1RE1B

Crystal structure of caspase-3 with a nicotinic acid aldehyde inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
91
structure length
91
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 16
structure length 91
sequence length 91
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1re1B00
3RJMB 4DCPB 1SC1B 2CDRB 2H54B 1RWMB 3R7SB 3KJNB 3GJQB 3D6HB 3IBCB 1I3OB 1ICEB 4ZVTB 3P4UB 2Y1LB 1GFWB 2C2KB 2QL9B 2H48B 2C2ZB 1RWWB 2CJYB 2H65B 1SC4B 2C2MB 2H5JB 2XYHB 2QLBB 2CNOB 3IBFB 2CJXB 2HBYB 2FQQB 2H4YB 2P2CB 1RWKB 2H51B 2C2OB 2QLJB 1RHQB 2Y0BB 4ZVRB 3KJQB 2XZDB 3GJSB 3R6GB 1RE1B 4ZVPB 2XYPB 1F9EB 2CNKB 3P45B 1I51B 4ZVUB 4JB8B 2QLFB 2XYGB 5IC4B 4ZVOB 3R6LB 4ZVQB 4LSZB 3SIPB 3GJRB 3R5JB 1QTNB 3R7BB 1BMQB 1RHKB 3D6MB 3D6FB 2CNNB 4DCOB 1SC3B 2XZTB 1PAUB 2HBQB 2CNLB 3EDRB 2QL7B 4DCJB 1IBCB 1RWPB 1RWOB 3QNWB 2C1EB 3KJFB 3NS7B 2QL5B 3EDQB 3GJTB 1RHMB 5IC6B 3R7NB 2HBZB 4ZVSB 2H5IB 1PYOB 5K20B 1RHRB 1RHUB 1RHJB 1RWXB 1NMEB 1RWNB 2H4WB 2HBRB 1RWVB 1QDUB 2DKOB
chains in the Genus database with same CATH superfamily
4ED4A 2W2OP 1NJYA 1MU2B 3EGNA 1S6UA 1S99A 3V81A 2M4MA 4B9TA 3UPFA 3ET6B 1CBKA 2EW9A 2XNRA 2ZVSA 1OSCA 4JYAJ 2QX0A 2X1FA 1U1MA 4KAIA 2AJ1A 1UZDA 3OL8A 4I0WA 1BGXT 2ZH5A 2Q1LA 1O5JA 3CJTA 3DDNA 3PFEA 3OUYA 1TUVA 5A6PA 1YJUA 2PEBA 3NMAA 4OYAA 1E6YA 1TKTA 2P6TA 1TFWA 3KWMA 1MN9A 5C25B 1HNWF 2CQ4A 2W4PA 4H4KA 1QAIA 2UUCF 3TJAA 3GFHA 3SI8A 4P74A 2K7KA 2RS2A 3NGUA 3L09A 4X66J 4TYAA 1GXUA 2AJFE 2GCFA 2EG1A 5HANA 2D74B 3FQLA 1VYAA 2NCKL 4FVMA 1RA6A 1TL7B 2GIRA 4C8YA 3UNGC 1X4DA 4ZJQA 5G4DA 7FD1A 2YWEA 2YTCA 1DTQA 3QIPA 1SJ4P 2UXCJ 2NSCA 4ECUA 5ADZA 1TK0A 2R3VA 4QPXA 2QFJA 3DDKA 2RRNA 3BN7A 4IG3A 4YY3J 5GADI 3K0JA 2XULA 3C6UA 3TO8A 1SC6A 2CG4A 1HBMA 3OR1B 4F0MA 1FDBA 4CLKA 3PIOQ 3UD4P 1WDDA 4F26A 2KG0A 3HKWA 4OLOA 4E98A 4M5DA 3CF5Q 3RR7A 4FF3A 1VHIA 3QNWB 3G4SS 2JLEA 2E44A 2OLWA 2H9ZA 3EYZA 3GJTB 1P9YA 2HKEA 1N5TA 2Z8QA 4I56A 1DY3A 4G1IA 2IBOA 1FEEA 1ZM3A 2C3UA 3GIIA 2D69A 5BYQA 3O2IA 2RT3A 3AQPA 4B3RJ 1HQUA 3C16A 2A3JA 3K89A 5K14A 2WB4A 1VR6A 5HQMA 4F3OA 2QGFB 1AZSA 2GHPA 4HHHA 5C24A 3MECB 1L3VA 3CDEA 4A8MP 5J2QB 4R0EA 2ROGA 3NWGA 3GIRA 3W64A 2BQRA 1WSRA 2FGOA 3QZ7A 3CULA 4NI2B 1JXVA 4URGA 2WOMB 2BANA 2DPJA 1RHQB 1KQFB 2ZNYA 2OPQA 1N33J 3Q8SB 4ECQA 1GMVA 4RZRA 1LOUA 4I64A 4ZVQB 4KB7A 3G6ES 4B3TF 1S1VA 1M5VC 1Z2ZA 3CC4S 5AE2A 4ZLNA 4IRKA 5B0BA 4UOGA 1CJTB 2XCPA 3MI7X 2C1EB 2BW2A 2C28A 1Q78A 3DXSX 4DFPA 4N77A 1PBUA 3M30B 4DFJA 1VISA 3M2VB 4LFCF 3UWTA 4U7UD 4AXIA 2FVSA 1VQOS 1RT3B 2V2ZA 4YHHJ 3E2EA 4CLYA 4N47A 2ATCB 4X4QA 4DBQA 2BQUA 3BR9A 1FWLA 3MM5B 2EKNA 3DRSB 2AKWB 4J5OA 2U2FA 5KFNA 2VBWA 2EKYA 3H0PA 4CNYA 4ZK7M 1NCLA 3DFEA 2BOPA 1CPZA 1WC5A 2Q79A 2K1RB 1V3ZA 4KSEB 4DS4A 2J7UA 3PFOA 1M0SA 4OFZA 3VVUA 1K0TA 4L75A 2W25A 4FN5A 3IS9A 1JKHA 4RW7B 2VIHA 3IO1A 2C22A 4C11B 2MQLA 4ERDA 4ES3A 2KRBA 2QSWA 4IFYB 5LT5A 2DNGA 1IN0A 3UQSA 4TY9A 3FCHA 2NPIA 3SCIE 3IGNA 4RU9A 1VQYA 2DNQA 3OVSA 4N56A 4EU0A 5B0DA 3SBMA 4AUKA 2J0SD 2KKHA 4EMDA 2E9ZA 3C2PA 2VF3A 4RPFA 2HHSA 1N54B 3HSGA 4L74A 4K4UA 3DLHA 3EGWB 2GMHA 1X4HA 2ZD1A 2UXDJ 2BX6A 4NCGB 2W24A 4TLRA 3CE8A 3SQGB 2HQFA 2HAIA 4HHUA 3Q2SC 1HYSA 4FYXB 3MEDB 3AJ2A 4DF8A 3OV7A 3IM8A 1S4FA 1VK3A 1JNRB 1N36J 1HFEL 4EO6A 1TTHB 4LSNA 1AA1B 4UW2A 4BWJA 3KLIA 1Q0NA 5GAHU 3GV8B 4DQPA 3MD1A 3DMJB 4LF5J 3ILLA 1Q95G 4KYZA 4HHJA 2FHKA 2HBZB 4DV3F 4LFAF 4F04B 3DM2B 2I6WA 1ZA2B 3IN5A 3NMRA 1Q7LB 1YKWA 4QZVB 3J7A1 4WFZA 3KLHA 2YPYA 4XPEA 2GV1A 4X84A 2ADCA 1CS4A 1BC6A 3EVOA 2FC8A 3MHYA 3S7RA 2XQCA 3M6WA 1SIZA 1XEZA 3N9UC 2VG5A 3VZIA 1FJCA 3VVTA 2YWGA 1BHNA 3HSJA 3I9ZA 1XERA 1T9XA 2IRUA 4JUZA 3GFYA 2BRKA 3C15A 4V1Ak 2CQPA 4B9MA 1H2TZ 2F63A 2CQBA 3EM1A 2P9GA 3DU5A 1U8SA 4DSKA 4QIEA 1RQ0A 5FLXY 2WBMA 1WC4A 4DR3J 2GW8A 3IG1A 2WW4A 5K8NA 2EK6A 2HZVA 2G2OA 1UFWA 1XWLA 1IR1A 4RUHA 1UZHA 4QIWD 3VWSA 3VAJA 2LXFA 2BE2A 4HKQA 2HZAA 1GT8A 2DXFA 1RAHB 4OHWA 2UXBJ 3OTBA 1RKIA 3GCWP 5I4MA 2GJ2A 1XNRF 4ZIWA 1U6BA 2BE9B 2MLXA 2AYMA 1S9FA 2R42A 3IBCB 3C19A 1YRXA 4LR7A 3OW2R 1D9DA 3QRQA 1HR0J 5E3RA 1T94A 3FK4A 3RG6A 2L9NA 1RT1B 4CWBA 1EQMA 2IY5B 4FVCA 4F4XA 2ZKTA 2X51A 2E1PA 2XS2A 4NZ6A 1I6JA 2QTWA 4C0HA 2WVFA 2MZ1A 3TEGA 1IBMF 3ETMA 4PAAA 2QO3A 1TL7A 2B3TB 2ZE2A 1D9FA 2CNNB 2XZTB 1H0HB 2W4DA 3JQKA 5JJBA 3FZ2A 3S01A 3C46A 1YITS 5EX0A 1M5OC 4YMEA 2J0QD 2H5EA 2F9JA 3FUYA 4ECTA 1KBRA 1Q1KA 2XNQA 1FKOB 4KR0B 3G82B 2XO6A 3OR1A 2GVZB 1KP6A 2YX1A 1TKZB 3HI9A 2IJRA 4JV1A 3V6HA 1SH0A 1YGYA 4ZPDA 2GA7A 4BHQA 1HA1A 2GO8A 2W01A 2N4CA 2CVEA 1T7PA 4QYZK 4MK9A 5F0WA 3LP1A 4NEZA 1MG7A 3LP0B 2N7CA 5KG0A 2YX4A 3DI6B 3IXQA 5DG9A 3K58A 3CDAA 4KV8B 3DLJA 2CAJA 1YJ7A 2E29A 3LPYA 2VBXA 1HKAA 7AT1B 1HIYA 3AFGA 5HP1B 1K9MT 3VGTA 2IHR1 2FB0A 2EG2A 2KXFA 2RDJA 4NI2A 2R8GA 2ZJQQ 4Z7CA 3A8KA 2WOMA 3H40A 3I9V9 5IV4A 2YH0A 3M9NB 1IKWB 4LRDA 3KK1B 2MQOA 1JMTA 2ZH8A 3J7YI 2BRLA 2W7OA 4FS2A 4OJ3A 1FRXA 2G2YA 5CCLA 4FNHA 1NHVA 2HNZB 4QYZJ 4ED2A 3I5CA 4LF8J 3NP5A 2MYFA 3ZZTA 2ZZMA 3DRPB 3IBFB 3M2VA 1UJ5A 1F9HA 4XIUA 3VF0B 4M95A 4GVBB 1O6XA 4URQU 2AF6A 1F60B 4FDFA 1LWXA 2AHOB 2A6MA 4DV4J 4UY8T 3OVBA 4WK3A 2HS4A 2XLJA 3I55S 1JIHA 1NU4A 3AOCA 1L3SA 2RNEA 2QA4S 2K3IA 1UW9A 3BYPA 5LSOA 3FBBA 1T0TV 4F4YA 2LU1A 1QVFR 4CM0A 4D3GA 3CCSS 4O4RA 1U1QA 3PV8A 1T9WA 4ZIVA 1CULB 2K1RA 5IM0B 3ZZUA 4QR0A 3MR5A 4R0JA 2L41A 1H2VZ 2JEJA 3CJ3A 4PWWA 3CUNA 4RW7A 4IRDA 3CCVS 1RT5A 2HHVA 1UEVA 4MKYA 3T3FA 2W7PA 4FF4A 2KL8A 1RB0A 3DCAA 5KFLA 5JVHQ 2JVRA 2QMUB 3QFWA 2D3UA 2D1CA 3EZ5A 3PM9A 1S77D 3C8YA 5AXKA 3H5YA 3CJKA 1KLMB 3U1MA 3DLLQ 2MKJA 3FVYA 4IH7A 3VZHA 3AODA 3QBCA 2B7BB 2NYIA 3BGLA 3QPIA 1WTFA 4ECXA 4B3SF 2XMUA 4NCGA 3VGVA 1T05B 3QAUA 2W2QP 3SQGA 3BSNA 2MJUA 2FVPA 1RTDB 2DB1A 3KLVA 2QA2A 3MEDA 4ZITA 3QGPA 3JYTB 5IQQA 1P27B 2HG4A 4ANCA 2XBPA 2K7JA 1OIAA 1FXDA 2NXCA 1GAOA 3VHQA 2XSFA 4HL9A 4NLUA 3FQKA 2MKHA 4FXWA 3BSAA 2K3KA 4NLRA 3MUTP 2I2YA 3T41A 3DMJA 5AJ3F 4CQ1A 1F1BB 3M8QB 2E7XA 2UZAA 3ICLA 1U1RA 1QTMA 1M5HA 1FO1A 2CPYA 2EFPA 2COLA 2HQCA 2ZNZA 2KDOA 3HT0A 4W4MA 3KUEA 1IKVB 3FFIB 2JC0A 3OSPA 5HAOA 4QWEA 1GH8A 3MEKA 1G1XA 1DHMA 1K44A 3KDNA 4WZQA 2XSJB 4ZHRB 2W9BB 3CDBA 1XR7A 3L3CA 1RT6A 3KJFB 3W63A 4KPCA 2HRTA 4X62F 2EFQA 2CPJA 5KG5A 2OH2A 8AT1B 2HK3A 4QWDA 2QG9B 4PXEA 2Z56B 3WIVA 1SQFA 2WB1D 4F3QA 1HI8A 4OYZA 4P75A 4RO0A 2DR9A 1R0CB 8ATCB 4PXDA 2POKA 3FNNA 3MM8B 3T5JA 5KFDA 1ZETA 3BBCA 3MTKA 2V6AA 2B8PA 1LW0B 3DRRB 2CQ3A 4U8VA 1TL1A 4JI8F 3CWJA 4BCAA 3N6LA 2WVCA 2V9KA 4C3MA 3RRHA 4Y0FA 4ZPBA 3J7Z5 2YWFA 1VIOA 3RAQA 2G13A 5G0RB 1R3NA 1UW4A 3UN3A 4DSIA 4F02A 4DN9A 5A8RB 2DXDA 1IQZA 3L4BC 4LIWA 4ANEA 4CT9A 1BQNB 2MKCA 2DH9A 2QLXA 3FSXA 3I96A 3I5AA 2PA8D 4RWWA 5GMKa 2CNLB 3CJ2A 4P52A 2AEMA 5KFEA 3AHPA 4Y2MA 3HO1A 3ILOA 4USVA 3KG0A 3MCSA 4RUAA 3PJ9A 1D0EA 2MB0B 4USWA 2GGPB 4M5GA 4NLWA 2YWKA 2LEBA 1LWEA 5E3CA 4IO1A 1JJ4A 2KT5A 1HNVB 1S9GB 3A1YG 1NSPA 2L08A 5HVFA 4GKJJ 3D1HA 2R2RA 1U2RA 3VAKA 4YDDB 2M3DA 4WFYA 3NLCA 4MKVA 2RRBA 2WSCC 1F9EB 2R7UA 1BWEA 6FDRA 3BBFA 1TKZA 2YY3A 4LQ3A 4G3IA 2DGXA 3GB0A 2FTRA 3MMCB 3SXLA 4XDDA 2FUG9 3TUJC 4YS2A 4DSLA 3EUNA 4H4MB 1MLAA 1AXQA 2FJDB 4OL8A 3DLBA 3LP0A 4AXJA 2DO4A 3OXGA 1UPMB 3Q22A 2X3GA 4HR2A 3AOAA 3DI6A 1NM2A 4WIIA 4G1PA 4ETZA 4MIWA 2OPSB 2DGWA 2XMJA 2FJVA 3ULHA 3GIJA 5D4NA 3U7JA 4RNNA 2IVMA 3BGRB 5D0RA 5IWAJ 2ZC4A 3IBWA 3J81Y 1IKWA 3OBIA 3O6QA 4ED6A 3QT6A 4ITSA 1SV5B 2V8PA 4DZDA 1U7LA 4C8MA 5KFBA 3GP9A 5KFGA 3FEXB 1SQEA 3BB5A 1I5OB 2VG6A 2DTJA 3TI0A 1EB0A 3C3LA 4J9MA 1D3WA 2J5AA 5BYSA 1IM6A 5AE3A 1TUWA 1F2GA 1EX8A 1XNRJ 2CADA 5F8MA 1A6LA 2C42A 1IBCB 1GTHA 2VKRA 3EDQB 5LMNF 1JJ2R 4QW9A 1TKXB 3R7NB 1UVKA 3H5UA 4AT1B 2ZITA 4OV6A 1TL3A 3BSCA 1IJEB 2RQMA 2EFGA 4IG0B 2ASJA 4NYOA 1CEZA 2OMOA 3ZZZA 3CSKA 1RT7B 2IM3A 4QR2A 2GJFA 2Q66A 3CCES 1S79A 5JXSA 5D4LA 4DSJA 4RNMA 3DLKB 4P2MA 3THTA 1CJKB 2H5JB 2QLBB 1CULA 1L3TA 3M2RB 4RNHA 2PMWA 5FDLA 1WC6A 1QE1B 2I38A 4DR6F 4I68A 2F3JA 3UW1A 4DLGA 1CJUB 3ZZPA 2XYPB 2E1CA 2NYHA 4DFKA 5CHCB 1Q5VA 1Y5LB 4JI5J 1B99A 5C2CA 1XJWB 2GMJA 1EIYB 3MM9A 2QMXA 3RRKA 1QSLA 1F0XA 2J9EA 2RF2B 3M4XA 3NS6A 2D3O1 4NLYA 1C4AA 2HHPA 2KVQE 1SBRA 5DLFA 2XI2A 4ZP7A 1VS3A 2B6AB 2YNGA 3F0NA 3BN4A 4QWBA 1IQTA 1NMEB 2PD1A 1FD8A 3NAHA 4FYYB 4IDKB 1HBNB 5HL7Q 2XZWA 4I1TA 1GX5A 3N79A 3AB2B 2HW3A 3IAM9 1U2FA 1WF0A 3L7OA 2IRXA 1UTAA 1KEKA 3F56A 1AFIA 3B54A 4JI2J 5HBMA 4OHYA 2B7CB 1P9QC 1WHVA 3MR7A 1RACB 4C8OA 4OI1A 1RTDA 3H59A 1Y5NB 3G8TA 4JBCA 2PIIA 3JYTA 5B0AA 1HNXF 3W5XA 4LF4F 1HD1A 1OY6A 4OYMA 3U1NA 2MJNA 1X5PA 1UCNA 2JFDA 1ZTTA 1YZ7A 1FF2A 2A2CA 3TEHB 2MZQA 1AUDA 3VAFA 1EARA 1KC8T 2ZDPA 1C0TB 4A8SA 6AT1B 1VC0A 4I2PB 1R6VA 2EVZA 1R6YA 3M8QA 1LK5A 5L46A 3Q8UA 5B09A 5F9LA 1YJWS 2JDJA 4DQSA 4A46A 4NMXA 3GIMA 1JLFB 1U8WA 4DCJB 3HSZA 2MQ8A 3OLAA 3NWRA 1I94F 4CO5A 2MMYA 2CYYA 2QFIA 4EZ6A 1CC8A 5D0GA 4KFBA 1OQ6A 3QT7A 2Z2YB 3PYFA 4UUWA 3QMQA 2DNNA 1S6QB 3VGSA 2DNKA 1P1TA 3PKYA 2VICA 3X1LB 3CJ0A 4TN2A 2ROEA 4Y34A 1PAEX 2CKWA 4ID5B 1HPZA 4NASA 2KT2A 1G3OA 4JI1J 3VGUA 4MJKA 2QLWA 5CH7B 4JI0J 4DL5A 2OP5A 2MTLA 4ZCMA 3MM8A 1JX4A 4JI4F 3KHLA 4LF7J 2R9LA 1NK4A 1LW0A 3TUZC 3DRRA 1QTNB 4ER8A 1YIJS 2XHWA 2W7AA 4OJHA 1NKCA 1LK7A 1YSJA 1JWWA 4N41A 3JQJA 1SL1A 4L6V3 2UUAJ 3P8BB 4LF9F 1F5CA 1EJ7L 2FD2A 2IVYA 2JC1A 1S0MA 5G0RA 5IXUA 4B9UA 4HDGA 3UDLA 4DPTA 2J7WA 4OV1A 2WSEC 3GCXP 1FDNA 3MUMP 2ZH4A 2UUBF 2VUGA 3UDCA 1Q5YA 1UVMA 2VG7B 3W2VB 4KC5A 3HHLC 2F40A 2BDPA 3UNYA 2YKOA 3U1LA 4USIA 3M8PB 3RB0A 1Y9OA 4JV5F 4DV1F 4YB5A 1R8CA 2ZBRA 5D3GB 4ZDNA 4DSEA 1TMJA 2QV6A 1C0UB 1NK8A 2F4VJ 3DN9A 2H1YA 1YRUA 1DAXA 1YJRA 2E1AA 2M88A 2CQ1A 3RW6A 5DRKA 3HD1A 2GVDB 1VQ9S 5I3PA 4Q43A 3P49B 5KFQA 3BO4A 3JXOA 3ZZ0A 2QRRA 1WOOA 1VQ6S 1RCXB 2V34A 2RMLA 2L48A 1BUXA 1X60A 2GHVC 4CLUA 2OEJA 3Q8YA 5DM6Q 1UA0A 2AIRB 5DS7A 4ID8A 3VALA 2VL1A 4DU7A 5BJRA 2LP4A 2FJBB 2IM2A 5DZ6A 2DNLA 1TZ0A 4LREA 1R31A 3DKDA 4C0BA 4F7VA 1C1BB 1HI1A 3LUYA 2N7YA 4CZCA 2ZDOA 2MY8A 4DR7F 2V69A 2Y0BB 4ZVRB 3LTOA 3TR5A 2Z2MA 4MAKA 1W26A 1ZPVA 3GR0A 1YBAA 4ZVOB 3TAMB 3R6LB 2HHHJ 4OYWA 1EZZB 4NRTA 2HS3A 2OD6A 4HACB 3K8WA 3BGRA 1K1SA 3IWNC 2MKIA 5DQHA 5H1SV 4NLQA 5CXTA 2GAGC 2E5LJ 3W5YA 3OFFA 4FYDA 2MZRA 1VQKS 1RA7A 1FJGF 1TV6B 2BMBA 2BZ2A 2ZJPQ 2AYGA 3MEGA 4DLEA 3RUBL 4WFXA 1PCAA 1L3KA 5M2RA 1YBTA 3OL7A 1DQAA 4RW6B 2NLWA 4IH5A 5B0EA 3KMSA 4ILMA 4USJC 2FLNA 4TQRA 1BQXA 5LSRA 1JNZB 3MTJA 2IBKA 2C2ZB 2BABA 4ED8A 4CIOA 3G6XA 1TKXA 3PW7A 2ALYB 2RRAA 4JYAF 2BJ8A 4TLQA 4LQ9A 4QPTA 3LPEA 1OWXA 4P7TA 4IG0A 2DRBA 1RT7A 1S1TB 4A8YA 1U4BA 3SIPB 8RUCA 3GJRB 1FFWB 1WOPA 4AL7A 3SCKE 3DLKA 4DL3A 4TY8B 1HWLA 2E5HA 3M2RA 2IJFA 2M7SA 5IT9U 4MKBA 4Y6IA 2FVRA 4DG1B 5B08A 1CJUA 3BGOP 2HQ3A 3LO3A 4LIRA 2RE1A 4X66F 1H2UX 2V50A 3PJWA 3HJVA 1SKWA 4RW4A 2DHAA 2OO4A 4L3KA 3A3OB 1FFSB 5HVGA 2BEFA 1OSDA 2Z0GA 1JXLA 4BBYA 4PXBA 2UXCF 2HAFA 1RU1A 2CPHA 4PG7A 4O3PA 4CM2A 3MAAB 1Q8KA 4WWSA 4IDKA 4ED1A 3P45B 1R0AA 3OHAA 1WORA 3O5TB 4R5PB 4F50A 4L73A 2ZHOA 1ZM4A 2KM8C 4WK1A 4CO3A 1URRA 5KT6A 1PJ6A 3PRVA 2DEJA 2VPXB 5HO4A 4PG6A 5ETMA 1EETA 2AT1B 1F3FA 3CCWA 2BE7D 2VASA 5KFJA 2GJIA 4RUBA 1ZZNA 2QIFA 1RAEB 1EHWA 3FCVA 5CYJA 2AJ2A 3BPDA 1C0TA 3VQTA 3I5BA 4I2PA 1J5OB 2OI2A 3PACA 3CD0A 4A8FA 4Z2XA 1UVNA 1MNEA 2DR7A 3UFCX 2RSQA 1NAQA 4M5HA 4EWTA 2DNMA 1R27B 4LVOP 1B4SA 1WUUA 5JMNA 2CPDA 5KOXA 3J7ZT 1KS2A 1RDRA 4U96A 4F0KA 1PBAA 3FEZA 3CD6S 4Q44A 4ZP6A 3I32A 2I9SA 2DR6A 5LMNJ 4AL6A 3TAQA 1S6QA 3M6VA 1NHKL 4GMKA 1RLDA 2A10A 2HRYA 2BM1A 3D6MB 4B9VA 3R5DA 4EBEA 1NB7A 2YKNB 3POTB 4LSLB 3EDRB 2DRAA 3IA0A 2LDIA 1VOMA 3IRXA 1FX4A 3CMES 4NA3A 5AXNA 4OI0A 2D7SA 4PUOB 2E9TA 1KTVA 5KFVA 4RUCA 4QIGA 2F8HA 3I87A 2W2NP 3C14B 4GVLA 3A3NB 3RJMB 1MW7A 3KG1A 3NNCA 4YHHF 3OLBA 3DU6A 2V2QA 2OFGX 2K8GA 3R97A 2Y1LB 2N4DA 2BM0A 1E6VB 1S97A 2CZVC 2RHQB 2YNIB 2O3DA 3UR3C 2R8IA 3GR1A 1G4CA 3HHEA 3ITHB 3L7PA 3GV5B 3M8WA 3TNVA 2QLJB 1RT2B 2VBZA 1RAJA 3FMWA 2CRLA 3MDFA 1I51B 4IUFA 2HURA 4FPIA 4RW8A 4WFAQ 3DYAA 4F4KA 4FPRA 3QSYB 1WC0A 2W8LA 3CDWA 4CLWA 3BKUA 2XCAA 1UFKA 1HHSA 3M8PA 1VQ8S 1N0VC 1U0SA 3AXMA 3HLUA 2NR0A 4ECWA 4Y3CA 1S49A 2GNKA 1WHWA 2FLOA 3KHRA 1C0UA 2CQHA 4PQAA 1UWAA 1N0UA 2RB7A 2HLUA 3MCNA 4RLEA 4KO0B 4J9OA 5KT5A 3TVZA 5A0YB 4U67Q 2HQDA 2HS0A 4Q45A 3D6HB 3ISNC 4YR0A 5D78A 3N5FA 3VAIA 1UWBB 2UXDF 3PR4A 4PG8A 1JLAB 1N5SA 2N82B 1S0VA 1I1GA 1YLXA 2BV3A 2R7XA 4RBTA 3V4IB 3M9MB 3LGNA 3TX0A 4I6YA 1GXTA 2W2PP 1N36F 5GMDA 4RBVA 1K1QA 3R7BB 5KG3A 4LBPA 1MSWD 5HLFA 1LNQA 1C1BA 3ZTRA 4DL7A 1GX6A 2E5JA 4BC7A 5CYQA 2CPFA 5KFRA 4AFFA 4DL0C 5J2MB 1DZ5A 4WPAA 4LF5F 3UCUP 1YTYA 1U45A 2IC3A 3ZZOA 2LXUA 1ZZFA 3TAMA 3MUVP 4GC7A 2V0NA 3I0SB 4ATNA 4NRUA 3SFGA 2VONA 4OQJA 2X1GA 1OO0B 1TAUA 2LLZA 2OAUA 3BO2A 1NSKL 1RT4A 3G6VA 4HI2A 4GC6A 3E3XA 3WX8A 1ZTWA 4GRSA 2YKPA 4J9KA 4HT7A 4QWCA 4CLTA 3JAMU 4L3NA 3C6TA 4RW6A 2XS7A 3T9ZA 4LFBJ 1C1CB 4LF9J 2J6SA 4ILRA 3RB3A 1B7FA 3MFHA 2AX1A 3PKMA 4HVZA 2KI2A 1KONA 4LJMA 1T02A 1RWOB 2O1PA 4KGKA 4YR3A 3T6JA 3KLFB 5C42A 3EICA 2KJVA 1T11A 2J6TA 5IC6B 3V6KA 1S6PB 4N76A 4IQMA 2BOAA 3DOLB 4YN3B 2UXBF 1KTQA 1PC5A 4XDCA 5B0GA 4IR1A 1PIEA 1RGVA 2IDEA 5IFMA 3NXZA 2B56A 3HZGA 4JV5J 4E8UA 3PTWA 5LJ5Y 4TY8A 3CCZA 4UY85 3WBZA 1UEKA 1VDHA 2W2MP 2AEFA 4ENOA 3HHLD 4DV2J 1D9AA 1UETA 1X4CA 4N8OA 2EWHA 3WC0A 2HHWA 2ZH1A 1HR0F 2OUGA 1HQEB 5GMEA 2C2DA 2NUHA 4PPZA 4OX9J 4A8XA 5HJYA 5KFFA 3O8WA 3ADAC 1HBUA 1Y5IB 5I3UB 3WDOA 5L9NA 2MQNA 3UDVA 2UU9F 4E2FB 1R8HA 1LKZA 2KU7A 2I8EA 1H3DA 1B3TA 2MPUA 3MAAA 1L5UA 3NGTA 1B64A 2HEKA 2CJ9A 4F2SA 3PEHA 1SUQB 2IAJB 3L9ZA 5EGYA 4CYUB 3UCGA 1NH7A 4KKOA 4UOFA 5DDPC 4PKDB 2QC3A 2YNHB 1TELA 1NZ8A 5ETKA 2AJ4A 3TA0A 1CJVB 2E1RA 4TQSA 3NNHA 1RTHB 1YX2A 3F41A 1BLUA 3N0VA 5KFPA 3QT5A 1RWKB 1RZMA 4CCHA 3NBPA 4F8RA 3PO4A 2HWIA 4M5NA 2HVIA 2CPIA 4J9QA 3MPDA 3Q83A 5LM7E 2YKMA 4OZJA 1J5OA 3ZZRA 1VC5A 1TVRB 5IT0A 2DNZA 1JLQB 3JSYA 1RTZA 3T5KA 1UAWA 1S12A 4LRAA 1R8BA 1IJFB 4FF1A 5F8IA 3W9HA 3OXFA 3W1YC 3LWLA 2HWTA 6FD1A 4K59A 2CIMA 2B51A 2WVDA 3FGVA 4PYDA 1A0OB 3RTVA 1HBOA 3D68A 3CCRS 3OTEA 2JEIA 2BJDA 2GHWA 4ZN3A 3B6BA 3AY0A 1FRHA 2XG8A 1FX2A 2E7VA 3SDEB 2YKNA 3G6YA 4LF8F 2NXUA 2APOA 3LP2B 2C2KB 2QL9B 1VRTA 3IC1A 5GAEU 2H4YB 2B9XA 2V5HG 2HFVA 5EN1A 4PUOA 3MPVA 2HVDA 3UDEA 3J81j 2HMIB 4N7TA 4TNOA 4X64J 3C14A 4KRWA 4DV4F 2EFOA 2CFXA 4X4RA 2EFVA 3NY0A 3MMAA 4L76A 2CWKA 3EXYA 1VBZA 3V6DA 2BKPA 4C8KA 4CNZA 1Y00A 4CLPA 2F1FA 2VC1A 2E7WA 1X9MA 2YNIA 2M9KA 3MEEB 2ZJRQ 4O3SA 3MZIA 3ITHA 3G71S 1UP1A 4F0HA 3SV3A 3MM6B 1RT2A 2KJWA 2J8SA 1FEHA 3BO3A 1TR0A 1SPBP 5J2NB 3H90A 4PXCA 4NPOA 3BQ2A 4DV5F 3CCLS 2NZCA 1FTCA 1M5SA 3HVWA 2CDQA 3T1YJ 4LVNP 1NKBA 3MR6A 2VFUA 5CA5A 1BY9A 5F8JA 3M6XA 2F4FA 1EAYC 1TFYA 2VA2A 2VOPA 4I67A 3H7HB 2W8KA 3VV2B 5A8KA 5K8OA 1S1WB 1R8PA 1REVB 2V4QA 2HNYA 3HF5A 3Q8QB 1FFGB 1D8ZA 3R8YA 4EYHB 5CCMA 2ZHBA 3GQCA 4X65J 1CVJA 2HVEA 1DLOB 4Y2IA 2VHGA 3K8VA 3RGIA 1LWFB 2AZ1A 4V19X 1WTBA 2C2NA 2F8MA 2AGOA 4M8LA 2LEAA 4DX6A 3DGPB 3KMQA 2DGQA 2MDAA 2VU5A 2FLLA 3EE3A 5LMUJ 3KJVA 5HK4A 3DDIA 3HVAA 2DYAA 2VD3A 2DCUB 3CW2C 3QWPA 3BPSP 2VJVA 2B8QA 1FDAA 1HMVB 5KFSA 4ZVEA 2RKIA 3R2CJ 2DNPA 1HNIB 2OJ3A 1KHVA 4DEZA 1LW2B 3KK2B 1U47A 5J2MA 5DDQC 2C2MB 3K7RA 1RI7A 1H98A 2A18A 2FY8A 3CIZA 2DNOA 3CJRA 4RJVA 1VCTA 3CO9A 3PZPA 2OELA 1VQNS 3R3TA 3I0SA 2EK1A 2AX0A 5IC4B 1S59A 4DUYF 4TYBA 2HHUA 2V8GA 2UVWA 2QE5A 4Y2KA 4LF6J 2J7KA 1PSDA 4DDFA 4EZ9A 5M2PA 2F8EX 1HD0A 1ZM9A 3IR7B 3A12A 1G2EA 1JLBB 3I56S 2Z30B 4ZCKA 5AE1A 3THPA 1C1CA 1IKXA 3H8YA 2CPEA 9RUBA 3DNCA 2BA9A 2ZOFA 4NE9C 2G0IA 4B3MF 5F8NA 3ZC4A 4UTGA 4DR4J 3H20A 3BS9A 1N34F 1IKYB 1RTJB 1ZM2A 2DXEA 5A2QU 5DDRC 5KT4A 4FKYA 2DIUA 1RTIB 1S6PA 1DRZA 3QLHB 4F25A 1NK9A 1FKPB 4KT0C 3BV8A 4I6AA 1YJ9S 2CVIA 2Y0SD 4WJBA 1XNQJ 5DO2A 4ZVHA 1VGYA 2MKYA 1APSA 3M1VB 4DX5A 1R43A 1H38A 4NL5A 2I5JB 4B17A 4M5KA 1FE4A 2W9CB 2AJQA 1HQEA 4NOHA 4X4PA 3TZYA 3NEKA 1XTZA 3HM9A 4IOAQ 2H5IB 2WONA 2Z58B 5K9FA 1S9EB 3JS9A 3CGIA 2R8HA 4EUVA 4WXWA 4WXOA 4OYIA 1ROFA 4RW9B 3AOBA 4IOBA 1M90T 1IM4A 4XK8C 3W2WA 2RVJA 1TK5A 4J9VA 2XS5A 4PQUB 3TJ8A 1NK6A 4OYPA 1N8RT 3W65A 3O1LA 3ISND 3RYLA 5GAHI 3W9JA 4GKJF 3CJ5A 3CVKA 3HULA 3UVJA 3RBZA 5HN0A 3K59A 1YJNS 2DHXA 4K5RA 3DOKB 4OI3A 2YPZA 3PYGA 2B5JB 4CDIA 1JK9B 3LW5C 4KGZB 3KLGA 3Q0AA 3K5OA 3KUGA 3PXGa 4DR1F 2LXIA 4C6AA 1SC3B 2AW0A 4YB6A 2CA9A 1XMQF 2MLYA 4RX6A 3U27A 3JSMA 5KG6A 5EWFA 1WJ9A 1UPPA 4RL1A 1TVRA 1GMWD 4MFBB 3V81B 4ZVGA 3B78A 1JLQA 1VBYA 4DS5A 9ATCB 1RWVB 2HGNA 3T9NA 1T9YA 2H4WB 4KHPJ 5L1KA 3NGDA 4K4XA 4CO2A 3UN2A 1TKDA 4ZOSA 4JI3F 2HQIA 4AQYF 3TQ1A 1MU2A 3H2LA 5DJBA 1XMOJ 5L39A 5IWAF 2CQ0A 1NUEA 3ET6A 5SUHA 2ZHAA 3RR8A 3OUYB 4Y28C 4J9NA 4FKXA 4FZVA 3Q23A 4NZ0A 1E6YB 2QJ3A 1IXKA 2JEGA 1XMBA 3OFGA 2EBEA 2A6OA 3VR1A 3DC2A 3MOZA 4ZS6A 2LYVA 3LP2A 1LXNA 5HMWA 2NPFA 4Y00A 5SZTA 3D6FB 3CCJS 2VFTA 4ZLPA 4KGMA 1UA1A 3MPYA 3RAXA 4UOCA 4HH0A 3WC2A 5C25A 4IH6A 1RHJB 4ED5A 3GTYX 4NXMJ 3NNAA 4JI6F 3RBEA 2QA1A 1AW0A 1N5QA 5GVQA 2LA6A 1SCJB 4MT1A 2FPHX 4DZ6A 4P2SA 5KFZA 2ZH3A 2LCWA 2ZWPA 2EI5A 3IR6B 4YQWA 3MM6A 2G0CA 3NGRA 2ZBQA 1KLNA 1X8DA 1IBKF 1S1UB 2BVZA 2C3MA 2XMKA 5IZHA 3C6UB 4TU8A 2ZVIA 1O0PA 2UU9J 2E9RX 3J80U 1T03B 4Y65A 1HBMB 3I31A 3MF5A 2WSFC 2R2UA 3GPAA 4NXNJ 1QLNA 2MXYA 1YG0A 2HFNA 2B4VA 4XPCA 5E7OB 3ZTPA 1X4BA 5CZXA 2LQ5A 3KK3B 4JI5F 3OT9A 1Z4UA 2RIJA 2FHJD 5T14A 1V3RA 3QSIA 1SKSA 4DV0J 4DCOB 1DTTB 1YQHA 1Q7YT 1OJ4A 4QIFA 4AD6A 3AD8C 1VBKA 2ZM6J 1F5BA 1V6HA 5KFTA 1T9TA 4RBUA 3UCZP 2CPXA 4DPXA 4DOZA 2O5DA 2VQEJ 4P73A 2RU3A 3Q8VA 5HROB 1LWFA 1RBAA 3MMBB 2OTLS 3DGPA 2WW8A 5IT9Y 4AE5A 3EZUA 2HYIB 4F4AA 2KZZA 3I4PA 2B9EA 3B8HA 2Y8WA 3HSDA 2VFVA 4JI2F 3QYYA 4U7CA 2OPQB 3MECA 5ETRA 3H42A 2R7SA 3K5MA 2GS8A 5J2QA 5KTQA 2D3OR 3DLGB 2AV5A 2Y1RI 5U47A 1HMVA 4NLGA 1S1VB 3PR5B 2ZH6A 2PI4A 3S8SA 4PABA 2RS8A 1IBLJ 3TUIC 3W62A 1AT1B 1OY9A 4J91A 3KK2A 3MAQA 3OXLA 4K4TA 4KGVB 4EBCA 3KLEB 5B0FA 2PDAA 2AD9A 1CQMA 1NHUA 1P6TA 4B9SA 1FDDA 3FRZA 1OPIA 2GQ2A 3PJXA 1CJTA 1NLKL 2GQQA 1QD1A 1WF1A 1N4LA 1RCOB 1NSQA 4C4WA 4KBIA 3KKFA 3M30A 1ZAWA 2J8AA 1FT8A 1XN9A 3B82A 1HQ2A 4ES1A 2BJ1A 3NS5A 2BJEA 2VPWB 1WSVA 5GAGU 1FD2A 4OX8A 2VKZG 2X3DA 1RT3A 1QY7A 1FKAF 4ZP9A 1AB8A 4CO0A 4DPUA 4LF2A 4ZKAA 4ZPAA 4JI1F 1MWQA 3MM5A 4G1QB 1XK8A 4WU2A 2KN4A 1Y7PA 1KQSR 3DRSA 2J0XA 5LSLA 5H9EK 3IS9B 3FMBA 2ASLA 4QOTA 3H4DA 4DWIA 2LKZA 4JI0F 2XYGB 4IR9A 1U1PA 1M1KT 3ZXWA 2E5IA 2L3MA 4LF7F 3AA8A 2MSTA 2K06A 4ETXA 3RZAA 1U09A 1IKYA 1MMLA 3W8PA 4X4OA 4P2FA 5LJ3Y 1KQGB 4DV5J 2QZ8A 1NJIT 3D3CJ 4P2XA 2IFXA 3QLHA 1S5ZA 2QL5B 2UUAF 2JVOA 4K5SA 3LANA 3M05A 4C11A 2VDHA 3BDPA 1EQ0A 2FHMA 4OHXA 2MGZB 4ZPCA 1V9OA 4IFYA 1JB0C 1QDUB 1N5YB 2DCLA 3LF0A 5B0CA 1HWJA 3DLEB 1QJHA 2H54B 3MFIA 2I5JA 1I3OB 2FIUA 3HHLB 2W9CA 2MSSA 1URNA 5H9EJ 1U25A 1XR5A 4DXLA 4JOUA 4LT6A 4K2XA 2CJAA 3D54A 4MIAA 5E3QA 4LSNB 2ACMA 1ZYQA 3KLIB 4PYAA 3FEYB 4PPDA 2WTFA 4PQUA 2F4VF 2DNYA 3HK2A 3M8RA 2BR0A 2FHOB 4JI7J 1RHKB 1WACA 3WX4A 2KYZA 4X4VA 2F65A 4MKAA 2YWWA 2OTJS 4CLFA 3HFVA 1F9FA 2MKKA 3DOKA 1N48A 2LQBA 2LFVA 3JSBA 5D15A 3TWZA 3HZEA 4LBHA 5DG8A 4K4SA 4U8YA 2EBGA 3KUHA 3DM2A 3BREA 2PSZA 2DGUA 1UFLA 3GYNA 5CABA 2F5GA 3ENWA 4ZVTB 3S1TA 2O01C 1RU2A 4MK8A 2B4UA 1SC4B 2OHDA 4DUYJ 2ZUAA 5AXLA 4H4OB 1S1XB 3OSNA 4MFBA 2ALZA 4DR2J 5DGAA 3C15B 2ILYA 3KTQA 2Y8YA 4PG5A 3T1AA 4OHVA 3IG1B 3W61A 2IM0A 2OPRB 4WP8A 2ZUGA 1SIWB 1WD6A 2AYBA 4B9LA 2HHHF 5A6WA 1FXLA 3EPGA 4I7FB 3PW4A 1JLCB 2BE2B 3Q89A 3MURP 2A2DA 3SQOP 5T41A 4K8RA 2E5LF 3IWXA 1RLCL 3R5GA 4B3MJ 4C98A 5IT4A 2DJWA 4YDXA 3VCDA 4X2BA 2JJ4D 1RHRB 1N34J 3GZ7A 3GYXB 3SMZA 2RD5C 2JHEA 2XMTA 4PR6A 2Z2LA 5DG7A 1OPZA 1RABB 3OJUA 5CD4H 3D4JA 4CTAB 3BDEA 1ACMB 5KAKA 3RAMA 4ZJOA 2RHSB 1HHQA 2ZE2B 3PO5A 3CXCR 2GFFA 1RT1A 4J7CA 3CIMA 2UV8A 3IGVA 4OZ5A 3MCOA 1BMQB 1W7WA 3TZXA 1S1UA 5L38A 3OVAA 4CLZA 4ECZA 4URSA 4CH7A 1KWMA 1Y11A 1T03A 3RBDA 3JAMY 4HTJA 2ATLA 3TX8A 4IRCA 5GADU 1Q53A 2UVRA 1N32J 1PILA 3CJ8A 3KK3A 4HTIA 2MKSA 5D6GA 3IAS9 1B0VA 2PFFB 3AXKA 2PGCA 1FKOA 2K2PA 3G82A 2JOQA 2BJ7A 1DTTA 3LP1B 2DGOA 2GVZA 4CI0B 3HVRA 4DX7A 1WEYA 1S76D 2J6UA 5F8GA 3GLJA 1SQGA 2EC0A 5J1NA 1OS5A 1T3NA 2P2CB 4ED0A 1YI2S 4K0KJ 1WEZA 1UVJA 4DR1J 4RNOA 4O3QA 5HROA 4C48A 3KHGA 1N6QB 4CH1A 1XMQJ 3MMBA 3TAPA 3QGHA 4EYIB 4JV2A 2IYGA 2VZ9A 1Q8IA 1MROB 5IV3A 2QYCA 2OIHA 1FRKA 2KM8B 1X4GA 4GO7X 5A76A 3Q8RB 1Y4ZB 4EI2A 3CMQA 1NDLA 5F3ZA 4WBFA 4KV8A 4O4GB 3D2WA 2YWHA 2NXJA 5HP1A 3ETOA 2HQGA 3DLGA 1KR4A 4KQZA 1XBWA 3OTOJ 4JI3J 1ZPWX 4M1KA 4Y2CA 4AQYJ 2G9OA 4DN0A 4NEYA 4I6WA 2KB2A 2DY1A 2DY9A 1QAYA 3BQ1A 1MMNA 1VQPS 5KFYA 4UQGA 1BQMB 4ANDA 1YK9A 4OIXA 2Y1IA 3KK1A 1DARA 3X3UA 5D8HB 2VFRA 3KLEA 5KFIA 1FWPA 3SSQA 1JQGA 1TP7A 4J37A 3G8SA 4R25A 1SJRA 4N8NA 1IUJA 3GV7B 1RWWB 2HNZA 1FXRA 2D9OA 1VQMS 4WP3A 3JB9k 1Y3KA 3OFHA 4H4KC 4NA1A 3JTNA 3DRPA 2GO9A 4ZVPB 2JLGA 3ZO7A 2DGSA 3BKFA 4DV7J 1VI7A 4GVBA 3PEJA 3R1LA 1FCAA 2WRMA 4DJBA 1WHYA 3PHTA 5IQ6A 5ETTA 1VQLS 1Q82T 4HEA9 1FVQA 3NOCA 2N3OA 3TW0A 4WYWA 3OPKA 4JI6J 4LMZA 3LALA 4G1QA 3QFHA 1QAXA 5ETOA 3JTOA 1RT5B 2DPIA 5DDOC 4NCBA 3RB6A 3FSIA 2UP1A 4WTYA 4X4TA 3OL6A 1IBKJ 1YZ6A 4CO1A 5IM0A 3B4MA 5J1EB 4NLSA 2G0JA 2M5YA 2R7RA 2OEKA 4YOEA 3TRGA 2P8IA 3KDOA 1YJTA 1T9VA 1PG5B 4CLSA 5F8HA 3CPWR 2LECA 1UL3A 2OD4A 3CJKB 2WBRA 3HHKA 3RB4A 2HBYB 3DXBA 3PRBA 1UVLA 3EVMA 1IR0A 4YUDA 2MGZA 1VLOA 2KXNB 3O44A 3UR0A 4OYBA 3A13A 1N5YA 3CCTA 5HI7A 2R7VA 5L1LA 2E66A 3DLEA 2WAQD 5F8LA 1WEXA 3SSRA 2DGVA 2UUTA 4YFUA 1U6FA 2Y9HA 2PO4A 2LMIA 3PG9A 1KLMA 3HHLA 2XGPA 3M9OB 1HI0P 4QCLA 1Q4RA 2MZSA 1PAUB 5B7WA 2E5GA 5KG4A 2CQCA 5F3TA 3WZ0A 4FYVB 1U1OA 2MZJA 4QJVA 1DQ9A 1T05A 3HHNB 1KOHA 2KG1A 5BYRA 3AAWB 5EUHA 3OHBA 1XQIA 2FJWA 1EP4B 5EX3A 1VK8A 3BR8A 5JUMA 1K47A 3H25A 1WKJA 3D0IE 2O67A 3EWGA 3R7SB 4QQBA 3T5HA 3F73A 2FGCA 1M5KC 4LRBA 2KT3A 4X4UA 4K4VA 4WYLA 2LA4A 3KOAA 4BC9A 5KT7A 5C2GA 3I6PA 2FDNA 2ZBIA 4W98A 4OI6A 1U0HB 3G86A 1VQ7S 1FRMA 4O3OA 1Y0HA 4YEAA 3K17A 4DPOA 1RISA 2H3EB 2ZEJA 3TQEA 1RT6B 1F6TA 3ZTSA 4USHA 4M5IA 2HHTA 1IKVA 3FFIA 1RBOB 4H4OA 1S1XA 2ERRA 2XSJA 4ZHRA 2X1AA 4U6PA 2W9BA 1B70B 2HNDB 3GILA 3I82A 1HNZJ 2OPRA 1RWNB 3TA2A 3EX7B 4FYWB 2BYCA 1SL0A 1F5AA 4P10A 1T8EA 1TL1B 3K57A 1FNMA 3EZOA 5EDWA 4I7FA 1FVSA 1JLCA 4MIBA 5J2PB 4MTPA 2AP6A 3ZZYA 4NLOA 3VAHA 4QR1A 1FHTA 5D4OA 1FTRA 1ULRA 2DGTA 2OSQA 1RBLA 1H6KX 1WKLA 3TA1A 3ENQA 3W60A 2CJQA 4OZ3A 2FJAB 5C5JA 2CQDA 4O23A 2EEYA 2QLFB 3MMJA 3T19A 4LFBF 1X9WA 3D67A 2YKAA 4DQRA 1GXLA 2G4BA 3JSRA 4NYZA 3NGSA 3CDUA 3BKTA 1VJWA 5A8RA 4CTAA 2AGQA 3N6NA 1BQNA 1LWEB 1KVKA 1A7GE 3WQPA 2IDLA 1BE4A 3FBEA 1VBXA 4DI6A 1WI6A 1KVIA 1UMJA 3NCRA 2FVCA 5F41A 3LGHA 1N52B 3ZNUA 2GGPA 3HT3A 2WK4A 2XHCA 5J1PA 4AYBD 3PNIA 4NLPA 1RAOA 1KFSA 2RJZA 2J76E 2O66A 1O51A 3LA0A 1OQ3A 4IFVB 5HMZA 1HNVA 1S9GA 3T6BA 2V8HA 4DV2F 3M8ZA 4YB1P 2DR5A 2P9CA 5I42B 4LRCA 5LXRA 2KTQA 5K8MA 1SVDA 1XIQA 1AROP 4J9SA 4P7VA 2FJEB 3H4BA 2ZH9A 1GTEA 1RK8A 4OX9F 3CC2S 4B3OB 3LGMA 4DFMA 4KIAA 3ZTQA 2DK2A 1CC7A 1U2CA 2VFSA 5BR8F 4UZBA 2FLPA 5A2QY 2KO1A 2EPIA 1S48A 3ZNJ1 1KVJA 2AGPA 1X4FA 1D09B 3GSIA 2Q6CA 1W2BR 4DV6J 3MMCA 1RWUA 4Q2LA 5D4PA 4QIVA 2IPOB 1X5TA 4F2RA 2VQFJ 4Q8FA 1N6QA 4ZVSB 2DHHA 1UKUA 2ROPA 4H4MA 1H7XA 1MROA 4DR5J 2Q6BA 4CRJA 2DO0A 2DKOB 1V3SA 4DHVA 4J9RA 2CJBA 2DT9A 2V68A 4WF9Q 3ILIA 4O4GA 3SZ2A 3ONQA 2BJ3A 2H48B 4ICLB 2JEFA 5L8RC 2OPSA 4DL6A 1X9SA 4YP3A 2DHSA 3B4DA 3CJSA 1G7CB 2VG6B 2P9EA 2ZKUA 4XAKA 3SSSA 3D5MA 3J7YU 1UVIA 4I69A 1BQMA 2C3PA 1FK9B 3W8GA 1SV5A 3KHHA 3SCLE 3PVXA 2NQPA 4WTOB 4WU3A 4GKKF 4LSZB 1N88A 2UUWA 2YVSA 3THVA 3P3DA 2V4JB 3QGGA 4EO8A 1HNWJ 3W5ZA 2PA3A 5MLCV 5KT2A 1TL3B 2UUCJ 2C2EA 3DRXA 4EGLA 2I1RA 3HFKA 2ZZNA 4ECRA 3HVTB 2OPPB 1R0BG 5KFCA 1J5EF 3VTIA 3KNGA 2WCXA 1B0PA 4DCPB 1RWMB 3KJNB 1CLFA 2Y1JA 1PYSB 2YKQA 2CZ9A 5FDLB 3GE9A 3GONA 4DX8H 1RXOB 2XMWA 3NRBA 3FKBA 1SJ3P 1RAAB 3UO0A 3HXMA 3CD7A 4WKYA 4OMFG 4DMZA 1CJKA 1G6BA 3BF4A 2F7VA 3MM9B 4X64F 1WELA 1NSAA 3D7SB 5J1EA 4BDPA 4I2QB 1QE1A 3PCOB 1UEUA 5E0OA 1S6OA 2KVIA 4WP9A 1PKUA 1U48A 3MPUB 1JLGB 3FDSA 2YNGB 3GU0A 4NZ7A 3MGJA 2QN6B 2VC0A 2RF2A 4HYKA 3OTCA 2Q43A 1WNEA 2BBEA 4P71A 2PMZD 4OZNA 2B9YA 2PMHA 4ECYA 5ETVA 1M1HA 5HBMB 1FRIA 2FVQA 2B6AA 1K0VA 1NPKA 2RUGA 1R89A 3QATA 5EWEA 2DH8A 2VBYA 3MWBA 3T1YF 4FXDA 1HBNA 3AQOA 4U9RA 4CP5A 3ZFVA 4TXSA 2DBBA 1LWCB 3MAHA 1EP4A 2RU9A 1S7IA 1KNZA 4DPYA 1FRJA 4IKAA 2FJXA 4X65F 4KHRA 5JVGQ 2M52A 2MHNA 3W7BA 2BKNA 3OL9A 2YH1A 4B3TJ 4UZCA 2XTJP 3MD3A 1R8AA 2JSXA 2QT7A 2RQ4A 1T3OA 4ZN1A 2NXEA 4NYPA 3J80Y 1Q81T 1IR2A 3KYLA 4O3NA 1Q16B 5LMUF 3PDNA 1U0HA 4KFBB 4LFCJ 1JLFA 2QA4G 3PYEA 4Y2AA 4UQTA 2PI5A 4OJ1A 4C8ZA 2HVZA 2X7IA 1F3VA 3FC9A 1Q86T 2XEXA 5THWA 2HFUA 3WHIA 1HPZB 1U02A 3LWMA 2V2VA 5D0HA 3QJLA 4BLGA 1BXNA 1WG4A 1YHQS 4ZA1A 3AD7C 1GMWA 2VV5A 2HNDA 4DQQA 4DUTA 2V63A 2BQ3A 1IWGA 1TL4A 3HKZD 5CD4A 2XWXA 3L7UA 4ID5A 3NG8A 4NX9A 1X7VA 2HIYA 5KFOA 3RRGA 2W4CA 1PC4A 2MHEA 5J2PA 2AQ4A 1YJVA 3BM7A 4RU2A 5HATA 2GIQA 2QEXS 4LF6F 1S7HA 2QL7B 4BWMA 1NZAA 5EWGA 3PW2A 1LEOA 2Z4PA 4FBUA 3PX6A 4M5MA 5BXIA 2OMLA 1M1GA 1X0PA 3M6UA 1Q8BA 3IFEA 2YBVA 4K2JA 5IOLA 2KH9A 1NPRA 1QUVA 4ELUA 4MH8A 3QT8A 4J9LA 2ZBCA 3TJ9A 3QRRA 2BUNA 1PJ5A 2GC8A 2B4PA 2Q3PA 2LDYA 1GEHA 2UVUA 5DM7Q 5DQGA 3K5NA 4DR4F 5DZ7A 4USTA 1NRKA 2CJXB 4PEOA 2FZKB 1NO8A 2VG7A 3W2VA 5KOWA 4S0MA 4FXVA 3PX4A 4IQXA 2R2SA 3KNAA 4Q0BB 3OD2A 5KFWA 4MYTA 1HWKA 5F0UA 3FRYA 1XNQF 2CQ2A 3QJPA 2YXLA 3BQ0A 5D3GA 5ETNA 4KGXB 4IFVA 2JH3A 4YR2A 3CJ4A 4FBTA 3ENVA 3H2VE 3T1HF 4ZVFA 3TVKA 2ZZTA 4OJGA 2DITA 5I42A 3TP2A 3SV4A 2AJ0A 3H5SA 2WZ1A 2B0GA 2GVDA 4DV3J 3US5A 3LOUA 4LFAJ 4B3OA 3AJ1A 3V4MA 5K20B 3UD5A 5KG7A 2FHJA 3UN5A 1DQ8A 4IO9Q 2MQQA 5CYMB 1QVGR 4FS1A 2KRRA 1KN6A 2AWZA 4OI2A 2HFZA 3D6TB 5KFKA 1FE0A 1HW8A 4OHZA 2JLFA 3QIDA 3HFZB 1VQ5S 3D1QA 3AA9A 1T95A 2PE8A 2MLZA 2ZH7A 1L3UA 3ZTOA 3OJSA 3GIKA 1B0TA 2XMMA 4D3HA 4UT4A 4EEYA 3M2UB 1HHTP 1NBEB 2UV8G 2CG8A 3KFWX 2GZOA 2PFDA 4ICLA 2ASDA 2IM1A 2Z57B 1FA0A 4OZ1A 5A8WB 1EKRA 2XI3A 2OFHX 2OGUA 1DJ0A 5HQ8A 3V2UC 3BZQA 4HACA 2J9DE 1WI8A 3G2XA 3MEGB 1NDKA 1RHUB 3N01A 5HQLA 1FK9A 4X4SA 2HHQA 3BJYA 2EC2A 1FERA 1DFDA 2LVWA 4KHPF 4ILLA 3QJJA 1SC1B 2V4JA 2RH3A 4GO5X 1TV6A 4KY3A 2QMWA 1FI4A 1ZOTA 3TZZA 1HW9A 2R8KA 4LRFA 3R27A 2CNOB 3DOMB 1XMOF 3HVTA 2HVHA 2OPPA 4HDHA 1NK5A 1FWKA 2JX2A 3V6JA 2KHDA 3Q24A 2VJUA 5ETPA 4MYUA 3CT9A 1IBMJ 4K50A 4OZ2A 4ECVA 4A8KA 3S6EA 2C2RA 1S1TA 4NLDA 3SFUA 3JQMA 2LEPA 2XC9A 2HZCA 5FJ4A 1VQ4S 3D0HE 2DEIA 2HGLA 3SCJE 3R9LA 1F2HA 5CQGA 4FP9A 1RADB 1GNKA 1Q8LA 4I2QA 4TU7A 1K8AT 2MY7A 1U1NA 4RW4B 4DG1A 4NXMF 4V19J 2ZOGA 4UOHA 1JLGA 3HP6A 3LAMA 2RQCA 2IYIA 4QU7A 3A8JA 4ELVA 4A48A 2CQGA 1X4AA 1ICEB 5E5NA 3EMTA 1YWXA 4A47A 1R0AB 2XMVA 2R7WA 5BR8J 5ITHA 1WC3A 4A8OA 4X4NA 3IWLA 1U24A 3R6GB 4K4WA 1U26A 4NXNF 1DURA 3BBBA 3N5BA 5HMYA 1EETB 2HIQA 4DUZF 1QM9A 4R5PA 1J2VA 2L9WA 3NCPA 4RR5A 1PO6A 2G1DA 4DV0F 1RUSA 1NJZA 3K5PA 1OYDA 3EGVA 1X4EA 1MWZA 2ZM6F 3GSDA 3LQVA 2RAQA 1LWCA 1UJ4A 3CO0P 5T7LB 2B9WA 1W2IA 1SKRA 2XLKA 2AYEA 4G6VB 2VQEF 2OSRA 3RBXA 2MEWA 3PRDA 1KOOA 4JP8A 3MM7B 4WFBQ 1QAJA 5E3PA 2R7TA 4USMA 2I0XA 4RKUC 4GKKJ 2KYXA 5CAAA 1TUGB 1PYTA 3CC7S 2PEHA 2BW7A 2DHGA 2DRDA 3GJSB 3K2YA 2HSEB 4ZPVR 4ZVUB 4JB8B 3EPIA 1MWYA 1IBLF 3QO9B 1HLWA 1CG2A 1GMUA 2AMCB 3GMGA 4K4ZA 1BWVA 3CD5A 2CWXA 1J5EJ 2JFKA 3IRXB 5HVHA 4FF2A 2VB6A 3NGKA 3M8YA 3OR2B 4NLVA 5LXYA 3MOJB 5D77A 1KSPA 5GAEI 4C3LA 5L9XA 1LFPA 3QAEA 3POTA 4PWDB 4LSLA 3P96A 5LOQA 2YQ0A 2DNHA 2R2TA 2VH7A 3MXHP 1ZAVA 4ZPTR 2NREA 3E8OA 2IMOA 4F36A 5DQIA 1K73T 1WC1A 5DLGA 3P5BP 4WFNQ 3BGUA 3GJQB 1BD6A 3CEDA 1N56A 2XY5A 4PRFA 4C3KA 2JRSA 1JLEB 1KKHA 1MN7A 1RSCA 4K4YA 4M5LA 2CJYB 5F9NA 3G9CA 2CPZA 1SL2A 4RW8B 4ZPWR 3DYAB 2LQ8A 2KFYA 1NKEA 1IWAA 2C2OB 4I4BA 1E6VA 2WVEA 2XZDB 3U02A 1U1LA 4Q7AA 5ETQA 2G1HA 2F9DA 2KXHA 1U49A 2V8VA 1HWIA 2P6SA 4KH0B 3BSOA 1H74A 1Y3JA 2IJNA 3D0GE 4B3SJ 3CMAS 2CXEA 3LH2S 2MQPA 2V4RA 2HBQB 4MMOA 2RILA 1NJWA 3TUPA 2VA3A 1RWPB 2M8DB 3FZBA 1FJEB 3CTRA 3NOGA 4Q0BA 1NNDA 4M94A 2YQ3A 2YQ1A 3D3BJ 4ZLJA 3N4WA 4UF4A 2KFZA 2ILZA 3TVYA 4DU8A 4K7QA 2IA0A 3BH6B 3GG1A 2XWYA 3R5CA 2PC6A 3EJMA 1S4EA 3O3LA 3ENAA 5K8PA 4U95A 5AJ3J 1RYRA 3I4HX 4KO0A 4QU6A 2YX7A 1W25A 5A0YA 5FLXU 2R7QA 1D8YA 4QYRA 3P6YC 2KZMA 3VAGA 3C66A 4PG4A 1UWBA 3HDSA 2FY1A 4C97A 1JLAA 4EBDA 5HLFB 5CYMA 3V5RA 3IRWP 3G8QA 5CYQB 3V4IA 1SJQA 1YVFA 4JI7F 4L72B 1JJHA 4R8UB 2WHOA 2BXJA 1XC9A 3TARA 2IC3B 2ZBPA 3TOQA 5HMXA 5CZVA 2VPZB 2QYGA 3M32B 4X62J 4Z37A 3TZWA 3F44A 1VRUB 3L95X 3AT1B 4W90B 3M2UA 1ZBTA 3HMJG 4NA2A 1P8GA 2ZC3A 1T9UA 5E3AA 1RJJA 2EXUA 4LR8A 1WKKA 1SXLA 4HI1A 5A8WA 1RT4B 1IVZA 1SH2A 2NZ4A 3HCXA 5K5MA 2GIFA 4ES2A 1YRTA 4NWBA 1GFWB 4JI8J 3G96A 5LL6d 2XY7A 5H9FK 1SI9A 2NS1B 4O0NA 5KFUA 4LUBA 3C6TB 3CCMS 1ZAXA 3CNQP 1Q79A 2BJ9A 2V67A 2C3YA 3H98A 1TK8A 4LBIA 4DR2F 1LXJA 2NUUG 4ED3A 2C3OA 4Q2MA 3FBFA 3HD2A 1VFJA 2IA6A 2V8DA 1Y10A 2V2KA 4TKTA 3PX0A 5C42B 3EGZA 4OX7A 1REGX 1GQEA 3ISZA 2VOOA 3E01B 3VAMA 5E2QA 2J0WA 3DOMA 1AYEA 2ZH2A 2R7OA 1C4CA 2D3ZA 4C8LA 4RWXA 3QRPA 3HX9A 3W66A 2G2ZA 2ZOMA 3AH6A 3KLFA 1KFDA 2HRUA 1X31C 5KG2A 4OYXA 3DOLA 5H9FJ 4PCQA 3MR3A 3ELHA 3CCUS 1NJXA 1EKSA 3IR5B 4KHMA 1ZA1B 1V5IB 1VIXA 3TYTA 1VC6A 5HSPA 1NXIA 2N3LA 1H7WA 1LQ9A 1HBUB 3T1HJ 3TANA 1RE1B 4O44B 4H54A 3LAKA 3I0RB 2LU2A 2GQCA 5RUBA 3BH7B 1FNOA 4NMLA 1WG5A 4OYOA 2FC9A 3M7VA 2FZGB 1KDNA 4YY3F 2CJKA 5I3UA 4OLPA 4PZVA 1ITPA 1WF2A 2EFNA 3QWUA 1PGZA 3K5LA 1NEEA 4XO0A 4KKOB 3IM9A 1NK7A 4IOCQ 1KRPA 2E1MC 3OQ2A 2DNRA 3NL0A 1N32F 4QWAA 4KPYA 3UD3P 3T5LA 4HLBA 4WE1B 5MAOA 4ECSA 2D41A 1V5VA 1SUQA 1U1KA 2IAJA 2JWNA 4C0OC 1HL6A 1KQKA 4CYUA 2VODA 2YNFB 5L1JA 2RQKA 1KHWA 3NBPB 3FJ2A 2XO7A 1QUPA 2YNHA 4USKA 4B3RF 5T7LA 2YKMB 1KD1T 2DISA 2V9WA 2HK2A 1TAQA 2ASYA 3QZ8A 4K0KF 3PY8A 1CJVA 2NSBA 2IRYA 3KJQB 1SKUB 1RTHA 4IYQA 4DPWA 2OKQA 1HARA 1RAIB 5KG1A 3MM7A 3SYZA 4A8WA 3E51A 1YBUA 2UVVA 4CO4A 5E33A 2RDDA 4J9PA 4NLTA 1UJ6A 2ZWOA 1N33F 1SH3A 5KFXA 2CUYA 3PW5A 1VMBA 1HBOB 1RHMB 2U1AA 2B4OA 3OTOF 2HLTA 3DHWC 4EFAC 5FIIA 2HGMA 2RDIA 4J90A 4WIQA 1RWXB 2BACA 3NKYA 3D1OA 3QO9A 1P1LA 2M8HA 2IVFB 4B08A 1VRTB 7FDRA 3G87A 2ADBA 4P72A 2GX8A 2CDRB 2B43A 3A8IA 1FESA 1X0FA 3OR2A 4W92B 3D66A 4DL2A 1TKTB 5IS2A 3SDEA 3QGIA 4PWDA 4CLLA 3BEGB 4OX6A 4Q5VA 3MPWA 2M2BA 4F4ZA 5M2UA 2JNJA 4DR6J 2V94A 3MMAB 3W9IA 2BKOA 3V6DB 3PIPQ 2CNKB 2DIVA 4DV7F 3SEOA 4KH1B 5ETLA 1RAFB 2HMIA 1J27A 3R5AA 4HT5A 1S72S 1JLEA 3DHXA 1NPPA 2ACYA 1H72C 4ELTA 4FNIA 3FSYA 4O0IA 2GMLA 4PWUA 3AD9C 4ZP8A 2Y3YA 4C7QA 2MZTA 3FBCA 2R8JA 1VLYA 4OZ0A 3MEEA 4ZCIA 3A8EA 1DTQB 3QIPB 2OEMA 4F4WA 3CB4A 4RNFA 4QBUA 2HBRB 2GAHC 4IG3B 5J2NA 2PN6A 4DQIA 5C7PA 4N5SA 1TMMA 1H73A 4OI4A 1O8BA 1YDLA 1TU0B 1TL5A 1Z1ZA 5A8KB 3PHEA 2KHCA 3IP0A 4AL5A 4OZLA 2HNYB 2XYHB 4M5DB 1JXEA 3UI3A 3GFXA 4F67A 4TVAB 3IMQJ 4DUZJ 3GWCA 1HNXJ 4LF4J 1NDCA 3KXDA 3Q86A 2HPUA 2XLIA 4ED7A 3UE2A 2LQ9A 1S1WA 5KFAA 3GYGA 1REVA 1RP5A 3VQSA 1HQUB 2VPYB 3C16B 4KJIA 3N28A 5K14B 3H5XA 4EK2A 3KJVB 2D9PA 3WIUA 1AZSB 5C24B 1DLOA 2CZ4A 1FRLA 1S0NA 4USUA 5KFHA 4Z7YA 3W3SA 1SB6A 5D0EA 1VHFA 2QSFA 1I94J 1WG1A 2XB2D 3R1HA 1MMDA 2RKIB 1WOSA 1QSSA 2BANB 3HPOA 1OY8A 1X5OA 2W1BA 4YB7A 4NCAA 4U7UK 2XM3A 4R8UA 1FJ7A 2XGQA 4J9UE 3NCQA 1HWUA 3EXCX 2HHXA 3M32A 1WHXA 1X5SA 3R5BA 1HNIA 1VRUA 1NH8A 1LW2A 2ZFHA 4E0DA 1U6ZA 4B9NA 2H51B 2KFNA 4G65A 2DH7A 3QQCD 1PJ7A 5FD1A 1GK8A 1NB2A 3GFZA 4M5JA 5KT3A 4A8QA 1VQSA 4JI4J 4XTTA 2J9DA 3AJDA 2AEJA 2P5VA 4ZJLA 3R5JB 4ZCLA 5HJXA 3D9BA 4BS2A 3AB4B 2WVBA 3P5TL 2SXLA 5GAGI 2XY6A 3ILJA 2DD8S 4LR9A 4TU9A 2DVIA 1ZH5A 3OFEA 4C8NA 4B02A 4M63A 1S57A 3GG0A 1IKXB 2AZ3A 1M5PC 2HFSA 1PYOB 1CQNA 2W9AA 4DR3F 1HNZF 1JLBA 5AXMA 2HWHA 2JL9A 3A4TA 1TQLA 2UUBJ 1DBDA 1WDTA 1NK0A 1AFJA 3E01A 2FZCB 1B7YB 1VJQA 1XR6A 1JKHB 3P4UB 1CSJA 4WKRA 4WCEQ 2H65B 3BGFA 2RUSA 1OMSA 5I3QA 2FQQB 4QW8A 4DV1J 3R2DJ 4MK7A 1RTJA 4LF1A 4A4JA 3DRYA 3RU0A 2CQIA 1RTIA 2A1BA 1N5VA 3D28A 3PYDA 3BYRA 3CJQA 4JV0A 2XMAA 2Z2ZA 3OTDA 4DL4A 1FKPA 1AUSL 1S0OA 3KG4A 1S10A 1LV5A 1C2PA 5DGBA 2VDIA 1FNXH 4DSFA 1SJ1A 2R4FA 4P6QA 3EVWA 4HH1A 2AU0A 3MR2A 3Q2TC 2WONB 3MCMA 3M1VA 3PW0A 1OYEA 3Q8PB 5E41A 2ZD1B 4O44A 2HFOA 2J9CA 3I0RA 3W2WB 1R7IA 1RYSA 3J81U 3CCQS 4O3RA 3DGVA 2X1BA 4Q8EA 1HYSB 2A0FB 4C9DA 4C2MA 1S9EA 1WWHA 4F3MA 5KFMA 3UVJB 1ELOA 4WZMA 3HJFA 4KTQA 3A3PB 4RW9A 4DF4A 4NLXA 4ZLLA 3HHDA 2IIHA 2FYXA 1RAGB 3JTPA 1QSYA 3RW7A 4DR7J 1NDPA 5EHHA 2ABYA 2JZ5A 4CH0S 3KLGB 1LFWA 5DETA 4WE1A 3FCWA 5AT1B 1Z2LA 3M8SA 5ETSA 2L9DA 2YNFA 2NXNA 1RKJA 4ZMMA 1A9NB 1VRQC 3J7AN 2MQMA 2DR8A 3JSMB 3KLHB 4ALZA 5L1IA 1D1UA 2B5JA 2PT0A 1CS4B 2IMWP 2M0GB 4DV6F 3NS7B 4UUXA 1SJFA 2M70A 2VG5B 1JJCB 2VQFF 3N6MA 1FJGJ 2LQJA 3H2UB 4P9SA 3NAIA 4CT8A 4KE5A 4DR5F 1ZS6A
chains in the Genus database with same CATH topology
3RJMB 4DCPB 1SC1B 2CDRB 2H54B 1RWMB 3R7SB 3KJNB 3GJQB 3D6HB 3IBCB 1I3OB 1ICEB 4ZVTB 3P4UB 2Y1LB 1GFWB 2C2KB 2QL9B 2H48B 2C2ZB 1RWWB 2CJYB 2H65B 1SC4B 2C2MB 2H5JB 2XYHB 2QLBB 2CNOB 3IBFB 2CJXB 2HBYB 2FQQB 2H4YB 2P2CB 1RWKB 2H51B 2C2OB 2QLJB 1RHQB 2Y0BB 4ZVRB 3KJQB 2XZDB 3GJSB 3R6GB 1RE1B 4ZVPB 2XYPB 1F9EB 2CNKB 3P45B 1I51B 4ZVUB 4JB8B 2QLFB 2XYGB 5IC4B 4ZVOB 3R6LB 4ZVQB 4LSZB 3SIPB 3GJRB 3R5JB 1QTNB 3R7BB 1BMQB 1RHKB 3D6MB 3D6FB 2CNNB 4DCOB 1SC3B 2XZTB 1PAUB 2HBQB 2CNLB 3EDRB 2QL7B 4DCJB 1IBCB 1RWPB 1RWOB 3QNWB 2C1EB 3KJFB 3NS7B 2QL5B 3EDQB 3GJTB 1RHMB 5IC6B 3R7NB 2HBZB 4ZVSB 2H5IB 1PYOB 5K20B 1RHRB 1RHUB 1RHJB 1RWXB 1NMEB 1RWNB 2H4WB 2HBRB 1RWVB 1QDUB 2DKOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RJM B;  4DCP B;  1SC1 B;  2CDR B;  2H54 B;  1RWM B;  3R7S B;  3KJN B;  3GJQ B;  3D6H B;  3IBC B;  1I3O B;  1ICE B;  4ZVT B;  3P4U B;  2Y1L B;  1GFW B;  2C2K B;  2QL9 B;  2H48 B;  2C2Z B;  1RWW B;  2CJY B;  2H65 B;  1SC4 B;  2C2M B;  2H5J B;  2XYH B;  2QLB B;  2CNO B;  3IBF B;  2CJX B;  2HBY B;  2FQQ B;  2H4Y B;  2P2C B;  1RWK B;  2H51 B;  2C2O B;  2QLJ B;  1RHQ B;  2Y0B B;  4ZVR B;  3KJQ B;  2XZD B;  3GJS B;  3R6G B;  1RE1 B;  4ZVP B;  2XYP B;  1F9E B;  2CNK B;  3P45 B;  1I51 B;  4ZVU B;  4JB8 B;  2QLF B;  2XYG B;  5IC4 B;  4ZVO B;  3R6L B;  4ZVQ B;  4LSZ B;  3SIP B;  3GJR B;  3R5J B;  1QTN B;  3R7B B;  1BMQ B;  1RHK B;  3D6M B;  3D6F B;  2CNN B;  4DCO B;  1SC3 B;  2XZT B;  1PAU B;  2HBQ B;  2CNL B;  3EDR B;  2QL7 B;  4DCJ B;  1IBC B;  1RWP B;  1RWO B;  3QNW B;  2C1E B;  3KJF B;  3NS7 B;  2QL5 B;  3EDQ B;  3GJT B;  1RHM B;  5IC6 B;  3R7N B;  2HBZ B;  4ZVS B;  2H5I B;  1PYO B;  5K20 B;  1RHR B;  1RHU B;  1RHJ B;  1RWX B;  1NME B;  1RWN B;  2H4W B;  2HBR B;  1RWV B;  1QDU B;  2DKO B; 
#chains in the Genus database with same CATH topology
 4ED4 A;  2W2O P;  1NJY A;  1MU2 B;  3EGN A;  1S6U A;  1S99 A;  3V81 A;  2M4M A;  4B9T A;  3UPF A;  3ET6 B;  1CBK A;  2EW9 A;  2XNR A;  2ZVS A;  1OSC A;  4JYA J;  2QX0 A;  2X1F A;  1U1M A;  4KAI A;  2AJ1 A;  1UZD A;  3OL8 A;  4I0W A;  1BGX T;  2ZH5 A;  2Q1L A;  1O5J A;  3CJT A;  3DDN A;  3PFE A;  3OUY A;  1TUV A;  5A6P A;  1YJU A;  2PEB A;  3NMA A;  4OYA A;  1E6Y A;  1TKT A;  2P6T A;  1TFW A;  3KWM A;  1MN9 A;  5C25 B;  1HNW F;  2CQ4 A;  2W4P A;  4H4K A;  1QAI A;  2UUC F;  3TJA A;  3GFH A;  3SI8 A;  4P74 A;  2K7K A;  2RS2 A;  3NGU A;  3L09 A;  4X66 J;  4TYA A;  1GXU A;  2AJF E;  2GCF A;  2EG1 A;  5HAN A;  2D74 B;  3FQL A;  1VYA A;  2NCK L;  4FVM A;  1RA6 A;  1TL7 B;  2GIR A;  4C8Y A;  3UNG C;  1X4D A;  4ZJQ A;  5G4D A;  7FD1 A;  2YWE A;  2YTC A;  1DTQ A;  3QIP A;  1SJ4 P;  2UXC J;  2NSC A;  4ECU A;  5ADZ A;  1TK0 A;  2R3V A;  4QPX A;  2QFJ A;  3DDK A;  2RRN A;  3BN7 A;  4IG3 A;  4YY3 J;  5GAD I;  3K0J A;  2XUL A;  3C6U A;  3TO8 A;  1SC6 A;  2CG4 A;  1HBM A;  3OR1 B;  4F0M A;  1FDB A;  4CLK A;  3PIO Q;  3UD4 P;  1WDD A;  4F26 A;  2KG0 A;  3HKW A;  4OLO A;  4E98 A;  4M5D A;  3CF5 Q;  3RR7 A;  4FF3 A;  1VHI A;  3QNW B;  3G4S S;  2JLE A;  2E44 A;  2OLW A;  2H9Z A;  3EYZ A;  3GJT B;  1P9Y A;  2HKE A;  1N5T A;  2Z8Q A;  4I56 A;  1DY3 A;  4G1I A;  2IBO A;  1FEE A;  1ZM3 A;  2C3U A;  3GII A;  2D69 A;  5BYQ A;  3O2I A;  2RT3 A;  3AQP A;  4B3R J;  1HQU A;  3C16 A;  2A3J A;  3K89 A;  5K14 A;  2WB4 A;  1VR6 A;  5HQM A;  4F3O A;  2QGF B;  1AZS A;  2GHP A;  4HHH A;  5C24 A;  3MEC B;  1L3V A;  3CDE A;  4A8M P;  5J2Q B;  4R0E A;  2ROG A;  3NWG A;  3GIR A;  3W64 A;  2BQR A;  1WSR A;  2FGO A;  3QZ7 A;  3CUL A;  4NI2 B;  1JXV A;  4URG A;  2WOM B;  2BAN A;  2DPJ A;  1RHQ B;  1KQF B;  2ZNY A;  2OPQ A;  1N33 J;  3Q8S B;  4ECQ A;  1GMV A;  4RZR A;  1LOU A;  4I64 A;  4ZVQ B;  4KB7 A;  3G6E S;  4B3T F;  1S1V A;  1M5V C;  1Z2Z A;  3CC4 S;  5AE2 A;  4ZLN A;  4IRK A;  5B0B A;  4UOG A;  1CJT B;  2XCP A;  3MI7 X;  2C1E B;  2BW2 A;  2C28 A;  1Q78 A;  3DXS X;  4DFP A;  4N77 A;  1PBU A;  3M30 B;  4DFJ A;  1VIS A;  3M2V B;  4LFC F;  3UWT A;  4U7U D;  4AXI A;  2FVS A;  1VQO S;  1RT3 B;  2V2Z A;  4YHH J;  3E2E A;  4CLY A;  4N47 A;  2ATC B;  4X4Q A;  4DBQ A;  2BQU A;  3BR9 A;  1FWL A;  3MM5 B;  2EKN A;  3DRS B;  2AKW B;  4J5O A;  2U2F A;  5KFN A;  2VBW A;  2EKY A;  3H0P A;  4CNY A;  4ZK7 M;  1NCL A;  3DFE A;  2BOP A;  1CPZ A;  1WC5 A;  2Q79 A;  2K1R B;  1V3Z A;  4KSE B;  4DS4 A;  2J7U A;  3PFO A;  1M0S A;  4OFZ A;  3VVU A;  1K0T A;  4L75 A;  2W25 A;  4FN5 A;  3IS9 A;  1JKH A;  4RW7 B;  2VIH A;  3IO1 A;  2C22 A;  4C11 B;  2MQL A;  4ERD A;  4ES3 A;  2KRB A;  2QSW A;  4IFY B;  5LT5 A;  2DNG A;  1IN0 A;  3UQS A;  4TY9 A;  3FCH A;  2NPI A;  3SCI E;  3IGN A;  4RU9 A;  1VQY A;  2DNQ A;  3OVS A;  4N56 A;  4EU0 A;  5B0D A;  3SBM A;  4AUK A;  2J0S D;  2KKH A;  4EMD A;  2E9Z A;  3C2P A;  2VF3 A;  4RPF A;  2HHS A;  1N54 B;  3HSG A;  4L74 A;  4K4U A;  3DLH A;  3EGW B;  2GMH A;  1X4H A;  2ZD1 A;  2UXD J;  2BX6 A;  4NCG B;  2W24 A;  4TLR A;  3CE8 A;  3SQG B;  2HQF A;  2HAI A;  4HHU A;  3Q2S C;  1HYS A;  4FYX B;  3MED B;  3AJ2 A;  4DF8 A;  3OV7 A;  3IM8 A;  1S4F A;  1VK3 A;  1JNR B;  1N36 J;  1HFE L;  4EO6 A;  1TTH B;  4LSN A;  1AA1 B;  4UW2 A;  4BWJ A;  3KLI A;  1Q0N A;  5GAH U;  3GV8 B;  4DQP A;  3MD1 A;  3DMJ B;  4LF5 J;  3ILL A;  1Q95 G;  4KYZ A;  4HHJ A;  2FHK A;  2HBZ B;  4DV3 F;  4LFA F;  4F04 B;  3DM2 B;  2I6W A;  1ZA2 B;  3IN5 A;  3NMR A;  1Q7L B;  1YKW A;  4QZV B;  3J7A 1;  4WFZ A;  3KLH A;  2YPY A;  4XPE A;  2GV1 A;  4X84 A;  2ADC A;  1CS4 A;  1BC6 A;  3EVO A;  2FC8 A;  3MHY A;  3S7R A;  2XQC A;  3M6W A;  1SIZ A;  1XEZ A;  3N9U C;  2VG5 A;  3VZI A;  1FJC A;  3VVT A;  2YWG A;  1BHN A;  3HSJ A;  3I9Z A;  1XER A;  1T9X A;  2IRU A;  4JUZ A;  3GFY A;  2BRK A;  3C15 A;  4V1A k;  2CQP A;  4B9M A;  1H2T Z;  2F63 A;  2CQB A;  3EM1 A;  2P9G A;  3DU5 A;  1U8S A;  4DSK A;  4QIE A;  1RQ0 A;  5FLX Y;  2WBM A;  1WC4 A;  4DR3 J;  2GW8 A;  3IG1 A;  2WW4 A;  5K8N A;  2EK6 A;  2HZV A;  2G2O A;  1UFW A;  1XWL A;  1IR1 A;  4RUH A;  1UZH A;  4QIW D;  3VWS A;  3VAJ A;  2LXF A;  2BE2 A;  4HKQ A;  2HZA A;  1GT8 A;  2DXF A;  1RAH B;  4OHW A;  2UXB J;  3OTB A;  1RKI A;  3GCW P;  5I4M A;  2GJ2 A;  1XNR F;  4ZIW A;  1U6B A;  2BE9 B;  2MLX A;  2AYM A;  1S9F A;  2R42 A;  3IBC B;  3C19 A;  1YRX A;  4LR7 A;  3OW2 R;  1D9D A;  3QRQ A;  1HR0 J;  5E3R A;  1T94 A;  3FK4 A;  3RG6 A;  2L9N A;  1RT1 B;  4CWB A;  1EQM A;  2IY5 B;  4FVC A;  4F4X A;  2ZKT A;  2X51 A;  2E1P A;  2XS2 A;  4NZ6 A;  1I6J A;  2QTW A;  4C0H A;  2WVF A;  2MZ1 A;  3TEG A;  1IBM F;  3ETM A;  4PAA A;  2QO3 A;  1TL7 A;  2B3T B;  2ZE2 A;  1D9F A;  2CNN B;  2XZT B;  1H0H B;  2W4D A;  3JQK A;  5JJB A;  3FZ2 A;  3S01 A;  3C46 A;  1YIT S;  5EX0 A;  1M5O C;  4YME A;  2J0Q D;  2H5E A;  2F9J A;  3FUY A;  4ECT A;  1KBR A;  1Q1K A;  2XNQ A;  1FKO B;  4KR0 B;  3G82 B;  2XO6 A;  3OR1 A;  2GVZ B;  1KP6 A;  2YX1 A;  1TKZ B;  3HI9 A;  2IJR A;  4JV1 A;  3V6H A;  1SH0 A;  1YGY A;  4ZPD A;  2GA7 A;  4BHQ A;  1HA1 A;  2GO8 A;  2W01 A;  2N4C A;  2CVE A;  1T7P A;  4QYZ K;  4MK9 A;  5F0W A;  3LP1 A;  4NEZ A;  1MG7 A;  3LP0 B;  2N7C A;  5KG0 A;  2YX4 A;  3DI6 B;  3IXQ A;  5DG9 A;  3K58 A;  3CDA A;  4KV8 B;  3DLJ A;  2CAJ A;  1YJ7 A;  2E29 A;  3LPY A;  2VBX A;  1HKA A;  7AT1 B;  1HIY A;  3AFG A;  5HP1 B;  1K9M T;  3VGT A;  2IHR 1;  2FB0 A;  2EG2 A;  2KXF A;  2RDJ A;  4NI2 A;  2R8G A;  2ZJQ Q;  4Z7C A;  3A8K A;  2WOM A;  3H40 A;  3I9V 9;  5IV4 A;  2YH0 A;  3M9N B;  1IKW B;  4LRD A;  3KK1 B;  2MQO A;  1JMT A;  2ZH8 A;  3J7Y I;  2BRL A;  2W7O A;  4FS2 A;  4OJ3 A;  1FRX A;  2G2Y A;  5CCL A;  4FNH A;  1NHV A;  2HNZ B;  4QYZ J;  4ED2 A;  3I5C A;  4LF8 J;  3NP5 A;  2MYF A;  3ZZT A;  2ZZM A;  3DRP B;  3IBF B;  3M2V A;  1UJ5 A;  1F9H A;  4XIU A;  3VF0 B;  4M95 A;  4GVB B;  1O6X A;  4URQ U;  2AF6 A;  1F60 B;  4FDF A;  1LWX A;  2AHO B;  2A6M A;  4DV4 J;  4UY8 T;  3OVB A;  4WK3 A;  2HS4 A;  2XLJ A;  3I55 S;  1JIH A;  1NU4 A;  3AOC A;  1L3S A;  2RNE A;  2QA4 S;  2K3I A;  1UW9 A;  3BYP A;  5LSO A;  3FBB A;  1T0T V;  4F4Y A;  2LU1 A;  1QVF R;  4CM0 A;  4D3G A;  3CCS S;  4O4R A;  1U1Q A;  3PV8 A;  1T9W A;  4ZIV A;  1CUL B;  2K1R A;  5IM0 B;  3ZZU A;  4QR0 A;  3MR5 A;  4R0J A;  2L41 A;  1H2V Z;  2JEJ A;  3CJ3 A;  4PWW A;  3CUN A;  4RW7 A;  4IRD A;  3CCV S;  1RT5 A;  2HHV A;  1UEV A;  4MKY A;  3T3F A;  2W7P A;  4FF4 A;  2KL8 A;  1RB0 A;  3DCA A;  5KFL A;  5JVH Q;  2JVR A;  2QMU B;  3QFW A;  2D3U A;  2D1C A;  3EZ5 A;  3PM9 A;  1S77 D;  3C8Y A;  5AXK A;  3H5Y A;  3CJK A;  1KLM B;  3U1M A;  3DLL Q;  2MKJ A;  3FVY A;  4IH7 A;  3VZH A;  3AOD A;  3QBC A;  2B7B B;  2NYI A;  3BGL A;  3QPI A;  1WTF A;  4ECX A;  4B3S F;  2XMU A;  4NCG A;  3VGV A;  1T05 B;  3QAU A;  2W2Q P;  3SQG A;  3BSN A;  2MJU A;  2FVP A;  1RTD B;  2DB1 A;  3KLV A;  2QA2 A;  3MED A;  4ZIT A;  3QGP A;  3JYT B;  5IQQ A;  1P27 B;  2HG4 A;  4ANC A;  2XBP A;  2K7J A;  1OIA A;  1FXD A;  2NXC A;  1GAO A;  3VHQ A;  2XSF A;  4HL9 A;  4NLU A;  3FQK A;  2MKH A;  4FXW A;  3BSA A;  2K3K A;  4NLR A;  3MUT P;  2I2Y A;  3T41 A;  3DMJ A;  5AJ3 F;  4CQ1 A;  1F1B B;  3M8Q B;  2E7X A;  2UZA A;  3ICL A;  1U1R A;  1QTM A;  1M5H A;  1FO1 A;  2CPY A;  2EFP A;  2COL A;  2HQC A;  2ZNZ A;  2KDO A;  3HT0 A;  4W4M A;  3KUE A;  1IKV B;  3FFI B;  2JC0 A;  3OSP A;  5HAO A;  4QWE A;  1GH8 A;  3MEK A;  1G1X A;  1DHM A;  1K44 A;  3KDN A;  4WZQ A;  2XSJ B;  4ZHR B;  2W9B B;  3CDB A;  1XR7 A;  3L3C A;  1RT6 A;  3KJF B;  3W63 A;  4KPC A;  2HRT A;  4X62 F;  2EFQ A;  2CPJ A;  5KG5 A;  2OH2 A;  8AT1 B;  2HK3 A;  4QWD A;  2QG9 B;  4PXE A;  2Z56 B;  3WIV A;  1SQF A;  2WB1 D;  4F3Q A;  1HI8 A;  4OYZ A;  4P75 A;  4RO0 A;  2DR9 A;  1R0C B;  8ATC B;  4PXD A;  2POK A;  3FNN A;  3MM8 B;  3T5J A;  5KFD A;  1ZET A;  3BBC A;  3MTK A;  2V6A A;  2B8P A;  1LW0 B;  3DRR B;  2CQ3 A;  4U8V A;  1TL1 A;  4JI8 F;  3CWJ A;  4BCA A;  3N6L A;  2WVC A;  2V9K A;  4C3M A;  3RRH A;  4Y0F A;  4ZPB A;  3J7Z 5;  2YWF A;  1VIO A;  3RAQ A;  2G13 A;  5G0R B;  1R3N A;  1UW4 A;  3UN3 A;  4DSI A;  4F02 A;  4DN9 A;  5A8R B;  2DXD A;  1IQZ A;  3L4B C;  4LIW A;  4ANE A;  4CT9 A;  1BQN B;  2MKC A;  2DH9 A;  2QLX A;  3FSX A;  3I96 A;  3I5A A;  2PA8 D;  4RWW A;  5GMK a;  2CNL B;  3CJ2 A;  4P52 A;  2AEM A;  5KFE A;  3AHP A;  4Y2M A;  3HO1 A;  3ILO A;  4USV A;  3KG0 A;  3MCS A;  4RUA A;  3PJ9 A;  1D0E A;  2MB0 B;  4USW A;  2GGP B;  4M5G A;  4NLW A;  2YWK A;  2LEB A;  1LWE A;  5E3C A;  4IO1 A;  1JJ4 A;  2KT5 A;  1HNV B;  1S9G B;  3A1Y G;  1NSP A;  2L08 A;  5HVF A;  4GKJ J;  3D1H A;  2R2R A;  1U2R A;  3VAK A;  4YDD B;  2M3D A;  4WFY A;  3NLC A;  4MKV A;  2RRB A;  2WSC C;  1F9E B;  2R7U A;  1BWE A;  6FDR A;  3BBF A;  1TKZ A;  2YY3 A;  4LQ3 A;  4G3I A;  2DGX A;  3GB0 A;  2FTR A;  3MMC B;  3SXL A;  4XDD A;  2FUG 9;  3TUJ C;  4YS2 A;  4DSL A;  3EUN A;  4H4M B;  1MLA A;  1AXQ A;  2FJD B;  4OL8 A;  3DLB A;  3LP0 A;  4AXJ A;  2DO4 A;  3OXG A;  1UPM B;  3Q22 A;  2X3G A;  4HR2 A;  3AOA A;  3DI6 A;  1NM2 A;  4WII A;  4G1P A;  4ETZ A;  4MIW A;  2OPS B;  2DGW A;  2XMJ A;  2FJV A;  3ULH A;  3GIJ A;  5D4N A;  3U7J A;  4RNN A;  2IVM A;  3BGR B;  5D0R A;  5IWA J;  2ZC4 A;  3IBW A;  3J81 Y;  1IKW A;  3OBI A;  3O6Q A;  4ED6 A;  3QT6 A;  4ITS A;  1SV5 B;  2V8P A;  4DZD A;  1U7L A;  4C8M A;  5KFB A;  3GP9 A;  5KFG A;  3FEX B;  1SQE A;  3BB5 A;  1I5O B;  2VG6 A;  2DTJ A;  3TI0 A;  1EB0 A;  3C3L A;  4J9M A;  1D3W A;  2J5A A;  5BYS A;  1IM6 A;  5AE3 A;  1TUW A;  1F2G A;  1EX8 A;  1XNR J;  2CAD A;  5F8M A;  1A6L A;  2C42 A;  1IBC B;  1GTH A;  2VKR A;  3EDQ B;  5LMN F;  1JJ2 R;  4QW9 A;  1TKX B;  3R7N B;  1UVK A;  3H5U A;  4AT1 B;  2ZIT A;  4OV6 A;  1TL3 A;  3BSC A;  1IJE B;  2RQM A;  2EFG A;  4IG0 B;  2ASJ A;  4NYO A;  1CEZ A;  2OMO A;  3ZZZ A;  3CSK A;  1RT7 B;  2IM3 A;  4QR2 A;  2GJF A;  2Q66 A;  3CCE S;  1S79 A;  5JXS A;  5D4L A;  4DSJ A;  4RNM A;  3DLK B;  4P2M A;  3THT A;  1CJK B;  2H5J B;  2QLB B;  1CUL A;  1L3T A;  3M2R B;  4RNH A;  2PMW A;  5FDL A;  1WC6 A;  1QE1 B;  2I38 A;  4DR6 F;  4I68 A;  2F3J A;  3UW1 A;  4DLG A;  1CJU B;  3ZZP A;  2XYP B;  2E1C A;  2NYH A;  4DFK A;  5CHC B;  1Q5V A;  1Y5L B;  4JI5 J;  1B99 A;  5C2C A;  1XJW B;  2GMJ A;  1EIY B;  3MM9 A;  2QMX A;  3RRK A;  1QSL A;  1F0X A;  2J9E A;  2RF2 B;  3M4X A;  3NS6 A;  2D3O 1;  4NLY A;  1C4A A;  2HHP A;  2KVQ E;  1SBR A;  5DLF A;  2XI2 A;  4ZP7 A;  1VS3 A;  2B6A B;  2YNG A;  3F0N A;  3BN4 A;  4QWB A;  1IQT A;  1NME B;  2PD1 A;  1FD8 A;  3NAH A;  4FYY B;  4IDK B;  1HBN B;  5HL7 Q;  2XZW A;  4I1T A;  1GX5 A;  3N79 A;  3AB2 B;  2HW3 A;  3IAM 9;  1U2F A;  1WF0 A;  3L7O A;  2IRX A;  1UTA A;  1KEK A;  3F56 A;  1AFI A;  3B54 A;  4JI2 J;  5HBM A;  4OHY A;  2B7C B;  1P9Q C;  1WHV A;  3MR7 A;  1RAC B;  4C8O A;  4OI1 A;  1RTD A;  3H59 A;  1Y5N B;  3G8T A;  4JBC A;  2PII A;  3JYT A;  5B0A A;  1HNX F;  3W5X A;  4LF4 F;  1HD1 A;  1OY6 A;  4OYM A;  3U1N A;  2MJN A;  1X5P A;  1UCN A;  2JFD A;  1ZTT A;  1YZ7 A;  1FF2 A;  2A2C A;  3TEH B;  2MZQ A;  1AUD A;  3VAF A;  1EAR A;  1KC8 T;  2ZDP A;  1C0T B;  4A8S A;  6AT1 B;  1VC0 A;  4I2P B;  1R6V A;  2EVZ A;  1R6Y A;  3M8Q A;  1LK5 A;  5L46 A;  3Q8U A;  5B09 A;  5F9L A;  1YJW S;  2JDJ A;  4DQS A;  4A46 A;  4NMX A;  3GIM A;  1JLF B;  1U8W A;  4DCJ B;  3HSZ A;  2MQ8 A;  3OLA A;  3NWR A;  1I94 F;  4CO5 A;  2MMY A;  2CYY A;  2QFI A;  4EZ6 A;  1CC8 A;  5D0G A;  4KFB A;  1OQ6 A;  3QT7 A;  2Z2Y B;  3PYF A;  4UUW A;  3QMQ A;  2DNN A;  1S6Q B;  3VGS A;  2DNK A;  1P1T A;  3PKY A;  2VIC A;  3X1L B;  3CJ0 A;  4TN2 A;  2ROE A;  4Y34 A;  1PAE X;  2CKW A;  4ID5 B;  1HPZ A;  4NAS A;  2KT2 A;  1G3O A;  4JI1 J;  3VGU A;  4MJK A;  2QLW A;  5CH7 B;  4JI0 J;  4DL5 A;  2OP5 A;  2MTL A;  4ZCM A;  3MM8 A;  1JX4 A;  4JI4 F;  3KHL A;  4LF7 J;  2R9L A;  1NK4 A;  1LW0 A;  3TUZ C;  3DRR A;  1QTN B;  4ER8 A;  1YIJ S;  2XHW A;  2W7A A;  4OJH A;  1NKC A;  1LK7 A;  1YSJ A;  1JWW A;  4N41 A;  3JQJ A;  1SL1 A;  4L6V 3;  2UUA J;  3P8B B;  4LF9 F;  1F5C A;  1EJ7 L;  2FD2 A;  2IVY A;  2JC1 A;  1S0M A;  5G0R A;  5IXU A;  4B9U A;  4HDG A;  3UDL A;  4DPT A;  2J7W A;  4OV1 A;  2WSE C;  3GCX P;  1FDN A;  3MUM P;  2ZH4 A;  2UUB F;  2VUG A;  3UDC A;  1Q5Y A;  1UVM A;  2VG7 B;  3W2V B;  4KC5 A;  3HHL C;  2F40 A;  2BDP A;  3UNY A;  2YKO A;  3U1L A;  4USI A;  3M8P B;  3RB0 A;  1Y9O A;  4JV5 F;  4DV1 F;  4YB5 A;  1R8C A;  2ZBR A;  5D3G B;  4ZDN A;  4DSE A;  1TMJ A;  2QV6 A;  1C0U B;  1NK8 A;  2F4V J;  3DN9 A;  2H1Y A;  1YRU A;  1DAX A;  1YJR A;  2E1A A;  2M88 A;  2CQ1 A;  3RW6 A;  5DRK A;  3HD1 A;  2GVD B;  1VQ9 S;  5I3P A;  4Q43 A;  3P49 B;  5KFQ A;  3BO4 A;  3JXO A;  3ZZ0 A;  2QRR A;  1WOO A;  1VQ6 S;  1RCX B;  2V34 A;  2RML A;  2L48 A;  1BUX A;  1X60 A;  2GHV C;  4CLU A;  2OEJ A;  3Q8Y A;  5DM6 Q;  1UA0 A;  2AIR B;  5DS7 A;  4ID8 A;  3VAL A;  2VL1 A;  4DU7 A;  5BJR A;  2LP4 A;  2FJB B;  2IM2 A;  5DZ6 A;  2DNL A;  1TZ0 A;  4LRE A;  1R31 A;  3DKD A;  4C0B A;  4F7V A;  1C1B B;  1HI1 A;  3LUY A;  2N7Y A;  4CZC A;  2ZDO A;  2MY8 A;  4DR7 F;  2V69 A;  2Y0B B;  4ZVR B;  3LTO A;  3TR5 A;  2Z2M A;  4MAK A;  1W26 A;  1ZPV A;  3GR0 A;  1YBA A;  4ZVO B;  3TAM B;  3R6L B;  2HHH J;  4OYW A;  1EZZ B;  4NRT A;  2HS3 A;  2OD6 A;  4HAC B;  3K8W A;  3BGR A;  1K1S A;  3IWN C;  2MKI A;  5DQH A;  5H1S V;  4NLQ A;  5CXT A;  2GAG C;  2E5L J;  3W5Y A;  3OFF A;  4FYD A;  2MZR A;  1VQK S;  1RA7 A;  1FJG F;  1TV6 B;  2BMB A;  2BZ2 A;  2ZJP Q;  2AYG A;  3MEG A;  4DLE A;  3RUB L;  4WFX A;  1PCA A;  1L3K A;  5M2R A;  1YBT A;  3OL7 A;  1DQA A;  4RW6 B;  2NLW A;  4IH5 A;  5B0E A;  3KMS A;  4ILM A;  4USJ C;  2FLN A;  4TQR A;  1BQX A;  5LSR A;  1JNZ B;  3MTJ A;  2IBK A;  2C2Z B;  2BAB A;  4ED8 A;  4CIO A;  3G6X A;  1TKX A;  3PW7 A;  2ALY B;  2RRA A;  4JYA F;  2BJ8 A;  4TLQ A;  4LQ9 A;  4QPT A;  3LPE A;  1OWX A;  4P7T A;  4IG0 A;  2DRB A;  1RT7 A;  1S1T B;  4A8Y A;  1U4B A;  3SIP B;  8RUC A;  3GJR B;  1FFW B;  1WOP A;  4AL7 A;  3SCK E;  3DLK A;  4DL3 A;  4TY8 B;  1HWL A;  2E5H A;  3M2R A;  2IJF A;  2M7S A;  5IT9 U;  4MKB A;  4Y6I A;  2FVR A;  4DG1 B;  5B08 A;  1CJU A;  3BGO P;  2HQ3 A;  3LO3 A;  4LIR A;  2RE1 A;  4X66 F;  1H2U X;  2V50 A;  3PJW A;  3HJV A;  1SKW A;  4RW4 A;  2DHA A;  2OO4 A;  4L3K A;  3A3O B;  1FFS B;  5HVG A;  2BEF A;  1OSD A;  2Z0G A;  1JXL A;  4BBY A;  4PXB A;  2UXC F;  2HAF A;  1RU1 A;  2CPH A;  4PG7 A;  4O3P A;  4CM2 A;  3MAA B;  1Q8K A;  4WWS A;  4IDK A;  4ED1 A;  3P45 B;  1R0A A;  3OHA A;  1WOR A;  3O5T B;  4R5P B;  4F50 A;  4L73 A;  2ZHO A;  1ZM4 A;  2KM8 C;  4WK1 A;  4CO3 A;  1URR A;  5KT6 A;  1PJ6 A;  3PRV A;  2DEJ A;  2VPX B;  5HO4 A;  4PG6 A;  5ETM A;  1EET A;  2AT1 B;  1F3F A;  3CCW A;  2BE7 D;  2VAS A;  5KFJ A;  2GJI A;  4RUB A;  1ZZN A;  2QIF A;  1RAE B;  1EHW A;  3FCV A;  5CYJ A;  2AJ2 A;  3BPD A;  1C0T A;  3VQT A;  3I5B A;  4I2P A;  1J5O B;  2OI2 A;  3PAC A;  3CD0 A;  4A8F A;  4Z2X A;  1UVN A;  1MNE A;  2DR7 A;  3UFC X;  2RSQ A;  1NAQ A;  4M5H A;  4EWT A;  2DNM A;  1R27 B;  4LVO P;  1B4S A;  1WUU A;  5JMN A;  2CPD A;  5KOX A;  3J7Z T;  1KS2 A;  1RDR A;  4U96 A;  4F0K A;  1PBA A;  3FEZ A;  3CD6 S;  4Q44 A;  4ZP6 A;  3I32 A;  2I9S A;  2DR6 A;  5LMN J;  4AL6 A;  3TAQ A;  1S6Q A;  3M6V A;  1NHK L;  4GMK A;  1RLD A;  2A10 A;  2HRY A;  2BM1 A;  3D6M B;  4B9V A;  3R5D A;  4EBE A;  1NB7 A;  2YKN B;  3POT B;  4LSL B;  3EDR B;  2DRA A;  3IA0 A;  2LDI A;  1VOM A;  3IRX A;  1FX4 A;  3CME S;  4NA3 A;  5AXN A;  4OI0 A;  2D7S A;  4PUO B;  2E9T A;  1KTV A;  5KFV A;  4RUC A;  4QIG A;  2F8H A;  3I87 A;  2W2N P;  3C14 B;  4GVL A;  3A3N B;  3RJM B;  1MW7 A;  3KG1 A;  3NNC A;  4YHH F;  3OLB A;  3DU6 A;  2V2Q A;  2OFG X;  2K8G A;  3R97 A;  2Y1L B;  2N4D A;  2BM0 A;  1E6V B;  1S97 A;  2CZV C;  2RHQ B;  2YNI B;  2O3D A;  3UR3 C;  2R8I A;  3GR1 A;  1G4C A;  3HHE A;  3ITH B;  3L7P A;  3GV5 B;  3M8W A;  3TNV A;  2QLJ B;  1RT2 B;  2VBZ A;  1RAJ A;  3FMW A;  2CRL A;  3MDF A;  1I51 B;  4IUF A;  2HUR A;  4FPI A;  4RW8 A;  4WFA Q;  3DYA A;  4F4K A;  4FPR A;  3QSY B;  1WC0 A;  2W8L A;  3CDW A;  4CLW A;  3BKU A;  2XCA A;  1UFK A;  1HHS A;  3M8P A;  1VQ8 S;  1N0V C;  1U0S A;  3AXM A;  3HLU A;  2NR0 A;  4ECW A;  4Y3C A;  1S49 A;  2GNK A;  1WHW A;  2FLO A;  3KHR A;  1C0U A;  2CQH A;  4PQA A;  1UWA A;  1N0U A;  2RB7 A;  2HLU A;  3MCN A;  4RLE A;  4KO0 B;  4J9O A;  5KT5 A;  3TVZ A;  5A0Y B;  4U67 Q;  2HQD A;  2HS0 A;  4Q45 A;  3D6H B;  3ISN C;  4YR0 A;  5D78 A;  3N5F A;  3VAI A;  1UWB B;  2UXD F;  3PR4 A;  4PG8 A;  1JLA B;  1N5S A;  2N82 B;  1S0V A;  1I1G A;  1YLX A;  2BV3 A;  2R7X A;  4RBT A;  3V4I B;  3M9M B;  3LGN A;  3TX0 A;  4I6Y A;  1GXT A;  2W2P P;  1N36 F;  5GMD A;  4RBV A;  1K1Q A;  3R7B B;  5KG3 A;  4LBP A;  1MSW D;  5HLF A;  1LNQ A;  1C1B A;  3ZTR A;  4DL7 A;  1GX6 A;  2E5J A;  4BC7 A;  5CYQ A;  2CPF A;  5KFR A;  4AFF A;  4DL0 C;  5J2M B;  1DZ5 A;  4WPA A;  4LF5 F;  3UCU P;  1YTY A;  1U45 A;  2IC3 A;  3ZZO A;  2LXU A;  1ZZF A;  3TAM A;  3MUV P;  4GC7 A;  2V0N A;  3I0S B;  4ATN A;  4NRU A;  3SFG A;  2VON A;  4OQJ A;  2X1G A;  1OO0 B;  1TAU A;  2LLZ A;  2OAU A;  3BO2 A;  1NSK L;  1RT4 A;  3G6V A;  4HI2 A;  4GC6 A;  3E3X A;  3WX8 A;  1ZTW A;  4GRS A;  2YKP A;  4J9K A;  4HT7 A;  4QWC A;  4CLT A;  3JAM U;  4L3N A;  3C6T A;  4RW6 A;  2XS7 A;  3T9Z A;  4LFB J;  1C1C B;  4LF9 J;  2J6S A;  4ILR A;  3RB3 A;  1B7F A;  3MFH A;  2AX1 A;  3PKM A;  4HVZ A;  2KI2 A;  1KON A;  4LJM A;  1T02 A;  1RWO B;  2O1P A;  4KGK A;  4YR3 A;  3T6J A;  3KLF B;  5C42 A;  3EIC A;  2KJV A;  1T11 A;  2J6T A;  5IC6 B;  3V6K A;  1S6P B;  4N76 A;  4IQM A;  2BOA A;  3DOL B;  4YN3 B;  2UXB F;  1KTQ A;  1PC5 A;  4XDC A;  5B0G A;  4IR1 A;  1PIE A;  1RGV A;  2IDE A;  5IFM A;  3NXZ A;  2B56 A;  3HZG A;  4JV5 J;  4E8U A;  3PTW A;  5LJ5 Y;  4TY8 A;  3CCZ A;  4UY8 5;  3WBZ A;  1UEK A;  1VDH A;  2W2M P;  2AEF A;  4ENO A;  3HHL D;  4DV2 J;  1D9A A;  1UET A;  1X4C A;  4N8O A;  2EWH A;  3WC0 A;  2HHW A;  2ZH1 A;  1HR0 F;  2OUG A;  1HQE B;  5GME A;  2C2D A;  2NUH A;  4PPZ A;  4OX9 J;  4A8X A;  5HJY A;  5KFF A;  3O8W A;  3ADA C;  1HBU A;  1Y5I B;  5I3U B;  3WDO A;  5L9N A;  2MQN A;  3UDV A;  2UU9 F;  4E2F B;  1R8H A;  1LKZ A;  2KU7 A;  2I8E A;  1H3D A;  1B3T A;  2MPU A;  3MAA A;  1L5U A;  3NGT A;  1B64 A;  2HEK A;  2CJ9 A;  4F2S A;  3PEH A;  1SUQ B;  2IAJ B;  3L9Z A;  5EGY A;  4CYU B;  3UCG A;  1NH7 A;  4KKO A;  4UOF A;  5DDP C;  4PKD B;  2QC3 A;  2YNH B;  1TEL A;  1NZ8 A;  5ETK A;  2AJ4 A;  3TA0 A;  1CJV B;  2E1R A;  4TQS A;  3NNH A;  1RTH B;  1YX2 A;  3F41 A;  1BLU A;  3N0V A;  5KFP A;  3QT5 A;  1RWK B;  1RZM A;  4CCH A;  3NBP A;  4F8R A;  3PO4 A;  2HWI A;  4M5N A;  2HVI A;  2CPI A;  4J9Q A;  3MPD A;  3Q83 A;  5LM7 E;  2YKM A;  4OZJ A;  1J5O A;  3ZZR A;  1VC5 A;  1TVR B;  5IT0 A;  2DNZ A;  1JLQ B;  3JSY A;  1RTZ A;  3T5K A;  1UAW A;  1S12 A;  4LRA A;  1R8B A;  1IJF B;  4FF1 A;  5F8I A;  3W9H A;  3OXF A;  3W1Y C;  3LWL A;  2HWT A;  6FD1 A;  4K59 A;  2CIM A;  2B51 A;  2WVD A;  3FGV A;  4PYD A;  1A0O B;  3RTV A;  1HBO A;  3D68 A;  3CCR S;  3OTE A;  2JEI A;  2BJD A;  2GHW A;  4ZN3 A;  3B6B A;  3AY0 A;  1FRH A;  2XG8 A;  1FX2 A;  2E7V A;  3SDE B;  2YKN A;  3G6Y A;  4LF8 F;  2NXU A;  2APO A;  3LP2 B;  2C2K B;  2QL9 B;  1VRT A;  3IC1 A;  5GAE U;  2H4Y B;  2B9X A;  2V5H G;  2HFV A;  5EN1 A;  4PUO A;  3MPV A;  2HVD A;  3UDE A;  3J81 j;  2HMI B;  4N7T A;  4TNO A;  4X64 J;  3C14 A;  4KRW A;  4DV4 F;  2EFO A;  2CFX A;  4X4R A;  2EFV A;  3NY0 A;  3MMA A;  4L76 A;  2CWK A;  3EXY A;  1VBZ A;  3V6D A;  2BKP A;  4C8K A;  4CNZ A;  1Y00 A;  4CLP A;  2F1F A;  2VC1 A;  2E7W A;  1X9M A;  2YNI A;  2M9K A;  3MEE B;  2ZJR Q;  4O3S A;  3MZI A;  3ITH A;  3G71 S;  1UP1 A;  4F0H A;  3SV3 A;  3MM6 B;  1RT2 A;  2KJW A;  2J8S A;  1FEH A;  3BO3 A;  1TR0 A;  1SPB P;  5J2N B;  3H90 A;  4PXC A;  4NPO A;  3BQ2 A;  4DV5 F;  3CCL S;  2NZC A;  1FTC A;  1M5S A;  3HVW A;  2CDQ A;  3T1Y J;  4LVN P;  1NKB A;  3MR6 A;  2VFU A;  5CA5 A;  1BY9 A;  5F8J A;  3M6X A;  2F4F A;  1EAY C;  1TFY A;  2VA2 A;  2VOP A;  4I67 A;  3H7H B;  2W8K A;  3VV2 B;  5A8K A;  5K8O A;  1S1W B;  1R8P A;  1REV B;  2V4Q A;  2HNY A;  3HF5 A;  3Q8Q B;  1FFG B;  1D8Z A;  3R8Y A;  4EYH B;  5CCM A;  2ZHB A;  3GQC A;  4X65 J;  1CVJ A;  2HVE A;  1DLO B;  4Y2I A;  2VHG A;  3K8V A;  3RGI A;  1LWF B;  2AZ1 A;  4V19 X;  1WTB A;  2C2N A;  2F8M A;  2AGO A;  4M8L A;  2LEA A;  4DX6 A;  3DGP B;  3KMQ A;  2DGQ A;  2MDA A;  2VU5 A;  2FLL A;  3EE3 A;  5LMU J;  3KJV A;  5HK4 A;  3DDI A;  3HVA A;  2DYA A;  2VD3 A;  2DCU B;  3CW2 C;  3QWP A;  3BPS P;  2VJV A;  2B8Q A;  1FDA A;  1HMV B;  5KFS A;  4ZVE A;  2RKI A;  3R2C J;  2DNP A;  1HNI B;  2OJ3 A;  1KHV A;  4DEZ A;  1LW2 B;  3KK2 B;  1U47 A;  5J2M A;  5DDQ C;  2C2M B;  3K7R A;  1RI7 A;  1H98 A;  2A18 A;  2FY8 A;  3CIZ A;  2DNO A;  3CJR A;  4RJV A;  1VCT A;  3CO9 A;  3PZP A;  2OEL A;  1VQN S;  3R3T A;  3I0S A;  2EK1 A;  2AX0 A;  5IC4 B;  1S59 A;  4DUY F;  4TYB A;  2HHU A;  2V8G A;  2UVW A;  2QE5 A;  4Y2K A;  4LF6 J;  2J7K A;  1PSD A;  4DDF A;  4EZ9 A;  5M2P A;  2F8E X;  1HD0 A;  1ZM9 A;  3IR7 B;  3A12 A;  1G2E A;  1JLB B;  3I56 S;  2Z30 B;  4ZCK A;  5AE1 A;  3THP A;  1C1C A;  1IKX A;  3H8Y A;  2CPE A;  9RUB A;  3DNC A;  2BA9 A;  2ZOF A;  4NE9 C;  2G0I A;  4B3M F;  5F8N A;  3ZC4 A;  4UTG A;  4DR4 J;  3H20 A;  3BS9 A;  1N34 F;  1IKY B;  1RTJ B;  1ZM2 A;  2DXE A;  5A2Q U;  5DDR C;  5KT4 A;  4FKY A;  2DIU A;  1RTI B;  1S6P A;  1DRZ A;  3QLH B;  4F25 A;  1NK9 A;  1FKP B;  4KT0 C;  3BV8 A;  4I6A A;  1YJ9 S;  2CVI A;  2Y0S D;  4WJB A;  1XNQ J;  5DO2 A;  4ZVH A;  1VGY A;  2MKY A;  1APS A;  3M1V B;  4DX5 A;  1R43 A;  1H38 A;  4NL5 A;  2I5J B;  4B17 A;  4M5K A;  1FE4 A;  2W9C B;  2AJQ A;  1HQE A;  4NOH A;  4X4P A;  3TZY A;  3NEK A;  1XTZ A;  3HM9 A;  4IOA Q;  2H5I B;  2WON A;  2Z58 B;  5K9F A;  1S9E B;  3JS9 A;  3CGI A;  2R8H A;  4EUV A;  4WXW A;  4WXO A;  4OYI A;  1ROF A;  4RW9 B;  3AOB A;  4IOB A;  1M90 T;  1IM4 A;  4XK8 C;  3W2W A;  2RVJ A;  1TK5 A;  4J9V A;  2XS5 A;  4PQU B;  3TJ8 A;  1NK6 A;  4OYP A;  1N8R T;  3W65 A;  3O1L A;  3ISN D;  3RYL A;  5GAH I;  3W9J A;  4GKJ F;  3CJ5 A;  3CVK A;  3HUL A;  3UVJ A;  3RBZ A;  5HN0 A;  3K59 A;  1YJN S;  2DHX A;  4K5R A;  3DOK B;  4OI3 A;  2YPZ A;  3PYG A;  2B5J B;  4CDI A;  1JK9 B;  3LW5 C;  4KGZ B;  3KLG A;  3Q0A A;  3K5O A;  3KUG A;  3PXG a;  4DR1 F;  2LXI A;  4C6A A;  1SC3 B;  2AW0 A;  4YB6 A;  2CA9 A;  1XMQ F;  2MLY A;  4RX6 A;  3U27 A;  3JSM A;  5KG6 A;  5EWF A;  1WJ9 A;  1UPP A;  4RL1 A;  1TVR A;  1GMW D;  4MFB B;  3V81 B;  4ZVG A;  3B78 A;  1JLQ A;  1VBY A;  4DS5 A;  9ATC B;  1RWV B;  2HGN A;  3T9N A;  1T9Y A;  2H4W B;  4KHP J;  5L1K A;  3NGD A;  4K4X A;  4CO2 A;  3UN2 A;  1TKD A;  4ZOS A;  4JI3 F;  2HQI A;  4AQY F;  3TQ1 A;  1MU2 A;  3H2L A;  5DJB A;  1XMO J;  5L39 A;  5IWA F;  2CQ0 A;  1NUE A;  3ET6 A;  5SUH A;  2ZHA A;  3RR8 A;  3OUY B;  4Y28 C;  4J9N A;  4FKX A;  4FZV A;  3Q23 A;  4NZ0 A;  1E6Y B;  2QJ3 A;  1IXK A;  2JEG A;  1XMB A;  3OFG A;  2EBE A;  2A6O A;  3VR1 A;  3DC2 A;  3MOZ A;  4ZS6 A;  2LYV A;  3LP2 A;  1LXN A;  5HMW A;  2NPF A;  4Y00 A;  5SZT A;  3D6F B;  3CCJ S;  2VFT A;  4ZLP A;  4KGM A;  1UA1 A;  3MPY A;  3RAX A;  4UOC A;  4HH0 A;  3WC2 A;  5C25 A;  4IH6 A;  1RHJ B;  4ED5 A;  3GTY X;  4NXM J;  3NNA A;  4JI6 F;  3RBE A;  2QA1 A;  1AW0 A;  1N5Q A;  5GVQ A;  2LA6 A;  1SCJ B;  4MT1 A;  2FPH X;  4DZ6 A;  4P2S A;  5KFZ A;  2ZH3 A;  2LCW A;  2ZWP A;  2EI5 A;  3IR6 B;  4YQW A;  3MM6 A;  2G0C A;  3NGR A;  2ZBQ A;  1KLN A;  1X8D A;  1IBK F;  1S1U B;  2BVZ A;  2C3M A;  2XMK A;  5IZH A;  3C6U B;  4TU8 A;  2ZVI A;  1O0P A;  2UU9 J;  2E9R X;  3J80 U;  1T03 B;  4Y65 A;  1HBM B;  3I31 A;  3MF5 A;  2WSF C;  2R2U A;  3GPA A;  4NXN J;  1QLN A;  2MXY A;  1YG0 A;  2HFN A;  2B4V A;  4XPC A;  5E7O B;  3ZTP A;  1X4B A;  5CZX A;  2LQ5 A;  3KK3 B;  4JI5 F;  3OT9 A;  1Z4U A;  2RIJ A;  2FHJ D;  5T14 A;  1V3R A;  3QSI A;  1SKS A;  4DV0 J;  4DCO B;  1DTT B;  1YQH A;  1Q7Y T;  1OJ4 A;  4QIF A;  4AD6 A;  3AD8 C;  1VBK A;  2ZM6 J;  1F5B A;  1V6H A;  5KFT A;  1T9T A;  4RBU A;  3UCZ P;  2CPX A;  4DPX A;  4DOZ A;  2O5D A;  2VQE J;  4P73 A;  2RU3 A;  3Q8V A;  5HRO B;  1LWF A;  1RBA A;  3MMB B;  2OTL S;  3DGP A;  2WW8 A;  5IT9 Y;  4AE5 A;  3EZU A;  2HYI B;  4F4A A;  2KZZ A;  3I4P A;  2B9E A;  3B8H A;  2Y8W A;  3HSD A;  2VFV A;  4JI2 F;  3QYY A;  4U7C A;  2OPQ B;  3MEC A;  5ETR A;  3H42 A;  2R7S A;  3K5M A;  2GS8 A;  5J2Q A;  5KTQ A;  2D3O R;  3DLG B;  2AV5 A;  2Y1R I;  5U47 A;  1HMV A;  4NLG A;  1S1V B;  3PR5 B;  2ZH6 A;  2PI4 A;  3S8S A;  4PAB A;  2RS8 A;  1IBL J;  3TUI C;  3W62 A;  1AT1 B;  1OY9 A;  4J91 A;  3KK2 A;  3MAQ A;  3OXL A;  4K4T A;  4KGV B;  4EBC A;  3KLE B;  5B0F A;  2PDA A;  2AD9 A;  1CQM A;  1NHU A;  1P6T A;  4B9S A;  1FDD A;  3FRZ A;  1OPI A;  2GQ2 A;  3PJX A;  1CJT A;  1NLK L;  2GQQ A;  1QD1 A;  1WF1 A;  1N4L A;  1RCO B;  1NSQ A;  4C4W A;  4KBI A;  3KKF A;  3M30 A;  1ZAW A;  2J8A A;  1FT8 A;  1XN9 A;  3B82 A;  1HQ2 A;  4ES1 A;  2BJ1 A;  3NS5 A;  2BJE A;  2VPW B;  1WSV A;  5GAG U;  1FD2 A;  4OX8 A;  2VKZ G;  2X3D A;  1RT3 A;  1QY7 A;  1FKA F;  4ZP9 A;  1AB8 A;  4CO0 A;  4DPU A;  4LF2 A;  4ZKA A;  4ZPA A;  4JI1 F;  1MWQ A;  3MM5 A;  4G1Q B;  1XK8 A;  4WU2 A;  2KN4 A;  1Y7P A;  1KQS R;  3DRS A;  2J0X A;  5LSL A;  5H9E K;  3IS9 B;  3FMB A;  2ASL A;  4QOT A;  3H4D A;  4DWI A;  2LKZ A;  4JI0 F;  2XYG B;  4IR9 A;  1U1P A;  1M1K T;  3ZXW A;  2E5I A;  2L3M A;  4LF7 F;  3AA8 A;  2MST A;  2K06 A;  4ETX A;  3RZA A;  1U09 A;  1IKY A;  1MML A;  3W8P A;  4X4O A;  4P2F A;  5LJ3 Y;  1KQG B;  4DV5 J;  2QZ8 A;  1NJI T;  3D3C J;  4P2X A;  2IFX A;  3QLH A;  1S5Z A;  2QL5 B;  2UUA F;  2JVO A;  4K5S A;  3LAN A;  3M05 A;  4C11 A;  2VDH A;  3BDP A;  1EQ0 A;  2FHM A;  4OHX A;  2MGZ B;  4ZPC A;  1V9O A;  4IFY A;  1JB0 C;  1QDU B;  1N5Y B;  2DCL A;  3LF0 A;  5B0C A;  1HWJ A;  3DLE B;  1QJH A;  2H54 B;  3MFI A;  2I5J A;  1I3O B;  2FIU A;  3HHL B;  2W9C A;  2MSS A;  1URN A;  5H9E J;  1U25 A;  1XR5 A;  4DXL A;  4JOU A;  4LT6 A;  4K2X A;  2CJA A;  3D54 A;  4MIA A;  5E3Q A;  4LSN B;  2ACM A;  1ZYQ A;  3KLI B;  4PYA A;  3FEY B;  4PPD A;  2WTF A;  4PQU A;  2F4V F;  2DNY A;  3HK2 A;  3M8R A;  2BR0 A;  2FHO B;  4JI7 J;  1RHK B;  1WAC A;  3WX4 A;  2KYZ A;  4X4V A;  2F65 A;  4MKA A;  2YWW A;  2OTJ S;  4CLF A;  3HFV A;  1F9F A;  2MKK A;  3DOK A;  1N48 A;  2LQB A;  2LFV A;  3JSB A;  5D15 A;  3TWZ A;  3HZE A;  4LBH A;  5DG8 A;  4K4S A;  4U8Y A;  2EBG A;  3KUH A;  3DM2 A;  3BRE A;  2PSZ A;  2DGU A;  1UFL A;  3GYN A;  5CAB A;  2F5G A;  3ENW A;  4ZVT B;  3S1T A;  2O01 C;  1RU2 A;  4MK8 A;  2B4U A;  1SC4 B;  2OHD A;  4DUY J;  2ZUA A;  5AXL A;  4H4O B;  1S1X B;  3OSN A;  4MFB A;  2ALZ A;  4DR2 J;  5DGA A;  3C15 B;  2ILY A;  3KTQ A;  2Y8Y A;  4PG5 A;  3T1A A;  4OHV A;  3IG1 B;  3W61 A;  2IM0 A;  2OPR B;  4WP8 A;  2ZUG A;  1SIW B;  1WD6 A;  2AYB A;  4B9L A;  2HHH F;  5A6W A;  1FXL A;  3EPG A;  4I7F B;  3PW4 A;  1JLC B;  2BE2 B;  3Q89 A;  3MUR P;  2A2D A;  3SQO P;  5T41 A;  4K8R A;  2E5L F;  3IWX A;  1RLC L;  3R5G A;  4B3M J;  4C98 A;  5IT4 A;  2DJW A;  4YDX A;  3VCD A;  4X2B A;  2JJ4 D;  1RHR B;  1N34 J;  3GZ7 A;  3GYX B;  3SMZ A;  2RD5 C;  2JHE A;  2XMT A;  4PR6 A;  2Z2L A;  5DG7 A;  1OPZ A;  1RAB B;  3OJU A;  5CD4 H;  3D4J A;  4CTA B;  3BDE A;  1ACM B;  5KAK A;  3RAM A;  4ZJO A;  2RHS B;  1HHQ A;  2ZE2 B;  3PO5 A;  3CXC R;  2GFF A;  1RT1 A;  4J7C A;  3CIM A;  2UV8 A;  3IGV A;  4OZ5 A;  3MCO A;  1BMQ B;  1W7W A;  3TZX A;  1S1U A;  5L38 A;  3OVA A;  4CLZ A;  4ECZ A;  4URS A;  4CH7 A;  1KWM A;  1Y11 A;  1T03 A;  3RBD A;  3JAM Y;  4HTJ A;  2ATL A;  3TX8 A;  4IRC A;  5GAD U;  1Q53 A;  2UVR A;  1N32 J;  1PIL A;  3CJ8 A;  3KK3 A;  4HTI A;  2MKS A;  5D6G A;  3IAS 9;  1B0V A;  2PFF B;  3AXK A;  2PGC A;  1FKO A;  2K2P A;  3G82 A;  2JOQ A;  2BJ7 A;  1DTT A;  3LP1 B;  2DGO A;  2GVZ A;  4CI0 B;  3HVR A;  4DX7 A;  1WEY A;  1S76 D;  2J6U A;  5F8G A;  3GLJ A;  1SQG A;  2EC0 A;  5J1N A;  1OS5 A;  1T3N A;  2P2C B;  4ED0 A;  1YI2 S;  4K0K J;  1WEZ A;  1UVJ A;  4DR1 J;  4RNO A;  4O3Q A;  5HRO A;  4C48 A;  3KHG A;  1N6Q B;  4CH1 A;  1XMQ J;  3MMB A;  3TAP A;  3QGH A;  4EYI B;  4JV2 A;  2IYG A;  2VZ9 A;  1Q8I A;  1MRO B;  5IV3 A;  2QYC A;  2OIH A;  1FRK A;  2KM8 B;  1X4G A;  4GO7 X;  5A76 A;  3Q8R B;  1Y4Z B;  4EI2 A;  3CMQ A;  1NDL A;  5F3Z A;  4WBF A;  4KV8 A;  4O4G B;  3D2W A;  2YWH A;  2NXJ A;  5HP1 A;  3ETO A;  2HQG A;  3DLG A;  1KR4 A;  4KQZ A;  1XBW A;  3OTO J;  4JI3 J;  1ZPW X;  4M1K A;  4Y2C A;  4AQY J;  2G9O A;  4DN0 A;  4NEY A;  4I6W A;  2KB2 A;  2DY1 A;  2DY9 A;  1QAY A;  3BQ1 A;  1MMN A;  1VQP S;  5KFY A;  4UQG A;  1BQM B;  4AND A;  1YK9 A;  4OIX A;  2Y1I A;  3KK1 A;  1DAR A;  3X3U A;  5D8H B;  2VFR A;  3KLE A;  5KFI A;  1FWP A;  3SSQ A;  1JQG A;  1TP7 A;  4J37 A;  3G8S A;  4R25 A;  1SJR A;  4N8N A;  1IUJ A;  3GV7 B;  1RWW B;  2HNZ A;  1FXR A;  2D9O A;  1VQM S;  4WP3 A;  3JB9 k;  1Y3K A;  3OFH A;  4H4K C;  4NA1 A;  3JTN A;  3DRP A;  2GO9 A;  4ZVP B;  2JLG A;  3ZO7 A;  2DGS A;  3BKF A;  4DV7 J;  1VI7 A;  4GVB A;  3PEJ A;  3R1L A;  1FCA A;  2WRM A;  4DJB A;  1WHY A;  3PHT A;  5IQ6 A;  5ETT A;  1VQL S;  1Q82 T;  4HEA 9;  1FVQ A;  3NOC A;  2N3O A;  3TW0 A;  4WYW A;  3OPK A;  4JI6 J;  4LMZ A;  3LAL A;  4G1Q A;  3QFH A;  1QAX A;  5ETO A;  3JTO A;  1RT5 B;  2DPI A;  5DDO C;  4NCB A;  3RB6 A;  3FSI A;  2UP1 A;  4WTY A;  4X4T A;  3OL6 A;  1IBK J;  1YZ6 A;  4CO1 A;  5IM0 A;  3B4M A;  5J1E B;  4NLS A;  2G0J A;  2M5Y A;  2R7R A;  2OEK A;  4YOE A;  3TRG A;  2P8I A;  3KDO A;  1YJT A;  1T9V A;  1PG5 B;  4CLS A;  5F8H A;  3CPW R;  2LEC A;  1UL3 A;  2OD4 A;  3CJK B;  2WBR A;  3HHK A;  3RB4 A;  2HBY B;  3DXB A;  3PRB A;  1UVL A;  3EVM A;  1IR0 A;  4YUD A;  2MGZ A;  1VLO A;  2KXN B;  3O44 A;  3UR0 A;  4OYB A;  3A13 A;  1N5Y A;  3CCT A;  5HI7 A;  2R7V A;  5L1L A;  2E66 A;  3DLE A;  2WAQ D;  5F8L A;  1WEX A;  3SSR A;  2DGV A;  2UUT A;  4YFU A;  1U6F A;  2Y9H A;  2PO4 A;  2LMI A;  3PG9 A;  1KLM A;  3HHL A;  2XGP A;  3M9O B;  1HI0 P;  4QCL A;  1Q4R A;  2MZS A;  1PAU B;  5B7W A;  2E5G A;  5KG4 A;  2CQC A;  5F3T A;  3WZ0 A;  4FYV B;  1U1O A;  2MZJ A;  4QJV A;  1DQ9 A;  1T05 A;  3HHN B;  1KOH A;  2KG1 A;  5BYR A;  3AAW B;  5EUH A;  3OHB A;  1XQI A;  2FJW A;  1EP4 B;  5EX3 A;  1VK8 A;  3BR8 A;  5JUM A;  1K47 A;  3H25 A;  1WKJ A;  3D0I E;  2O67 A;  3EWG A;  3R7S B;  4QQB A;  3T5H A;  3F73 A;  2FGC A;  1M5K C;  4LRB A;  2KT3 A;  4X4U A;  4K4V A;  4WYL A;  2LA4 A;  3KOA A;  4BC9 A;  5KT7 A;  5C2G A;  3I6P A;  2FDN A;  2ZBI A;  4W98 A;  4OI6 A;  1U0H B;  3G86 A;  1VQ7 S;  1FRM A;  4O3O A;  1Y0H A;  4YEA A;  3K17 A;  4DPO A;  1RIS A;  2H3E B;  2ZEJ A;  3TQE A;  1RT6 B;  1F6T A;  3ZTS A;  4USH A;  4M5I A;  2HHT A;  1IKV A;  3FFI A;  1RBO B;  4H4O A;  1S1X A;  2ERR A;  2XSJ A;  4ZHR A;  2X1A A;  4U6P A;  2W9B A;  1B70 B;  2HND B;  3GIL A;  3I82 A;  1HNZ J;  2OPR A;  1RWN B;  3TA2 A;  3EX7 B;  4FYW B;  2BYC A;  1SL0 A;  1F5A A;  4P10 A;  1T8E A;  1TL1 B;  3K57 A;  1FNM A;  3EZO A;  5EDW A;  4I7F A;  1FVS A;  1JLC A;  4MIB A;  5J2P B;  4MTP A;  2AP6 A;  3ZZY A;  4NLO A;  3VAH A;  4QR1 A;  1FHT A;  5D4O A;  1FTR A;  1ULR A;  2DGT A;  2OSQ A;  1RBL A;  1H6K X;  1WKL A;  3TA1 A;  3ENQ A;  3W60 A;  2CJQ A;  4OZ3 A;  2FJA B;  5C5J A;  2CQD A;  4O23 A;  2EEY A;  2QLF B;  3MMJ A;  3T19 A;  4LFB F;  1X9W A;  3D67 A;  2YKA A;  4DQR A;  1GXL A;  2G4B A;  3JSR A;  4NYZ A;  3NGS A;  3CDU A;  3BKT A;  1VJW A;  5A8R A;  4CTA A;  2AGQ A;  3N6N A;  1BQN A;  1LWE B;  1KVK A;  1A7G E;  3WQP A;  2IDL A;  1BE4 A;  3FBE A;  1VBX A;  4DI6 A;  1WI6 A;  1KVI A;  1UMJ A;  3NCR A;  2FVC A;  5F41 A;  3LGH A;  1N52 B;  3ZNU A;  2GGP A;  3HT3 A;  2WK4 A;  2XHC A;  5J1P A;  4AYB D;  3PNI A;  4NLP A;  1RAO A;  1KFS A;  2RJZ A;  2J76 E;  2O66 A;  1O51 A;  3LA0 A;  1OQ3 A;  4IFV B;  5HMZ A;  1HNV A;  1S9G A;  3T6B A;  2V8H A;  4DV2 F;  3M8Z A;  4YB1 P;  2DR5 A;  2P9C A;  5I42 B;  4LRC A;  5LXR A;  2KTQ A;  5K8M A;  1SVD A;  1XIQ A;  1ARO P;  4J9S A;  4P7V A;  2FJE B;  3H4B A;  2ZH9 A;  1GTE A;  1RK8 A;  4OX9 F;  3CC2 S;  4B3O B;  3LGM A;  4DFM A;  4KIA A;  3ZTQ A;  2DK2 A;  1CC7 A;  1U2C A;  2VFS A;  5BR8 F;  4UZB A;  2FLP A;  5A2Q Y;  2KO1 A;  2EPI A;  1S48 A;  3ZNJ 1;  1KVJ A;  2AGP A;  1X4F A;  1D09 B;  3GSI A;  2Q6C A;  1W2B R;  4DV6 J;  3MMC A;  1RWU A;  4Q2L A;  5D4P A;  4QIV A;  2IPO B;  1X5T A;  4F2R A;  2VQF J;  4Q8F A;  1N6Q A;  4ZVS B;  2DHH A;  1UKU A;  2ROP A;  4H4M A;  1H7X A;  1MRO A;  4DR5 J;  2Q6B A;  4CRJ A;  2DO0 A;  2DKO B;  1V3S A;  4DHV A;  4J9R A;  2CJB A;  2DT9 A;  2V68 A;  4WF9 Q;  3ILI A;  4O4G A;  3SZ2 A;  3ONQ A;  2BJ3 A;  2H48 B;  4ICL B;  2JEF A;  5L8R C;  2OPS A;  4DL6 A;  1X9S A;  4YP3 A;  2DHS A;  3B4D A;  3CJS A;  1G7C B;  2VG6 B;  2P9E A;  2ZKU A;  4XAK A;  3SSS A;  3D5M A;  3J7Y U;  1UVI A;  4I69 A;  1BQM A;  2C3P A;  1FK9 B;  3W8G A;  1SV5 A;  3KHH A;  3SCL E;  3PVX A;  2NQP A;  4WTO B;  4WU3 A;  4GKK F;  4LSZ B;  1N88 A;  2UUW A;  2YVS A;  3THV A;  3P3D A;  2V4J B;  3QGG A;  4EO8 A;  1HNW J;  3W5Z A;  2PA3 A;  5MLC V;  5KT2 A;  1TL3 B;  2UUC J;  2C2E A;  3DRX A;  4EGL A;  2I1R A;  3HFK A;  2ZZN A;  4ECR A;  3HVT B;  2OPP B;  1R0B G;  5KFC A;  1J5E F;  3VTI A;  3KNG A;  2WCX A;  1B0P A;  4DCP B;  1RWM B;  3KJN B;  1CLF A;  2Y1J A;  1PYS B;  2YKQ A;  2CZ9 A;  5FDL B;  3GE9 A;  3GON A;  4DX8 H;  1RXO B;  2XMW A;  3NRB A;  3FKB A;  1SJ3 P;  1RAA B;  3UO0 A;  3HXM A;  3CD7 A;  4WKY A;  4OMF G;  4DMZ A;  1CJK A;  1G6B A;  3BF4 A;  2F7V A;  3MM9 B;  4X64 F;  1WEL A;  1NSA A;  3D7S B;  5J1E A;  4BDP A;  4I2Q B;  1QE1 A;  3PCO B;  1UEU A;  5E0O A;  1S6O A;  2KVI A;  4WP9 A;  1PKU A;  1U48 A;  3MPU B;  1JLG B;  3FDS A;  2YNG B;  3GU0 A;  4NZ7 A;  3MGJ A;  2QN6 B;  2VC0 A;  2RF2 A;  4HYK A;  3OTC A;  2Q43 A;  1WNE A;  2BBE A;  4P71 A;  2PMZ D;  4OZN A;  2B9Y A;  2PMH A;  4ECY A;  5ETV A;  1M1H A;  5HBM B;  1FRI A;  2FVQ A;  2B6A A;  1K0V A;  1NPK A;  2RUG A;  1R89 A;  3QAT A;  5EWE A;  2DH8 A;  2VBY A;  3MWB A;  3T1Y F;  4FXD A;  1HBN A;  3AQO A;  4U9R A;  4CP5 A;  3ZFV A;  4TXS A;  2DBB A;  1LWC B;  3MAH A;  1EP4 A;  2RU9 A;  1S7I A;  1KNZ A;  4DPY A;  1FRJ A;  4IKA A;  2FJX A;  4X65 F;  4KHR A;  5JVG Q;  2M52 A;  2MHN A;  3W7B A;  2BKN A;  3OL9 A;  2YH1 A;  4B3T J;  4UZC A;  2XTJ P;  3MD3 A;  1R8A A;  2JSX A;  2QT7 A;  2RQ4 A;  1T3O A;  4ZN1 A;  2NXE A;  4NYP A;  3J80 Y;  1Q81 T;  1IR2 A;  3KYL A;  4O3N A;  1Q16 B;  5LMU F;  3PDN A;  1U0H A;  4KFB B;  4LFC J;  1JLF A;  2QA4 G;  3PYE A;  4Y2A A;  4UQT A;  2PI5 A;  4OJ1 A;  4C8Z A;  2HVZ A;  2X7I A;  1F3V A;  3FC9 A;  1Q86 T;  2XEX A;  5THW A;  2HFU A;  3WHI A;  1HPZ B;  1U02 A;  3LWM A;  2V2V A;  5D0H A;  3QJL A;  4BLG A;  1BXN A;  1WG4 A;  1YHQ S;  4ZA1 A;  3AD7 C;  1GMW A;  2VV5 A;  2HND A;  4DQQ A;  4DUT A;  2V63 A;  2BQ3 A;  1IWG A;  1TL4 A;  3HKZ D;  5CD4 A;  2XWX A;  3L7U A;  4ID5 A;  3NG8 A;  4NX9 A;  1X7V A;  2HIY A;  5KFO A;  3RRG A;  2W4C A;  1PC4 A;  2MHE A;  5J2P A;  2AQ4 A;  1YJV A;  3BM7 A;  4RU2 A;  5HAT A;  2GIQ A;  2QEX S;  4LF6 F;  1S7H A;  2QL7 B;  4BWM A;  1NZA A;  5EWG A;  3PW2 A;  1LEO A;  2Z4P A;  4FBU A;  3PX6 A;  4M5M A;  5BXI A;  2OML A;  1M1G A;  1X0P A;  3M6U A;  1Q8B A;  3IFE A;  2YBV A;  4K2J A;  5IOL A;  2KH9 A;  1NPR A;  1QUV A;  4ELU A;  4MH8 A;  3QT8 A;  4J9L A;  2ZBC A;  3TJ9 A;  3QRR A;  2BUN A;  1PJ5 A;  2GC8 A;  2B4P A;  2Q3P A;  2LDY A;  1GEH A;  2UVU A;  5DM7 Q;  5DQG A;  3K5N A;  4DR4 F;  5DZ7 A;  4UST A;  1NRK A;  2CJX B;  4PEO A;  2FZK B;  1NO8 A;  2VG7 A;  3W2V A;  5KOW A;  4S0M A;  4FXV A;  3PX4 A;  4IQX A;  2R2S A;  3KNA A;  4Q0B B;  3OD2 A;  5KFW A;  4MYT A;  1HWK A;  5F0U A;  3FRY A;  1XNQ F;  2CQ2 A;  3QJP A;  2YXL A;  3BQ0 A;  5D3G A;  5ETN A;  4KGX B;  4IFV A;  2JH3 A;  4YR2 A;  3CJ4 A;  4FBT A;  3ENV A;  3H2V E;  3T1H F;  4ZVF A;  3TVK A;  2ZZT A;  4OJG A;  2DIT A;  5I42 A;  3TP2 A;  3SV4 A;  2AJ0 A;  3H5S A;  2WZ1 A;  2B0G A;  2GVD A;  4DV3 J;  3US5 A;  3LOU A;  4LFA J;  4B3O A;  3AJ1 A;  3V4M A;  5K20 B;  3UD5 A;  5KG7 A;  2FHJ A;  3UN5 A;  1DQ8 A;  4IO9 Q;  2MQQ A;  5CYM B;  1QVG R;  4FS1 A;  2KRR A;  1KN6 A;  2AWZ A;  4OI2 A;  2HFZ A;  3D6T B;  5KFK A;  1FE0 A;  1HW8 A;  4OHZ A;  2JLF A;  3QID A;  3HFZ B;  1VQ5 S;  3D1Q A;  3AA9 A;  1T95 A;  2PE8 A;  2MLZ A;  2ZH7 A;  1L3U A;  3ZTO A;  3OJS A;  3GIK A;  1B0T A;  2XMM A;  4D3H A;  4UT4 A;  4EEY A;  3M2U B;  1HHT P;  1NBE B;  2UV8 G;  2CG8 A;  3KFW X;  2GZO A;  2PFD A;  4ICL A;  2ASD A;  2IM1 A;  2Z57 B;  1FA0 A;  4OZ1 A;  5A8W B;  1EKR A;  2XI3 A;  2OFH X;  2OGU A;  1DJ0 A;  5HQ8 A;  3V2U C;  3BZQ A;  4HAC A;  2J9D E;  1WI8 A;  3G2X A;  3MEG B;  1NDK A;  1RHU B;  3N01 A;  5HQL A;  1FK9 A;  4X4S A;  2HHQ A;  3BJY A;  2EC2 A;  1FER A;  1DFD A;  2LVW A;  4KHP F;  4ILL A;  3QJJ A;  1SC1 B;  2V4J A;  2RH3 A;  4GO5 X;  1TV6 A;  4KY3 A;  2QMW A;  1FI4 A;  1ZOT A;  3TZZ A;  1HW9 A;  2R8K A;  4LRF A;  3R27 A;  2CNO B;  3DOM B;  1XMO F;  3HVT A;  2HVH A;  2OPP A;  4HDH A;  1NK5 A;  1FWK A;  2JX2 A;  3V6J A;  2KHD A;  3Q24 A;  2VJU A;  5ETP A;  4MYU A;  3CT9 A;  1IBM J;  4K50 A;  4OZ2 A;  4ECV A;  4A8K A;  3S6E A;  2C2R A;  1S1T A;  4NLD A;  3SFU A;  3JQM A;  2LEP A;  2XC9 A;  2HZC A;  5FJ4 A;  1VQ4 S;  3D0H E;  2DEI A;  2HGL A;  3SCJ E;  3R9L A;  1F2H A;  5CQG A;  4FP9 A;  1RAD B;  1GNK A;  1Q8L A;  4I2Q A;  4TU7 A;  1K8A T;  2MY7 A;  1U1N A;  4RW4 B;  4DG1 A;  4NXM F;  4V19 J;  2ZOG A;  4UOH A;  1JLG A;  3HP6 A;  3LAM A;  2RQC A;  2IYI A;  4QU7 A;  3A8J A;  4ELV A;  4A48 A;  2CQG A;  1X4A A;  1ICE B;  5E5N A;  3EMT A;  1YWX A;  4A47 A;  1R0A B;  2XMV A;  2R7W A;  5BR8 J;  5ITH A;  1WC3 A;  4A8O A;  4X4N A;  3IWL A;  1U24 A;  3R6G B;  4K4W A;  1U26 A;  4NXN F;  1DUR A;  3BBB A;  3N5B A;  5HMY A;  1EET B;  2HIQ A;  4DUZ F;  1QM9 A;  4R5P A;  1J2V A;  2L9W A;  3NCP A;  4RR5 A;  1PO6 A;  2G1D A;  4DV0 F;  1RUS A;  1NJZ A;  3K5P A;  1OYD A;  3EGV A;  1X4E A;  1MWZ A;  2ZM6 F;  3GSD A;  3LQV A;  2RAQ A;  1LWC A;  1UJ4 A;  3CO0 P;  5T7L B;  2B9W A;  1W2I A;  1SKR A;  2XLK A;  2AYE A;  4G6V B;  2VQE F;  2OSR A;  3RBX A;  2MEW A;  3PRD A;  1KOO A;  4JP8 A;  3MM7 B;  4WFB Q;  1QAJ A;  5E3P A;  2R7T A;  4USM A;  2I0X A;  4RKU C;  4GKK J;  2KYX A;  5CAA A;  1TUG B;  1PYT A;  3CC7 S;  2PEH A;  2BW7 A;  2DHG A;  2DRD A;  3GJS B;  3K2Y A;  2HSE B;  4ZPV R;  4ZVU B;  4JB8 B;  3EPI A;  1MWY A;  1IBL F;  3QO9 B;  1HLW A;  1CG2 A;  1GMU A;  2AMC B;  3GMG A;  4K4Z A;  1BWV A;  3CD5 A;  2CWX A;  1J5E J;  2JFK A;  3IRX B;  5HVH A;  4FF2 A;  2VB6 A;  3NGK A;  3M8Y A;  3OR2 B;  4NLV A;  5LXY A;  3MOJ B;  5D77 A;  1KSP A;  5GAE I;  4C3L A;  5L9X A;  1LFP A;  3QAE A;  3POT A;  4PWD B;  4LSL A;  3P96 A;  5LOQ A;  2YQ0 A;  2DNH A;  2R2T A;  2VH7 A;  3MXH P;  1ZAV A;  4ZPT R;  2NRE A;  3E8O A;  2IMO A;  4F36 A;  5DQI A;  1K73 T;  1WC1 A;  5DLG A;  3P5B P;  4WFN Q;  3BGU A;  3GJQ B;  1BD6 A;  3CED A;  1N56 A;  2XY5 A;  4PRF A;  4C3K A;  2JRS A;  1JLE B;  1KKH A;  1MN7 A;  1RSC A;  4K4Y A;  4M5L A;  2CJY B;  5F9N A;  3G9C A;  2CPZ A;  1SL2 A;  4RW8 B;  4ZPW R;  3DYA B;  2LQ8 A;  2KFY A;  1NKE A;  1IWA A;  2C2O B;  4I4B A;  1E6V A;  2WVE A;  2XZD B;  3U02 A;  1U1L A;  4Q7A A;  5ETQ A;  2G1H A;  2F9D A;  2KXH A;  1U49 A;  2V8V A;  1HWI A;  2P6S A;  4KH0 B;  3BSO A;  1H74 A;  1Y3J A;  2IJN A;  3D0G E;  4B3S J;  3CMA S;  2CXE A;  3LH2 S;  2MQP A;  2V4R A;  2HBQ B;  4MMO A;  2RIL A;  1NJW A;  3TUP A;  2VA3 A;  1RWP B;  2M8D B;  3FZB A;  1FJE B;  3CTR A;  3NOG A;  4Q0B A;  1NND A;  4M94 A;  2YQ3 A;  2YQ1 A;  3D3B J;  4ZLJ A;  3N4W A;  4UF4 A;  2KFZ A;  2ILZ A;  3TVY A;  4DU8 A;  4K7Q A;  2IA0 A;  3BH6 B;  3GG1 A;  2XWY A;  3R5C A;  2PC6 A;  3EJM A;  1S4E A;  3O3L A;  3ENA A;  5K8P A;  4U95 A;  5AJ3 J;  1RYR A;  3I4H X;  4KO0 A;  4QU6 A;  2YX7 A;  1W25 A;  5A0Y A;  5FLX U;  2R7Q A;  1D8Y A;  4QYR A;  3P6Y C;  2KZM A;  3VAG A;  3C66 A;  4PG4 A;  1UWB A;  3HDS A;  2FY1 A;  4C97 A;  1JLA A;  4EBD A;  5HLF B;  5CYM A;  3V5R A;  3IRW P;  3G8Q A;  5CYQ B;  3V4I A;  1SJQ A;  1YVF A;  4JI7 F;  4L72 B;  1JJH A;  4R8U B;  2WHO A;  2BXJ A;  1XC9 A;  3TAR A;  2IC3 B;  2ZBP A;  3TOQ A;  5HMX A;  5CZV A;  2VPZ B;  2QYG A;  3M32 B;  4X62 J;  4Z37 A;  3TZW A;  3F44 A;  1VRU B;  3L95 X;  3AT1 B;  4W90 B;  3M2U A;  1ZBT A;  3HMJ G;  4NA2 A;  1P8G A;  2ZC3 A;  1T9U A;  5E3A A;  1RJJ A;  2EXU A;  4LR8 A;  1WKK A;  1SXL A;  4HI1 A;  5A8W A;  1RT4 B;  1IVZ A;  1SH2 A;  2NZ4 A;  3HCX A;  5K5M A;  2GIF A;  4ES2 A;  1YRT A;  4NWB A;  1GFW B;  4JI8 J;  3G96 A;  5LL6 d;  2XY7 A;  5H9F K;  1SI9 A;  2NS1 B;  4O0N A;  5KFU A;  4LUB A;  3C6T B;  3CCM S;  1ZAX A;  3CNQ P;  1Q79 A;  2BJ9 A;  2V67 A;  2C3Y A;  3H98 A;  1TK8 A;  4LBI A;  4DR2 F;  1LXJ A;  2NUU G;  4ED3 A;  2C3O A;  4Q2M A;  3FBF A;  3HD2 A;  1VFJ A;  2IA6 A;  2V8D A;  1Y10 A;  2V2K A;  4TKT A;  3PX0 A;  5C42 B;  3EGZ A;  4OX7 A;  1REG X;  1GQE A;  3ISZ A;  2VOO A;  3E01 B;  3VAM A;  5E2Q A;  2J0W A;  3DOM A;  1AYE A;  2ZH2 A;  2R7O A;  1C4C A;  2D3Z A;  4C8L A;  4RWX A;  3QRP A;  3HX9 A;  3W66 A;  2G2Z A;  2ZOM A;  3AH6 A;  3KLF A;  1KFD A;  2HRU A;  1X31 C;  5KG2 A;  4OYX A;  3DOL A;  5H9F J;  4PCQ A;  3MR3 A;  3ELH A;  3CCU S;  1NJX A;  1EKS A;  3IR5 B;  4KHM A;  1ZA1 B;  1V5I B;  1VIX A;  3TYT A;  1VC6 A;  5HSP A;  1NXI A;  2N3L A;  1H7W A;  1LQ9 A;  1HBU B;  3T1H J;  3TAN A;  1RE1 B;  4O44 B;  4H54 A;  3LAK A;  3I0R B;  2LU2 A;  2GQC A;  5RUB A;  3BH7 B;  1FNO A;  4NML A;  1WG5 A;  4OYO A;  2FC9 A;  3M7V A;  2FZG B;  1KDN A;  4YY3 F;  2CJK A;  5I3U A;  4OLP A;  4PZV A;  1ITP A;  1WF2 A;  2EFN A;  3QWU A;  1PGZ A;  3K5L A;  1NEE A;  4XO0 A;  4KKO B;  3IM9 A;  1NK7 A;  4IOC Q;  1KRP A;  2E1M C;  3OQ2 A;  2DNR A;  3NL0 A;  1N32 F;  4QWA A;  4KPY A;  3UD3 P;  3T5L A;  4HLB A;  4WE1 B;  5MAO A;  4ECS A;  2D41 A;  1V5V A;  1SUQ A;  1U1K A;  2IAJ A;  2JWN A;  4C0O C;  1HL6 A;  1KQK A;  4CYU A;  2VOD A;  2YNF B;  5L1J A;  2RQK A;  1KHW A;  3NBP B;  3FJ2 A;  2XO7 A;  1QUP A;  2YNH A;  4USK A;  4B3R F;  5T7L A;  2YKM B;  1KD1 T;  2DIS A;  2V9W A;  2HK2 A;  1TAQ A;  2ASY A;  3QZ8 A;  4K0K F;  3PY8 A;  1CJV A;  2NSB A;  2IRY A;  3KJQ B;  1SKU B;  1RTH A;  4IYQ A;  4DPW A;  2OKQ A;  1HAR A;  1RAI B;  5KG1 A;  3MM7 A;  3SYZ A;  4A8W A;  3E51 A;  1YBU A;  2UVV A;  4CO4 A;  5E33 A;  2RDD A;  4J9P A;  4NLT A;  1UJ6 A;  2ZWO A;  1N33 F;  1SH3 A;  5KFX A;  2CUY A;  3PW5 A;  1VMB A;  1HBO B;  1RHM B;  2U1A A;  2B4O A;  3OTO F;  2HLT A;  3DHW C;  4EFA C;  5FII A;  2HGM A;  2RDI A;  4J90 A;  4WIQ A;  1RWX B;  2BAC A;  3NKY A;  3D1O A;  3QO9 A;  1P1L A;  2M8H A;  2IVF B;  4B08 A;  1VRT B;  7FDR A;  3G87 A;  2ADB A;  4P72 A;  2GX8 A;  2CDR B;  2B43 A;  3A8I A;  1FES A;  1X0F A;  3OR2 A;  4W92 B;  3D66 A;  4DL2 A;  1TKT B;  5IS2 A;  3SDE A;  3QGI A;  4PWD A;  4CLL A;  3BEG B;  4OX6 A;  4Q5V A;  3MPW A;  2M2B A;  4F4Z A;  5M2U A;  2JNJ A;  4DR6 J;  2V94 A;  3MMA B;  3W9I A;  2BKO A;  3V6D B;  3PIP Q;  2CNK B;  2DIV A;  4DV7 F;  3SEO A;  4KH1 B;  5ETL A;  1RAF B;  2HMI A;  1J27 A;  3R5A A;  4HT5 A;  1S72 S;  1JLE A;  3DHX A;  1NPP A;  2ACY A;  1H72 C;  4ELT A;  4FNI A;  3FSY A;  4O0I A;  2GML A;  4PWU A;  3AD9 C;  4ZP8 A;  2Y3Y A;  4C7Q A;  2MZT A;  3FBC A;  2R8J A;  1VLY A;  4OZ0 A;  3MEE A;  4ZCI A;  3A8E A;  1DTQ B;  3QIP B;  2OEM A;  4F4W A;  3CB4 A;  4RNF A;  4QBU A;  2HBR B;  2GAH C;  4IG3 B;  5J2N A;  2PN6 A;  4DQI A;  5C7P A;  4N5S A;  1TMM A;  1H73 A;  4OI4 A;  1O8B A;  1YDL A;  1TU0 B;  1TL5 A;  1Z1Z A;  5A8K B;  3PHE A;  2KHC A;  3IP0 A;  4AL5 A;  4OZL A;  2HNY B;  2XYH B;  4M5D B;  1JXE A;  3UI3 A;  3GFX A;  4F67 A;  4TVA B;  3IMQ J;  4DUZ J;  3GWC A;  1HNX J;  4LF4 J;  1NDC A;  3KXD A;  3Q86 A;  2HPU A;  2XLI A;  4ED7 A;  3UE2 A;  2LQ9 A;  1S1W A;  5KFA A;  3GYG A;  1REV A;  1RP5 A;  3VQS A;  1HQU B;  2VPY B;  3C16 B;  4KJI A;  3N28 A;  5K14 B;  3H5X A;  4EK2 A;  3KJV B;  2D9P A;  3WIU A;  1AZS B;  5C24 B;  1DLO A;  2CZ4 A;  1FRL A;  1S0N A;  4USU A;  5KFH A;  4Z7Y A;  3W3S A;  1SB6 A;  5D0E A;  1VHF A;  2QSF A;  1I94 J;  1WG1 A;  2XB2 D;  3R1H A;  1MMD A;  2RKI B;  1WOS A;  1QSS A;  2BAN B;  3HPO A;  1OY8 A;  1X5O A;  2W1B A;  4YB7 A;  4NCA A;  4U7U K;  2XM3 A;  4R8U A;  1FJ7 A;  2XGQ A;  4J9U E;  3NCQ A;  1HWU A;  3EXC X;  2HHX A;  3M32 A;  1WHX A;  1X5S A;  3R5B A;  1HNI A;  1VRU A;  1NH8 A;  1LW2 A;  2ZFH A;  4E0D A;  1U6Z A;  4B9N A;  2H51 B;  2KFN A;  4G65 A;  2DH7 A;  3QQC D;  1PJ7 A;  5FD1 A;  1GK8 A;  1NB2 A;  3GFZ A;  4M5J A;  5KT3 A;  4A8Q A;  1VQS A;  4JI4 J;  4XTT A;  2J9D A;  3AJD A;  2AEJ A;  2P5V A;  4ZJL A;  3R5J B;  4ZCL A;  5HJX A;  3D9B A;  4BS2 A;  3AB4 B;  2WVB A;  3P5T L;  2SXL A;  5GAG I;  2XY6 A;  3ILJ A;  2DD8 S;  4LR9 A;  4TU9 A;  2DVI A;  1ZH5 A;  3OFE A;  4C8N A;  4B02 A;  4M63 A;  1S57 A;  3GG0 A;  1IKX B;  2AZ3 A;  1M5P C;  2HFS A;  1PYO B;  1CQN A;  2W9A A;  4DR3 F;  1HNZ F;  1JLB A;  5AXM A;  2HWH A;  2JL9 A;  3A4T A;  1TQL A;  2UUB J;  1DBD A;  1WDT A;  1NK0 A;  1AFJ A;  3E01 A;  2FZC B;  1B7Y B;  1VJQ A;  1XR6 A;  1JKH B;  3P4U B;  1CSJ A;  4WKR A;  4WCE Q;  2H65 B;  3BGF A;  2RUS A;  1OMS A;  5I3Q A;  2FQQ B;  4QW8 A;  4DV1 J;  3R2D J;  4MK7 A;  1RTJ A;  4LF1 A;  4A4J A;  3DRY A;  3RU0 A;  2CQI A;  1RTI A;  2A1B A;  1N5V A;  3D28 A;  3PYD A;  3BYR A;  3CJQ A;  4JV0 A;  2XMA A;  2Z2Z A;  3OTD A;  4DL4 A;  1FKP A;  1AUS L;  1S0O A;  3KG4 A;  1S10 A;  1LV5 A;  1C2P A;  5DGB A;  2VDI A;  1FNX H;  4DSF A;  1SJ1 A;  2R4F A;  4P6Q A;  3EVW A;  4HH1 A;  2AU0 A;  3MR2 A;  3Q2T C;  2WON B;  3MCM A;  3M1V A;  3PW0 A;  1OYE A;  3Q8P B;  5E41 A;  2ZD1 B;  4O44 A;  2HFO A;  2J9C A;  3I0R A;  3W2W B;  1R7I A;  1RYS A;  3J81 U;  3CCQ S;  4O3R A;  3DGV A;  2X1B A;  4Q8E A;  1HYS B;  2A0F B;  4C9D A;  4C2M A;  1S9E A;  1WWH A;  4F3M A;  5KFM A;  3UVJ B;  1ELO A;  4WZM A;  3HJF A;  4KTQ A;  3A3P B;  4RW9 A;  4DF4 A;  4NLX A;  4ZLL A;  3HHD A;  2IIH A;  2FYX A;  1RAG B;  3JTP A;  1QSY A;  3RW7 A;  4DR7 J;  1NDP A;  5EHH A;  2ABY A;  2JZ5 A;  4CH0 S;  3KLG B;  1LFW A;  5DET A;  4WE1 A;  3FCW A;  5AT1 B;  1Z2L A;  3M8S A;  5ETS A;  2L9D A;  2YNF A;  2NXN A;  1RKJ A;  4ZMM A;  1A9N B;  1VRQ C;  3J7A N;  2MQM A;  2DR8 A;  3JSM B;  3KLH B;  4ALZ A;  5L1I A;  1D1U A;  2B5J A;  2PT0 A;  1CS4 B;  2IMW P;  2M0G B;  4DV6 F;  3NS7 B;  4UUX A;  1SJF A;  2M70 A;  2VG5 B;  1JJC B;  2VQF F;  3N6M A;  1FJG J;  2LQJ A;  3H2U B;  4P9S A;  3NAI A;  4CT8 A;  4KE5 A;  4DR5 F;  1ZS6 A; 
#chains in the Genus database with same CATH homology
 3RJM B;  4DCP B;  1SC1 B;  2CDR B;  2H54 B;  1RWM B;  3R7S B;  3KJN B;  3GJQ B;  3D6H B;  3IBC B;  1I3O B;  1ICE B;  4ZVT B;  3P4U B;  2Y1L B;  1GFW B;  2C2K B;  2QL9 B;  2H48 B;  2C2Z B;  1RWW B;  2CJY B;  2H65 B;  1SC4 B;  2C2M B;  2H5J B;  2XYH B;  2QLB B;  2CNO B;  3IBF B;  2CJX B;  2HBY B;  2FQQ B;  2H4Y B;  2P2C B;  1RWK B;  2H51 B;  2C2O B;  2QLJ B;  1RHQ B;  2Y0B B;  4ZVR B;  3KJQ B;  2XZD B;  3GJS B;  3R6G B;  1RE1 B;  4ZVP B;  2XYP B;  1F9E B;  2CNK B;  3P45 B;  1I51 B;  4ZVU B;  4JB8 B;  2QLF B;  2XYG B;  5IC4 B;  4ZVO B;  3R6L B;  4ZVQ B;  4LSZ B;  3SIP B;  3GJR B;  3R5J B;  1QTN B;  3R7B B;  1BMQ B;  1RHK B;  3D6M B;  3D6F B;  2CNN B;  4DCO B;  1SC3 B;  2XZT B;  1PAU B;  2HBQ B;  2CNL B;  3EDR B;  2QL7 B;  4DCJ B;  1IBC B;  1RWP B;  1RWO B;  3QNW B;  2C1E B;  3KJF B;  3NS7 B;  2QL5 B;  3EDQ B;  3GJT B;  1RHM B;  5IC6 B;  3R7N B;  2HBZ B;  4ZVS B;  2H5I B;  1PYO B;  5K20 B;  1RHR B;  1RHU B;  1RHJ B;  1RWX B;  1NME B;  1RWN B;  2H4W B;  2HBR B;  1RWV B;  1QDU B;  2DKO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...