3A 2QTVB 2J0SA 5FR1A 2X19A 3AVPA 1FP6A 3DOFA 1CJVC 3CBQA 1H8HA 5ANRB 5FPSA 3T1QA 2YNMA 3AF0A 3F5FA 3OIUA 4EFNA 2W6ID 4EPXA 1JI0A 2FZLA 2NOAA 3HWSA 5CIQA 1P6XA 2J0QA 3ICEA 5AUNB 3AQ4A 1ZMXA 2CJWA 1SXJB 4EIWA 2WJIA 1YR7A 1Q3HA 2NPIA 2IF0A 3FMPB 5FUVA 4UNRA 1KI9A 4TQAA 4G0NA 5FTLA 1RPZA 1GKUB 3RS0A 4BLTA 4W9MC 2BCGY 1P9RA 5FPTA 1HY3A 5EXSA 2Q9BA 3RSOA 1HUQA 1NVWQ 1E94E 2GF0A 4TL9A 2HF9A 5KSYA 1W4BA 1W0KA 5DIFA 1LV7A 1NN1A 3WYFA 4IEIA 4TSFA 1OKKD 2CL0X 2FGKA 3C41J 3RRZA 4DLSA 3AKDA 4JIMA 2ERYA 4Q66C 4TQ9A 5IK2A 2ODWA 1XB2A 3B9PA 4BFTA 3OESA 3RNLA 2XSZA 4BRUA 4KFTA 4NYMR 4D26A 4IDPA 3B1WA 4FCWA 1KI3A 3GLFA 5JRJA 4ZCLA 1FNNA 5CJ2A 1CBUA 3KL4A 1ZW6A 4M22A 4DBLC 2WOJA 3ZIAA 2CLSA 3FKSA 4CEJB 3VR6A 4TYPA 1E9AA 2RB4A 3DOEA 4JLOA 3W6NA 3EPHA 1SHZA 2JJ1A 4IOJA 4J0QA 4AI6A 3BD9A 4Q9IA 3B8HA 3VNUA 1XXHA 3QSYA 4D25A 3TW8B 2WJVA 3TSZA 4LV8B 3K0AB 2XNSA 2QSYA 4U00A 1D2MA 4C0SA 1ZIPA 2FA9A 4D0NA 2FDCA 3DKVA 3TQCA 2NMVA 3R8CA 2V7QA 1XD2B 3ZGXA 4FIDA 2AK2A 2QBYA 6Q21A 4IDQA 1G5TA 4URXR 3UANA 1UBEA 1LW7A 4NKRA 4Q7LA 2MSEB 5GJVC 1PJRA 2UZIR 1EFRD 4PAMA 1DAGA 3AP2A 1WRBA 1ONBA 4Q7MB 4L5BA 4P4TA 5EP1A 1R7RA 4ZDJA 3RRMA 1PV4A 4ZKEA 4PTLA 1P2TA 2OFOA 5SZKB 4DLTA 2QMEA 4M2LA 2OG2A 1W2HA 1Z07A 2ZRBA 1GWNA 3QVVA 1RJ9A 3IILA 4UXIA 1N6PA 1PLKA 4Q19A 2V1XA 3I73A 2NGRA 1G3RA 2R6CA 4HZUB 1SXJA 1X86B 3FWYA 3PXGA 3PUVA 4A6XA 1U90A 2QUZA 4B3GA 1NG1A 1TQDA 5G3ZA 3RS4A 3GJ7A 4BWYA 5J47A 2ZJYA 4PX9A 3GJ6A 2EFGA 2R44A 3A4MA 3U3JA 1AN0A 4C0BA 2GTPA 1Z0KA 2IW3A 4NCKA 4LC1A 2J0UA 3I1FA 4Z51A 1NIPA 1OB2A 2X77A 4R7ZA 2NPFA 1Z8FA 4IFBA 5KNCA 1SGWA 1P75A 2YWEA 3ZIAD 3B82A 1QHXA 3FMOB 1HT1E 4ZPXA 2J46A 3KJGA 4EPWA 3BOSA 3WBKA 3LH5A 4B2PA 3GJ8A 1U8YA 2GCNA 3V4FA 4IOLA 4IDHA 2G6BA 3MD0A 3Q3JB 2IYWA 4IEEA 1KK2A 1VYTA 1GG2A 1A1VA 3GEIA 3WRYC 2HYIC 4HAVA 5KUTA 4ESHA 2QE7A 1XEWY 4GZLA 2OZEA 1XD9A 2DYKA 4TQUS 5EE3A 4MYCA 4RFSA 5FTJA 1DBSA 2GNOA 2XZLA 2GDJA 3SZRA 4DSUA 4KO8A 4B44A 4GI7A 2ZREA 1R5OA 2GCOA 1YE8A 4K81B 4DSTA 5JI2E 3DM9B 4TYNA 1VYVA 3DKPA 4QBIA 1G291 4Q9HA 1ZM3A 4XTRA 4KCGA 5KO2A 1TL7C 5AUPB 2OSBA 3ADBA 2RHMA 1Q20A 1UBFA 4LPKA 5FI1B 4NONA 1KY3A 621PA 3CX7A 2N46A 2B21A 1KHTA 5AJXA 3U7GA 2VPPA 3CRVA 3FMIA 2ZI4A 3LY5A 4RY2A 2YVUA 3ZH9B 1G6HA 4DCUA 1T91A 1U99A 1VIAA 3ONWA 2ZU6A 1LFDB 1X8LA 4BPBA 4F7WA 1QG2A 3M4YA 3BAFA 2WSMA 3JVUA 3OE7D 1MO6A 3A4LA 3B78A 1JB1A 1ZM2A 2ZUDA 3SI7A 3K0FA 2R6GA 3ZZUA 1NLZA 2W6IA 4NCNA 2FGJA 1DO2A 1OJLA 4JLVA 3TLXA 4LJ5A 1MO3A 1NVVR 4C0AC 3UMRA 1E2FA 1MO5A 1AKYA 2E87A 1J99A 2IWHA 1W7AA 3TAUA 1M7GA 3LD9A 3FHCB 2QAGA 2ORVA 3GLHB 1XMSA 1ELOA 3MG9A 3GLHE 3CX6A 3GLGA 4DCVA 1E2KA 3BFXA 1E9RA 4XH9B 4DUGD 4BFXA 5GVRA 2BMEA 4I1OA 5TXGA 4KODA 4LJ9A 3IQWA 1VG1A 1ESNA 1KI1A 2YWGA 3LXXA 4YMVA 4MRVA 2HLDA 2C04A 4HUQB 2C98A 1Q22A 4Q1AA 3KXLA 3SJCA 4OI4A 5HKKD 4A0RA 3ADCA 5J40A 1N6KA 1W46A 3U6BA 2DHRA 2QTHA 3FHTA 1NMZA 1SVKA 1OHHA 3W6OA 2GJSA 4M21A 3ZJYA 5FPKA 1W47A 1SKYB 2G0NA 1S1CA 1UKZA 4M1SA 2QTFA 4JS0A 1Q1QA 2O0JA 3A1VA 4B43A 1JR6A 3NKVA 4QM7A 1EGAA 1G6OA 4NCHA 3NIBA 1JALA 4DLVA 3BK7A 3FDIA 4BEJA 3U3MA 2G83A 3GD7A 4Q7JB 3QXXA 3A58B 1XJCA 2OHFA 3ND8A 4UJ5A 3WNBA 3O8BA 4BFYA 1NBME 2OAQ1 4URVR 2JASA 2BMFA 2ORIA 3VQTA 1LVGA 1QF9A 1H8EA 1X8JA 1M8PA 2J3EA 4B47A 4DB2A 1E6CA 2ZR0A 1FMLA 2OLKA 4KFSA 4GMDA 3HYRA 3ZDQA 2NZ8A 2CK3A 3RAPR 3EXAA 4B34A 1GRQA 3WYAA 2A5DA 4G5RA 1T4GA 3U3KA 3LO5A 5H1YA 4LK2A 3FKSD 3NEJA 1XCPA 3X1XA 2HXYA 2NTYC 2WBLC 3P4YA 4CEHA 3DDCA 1R5BA 2JLXA 3OEED 4V02A 4BLRA 2BMJA 3L2OB 4B6EA 4BFWA 1KSJA 1KTVA 3FFAA 1E2GA 4Z1MA 4V0MA 4DT1A 4F91B 4DDTA 4DLYA 4GDFA 2XTMA 1R8QA 1CR1A 3EA5A 4Q4JB 4YDHB 4X8LA 3T61A 4YMTA 5IK2D 5J4HA 1IN8A 2G3YA 2BBSA 2KE5A 2RAPA 3U7EB 4BECA 5EUQB 1S3SA 1SQ5A 2A5GA 5CDFA 1L4YA 4MQBA 2OCYC 2VHUA 2OEPA 4M4SA 4RCZA 5KTYA 1PUJA 1ZUIA 2PEZA 4E22A 3SDZA 2GVDC 3QKRA 1VECA 4A82A 3ZQJA 4B3BA 2D2EA 3KKQA 3DHWC 3TW4A 4TLCA 1YZGA 4Q4LA 4YXWA 3QI2A 4Q1EA 3QXCA 3X1ZA 3TGPA 1ZRHA 4V0OA 2OILA 4M9ZA 1XPOA 2DCUA 4NYMQ 3GLIB 1NSTA 4PHTA 1KI6A 4OI2A 1EX7A 1KMHB 1TUEA 3U7HB 4WW0A 1FFHA 1YJ5A 2AD1A 3N5CA 1I2MA 2ZITA 1G18A 3ZS9A 2AFHE 221PA 4IRUB 2BOVA 1KDOA 1XTRA 2P6NA 2IUTA 3H1TA 1GKIA 3THXA 2QRNA 4DCNA 4OHYA 3M0EA 5CIWA 5G3YA 4RFVA 4EPTA 5EP2A 3SJZA 2Z0MA 3I61A 1QBKC 3BB3A 3EPJA 3VNVA 4DDWA 5EE0A 4IDOA 1Q21A 4KJZA 1DPFA 3TVTA 1E2EA 1S0UA 2P2LA 1ZBDA 4RKEA 5B30A 4CT4B 4X8OA 2QP9X 1NG9A 4PFSA 4TLAA 2ZRKA 3CO5A 5AUOB 2ODEA 1ZUNB 5JSZB 3THWA 4LYFA 1E1RA 2FOLA 3Q7QA 2J87A 4AKEA 3CH4B 5L8VA 1YZTA 4NYJR 2ANBA 4PSKA 4OQFA 4FD2A 3ZZTA 2ZI6A 3RLFA 4PAQA 4YONB 2CHQA 5B58C 4BFSA 4ESVA 3PEYA 1QHGA 3E2IA 2JIZD 2ZSEA 5DHFA 1XPRA 4PHGA 5FL7D 4XIGS 5EQTA 3AVTA 4GP7A 1M7BA 2ZYTX 2JATA 1C1YA 2B6HA 4K8OA 5L3RA 2XGJA 1E0SA 2BEJA 1O87A 2VP5A 1KI7A 5H8WA 3KXKA 1RKBA 2C9CA 2G0TA 4A92A 1MABA 3MCAA 1KK3A 3SN6A 1CRQA 3EZ7A 4TZ0A 1IXSB 3ADKA 4DIDA 2AX4A 3MLEA 4QHYA 1VMAA 1KAGA 3K0EA 4WZAE 1EFTA 2REOA 2C9OA 3B1YA 3A1SA 1VTKA 2JGNA 2WWYA 2YOGA 3VHLB 1KKMA 4R98A 2F55A 3WMGA 4YLGA 1TX4B 2A5YB 2ZANA 1CRPA 2XOKA 1ZD9A 2KB0A 2ZSBA 2YC2C 3RANA 2ZXUA 3IIJA 4C4PA 4DUGA 1UKVY 3MMPA 4IKEA 1Z06A 3RYTC 1VG9B 3OAAD 4Q9LA 2WMOB 5EZ5A 2YWFA 3N70A 3VR1A 4I99A 4HLQB 3OE7A 4HAYA 2ZSFA 3ZD6A 4O0MA 1DAKA 2WSSA 3TSWA 1IAQA 2F3TA 1T5LA 1SVIA 3WNDA 1KNXA 5AJVB 2IYUA 5TARA 1A5TA 5FPYA 5FL3A 4PHFA 1D2EA 1ANKA 2EFEB 4LBVA 4JLJA 1KO8A 1QHNA 4HATA 2GESA 1E1QD 1KSGA 2QP3A 4WIAA 4HDOB 5LPNA 5CDFE 2LCFA 4JJZA 4I81A 5M04A 2DFLA 1COWD 3HJNA 5H70A 4D4MA 4QBGB 2FZ4A 4L9WA 2ORWA 3ASZA 2X2EA 3ZLJA 2EFDB 2WAYA 2AN9A 4KBFA 4KBGA 2QORA 1W36C 2BWJA 2FJUA 2IS6A 1XCGB 1Z3IX 4XVQA 3PJRA 4NP6A 3KB1A 4V0KA 4TSFD 2ZRDA 2XAUA 2XTNA 4PO8A 4JLDA 3UG6A 2RCNA 2VL7A 1GL6A 4C0KA 1ZU4A 2IYZA 5JWOA 2WM9B 3QKUA 3W8RA 2VRWA 1MKYA 3B85A 4GPTA 4LHWA 2A3RA 3EZFA 1XBTA 4MKHA 2V1UA 2W2TA 2PH1A 1E9CA 4D82A 4L8GA 2O8FA 1IN7A 3EC1A 1CLUA 4HLDA 4BGDA 1HQCA 2VBCA 2ZRIA 1IN6A 1D2NA 3CRW1 5FR2A 4BQSA 3PV0A 2AKYA 3PUZA 1M34E 4QKQA 2FPKA 1G41A 1JQLB 1Q44A 2A5JA 3B1XA 3BBPA 2IS2A 1G7TA 1YZQA 3D31A 3CUEF 4TLBA 1E0KA 3IEUA 4C0JA 3U3OA 3AF2A 2Q9CA 4X8HA 1TPZA 2YOFA 1VHLA 4ON9A 3IO5A 2QRZA 4GOJA 4PC3A 4RZ3A 2Q6TA 5CB8A 2XOKD 3ZD7A 2XX3A 1NLFA 4B73A 2V3CC 1Q1BA 2VP0A 2D2FA 3HP1A 4JLBA 2EVWX 1UAAA 2QN6A 2W83A 2CDNA 5JSZA 4QGAA 1N6RA 1DS6A 3CONA 3AEZA 2ZRGA 1HURA 4ARZA 4WZ6A 5FBWB 5JCZA 1OHHD 4B3XA 4F38A 2WJHA 2J7KA 4RZUA 4L15A 2FWRA 1Z6YA 1XU4A 5EZ6B 3THWB 2J0VA 4AKHA 5KPJA 3P4XA 4P32A 1KGDA 3T06B 3U4QA 1QHSA 2HJGA 1OIXA 4UJ3A 1N5IA 2JJ8A 1KYIA 2Z83A 3C16C 1JPNA 2WPDD 2Q3MA 1DO0A 1SVSA 121PA 1YKSA 2RGGA 4JT4A 3A8TA 4BLOA 4D4KA 1IHUA 5CK4A 1XMIA 1RVDA 1N5KA 2O8EB 2PEYA 2EWVA 1DADA 1M7HA 2OXRA 2ZTSA 3H86A 4LV5B 4PPQA 3RWMB 2BJVA 4BLQA 2NO0A 3UIEA 4HLUC 4D4LA 2IX3A 4XSGA 4YMUA 3EPKA 4FCVA 4OHVA 1KO4A 1KMHA 1XWIA 4LUCA 1VCNA 1KI6B 2C77A 3K09A 4CZ2A 3VFDA 5B57C 4Q01A 2W6JA 2FV8A 1NMYA 2FSGA 2GKSA 1FUUA 2YZ2A 1E4VA 3NWJA 1IXRC 4JLKA 1Z0DA 4LHVA 2HT6A 2PCJA 3KB2A 4IVPA 1IXZA 1L7VC 2ZVQX 4LHZA 3T1VA 1MH1A 3GFTA 2VHQA 4TWZA 4M0LA 2X8AA 2ZQ5A 1G8HA 4NE2A 3VX4A 1MRNA 3GJXC 3UATA 4UKDA 5FOVA 2DPXA 1GILA 2IEZA 3LBHA 3LDAA 1J8YF 5FOWA 2F1JA 2J0UB 1OXXK 2EQBA 4II7A 4DSOA 2OCAA 4E09A 1JXMA 3OF5A 3B2EA 3RRNA 4KLNA 1VPLA 4DIEA 4B3FX 3W3AA 4RD2A 5EXPA 2ZJZA 5DI3A 3A1WA 1OIVA 2CMKA 3MJHA 5KDDA 2V6IA 3IHLA 5JJLA 3DEFA 1OKKA 2AWNA 3FFBA 4HAXA 3T34A 3W6PA 2OO7A 3RS5A 1NMXA 4PXAA 1UEJA 2HXSA 4XWKA 2GZAA 3U44B 3U60B 3DO6A 3ICQB 4MUAA 4PQRA 1LS1A 1AM4D 2R62A 2F1IA 2SHKA 1Z0JA 1D8TA 4JVMA 4MRPA 3UPUA 1MT0A 2WVJA 1GNPA 4MYHA 5DN6D 4D2IA 5KNDA 1COWA 4PPFA 3AVWA 2A78A 1WCV1 3IGFA 4BEBA 1FL9A 3KJHA 1O3YA 3BRWD 1ZNZA 5KSZA 1U2RA 2G1JA 4JZKA 4M9XA 1YQTA 1T6NA 4QFMA 2GRJA 2CL6X 2ZJOA 4MGZR 4Z1MD 3I32A 4AWXA 1W36B 4M1OA 2WJGA 4YC7A 1U8ZA 1PLLA 3TJZA 2R6DA 3Q5EA 3DM5A 4DLZA 4WBSA 2P6UA 3U44A 1XEXB 3CZQA 1U9IA 2J1LA 3AVQA 2BKUA 1YHNA 1QHHA 4QRHA 5E95A 3NBZC 2ZRFA 3QXSA 1WB9A 1T5IA 4MH0R 3JZAA 5FI0B 4NHOA 5FUXA 4CW7A 4BASA 1EFUA 1N5JA 1P7CA 3CM0A 4MRNA 3AKEA 2HUPA 3V4RA 4P4UA 2CCJA 4DEYA 1NNEA 2BM0A 3BXZA 3VR5A 1W44A 2QQ0A 1LB1B 5A0FA 3BFVA 1H8ED 3PR1A 3THYB 4QGHA 3MWKA 5CITA 5BYKA 4DLUA 4TLDA 5TVKA 4QJ5A 4AD8A 4TMXA 1E2MA 2WV9A 3LFUA 2WPDA 1N0WA 1VYUA 1ZUHA 4LJ6A 5A5GA 1GAJA 4DLWA 1XZQA 2PZFA 4DJTA 2A30A 1LNZA 3MRSA 3IEVA 4TL7A 4HZIA 1ZD1A 2VQSA 2QL6A 4OKSA 4XJXA 3S1AA 3BERA 2NO6A 3CPHA 3TIFA 1L8QA 2RGBA 2Z6VA 1BS1A 4A2QA 2O8EA 821PA 4TTQA 1W4RA 2GILA 3PIRA 2D7CA 1SULA 1HE1C 4LWZA 4OQLA 3LVRE 2DY1A 2MSDB 1E1RD 3CKLA 2VP9A 3WBJA 4XOIA 2F1RA 3U4QB 5BN5A 2PJRA 5HE8A 2JLRA 2XEXA 2ZJBA 3KKPA 1J7KA 2XB4A 3CF2A 2BC9A 2ZEJA 4KLZA 3T5DA 2IYLD 3KKMA 4W5WA 1QVRA 3MSXA 4LZZA 3CR7A 1IY0A 2GAOA 1AZSC 5HE9A 2YJTD 4POAA 5LD2B 5G53C 4BZQA 4UNSA 2N42A 1E96A 3ND9A 1YRBA 3CNLA 3THXB 4LJ4A 1RE0A 2G77B 4DLRA 3B13B 5BWMA 4OYHA 4RD3A 2OCPA 2ZVPX 1CJKC 3I92A 1MO4A 2OLJA 2XNDD 2ZRNA 4A2WA 1GOTA 3Q85A 2CEAA 5E7IA 3RC8A 3OZXA 3IUYA 2ZAOA 5EE5B 2BEKA 4QGFA 2PMDA 1BKDR 1XNJA 2H5EA 4A4DA 5SZIA 3SBDA 5FBLB 1PVOA 1Z5ZA 3R9XA 3QPWA 1ZCBA 3LX5A 4TMVA 1SVMA 1FQJA 1V43A 5FUYA 5BXQC 5UKDA 4XWAA 2RHDA 3R9WA 1SKYE 2CLCX 1ZP6A 2H57A 1W1WA 2XTZA 3TRFA 4PHHA 4HDCA 3CWZA 4IXMA 4FWTA 4FWIB 1RZ3A 2GK6A 1C9KA 3CPEA 3KTAA 1HH4A 1VCIA 2CNWA 4KYIB 5TY0A 2P0EA 2Q9AA 4PZYA 5G40A 1KK1A 4GRAA 4R2HA 2C99A 4D80A 2WMNB 1E1QA 1CR4A 2WIAA 4BZPA 4TL8A 1OXVA 1OT3A 1FQKA 1UEIA 2QQEA 1KSFX 3P20A 1FUKA 2ZAMA 5C2JB 2D74A 4KU4A 2F43B 5K8IA 1G1MA 1NVXQ 2KBEA 3Q9LA 3OAAA 3LWNA 3LXRA 2QPOA 1YVDA 3NVAA 5C18A 4BRWA 5JS8A 5K8UA 4LYJA 2OM2A 2ZRMA 3TE6A 2DBYA 2E9SA 2VP6A 1NSFA 1YZKA 3AH8A 1G5PA 2Y8EA 4RD4A 4NL4H 3AVOA 3NHAA 4B33A 1KJWA 1OV4A 4RZXA 1N2CE 3C5CA 3EW9A 4BZXA 4TYYA 3FHOA 5LB2A 2XZPA 721PA 3T35A 3LV8A 1IBRA 4EQ6A 2IUSA 1QZXA 5BN4A 1G19A 2QGZA 1N6NA 4G5QA 3CZPA 4JKYA 2ZR9A 8OHMA 1XEXA 3QXJA 3WMEA 3TMKA 2CHVA 3G82C 1BO6A 1XXHB 1KI8A 3PEVA 5HPYB 5J4YA 1S1MA 3QPVA 1H65A 4FW9A 1TU3A 1W4AA 2GEVA 3GEHA 4G5SA 3HU1A 4W7SA 2LWIA 1UBGA 1PUIA 3KTAB 4JLAA 4IOKA 3CRQA 3PENA 5JRZA 2V7QD 3K8YA 2JLWA 4B35A 5KOYA 4C30A 2LKDA 5LD2C 1AK2A 1XTQA 1Z6TA 5DE3A 4B2IA 2IBMA 4BFVA 1B23P 1P60A 2O0HA 4QJ4A 4NYIR 4D4JA 3RVBA 2XZOA 2D7DA 3FPAA 1G9XA 1II8B 3ZQ6A 4F92B 2QU8A 2IA5A 1XMJA 2ZYWX 4UQOA 2FG5A 4B75A 1CKEA 1MRSA 5JZVA 2QGNA 3GLGB 3CRRA 5DI3B 1MR3F 5GJWC 4AURA 5AJYA 3AKCA 1E32A 2EFHB 3K9NA 4TZ6A 4DRZA 4D81A 3A6PC 4G5OA 5DGXA 2Q21A 4Q1CA 2F9LA 1Q1EA 5DLQC 2HEIA 3O8DA 1P4SA 1R2QA 2YHSA 4C0QC 4GMXA 1W49A 4LJYA 1Q0UA 3KZ1E 4P4SA 4BLSA 3UXMA 2H92A 1KMQA 4KFRA 4HYYA 1XDBA 4DXAA 5DNYB 1FX0B 3EPLA 4FMCB 5GADl 3C5HA 4JSYA 4LSGA 3T1OA 1ZYUA 3GFPA 3LLMA 1TUIA 1S8FA 2ZJ5A 1G4UR 3REGA 4ASUD 2J59A 1XTJA 2VHCA 1A4RA 4MDFA 1AIPA 4GFDA 4EFMA 1PLJA 3C14C 1UJ2A 2IYXA 1QG4A 3M6AA 5BYJA 3KQNA 1ODFA 2NO9A 3QG1A 4FMDB 4HUTA 2ZS8A 2PBRA 5JFGA 2GXAA 4RVCA 4CEIB 4RJLA 2P65A 3LQQA 5FPHA 5BW8A 1RRFA 3AVUA 3DZ8A 3PUYA 4ACAA 4U02A 1R10A 4AKIA 2ZRJA 4S35A 3V00A 4E5UA 1TF2A 1E9BA 1CR0A 3FOZA 3NBFA 5JLJA 1TNDA 2KI5A 4ZDWA 4MITA 1U9IC 1J90A 4LYAA 4JMPA 4UNPA 4M9SA 1NLYA 4O25A 4TYWA 4CDGA 2ZYVX 2J7PD 3FTQA 1NIJA 3CLVA 4A0HA 4HB4A 1M2OB 1N25A 2CVHA 3H2YA 3F8TA 2PLFA 2GXUA 2GZHA 1ZM7A 3AGPA 1ZC4A 2PZGA 3ZVLA 4URZR 2X1VA 2FF7A 2PZEA 4YMSA 3MWJA 5FOUA 2UVQA 2VTKA 3W90A 1XEFA 4Q1FA 4Z8YA 1E2HA 3OEEA 2CK3D 2RKOA 1KKLA 3CF6R 1FX0A 2BVNA 3OFND 2QY9A 4BFZA 5JHHB 4AYWA 2J41A 3C4JA 3FKQA 1G7RA 1X6VA 3BFKA 3CB4A 5JJIA 3LBIA 3IBYA 3L0OA 4FXPA 4R2IA 2IWRA 2C2HA 5IT5A 3TUJC 2AR7A 5L3SB 4QHTA 4QL3A 2IYRA 1QHHB 3ZVRA 4LBYA 1YZNA 1RRCA 1XD8A 3OHMA 4Q4JA 4DDVA 3AP1A 4NMMA 4DHEA 1A7JA 1W36D 1E9SA 3KQLA 4EKDA 1KDRA 1QRAA 4HZUA 3DMNA 3PCRB 5FL7A 3L8ZA 3THYA 4A15A 1G3IA 4UNQA 4AYXA 5C4MA 3T1TA 4LI0A 2WKQA 4JSTA 1C4OA 1TMKA 4A2PA 3GEEA 1II8A 3WYGA 3KKOA 1K6MA 1IONA 1M1YE 3SU8A 4TMKA 2O8FB 2WWXA 2A7QA 4I1VA 1G8FA 4DB4A 3RHFA 2QP4A 2ZETA 2JLUA 4URYR 4KAXA 3AUYA 2DB3A
chains in the Genus database with same CATH superfamily
2Q41A 2J5XA 3UK2A 4B3HA 4KRFA 1NW3A 1Q92A 4LBWA 4ND2A 4AKGA 2CBGA 5AVYA 3RTGA 3H3JA 1R6DA 3QE4A 2I1QA 3QE2A 2OE2A 3QIAA 4O2LA 3KFVA 4WKCA 5IVDA 2XE8A 1SBNE 1Q50A 3VZSA 4IW3B 1XMVA 3EJ6A 3P27A 3B1VA 4Y6SA 1XE3A 3DCNA 5CHEA 2EW2A 3HJTA 4WBNA 2GAJA 5B6PA 2XCQA 5IVHA 1T4MA 4CKXA 3EA0A 5BNTA 4QBKA 5LOVF 4R2KA 3AHGA 3GX1A 2JJ2D 3NHKA 2ERCA 4GMGA 5A7HA 2WK1A 4BMCA 3UMFA 4BQOA 2ACKA 3KQVA 5JH7F 2XVXA 4LYGA 1BH2A 2YY7A 1KQ3A 3LLCA 4YAJA 4UULA 2AFIE 4TKVB 3T5GA 3BMCB 2WAXA 4GWGA 3QYJA 3R9KA 4TSRA 1KHHA 5F23A 5ELXA 4TMWA 2YKGA 2CNWD 3IT0A 2JA2A 2HA3A 4OQNA 3AI1A 3KQOA 4RYLA 5FOTA 1D7OA 4UCQA 4L9SA 5LZ2A 1QG6A 3E22A 3ZEIA 3WX0A 4XYEA 2Z4TA 3DEJA 3PCXA 4BQIA 4JP5A 3ROFA 1I01A 2OKCA 1NPYA 2VO1A 4H7IA 2V8OA 5ECGC 3ZXIA 1P2SA 4M8IA 5K8LA 1SXJC 3QFFA 2Y1FA 2C2XA 4UNIA 5LU8A 4IIBA 3SF8A 3F7TA 3QU9A 3U2QA 3KEOA 1EUDB 1WE2A 3DAPA 5CVJA 1I7LA 5KTOA 2IKSA 3ROTA 4KQEA 2BEWB 3WQBA 4DKXA 5JCOC 2HIHA 3BE8A 1OFTA 2OC4A 2P2CA 3CY6A 4FS3A 3ZWCA 4BNMA 2QE7D 4H4DA 5E3HA 3ECCA 3LZCA 2QTRA 3QUTA 4C7XA 1SXPA 1KRWA 2XUQA 3KDAA 3PGJA 2JFHA 3NYQA 5GIOE 1E79D 1UODA 2GZ3A 2HY7A 2XMGA 4R2JA 4P36A 2ASVA 3NC1C 1ZDMA 4E51A 1XZIA 2WFMA 2CLDX 3G88A 4IDAA 3Q72A 4KXYA 4S0XA 2F55A 3ZGYA 3ZJUA 1Y7HA 1G5FA 4NBUA 5AYVA 1CHNA 1CG6A 2HWYA 5LP1A 3DWFA 3K5HA 4EK9A 4P1ZA 1GD1O 1GUZA 1P1FA 3TG2A 2WHYA 2EBHX 1Z0IA 3S44A 3FMFA 4X64B 5AQ1A 3W7AA 3MWDA 4UXJA 3WV5A 4UD6A 4HH1A 1NNSA 1DARA 2PHZA 4D9EA 2NZXA 4FJ0A 2I65A 4CMIB 2XODA 3RVNA 1ZONA 2VDNB 5BR7A 1E58A 2O8CB 5CHYA 2K5UA 1DG1G 3GZJA 3R4VA 4D9FA 4W8OA 1VL0A 1PAUA 2HYDA 2QRQA 4H3VA 3BWMA 3EEOA 3EMKA 2VJDA 4LOJA 4CIDA 3URMA 2L17A 5A62A 1NBAA 1ONSA 1LA2A 1Z34A 4H6XA 4M0MA 3SYTA 1Z9BA 4A7PA 1GPJA 3VU8A 3KZXA 3OQBA 3ZY4A 1P62B 4PCAA 2WU0A 1GZ5A 3NGXA 1JKJA 4U9IS 4HDMA 1BYUA 1EFCA 1YGPA 2WJYA 4RFSB 2HJRA 3F6RA 4Z8XA 4HI0E 5DYTA 4EHBA 3ILVA 4BUJA 2RFLA 5BXYA 4KX3A 5E7MA 2WM2A 3O5AA 5TMPA 4D9HA 1NQ5A 2C2KA 5HX7A 4NK5A 1H6BA 1QAMA 4UU1A 5ALWA 2NTNA 2FH5B 4B1FA 2QM7A 3E23A 4FPXA 3MJDA 5E1DA 3JCZA 2YFKA 3FE2A 2QD5A 2OGZA 2QJTA 2I7CA 3KT8A 3QVWA 3ZV7A 1MO2A 1SXJD 4P0QB 3R9XB 5EMHA 1I0LA 3CTMA 3HKCA 3OMWA 4TZTA 3T52A 3Q9SA 3LTNC 4N5DA 1NW6A 3TZCA 1Y9JA 3H17A 4OQDA 5ENDA 3UJBA 1NQAO 2PT6A 4TMZA 4E6EA 3U56A 2HRDA 1PKXA 4QE3A 3O93A 4MYDA 1A88A 1U3VA 1X80A 2JHAA 1GXSA 2JRLA 3B9BA 4EG3A 2R7AA 4UHCA 5B1EA 4E7PA 1P0MA 1X14A 1I7QB 3OUTA 4GW3A 2DRIA 3I2KA 4JNCA 2CJYA 4IINA 5HCNA 1ULAA 3I01M 3T0GA 1N8KA 3L7JA 1LF5A 2CNLA 3MERA 1JR3E 3C48A 1ZIOA 2CLLB 3SF8B 1NTOA 1W35A 1YB4A 3ZY3A 3VVCA 4PIPA 1V6SA 4BB9A 1Y42X 3BORA 4PQEA 4U4AA 3WYNA 1E69A 1N8SA 4IZ6A 5AJZA 3M5DA 3MMNA 5DYIA 3L6OO 4BCDA 2QRMA 1VJ5A 3PU6A 2D06A 2HGSA 2WHXA 4JJ7A 4OBEA 3ML1A 5TGTA 3LZDA 4TMTA 3TKYA 3ZGOA 2EFCB 2Q0HA 5DO9A 1XP8A 3HCRA 1UMBA 3AFOA 4PZ0A 2XTAA 5TDHA 2YR0A 3V97A 1KQFA 1UP4A 1WHTA 1VKZA 5F1PA 3R0IA 4GI5A 3U80A 2R8XA 2OP0A 3DBLA 1SKAA 1Z3CA 1DIRA 1R15A 4FSDA 3U1TA 1KOGA 1DHTA 3OX2A 4RTJA 4R1SA 5A6SA 1JAHA 1MB0A 1QGAA 1MAWA 1EGVB 3E9ZA 3O1JC 1M8KA 3B20A 4XIJA 4ZIRB 2QI9F 1E7SA 2FWAA 3ENWA 4JGIA 2QDKA 5JAQA 3WSWA 1U0HC 4V0ME 4LXQA 4P3PA 1R0LA 1US8A 4HK4A 4I66A 3M4NA 3IDFA 3TNJA 5LOVA 1JHDA 3MBIA 4MS4B 3PQCA 4XD7A 3LQRA 4WBNF 2HGZA 2MCFA 5AMXA 1JXOA 3DEKA 3O47A 3RYHB 2IEAA 1RW4A 4NX2A 3RSSA 1D1SA 1ZGHA 1ZRNA 2QRVA 1CDZA 3CLUC 1A71A 3UJAA 2IU6A 1JPJA 4FKBA 1K4MA 2H7VA 4E5DA 1RRMA 2EX4A 2XIQA 5JWHA 3PQ3A 3GF4A 4LCBA 1KQOA 3OC0A 3S3TA 2ZWIA 1XAGA 3VAYA 3PGKA 2OBLA 1GGVA 1AG9A 2JW5A 2Z5GA 1T6BY 3UAGA 1Z2OX 5EMKA 1GG9A 1T8RA 3D6NB 3N8IA 5A7FA 3UWMA 4KVFA 2VWGA 4TKLA 2PKCA 4QELA 1Z4MA 1USGA 2QBYB 4GPD1 4DV6B 1KH1A 3RTDA 4AK9A 4OB6A 1Z82A 1Z4IA 1ZO8A 3RKRA 1Y3FE 1W2GA 3OEWA 2XBLA 3E70C 3E15A 1LTQA 2CNOA 4L6IA 1WWKA 3OE4A 4MKIA 1IBLB 1JWBB 3GLHA 4TOIA 4YV1A 4ZHSA 1G2IA 3N5KA 3ASYA 1Q12A 4MWOA 1IMOA 2BCJQ 3N8HA 3KPVA 3ZI4A 2REQA 3PUWA 1R3UA 4AL4A 2R8RA 3D4IA 4KV9A 5HJ5A 1N2IA 4ZEOA 5BV7A 3CTPA 3D02A 2CE2X 4IX9A 4MWDA 3QXGA 3VAZA 3ZKAA 4AT1A 2R2GA 2YOHA 3W1VA 2VDUE 1UWCA 1E62A 1FBTA 1CQXA 2R8BA 3DGEC 4KC0A 1A7KA 4FZVA 4ZVSA 3W2IA 1U1DA 3MGBA 2FWJA 3O3NB 2R4UA 4MS4A 2P2SA 4YRMA 3A28A 3EQZA 4J0HA 4OA8A 2DECA 1XZCA 4FT2A 1IEVA 1XI2A 3DEAA 1SQGA 2FR1A 1L7XA 4NF2A 1NRXA 2GT1A 3OT5A 1YQGA 3JALB 3DCJA 3FDZA 1P77A 4UBMA 1T3SA 4P7JA 3UFBA 2ZSDA 1Z33A 3DUFA 1ZNXA 4V03A 1JKXA 4ANFA 4QM6A 2X2FA 4FE4A 3WKDA 5K8TA 1Z63A 2M1XA 1BCRB 1V96A 3KHSA 1MIHA 1IK6A 3FPGA 2FZCA 3CYFA 4KQFA 2F62A 1GPUA 2AGVA 4RMNA 3FVTA 1PFYA 3UUFA 1U5BB 2HA0A 1CXZA 4KR6A 4NTZA 2Y92A 1KI2A 5L9AA 2IBSA 3Q6MA 3DUWA 4ZVLA 5SV2A 3TSOA 4U7JA 4R83A 4NCXA 1X3SA 2B94A 2N1BA 4C7MA 2Z09A 3CWQA 2BM1A 1GLGA 5I7OA 4IJWA 1G7CA 4OAQA 1L4UA 9MHTA 4I1YA 4F46A 4JI0B 2R11A 4FFSA 1J2YA 3Q7EA 2NVWA 1A9OA 2FYTA 3T12A 3CZ5A 4NHEA 1GU0A 2QW8A 4U0JA 3A04A 5BV8A 3ZLUA 4YLYA 3BGWA 1IEQA 2J6CA 5ITZA 2XVYA 4OXIA 3OZUA 1ETHA 1VL1A 2IXFA 5ALSA 3I72A 4IFEA 4L07A 2NNWB 2VS1A 4WVFA 1KYYA 2B1IA 4UXHA 4BNWA 1HT0A 2PX5A 3FBGA 3KLBA 4GKVA 4O5OA 4KXQA 3WNZA 1PVDA 1DV1A 4WFJA 3ZDRA 3ZWNA 1R0XA 3NV7A 3U48A 1KI4A 2WFAA 1EFVA 1DXQA 3CT4A 2ATIA 1Q77A 2K7FA 3QVLA 3LLVA 4M99A 3E9QA 2DP4E 4DNOA 4CT5A 5I45A 2IPAB 2VPYA 2NTVA 3GVXA 3Q11A 1IY1A 3I4LA 1OGJA 3K92A 3F1LA 1Z2PX 3TZKA 5HVNA 1VL2A 1AT1A 3D1JA 3LC0A 2BV3A 4DIBA 3JQEA 1AS0A 3I2HA 3LPLA 1TD9A 5KQPA 1NBMD 2VOJA 1PQYA 3JWHA 3NBAA 2VEDA 4HRVA 3V2GA 4DT1B 2AEEA 3K4PA 4HDQB 4YN3A 4XW2A 5CFLA 2DWOA 5DSXA 4MW2A 3SQMA 2O8DA 1H2AS 3ESDA 2GYWA 2RGWA 3V8BA 1OPRA 1UMKA 4QOGA 4QNMA 1AS3A 4ZT7A 3DLBA 3CRMA 2NG1A 2I4LA 2YW9A 4XEHA 5CT6A 1N9KA 3HBLA 5EP3A 4ASUA 3ILXA 4C78A 2AMYA 2IPOA 3ZN2A 4CCYB 3KO8A 2GZDA 3VNRA 1CZOA 1PW7A 5D00A 5HKLA 2IZ7A 2ZJ8A 3ESZA 3P5BA 1UJ6A 1FB5A 2YQ4A 3TIXB 2O8CA 4WLNA 5GVSA 1NN3A 3IBGA 2Q6OA 4G4IA 4RPJA 2JBAB 2B78A 4IF4A 4RY8A 2BUBA 5SZJA 3C3DA 1DQPA 1DT5A 4BCBA 4ITUA 4DANA 4WN3A 3EY4A 2PUWA 1AKNA 2Y76A 5FCDA 3G23A 1QB8A 3FDZB 2GOYA 4GKAA 3E27A 4E70A 4LWOA 4EZEA 5L3QA 2HJVA 4OG2A 1WD7A 4AY3A 3BM5A 1ZMTA 1G55A 1ZK4A 3D2CA 3N6XA 4L4SA 4D46A 3LCVB 3GRUA 4RKYA 5ESWA 3K9QO 3M6WA 5CFRA 4KW7A 4BLPA 1Y63A 1TYEB 2EFYA 2FXIA 3QOFA 4PN7A 1XRNA 4C88A 2VZ0A 1HRKA 3WKEA 4O2RA 1D1QA 1NY5A 5B58T 1V6AA 4CF6A 4YAFA 1DC5A 3S8YA 1S8NA 2C84A 4B6OA 4N39A 3D54D 2WRZA 3NTQA 3VO2A 1L4BA 3PWKA 5FLXA 1EWRA 3FSRA 3IVRA 4RHTA 1QONA 3ON5A 1KYWA 3W34A 2HCFA 4P4LA 4G0PA 4Q4HB 2JK0A 5GGXA 1SZJG 1YC5A 3M2TA 1DGQA 2IH2A 4CQMD 1UPTA 1TC2A 1GDDA 1W19A 2O3JA 5CJPA 4ZYUA 4BTVA 2GBLA 3NP9A 4P3KA 4Z53A 2W37A 4KOEC 4Z1OA 3PJGA 2JEZA 4F56A 2B30A 3SYKA 4MV6A 3UJ9A 1CT9A 3LCCA 1K8QA 1V16A 1Z45A 3L6RA 4FI3C 3C43A 5FO0A 4DWJA 1VJGA 4NG4A 3EXG1 4AY2A 3DBHB 2QVLA 2ISSD 1BD4A 5HS6A 4DIKA 3ADDA 2P27A 2QA5A 3UJHA 3GGGA 1V16B 1A9QA 2B1RA 1CUGA 2Q3JA 2X58A 3E2MA 3OPQA 4N5NA 4D56A 2BTEA 4JYCA 3H1GA 3TE7A 1GTMA 4D43A 3FPEA 4ZDIA 1RXUA 4AS3A 3TW0A 2C2MA 2KX7A 3V1MA 1HDIA 3HCAA 4KDCA 3WGHA 4Y0VA 1ATZA 2AV6A 2C3YA 1S2DA 2ON6A 4IDCA 1XQWA 3TD9A 2AW5A 4EBFA 1Y8QA 4QATA 1B2LA 4XXHA 5LDGA 4OF4A 5I8PA 3B5JA 4B7UA 2VDMB 4G1CA 2O1WA 3D8RA 2UXDB 4RZIA 2DY0A 3I2JA 1M6EX 3PGXA 4NDZA 4PC1A 5TVGA 4AF7A 4Q21A 1N7JA 2UZ1B 2Q5LA 4GWLA 1ZN8A 5DWVA 1NN0A 4QJ3A 5KYWA 1TOAA 4RFLA 2CHGA 3H2GA 4GOND 4LGYA 5KSWB 1T2DA 1O95A 1QIKA 2B9EA 3B3QA 2AI2A 1GZ6A 3OQPA 2IF2A 3I8XA 3QKIA 4WTOA 3E7PA 3LA8A 4UFOA 4B3IA 4MWSA 3CRZA 2ZIVB 3F6PA 2VHVA 3FDFA 1O9HA 3FWNA 3PG5A 1OREA 4KUEA 1EK2A 1FRZA 2C8KA 3H4VA 3LPMA 4C3ZA 4C7OA 1JH9A 1DRJA 5EP4A 4G5GA 1ESMA 3AESA 1N7HA 5SY6A 1H6AA 4F5ZA 2EG5A 2FEKA 4P6VF 4PEVA 2VHTA 1EEHA 3A0RB 3EFHA 4TTPA 1SM4A 4HNQA 5B3AA 5GP1A 1LC0A 4M3NA 1F60A 4INOA 4YTEA 3P0HA 2JFUA 2X5OA 1WQ1R 2YQ5A 4M0EA 2R9VA 1J1ZA 2CZCA 2ZI3A 2WWHA 2NU7A 1B42A 4KR7A 3IIKA 2FPMA 1EWVA 1PR5A 2AJLI 3EUWA 5ALMA 1A76A 3HDGA 1ZN2A 2QAGB 1CVIA 4FHCA 1D9XA 1XMXA 4IVRA 2Y9MB 4LBZA 1KAQA 4BN0A 5CXQA 4QEDA 2EHJA 1QP4A 4UOEA 3UOWA 1KYXA 3H0KA 3L3BA 4KLRA 4MWGA 1KXZA 3TBHA 3VKUA 1IM5A 5BN3B 2PUAA 2PUFA 4NSNA 1UXOA 2ZK7A 3C8HA 2BZSA 2PT9A 3HSKA 4NCBA 1JLSA 2B34A 2YXBA 2O0KA 3DG9A 3OA0A 2RJNA 4EJMA 3I9JA 1KR5A 4Z7JA 5TGZA 2FN3A 4WK4B 4F5DA 2CHUA 5IH3A 4B9EA 1G20E 3UY4A 1OMOA 3LOUA 1M74A 1WV0A 1GSAA 3NQ41 1LEHA 2Q5QA 3PFCA 2I2CA 2P67A 2YRFA 4FYKA 2BBOA 1B16A 3JYLA 4CNBA 3SZUA 1EB8A 4U9HS 2C3PA 2E37A 1SUWA 2Q0XA 1CNMA 3JQFC 3TQQA 1OD6A 4XQGA 1ZWLA 4Y0AA 5JDCA 1RS0A 2D5AA 5JCJD 2F9FA 2XBUA 4OXNA 4XD7D 2RG7A 1JNXX 2I3ZA 2PJZA 1KFKB 2ZUCA 2H2WA 2RMKA 3G5UA 3NPAA 1RYEA 2HREA 4M1EA 2VWQA 4UHKA 2LBPA 1PZNA 3ZGVA 1P2UA 3TUZC 3R9IA 3SFVA 3S29A 1E5DA 1I6KA 5IJ0B 3OFJA 1N3YA 3REQB 3QWIA 4JJ6A 4WNYA 2NXNA 1I5OA 2P78A 3A1TA 3C6MA 3ZK8A 3FVVA 1YZVA 4IX1A 4X95A 1U3DA 2XE4A 4COKA 3KXDA 4FDLA 2BDEA 2PXAA 4KWIA 4D57A 1JIUA 5KNDH 3QU7A 4FYVA 1XZPA 4NZYA 1W93A 1PCXA 1P2FA 1SCKA 3QJ5A 4DNQA 1EJ2A 2B1JA 3FYUB 1JNYA 2WINI 3GI1A 1J6UA 4K6FA 3PITA 2ISQA 2I8AA 1AK9A 2ZTVA 3U4GA 2Y4NA 3OPMA 2FSSA 5EHIA 3SYNA 2EZ4A 1AXGA 3A1NA 3C3EA 1Z2CA 4PRLA 4D8UA 3ZHYA 1CDDA 3WP0A 1QDUA 3GGPA 4HWSA 5I7AA 4AUEA 4S1PA 3BSFA 2AJ8A 3WYBA 2FKNA 1JTEA 3IIIA 2WC1A 3F4KA 4JEHA 7GPBA 1I6WA 3GPDG 4XWWA 3G5MA 2F7SA 3OZCA 4HQKA 3T7CA 3F0TA 3K32A 3FOBA 1T8YA 1AZWA 4PZPA 5KSOA 1XZKA 2OBNA 4ZJZA 1BEUB 5DSZA 3ZD8A 2C57A 1BEEA 2R7MA 4R0VA 3AF4A 1IBCA 1FPMA 2DTXA 1ZLYA 4JZYA 3IBSA 2D4HA 3LFHA 4A16A 4MJLA 3QYFA 3T3EA 1KFEB 3PR2B 1KEWA 1BAPA 1YCGA 2JAHA 2VJQA 4I55A 4FONA 3TNFA 3L9WA 3BIXA 2P3LA 5IAGA 5TT1A 3RVLA 3CCBA 4BQQA 3WL6A 2WMDA 1SKBA 1H66A 1L2TA 1AKTA 3Q3VA 2P3QA 4M1TA 1C81A 4MQFA 2ZBEA 1EVQA 3CMCO 3FHJA 4ILKA 3DLTA 5IUJC 4MA0A 3ZCXA 2IYSA 1XHLA 3M2PA 3C70A 5IHPA 1ZGJA 2RHOA 4GX2A 3U7FB 4WXMA 5CX4A 2ZTUA 2ZROA 2GK7A 4US1R 4F12A 2QK4A 4RU1A 1AQIA 5HZMA 1OF1A 2PWZA 1B26A 3K94A 4ZANA 4A6PA 1DMSA 1P91A 3ERCA 4YMWA 5KNCH 2C7GA 2CYBA 4JVOA 4NCIA 1YHYA 3AB7A 4ZAVA 1QH8A 3DBVO 5BUZA 2P9CA 5DW0A 1ZH6A 1N2OA 2GM3A 3ANMA 4WESB 3HUDA 4XPZA 4JVLA 3N7AA 3GN2A 3SY8A 1DAOA 2Q3HA 4DW8A 3TDNA 5JE8A 4IY1A 2GJKA 1HOXA 1RM0A 4NBKA 3OLYA 1V3VA 2CFSA 3TIIA 1C3XA 4KGZA 1G8GA 3AU9A 3KPYA 4EB3A 1N2EA 4ZI2A 5HM8A 1F5NA 1Y3BE 2WD9A 1V7CA 4O0LA 4WACA 4J3NA 4GMKA 1L1EA 2DAPA 1F5SA 3D2LA 4L95C 1MDBA 1TT7A 2R6FA 3NTUA 4MGYR 5AJUA 4OO3A 5ED0A 4ZVTA 3HUUA 4MPJA 3PE6A 3GG9A 2C5BA 1N6HA 1U3UA 4XLTA 3KCQA 2IE0A 3Q9UA 3JU3A 4OUDA 1QQTA 4WNAB 1YBFA 2I67A 2XLBA 1QIFA 1S3GA 1GPKA 1KEUA 1U0GA 2RGNA 2OD9A 4RKRA 4D9JA 2IHKA 5F3WB 1N77A 3RT1A 1IQ0A 1J2JA 4GBMA 4Q9JA 1UJBA 3ZX5A 3UMMA 4QVIA 2ASEA 3F6SA 2D54A 5ICCA 1L5LA 1Z22A 3WAJA 4LJRA 1F38A 3E18A 3L7BA 2CHFA 4DLLA 1FMTA 5L3QB 1H0RA 4E5VA 3NVKI 4E4YA 5LZ8A 3PQFA 1Q7RA 2WB2A 1E1NA 2IQ5A 2J9ZB 1O08A 3OE1A 3N2GB 4EPYA 2F3QA 4HJXA 4O3MA 4Y2SA 1C9MA 1G8YA 2HMWA 4CODB 2LIPA 2GBGA 1L3BA 4HFJA 3O7WA 3W5UA 4GXNA 3ZJVA 1L4NA 3PKJA 4OK5A 1ND6A 2DQYA 3BXXA 3K0FB 3TTSA 3CGWA 3LGSA 3CURA 4K7JA 5KYNA 2VUUA 3L4BA 1A04A 1L4LA 2Y4OA 2CCKA 3HA2A 3P2MA 1BRTA 1N0UA 1YR9A 2IE8A 4L16A 5INTA 3BSWA 3U4IA 2VIIA 2ZS9A 3LPNA 4KX5A 1I1OA 3BC1A 3DBRA 1R8XA 1UPBA 1KYVA 4NOMA 3WL3A 3DL0A 3B36A 3SKYA 3WLTA 2QTVA 4GL2A 3ABZA 1LI4A 4K6MA 1AMUA 3RIXA 3OCUA 2DUWA 3K30A 4EA9A 2I54A 1C0IA 2GZRA 3GGDA 1IWOA 1I51A 4DMUB 4EYKA 1X70A 5FWAA 5B4UA 3EJWA 3C15C 5CX1A 5CLJA 2VP2A 3GBSA 3INNA 3AHJA 4F3TA 1PS9A 1WB6A 2PQ6A 1CD5A 1WD5A 4WOPA 5T4BA 5C1BA 3O8OB 2Z3VA 3HLKA 2W43A 4K40A 2IK8A 2IEIA 1BW9A 3OWOA 2MYUA 4Q3KA 4Q24A 2SNIE 2XMPA 3O82A 1A95A 1RT9A 4LXUA 4DDKA 3SC2B 5AW1A 3D3WA 2D13A 2W58A 1FDRA 4FHGA 4LY0A 5D3KA 4XWOA 1S4QA 2E5LB 4C4YA 3TI9A 5EIWA 3UZUA 5F2EA 2DETA 2DBZA 3MXTA 1IEWA 1OIWA 3DT9A 4INAA 2ECOA 1YGYA 5CFMA 2PGNA 2FWNA 1R0RE 1BMQA 2XUOA 3VVLA 2DFTA 5D51S 1Z5WA 1T9AA 2B3DA 4Z9XA 4D99A 4ZI7A 3VU0A 3IPLA 5D3MB 5KHOC 2MMGA 2VXOA 3G13A 1AU9A 3QMVA 1YKFA 5ILGA 3R7WA 5I3CA 1LLDA 1LLQA 1N2CA 2HI0A 3FVQA 4AZ3B 1J00A 1OBFO 1FDSA 1L9XA 4FQ5A 2IOHA 3ISJA 3V4LA 4AWBA 2HWKA 4TMYA 2IP2A 2O7VA 2LPMA 3MN1A 4QAQA 4IIUA 4EZIA 3DYBA 1AQNA 3NHWA 2E0IA 3R8FA 3C1AA 1TI7A 1ECFA 1G3MA 1G5RA 1MORA 4PPGA 2O3UA 2Z4RA 3CLKA 2ZRAA 1FP2A 1XJ5A 3O1HB 4LGMA 2R6JA 3H5RA 4HQ0A 5H16A 3D64A 3TXAA 2O57A 3TS1A 2RH9B 2Q1WA 3HYTA 2FW9A 3KETA 3INTA 4D79A 1ZUD1 4JL6A 1VJCA 3AJAA 4K0RA 1OTXA 4DV3B 3PNSA 2I99A 3NOVA 2QMZA 4YQEA 3BXGA 5CLGA 3QSGA 3MZ0A 4H7PA 1YF3A 1QH0A 1J5XA 1OYWA 3GLFE 3ROQA 1NL3A 1SZDA 3GJZA 3UGQA 1ZHHA 3Q4GA 2Z2KA 4UAVA 1NVTA 2CUTA 3SQNA 1NVVQ 2AA3A 4Z0PA 4ZCTA 1ESZA 3KP1A 4HDNA 4MRSA 1OWMA 4IG4A 1AOXA 1ZQ9A 2H59A 2C82A 4M1ZA 1GPMA 3P2YA 3IHTA 1FU4A 3V1KA 2YINC 1KE1A 3Q5DA 1RYNA 3CX8A 3EWAA 1LD3A 1LJ8A 2HJHA 4KI7A 4LXYA 4YJKA 1B3BA 5CB4B 2WVAA 3FFXA 1IEXA 5FBZA 1VGVA 1XAIA 3RSLA 1M2WA 3EYAA 1O94A 4EJSB 2BI4A 1ZH4A 2YJ4A 3QFRA 5FPQA 3NI2A 5JV5A 3RNOA 3U4HA 2GSDA 2OG1A 1DL5A 1YJBA 1XTIA 3KUCA 2O23A 4IRXA 5BMVF 4PLZA 1JWLA 1DAPA 2J9YB 3K8ZA 5JBQA 4O63O 1LS6A 4BMXA 3DSRA 4HNHA 1OFVA 1TQ4A 1SHKA 4G0XA 1WETA 1F20A 3CSUA 4MQLA 1FW6A 3CGGA 1JEDA 4S1WA 4EWLA 3TB4A 3FOCA 1XLUA 2I1WA 2I4TA 4LJ8A 4WLEA 1E1CA 4AJPA 3G79A 3AB8A 1I94B 1H3EA 2QWXA 3TZLA 1QM5A 4FDTA 1ISSA 4I4LA 4B3CA 5T4HA 3GWGA 2AOTA 5EKSA 2ZZMA 2GBIA 4QU9A 2XOEA 2Y71A 3I9V1 3AKZA 2I8CA 2DMRA 4V2UA 1W8IA 2BFDA 3L8YA 2BTQA 4M9UA 4EAQA 5FA5A 5C5EA 5EJAA 3HJFA 1SCNE 1P7YA 1XKLA 3ZBTA 1JHRA 1JU9A 4I3GA 2AZMA 2BFBB 4BMDA 1GKYA 1WO8A 3CMMA 2IWRA 3LBFA 3L4EA 1N3IA 4ZP1A 2C5LA 2GEUA 4O3FA 3FYHA 3T0IA 2ZRHA 3TYXA 4EB8A 4E3ZA 5JWRA 1QIDA 4NENB 4G0MA 4L4XA 3ZWXA 5F7OA 1RDFA 4ZYXA 2XCRB 1ZGGA 5GQSA 2AXNA 1FLAA 3TPFA 2AF3C 2WLTA 1CUBA 4LI3X 3RTBA 1EGQA 1A9XB 2AC7A 3SZGA 1F2DA 4AIIA 3NNNA 1POWA 4GOKA 4I6JA 3VU9B 3O3MB 2Q45A 2OGWA 4ZI3A 1QVAA 1KEPA 4QRDA 5J58A 2VF8A 2VP4A 1UC5B 4GKBA 2XITA 3LAWA 1DAFA 2F4NA 1BE0A 4PAGA 1JLRA 1UFKA 1UFOA 4GF5A 1L5NA 3WP1B 2BSQA 1DELA 4O4LB 1DBPA 4ZZ2A 4G85A 3NGMA 1Q19A 2RB5A 4L1KA 3IE1A 2F9MA 1J42A 4HEA6 1QX4A 3B3FA 3OF3A 3UHOA 1IHDA 1X7ZB 4X5OA 1PDWA 2J9FB 4MUJA 1V3UA 4NCJA 2FFQA 4BVAA 4IVQA 4UM5A 1F3OA 3O8QA 2GVZC 2B92A 2C59A 1P8AA 2B82A 2RGAA 3DTVB 3HL0A 5BWOA 3IP8A 2X76A 2PAAA 1ZNWA 1GU1A 1LVUA 5A71A 5BNIA 1CUUA 4KXFB 5IYZB 5KMGB 4BFCA 4EZBA 4LHXA 1K92A 2V5UA 4X1KB 4TLLB 4B6SA 1P3JA 1QCYA 3TLEA 5LZ7A 4R81A 3PB3A 2BW0A 4JFAA 4ZVPA 1GGFA 5LQRA 1WCXA 4XDGA 1P9WA 1N0VC 2QZSA 4NBLA 1Z5VA 2H8KA 3EIQA 2O8NA 3JQBC 5KQLA 1PS0A 3A2NA 4EA7A 3GPBA 1RWPA 2X41A 3EIUA 3KM0A 2QY6A 4PE5B 4A0FA 9GPBA 3P45A 4WGFA 5TB5A 4E2XA 1SC4A 3OCXA 4XB2A 1A2KC 1JXAA 1OXSC 4NG5A 3WGOA 3WK6A 4F8EA 1F0PA 1H2XA 6NULA 3GLIA 1SNYA 2VNHA 1LX6A 3A9SA 5CM9C 5ESDA 3S27A 4DG9A 1KDZA 2D62A 1E98A 3B7WA 3KWFA 4H7EA 2R1ZA 3FUCA 4H6PA 5AOCA 4UFPA 4D5EA 1F51E 2KWIA 1PEYA 2APJA 5SYNA 1XTSA 3K9HA 2EJWA 2GO1A 3L1HA 3PPIA 5G1PA 3RU3A 2I1VB 3ZV6A 1CRLA 3HGTA 2VSFA 3WISA 3T5AA 5KREA 3ZWPA 2Q8NA 1LPOA 2OFXA 3BD7A 3QY0A 2J3MA 2J0SA 5BSHA 5FR1A 4G25A 1FP6A 4JI4B 1CJVC 1TMOA 3E61A 1RACA 2C1XA 4QOEA 5ELMA 5FNVB 5C5DA 1J97A 2W6ID 4KL8S 4KN6A 3R5TA 3BMNA 4NI5A 1RJEA 4DARA 2IZOA 1RI2A 4F0JA 1UXGA 1P0QA 2IF0A 3FMPB 4OA5A 5FUVA 4TQAA 2QQGA 2PTGA 3ICWA 4G0NA 4DUPA 1RPZA 3DR5A 3GLRA 3D9QX 4YO7A 3KJZA 3RS0A 4W9MC 1QOQB 9ATCA 1H9BA 2WTBA 2IKQA 3BXHA 4B83A 2EX0A 4ABTA 4ZPJA 3RSOA 4L8LA 5HNKA 1O95C 1NVWQ 1O89A 2PL5A 3HSSA 4IDGA 1CYDA 1TZBA 5BYAA 4R3WA 5DIFA 3T9BA 3LIIA 4CMIA 1NN1A 1M6YA 4IEIA 4TSFA 3IQIX 4RQTA 3C41J 2O2SA 1EK6A 1KH2A 2C7BA 2J3DA 3K72B 3AKDA 4RQUA 3RRZA 4BBZA 4E21A 1B0ZA 1W75A 4BXOA 3HFGA 3WHIA 5A0TA 3C8DA 4OH7A 2BP7B 4BFTA 4EUKA 1YU6A 3G5AA 4MP3A 3WMRA 1EUQA 2HW8A 2JIOA 2XSZA 3DBHA 4NYMR 3ACCA 2FW6A 3ZJ5A 4FCWA 2YRWA 4KLCA 1FNNA 4ZCLA 2Q50A 1SIOA 1DINA 1TMGE 5CW1A 3C2QA 3WAKA 4DBLC 4YRFA 3M6LA 2CLSA 2HMVA 4MJXA 1EZZA 4RIEA 1J56A 4TYPA 1XG5A 1EVIA 1V7PC 1TYDE 4HXFB 3V1LA 4MRMA 3WLOA 2M6SA 4MUNA 1M0SA 1O0CA 2EKZA 2Q1TA 3DFZA 1U3CA 5KVCA 4GR5A 4D9NA 5IDQA 2Q62A 4B6QA 1UOPA 3GUVA 4W99A 1KZ6A 2Y99A 4J4HA 2AXQA 4MUXA 5A9RA 1IUNA 2E2WA 1Z12A 2WJVA 5DNAA 1JX6A 2Q3EA 4HGQA 5E0OA 3DEIA 3SEFA 2XNSA 1RLUA 4U00A 1D2MA 1GQ2A 4PV7A 1USVA 3X1KA 4NQRA 3TQCA 4YBRA 4RVHA 3LXUX 3QVXA 1H69A 2P2NA 2Z8YA 3IP1A 2XYRA 4H0CA 5EJFA 4FIDA 2AK2A 3M4ZA 1ECBA 1Y9AA 2D1TA 5F51A 6Q21A 3UAXA 4MJ3A 3O3CA 1YT5A 5AO9A 5LQJA 1LW7A 4NKRA 3WLAA 2C83A 1DJMA 1BXRA 4X92A 3MNFA 4E4TA 4GMFA 1N34B 1DJPA 3AG5A 3KHTA 4Y9UA 1E1LA 3RSQA 1DAGA 3AP2A 1EVLA 4PW0A 1ZIDA 3FUXA 1R7RA 3OQNA 3HZRA 3NUGA 3PSHA 3ZDFA 4PTLA 5AJHA 2H2IA 1B8OA 4ND6A 2OFOA 4PFJA 5SZKB 2Y0CA 4M2LA 2BLLA 3WL8A 4OD0A 2LIVA 2QRVB 2ZBDA 4XGNA 2ZRBA 2VOEA 1FC0A 2OV4A 3LQKA 1J0EA 3QVVA 5CT4A 5A4AA 3L8HA 3JW8A 4FSXA 4QPNA 1N6PA 3MJCA 3RSFA 4Q19A 2V1XA 3FPKA 3UBMA 4ER7A 4RXTA 1Z0SA 3FWYA 3JZDA 2XZDA 4PHCA 4ZYTA 3PUVA 5K0BA 3KOUA 3UHJA 1NG1A 5FA8A 1M6WA 5BSMA 5K8JB 5J3JA 3WZMA 3EQ7A 3TNDA 1UJNA 3ZXSA 1V1RA 2ZJYA 4ZOBA 3O8LA 4CQNA 3GA5A 2M2IA 3ZV5A 2YRXA 2ZATA 2A58A 1I32A 1TJ5A 5DMHA 3I1FA 2CZGA 4HO1X 5F7JA 1X7YB 1NIPA 2VJOA 3HXTA 3EGCA 4QPPA 5JJ5A 3FOAA 5JALA 1V8FA 1JIQA 2I5PO 2WF8A 4M6WA 1Z8FA 2VQ6A 2PMEA 1CC1S 1SGWA 1Y80A 2VRCD 1Z4PX 1J8VA 2YWEA 3H5AA 3M7IA 3RD5A 1NRIA 1UBOS 4J0CA 3ZLTA 1HT1E 3L0BA 3ZHQA 4K9OA 3ROZA 2QU7A 4B2PA 2X5XA 2QG9A 5CFQA 1M3SA 2CKDA 2I6FA 2X5KO 3EXHC 2JG3A 3MD0A 5D87A 2AQHA 4MP6A 2PYDA 3F98A 4IEEA 2IVFA 4KQ2A 2G5CA 4BQFA 1R9MA 4IKPA 4KIUA 5KB3A 1T5DX 2NSYA 3WRYC 1SUAA 1W88B 4X54A 3H87A 1XEWY 4G23A 4AJ2A 1STOA 4NPAA 1H6DA 3TZHA 4CLHA 3VOBA 3QX8A 2BFMA 3H5OA 3PNPA 4DTIA 2QJWA 1HG1A 4UASA 3RREA 2GDJA 1PZGA 3HM2A 5E2IA 4EKYA 1E8DA 1TJNA 3NZEA 1C1HA 3QV1A 1ORTA 3PFKA 2JCBA 4GI7A 1E6UA 1RXSA 1QQ7A 1GZHB 4GDMA 1MQ8B 1SUCA 4RTSA 4II2A 4FCCA 5JCJA 4TWBA 1P80A 5L6LB 4K81B 1HLGA 3T7KA 4TYNA 1LU9A 5ALEA 1JG3A 5AKJA 3DKPA 4QBIA 3N2KA 1ZM3A 2GPNA 5D86A 2QL7A 2ETXA 4R4JA 4ZQFA 2P6MA 4HZGA 4DQVA 1E7QA 3PX3A 2YHUA 3AJRA 1UBFA 4LPKA 4X7BA 3RYFB 1N1GA 3ZVKA 3VOSA 3TEJA 1L5ZA 2R25B 1OWPA 2ZTMA 3CX7A 1SEPA 2B21A 2P0AA 3F9IA 4DA7A 3CRVA 3GWZA 3BN3A 2ZI4A 5HQ3A 4BUCA 4RLHA 4UPEA 2FWMX 5G02A 1G6HA 1Q95A 3QRWA 3AHEA 3ITDA 3DBOB 2V7TA 2AQIA 2VP3A 4I1RA 4YWHA 4EMUA 1HSOA 5E38A 1LFDB 3A6GA 2JPDA 3JWEA 1YB2A 4AKTA 1UBNA 2DWCA