1RE1B

Crystal structure of caspase-3 with a nicotinic acid aldehyde inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
91
structure length
91
Chain Sequence
b'KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 16
structure length 91
sequence length 91
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1re1B00
2QLFB 2H5IB 1RE1B 1PYOB 2QLBB 3KJNB 3IBFB 2C2OB 2CJXB 3GJRB 3KJQB 4LSZB 3R5JB 2H48B 3P4UB 3SIPB 3R7SB 1RWPB 1I3OB 1BMQB 1RWXB 1RHMB 5IC6B 1RWVB 3P45B 2Y1LB 2DKOB 1QTNB 3EDRB 2XYGB 1RWKB 1RHKB 3R7BB 3NS7B 1IBCB 2FQQB 2CNNB 1F9EB 1RWOB 2CDRB 3GJSB 3D6FB 4ZVRB 2P2CB 1RHRB 1PAUB 3EDQB 2H4YB 3GJQB 4DCJB 4ZVQB 3QNWB 2HBZB 3D6HB 5IC4B 2QL5B 2XZTB 4DCPB 1SC3B 1RWMB 4DCOB 2C2KB 1RHJB 1I51B 2CJYB 2H65B 2H54B 3KJFB 1SC1B 1GFWB 2CNKB 3D6MB 3R6LB 1RWWB 3R7NB 1SC4B 1ICEB 3IBCB 2CNOB 2H51B 2QL9B 4ZVPB 2Y0BB 1RHQB 2QLJB 2HBYB 2XYPB 3R6GB 1RHUB 2QL7B 1RWNB 4ZVOB 2H4WB 3RJMB 2HBRB 2C1EB 2HBQB 5K20B 3GJTB 1QDUB 4ZVTB 2CNLB 4ZVUB 2C2ZB 2C2MB 2XZDB 1NMEB 2H5JB 2XYHB 4JB8B 4ZVSB
chains in the Genus database with same CATH superfamily
2ABYA 3L95X 1FDNA 3P49B 3GILA 1EP4B 2Q66A 1RDRA 4OL8A 2VFTA 5DDPC 3DCAA 4DUZJ 5I42B 3DU5A 1SBRA 4LF1A 1IXKA 3PW4A 2B43A 1H6KX 5M2UA 4OZ1A 2IVYA 2OKQA 3PYEA 1S77D 4PUOB 4UZCA 3EYZA 4ZVGA 2MY7A 3PZPA 1FKPA 1SJQA 5L1IA 3OW2R 5IM0B 2IJFA 1RT5A 4JV5J 3LP2A 3PV8A 1L3KA 1RSCA 1N48A 3TA1A 2P9CA 1JNRB 3OR2A 1VRQC 1Q0NA 3M8YA 2OPSB 1S1XB 2A6OA 2OPQB 4DF8A 2IHR1 4DSJA 4OHVA 4W92B 1M5OC 2B6AA 5BJRA 2DXFA 5KG1A 1G7CB 4NOHA 4QYRA 2F4VF 3CC7S 4ED1A 4P2MA 3N5BA 2WTFA 1KFDA 5IFMA 3C66A 2HHPA 1X9SA 1YX2A 3LWMA 2GGPB 2X3GA 2CPZA 1B0PA 3IWLA 4P7VA 3UCZP 4H54A 3FMWA 4EMDA 1U1RA 1S6OA 2OFGX 2ZZTA 2QSFA 3CO0P 2VKRA 3AODA 4JI1J 1VRTA 2FUG9 1GT8A 2XCPA 1N5SA 4I7FA 1AUSL 1SQGA 2D7SA 3NL0A 2F3JA 3G8QA 4C48A 2WB4A 2H5EA 3CSKA 3RB4A 1TK8A 5EN1A 1YRXA 2FC8A 3MR2A 2HIQA 3SV4A 3AOCA 3GG1A 4XIUA 3M8RA 3G9CA 3KDOA 3H8YA 4NEZA 3C8YA 3RUBL 1J5OB 1WC5A 6FD1A 1KQFB 3KLGA 4B9NA 3A3PB 2B8PA 1U25A 2UXBJ 3DGPB 1U02A 4RW7A 4ZLNA 1SKSA 2UVUA 3U27A 4QPTA 1U6ZA 1IKWB 3V4IA 1L3VA 5KT2A 3EXYA 1Y9OA 5E3QA 3DHXA 3G6YA 6FDRA 2RDIA 4JI4F 1CS4A 1R89A 3T1YF 1KC8T 2LXFA 1SVDA 3K7RA 1S97A 3SSQA 2FIUA 4ELUA 2RILA 4USIA 3J81U 2CJKA 4Y0FA 2HNYB 2ZBPA 3BKTA 4RW9A 5SUHA 3K8WA 2OTLS 3TX0A 2PIIA 2YPZA 2P6TA 1QVFR 2HZVA 2Q43A 4H4KA 2BANA 3WIVA 2ZJQQ 1MWQA 4JV1A 4K4WA 1TVRA 1KQKA 4DFKA 4O3PA 2D3O1 3GFZA 3JAMU 5KFTA 3W7BA 2APOA 4HH1A 1FT8A 1IR1A 4AL5A 4GKKF 4DR6J 1REVA 1RB0A 4NE9C 3KFWX 4DPWA 3SDEB 1AB8A 4FYXB 4LFCF 1F9HA 3QT7A 1JKHA 4K4UA 2LQJA 3PW7A 3MEEB 4NLOA 4Q8FA 1VR6A 3MEDB 3W2VB 4BLGA 1N32J 3Q8QB 5DDRC 4C8LA 3A8IA 2CQ2A 2W2MP 3UNGC 2MQNA 5I3UA 1WHVA 5LMNJ 4UOCA 2XULA 4P9SA 1YGYA 4JOUA 4KR0B 5KFNA 2KVIA 2B5JA 3CWJA 3FZBA 4KH0B 1VOMA 3N6MA 2ILYA 2XMAA 2MZJA 4HLBA 5BYRA 4DV6F 4LIRA 2H3EB 2GV1A 5FJ4A 1IM4A 3BN7A 3T1HF 5HN0A 3W61A 5M2PA 3VALA 1JLCA 4K5RA 2M52A 2MJNA 4XDDA 1KR4A 1CG2A 2V63A 5C2GA 4PXEA 2XMVA 1SKUB 3UDLA 3KLVA 1O6XA 3NY0A 3R27A 5GAGI 1S49A 1DTTB 2W2OP 4CI0B 3KLHB 2IC3B 2WRMA 3BO3A 1FKOA 3U02A 4G1PA 3W9HA 1IBLJ 2W9AA 1JLEB 1H2UX 2YH0A 1NRKA 4ZVEA 2CXEA 1B99A 4NLTA 3D0HE 3CUNA 4YY3F 3AD9C 5CH7B 2YKAA 2LXIA 3D4JA 5DM7Q 4R0EA 1JWWA 3MAAA 1Q95G 3PJ9A 3C6TB 4EUVA 4FF1A 4OYOA 4ZIVA 3TQ1A 4EO6A 5KFUA 1S59A 1U09A 5GADU 1H73A 1I1GA 1Y5IB 2CUYA 1F6TA 1F3FA 1WG1A 3CCJS 3W9JA 3HKZD 2O66A 1W2BR 3EDQB 2FZCB 1X9MA 2CPHA 2AEFA 1RHJB 4Y2CA 3AJ2A 3RR7A 3PACA 2CAJA 3EGVA 1AUDA 4FXVA 2DR5A 3R5BA 4IRKA 2VG6A 3IBWA 2EFNA 5KT4A 4FS1A 2E1RA 2LXUA 1VQLS 2FJXA 2RKIB 2AKWB 5J2QA 1C0UA 1IKVB 4WFZA 4NLPA 3ELHA 3MTKA 3UN2A 3PVXA 2AX0A 3IS9B 5LJ3Y 4DL2A 2B3TB 4ZCMA 2OPRA 1JMTA 3K5PA 1EHWA 2HVHA 3CCVS 4ZITA 2EKNA 3IG1A 4KV8A 2A18A 2KHDA 2VV5A 2BABA 2BR0A 4CLUA 1S1UA 4MYUA 2J5AA 2MMYA 3JSBA 4K5SA 1XC9A 2AYMA 1PC5A 3CCWA 5KT5A 2CZ9A 1X0PA 5T7LB 5MLCV 2IM1A 2VOPA 4IOAQ 2MQPA 3CNQP 4B3RJ 3BO2A 2MPUA 5CZXA 1A7GE 2FGCA 4LRAA 3A3NB 3V81A 3LGMA 3DLJA 3OQ2A 4DR2F 3UDVA 1FX2A 4PYAA 2H51B 4ZP8A 3NOGA 5AE1A 4J9NA 1CQMA 3UI3A 5ETTA 2O3DA 4QIGA 1VCTA 2OP5A 4NZ6A 3CCZA 3KLEA 3BSAA 2VBXA 2R8JA 3I0SA 5IS2A 3JYTB 4PQUB 4NASA 3RG6A 1CJVA 3Q8SB 2B8QA 2NXUA 4DV2J 1M5KC 4MIWA 1RI7A 3H2LA 3T3FA 1GXUA 1NO8A 4O3RA 3UD5A 5DDOC 4OQJA 4F4XA 2B0GA 4CIOA 2W4PA 3NGSA 5JJBA 2RF2A 3ILLA 3LALA 3PEHA 3H2UB 4F26A 2JVOA 4PPZA 1BXNA 5EX3A 4E8UA 1M1KT 3AQPA 4H4OA 4FXWA 4EK2A 2XI3A 5G0RB 2HURA 3K5NA 5JMNA 5F3TA 1SC3B 4BDPA 2UU9F 2WSEC 1PG5B 4KRWA 3D1HA 1W7WA 2RUSA 3J7YI 3T1AA 2ZC4A 3I9V9 3Q83A 4YFUA 2RQMA 5H9FK 3IRXA 4DV7F 5D0RA 4ZVOB 5B0EA 2DHSA 4Y6IA 2DHXA 2HQDA 4OX6A 1NB7A 4ZLPA 4IKAA 4NLXA 2FVPA 1YK9A 2MGZA 3LP1B 3KMSA 2PA3A 1PYOB 3IBFB 4UQTA 2NYHA 2CJXB 2J8AA 4WP8A 1LWFB 4F36A 1AW0A 2YNIB 1XEZA 4UF4A 1QAIA 1ZH5A 1AFJA 5SZTA 5HROB 4ZVHA 2CVEA 3IR7B 4FBTA 1TTHB 4Q5VA 4CLSA 4EYHB 2UUAF 1A6LA 2G2OA 2LMIA 1S99A 4DR5F 1M1GA 4JI8F 4DV5F 2R7VA 2FJVA 1V3RA 1YDLA 1RCOB 4L74A 3OVSA 4C8YA 3RGIA 2HRTA 2CG8A 2FVQA 1VK8A 4DMZA 3N4WA 2RQ4A 3CD7A 4PEOA 1QLNA 2W1BA 2VA2A 5GAHI 2VZ9A 4K4TA 3GSIA 1FHTA 3PRDA 2ROEA 4QW9A 1N5YA 3ZXWA 1NDCA 5B0CA 4X4RA 4LT6A 3M2VA 1JX4A 1FXDA 1JK9B 4CLLA 2ZHAA 2IMWP 1MNEA 2IJRA 4QCLA 4C8ZA 5A8RB 4F2SA 4LFAJ 2ZBRA 1NBEB 3JSYA 2DK2A 3I4PA 2GJ2A 1NU4A 1UJ5A 4RW4A 4M5MA 2DPIA 3D0GE 1HNVB 1T95A 2NUHA 2XMWA 4KPCA 3ZZUA 5DQGA 1SJ4P 3BDPA 2MQOA 2YKNB 1VFJA 4LBIA 1UA1A 4Q7AA 4L3NA 2HVEA 1MU2B 1FRHA 1WC0A 4Y2MA 4I2QA 3I6PA 3MM8A 3OJUA 2HWTA 3W9IA 3JSMB 3BJYA 4C3MA 3EGWB 2BOAA 3BDEA 3TA0A 4ELTA 1S0VA 3QRPA 1PKUA 1S79A 3BYPA 1UEVA 4Y65A 1FJGJ 4LF5J 2VL1A 4ZLLA 1NSKL 1RTIA 2V6AA 3M2UB 3I0RB 4O4GB 4M5JA 2JLFA 3B6BA 1O8BA 4I6AA 1KD1T 3J7A1 4A8OA 4LFBJ 1H3DA 3R97A 3VAHA 2QA2A 2DGTA 1I94J 1P1LA 1FRXA 4KO0A 3VGSA 3GJTB 4AQYJ 1ZOTA 1KS2A 2CPIA 1J5EF 1H98A 4JI0F 1T9UA 2XZWA 1X31C 2CJBA 4HHUA 1EQMA 4DSFA 4DG1B 2GHPA 1DLOA 4BCAA 4ZJLA 3D7SB 1AZSA 2QMXA 1X60A 1HW9A 2DR7A 1HWKA 4F25A 4FVMA 4FPIA 2Z57B 3UQSA 4YDDB 5F8HA 1NJYA 3NP5A 3WX8A 5DM6Q 2GCFA 3OL7A 2K1RA 4X4TA 1T05A 3QAEA 1Z2ZA 3OFHA 3CJ0A 2A1BA 3GE9A 2GVZB 2GC8A 5H9EJ 3MECB 2VONA 1SB6A 2H65B 3GONA 3O3LA 2V4QA 2DD8S 2GHVC 1FI4A 1SH2A 1FNOA 3GPAA 1Q4RA 4LRFA 1VLYA 4LF9J 2XWYA 2OD6A 3PJXA 1YJRA 1FVSA 3U7JA 4CO5A 4Q2MA 2ZE2B 4J9MA 4KGVB 1H2VZ 2XMUA 1SXLA 2AYEA 1TL7B 3H25A 8RUCA 1KOHA 4DL5A 4IG3A 1FVQA 1Q8BA 4TYAA 1VK3A 1GEHA 2KT5A 1K8AT 4B9TA 3CGIA 1ACMB 1OMSA 3F41A 4MIAA 2DYAA 2OHDA 4NMXA 3OSPA 3L9ZA 4L73A 1HNZJ 4B02A 1PC4A 3BBCA 2RUGA 3VZHA 1FE4A 5HATA 2BKPA 1C1BA 3I32A 2CNNB 4DU8A 1SPBP 1UFWA 2BE7D 2WOMA 4NWBA 2E7XA 1GK8A 3EE3A 4ZPBA 5HQLA 4ZN3A 1SCJB 1N34F 5D4NA 4LF8J 1S1WB 3MM7B 3FEXB 3VR1A 1YJVA 3BSNA 2Z4PA 2XLKA 3M2RB 3CJKB 1BC6A 3OHBA 2XB2D 2WONB 1GMWD 5CYQA 1SC4B 1YITS 3EVWA 5I42A 4FVCA 1YI2S 3DM2B 3KJVB 3LA0A 3PY8A 4DEZA 2N4DA 2E9RX 3P6YC 4YN3B 3NEKA 3PO5A 5HANA 4PUOA 2W9CB 2R2SA 4PXCA 4DFPA 5DQHA 4RNHA 3QT8A 3QJPA 2LQ9A 1HNXF 4A8FA 2P9GA 5GMDA 1L3UA 4Q2LA 2HMIA 1UP1A 2PSZA 2OPSA 2HFSA 1XTZA 2HQ3A 2OPQA 1HI8A 3ZZOA 2HW3A 1BHNA 1M1HA 2RHSB 4HVZA 2LVWA 3LGHA 5F8LA 1YSJA 1Q5YA 2M3DA 3D6HB 1MG7A 4QWDA 5EWGA 2GGPA 2BX6A 2F4VJ 2D9OA 1YJWS 3TZXA 1YIJS 2MQLA 3A4TA 1CJTB 2G1HA 1RABB 4IDKA 1VJQA 3M8SA 2FDNA 2J0QD 1LK5A 2LEAA 1SI9A 3OXGA 1JJ2R 1HYSB 3OL6A 4URGA 3BKFA 2DH8A 5D4LA 1C1CB 4F67A 2YKMB 1TP7A 4KFBB 5IT9Y 2COLA 4NYZA 3G82A 4ELVA 4CQ1A 4C3KA 4MKAA 3DRSB 4V1Ak 2VFRA 5C24B 4IQXA 2E44A 4J9LA 4OZLA 4DXLA 4HHJA 1VQ9S 3FQLA 3DRRA 4LIWA 2M0GB 5A76A 4O0NA 2RT3A 1BWEA 2BJEA 3B4MA 4M5DA 1HQEA 1DBDA 2QL5B 2QMUB 5LSRA 4ZHRB 2E5IA 2IVFB 1YBTA 1VC0A 1UJ4A 3MZIA 4JUZA 4A8SA 3OTDA 1RGVA 5KFYA 3TYTA 1N56A 2YBVA 3IXQA 2OMOA 2HHWA 1PGZA 2ZWPA 1PO6A 4TXSA 3IGVA 1RT7B 4JI4J 2DISA 2FY1A 2HBQB 3T1YJ 3HHLD 5LM7E 3I5BA 5C5JA 2HNYA 4WFBQ 4WKRA 4UZBA 5J2PA 1RA6A 2AF6A 3D3CJ 2NYIA 2V2VA 1D09B 1RU2A 1TV6A 3LGNA 5C42B 4HH0A 3HSGA 3DI6A 3GIKA 2GNKA 3BPDA 1Q7LB 2KG0A 4QR2A 3KG4A 3CC4S 4EWTA 2QV6A 5KOXA 1R6YA 1U0HA 5ETLA 3GQCA 4GKKJ 4ZVRB 3MUTP 4OZNA 3T6JA 4IQMA 3W66A 4DCJB 5LOQA 3MEEA 2MZRA 2ZBQA 4LFCJ 8AT1B 3MEDA 2XZTB 1NJXA 3QWUA 4XPCA 1T9XA 2IBOA 5AXNA 4CLKA 2MYFA 4B3MF 3VAJA 1RACB 3ILJA 4RLEA 4P2SA 2POKA 3QFWA 4B9LA 1HQUA 4ALZA 4E0DA 2V50A 4E98A 3AQOA 4EBEA 4O44A 2C2ZB 1WEZA 3N79A 3PKYA 2WVCA 3V6KA 5FIIA 3D54A 1TR0A 2ZM6F 1S0NA 3MM9A 1XWLA 3MR3A 4DV6J 2O5DA 3P4UB 4F8RA 3IRWP 3T1HJ 4A46A 1BMQB 1OY9A 2MLZA 3EDRB 1U2RA 1HNWF 1TKTB 4JI5F 2RJZA 1B0VA 3KLHA 3FBBA 4ED5A 3GJSB 4OYXA 3S01A 2GHWA 2B9XA 2AJQA 3EVOA 2ZJRQ 5DG7A 4QOTA 2LQ5A 5CYMB 2BE2B 1Y3JA 1ZM4A 2QA1A 5HJYA 2HVZA 1R8CA 4XAKA 4FPRA 4UOHA 2BRKA 4P73A 5HBMA 2I9SA 3TO8A 5F3ZA 3MOJB 2ALYB 1C0TB 4QIVA 4YY3J 5T41A 4Y2KA 3HCXA 1OQ6A 4C98A 1HBMB 3BO4A 2ACYA 3AB4B 4DL0C 2ZVSA 3UE2A 4P74A 2BEFA 2YKQA 3UVJA 1WSRA 2L08A 1R8BA 3WIUA 3KG0A 3DGVA 2HIYA 2GQQA 4NL5A 4OX8A 4WFYA 2UP1A 3TJAA 4KKOB 4ID8A 2NS1B 3D0IE 1WTBA 2LA6A 4QU6A 2RB7A 1IKVA 4W98A 4RNFA 2D9PA 2RDDA 1D3WA 4A8WA 1DQ8A 5KFJA 5BXIA 2L9DA 2HRYA 2DGWA 1U1QA 2GQCA 1VIXA 4LJMA 3SSSA 2ZZMA 4ZP6A 3PCOB 3HHKA 4OYZA 3HZGA 1V3SA 2IA0A 4CM2A 2Y0BB 1YHQS 1OWXA 1SIWB 2AT1B 1RWNB 4IFVB 2P8IA 3EXCX 3H4DA 1YZ6A 3W60A 3MMBA 2Z2YB 1DAXA 3TAMA 2G2YA 4ZVUB 1FO1A 1UETA 4OYBA 5F41A 1S1VB 1T9WA 2MKKA 2IDEA 3V6JA 4RPFA 4GVBB 1T3OA 4ECZA 1TAQA 4R5PB 4B3OB 2D69A 2BJ1A 4PG6A 1QAJA 4A8YA 1FRJA 4ZPDA 4QYZK 1V5IB 1X5TA 3IP0A 4W90B 5AJ3F 1U6BA 3DLGB 2HQGA 3BBFA 3FFIB 3W3SA 1LXJA 2FQQB 3UFCX 1QY7A 4A48A 2W7PA 1XQIA 4DR2J 1UJ6A 2NR0A 3RBEA 2ZHOA 4HYKA 4YR3A 4X66F 1MMLA 3FKBA 1DRZA 2X51A 1YWXA 4PQUA 4FNIA 5J2NB 3AT1B 3E01A 1UVNA 2CPYA 3SV3A 1YJTA 3VZIA 1RT6A 4DBQA 2LDIA 3UCUP 5KFWA 4O3OA 5HP1A 5KG4A 1M90T 3J7AN 1HNIA 4Q0BB 3MEKA 3U1LA 3ZZZA 2N82B 3QRRA 3ISND 2FD2A 2CQHA 2YWGA 2XS7A 4NRUA 4AE5A 2KZZA 1K73T 1PBAA 1WHWA 2PT0A 4ANEA 3IGNA 5GAHU 5HMYA 3DOKB 2E5LF 4LSLB 2DY1A 5T14A 1DZ5A 4LSZB 2IM0A 2L41A 4H4MB 1Q8LA 3LPEA 4HR2A 2IAJA 4HT7A 3RW6A 2UU9J 2GMHA 3EJMA 2EC2A 5KG5A 3NXZA 3JQJA 1YJUA 3RAMA 1KVIA 1RAFB 1T03A 5D3GA 4AYBD 3HSDA 3UWTA 4DV7J 3EICA 1UVJA 2DNZA 4ZPAA 3UDEA 3LP1A 2E5JA 4F3QA 2WSFC 2VQEF 2R7QA 1S9EB 2IJNA 2OIHA 2VPWB 1RLCL 1NEEA 2XO7A 3MFIA 1RTDB 4UT4A 1NNDA 3NS5A 5J1NA 2HBRB 2PDAA 2ZOGA 4CO4A 5K20B 3H7HB 1KLMA 3DMJB 3HPOA 4K4SA 2C2MB 2UUAJ 4Q8EA 3NCQA 3POTB 1S4FA 2B4VA 4JI8J 4DV5J 3OVBA 1MSWD 1J2VA 5HVHA 3X1LB 1X4CA 2DNPA 4NPOA 3SCLE 1ITPA 4DR7F 5A8KB 2J6SA 2BZ2A 2DXEA 4YHHF 3F44A 4M1KA 3MM6B 2GIRA 2H1YA 5C25B 2JJ4D 2G2ZA 3FRYA 3J7ZT 3MOZA 3V6DB 3K8VA 1FJ7A 3A12A 4YUDA 1EX8A 5A8RA 3IWXA 2MTLA 3QJLA 4NLVA 2DNYA 4OYWA 4K7QA 3NAHA 4DQPA 4N8OA 4DN9A 4R0JA 3CF5Q 3CXCR 4K4XA 2IRXA 3K59A 1ZYQA 3M6UA 2X1AA 2QIFA 1S4EA 1LW0B 1RBAA 1RAIB 1Y5LB 3WC0A 1C2PA 1MROB 5DQIA 3MMAB 1HMVA 3DRPA 4ZVFA 4WTOB 3EX7B 2QLFB 3JSMA 3Q8YA 1WC3A 3IR6B 3LOUA 3JTPA 4X4SA 4ZKAA 3OUYB 1S6UA 2B9YA 1S48A 2VQFF 1ZM9A 4YEAA 3I0RA 1N88A 4ZMMA 3N5FA 2DNQA 2Y1LB 4P52A 3PTWA 1WEXA 5LSLA 2YNHB 3NS7B 2RIJA 1G3OA 1S1TA 4N8NA 3PYFA 2PMWA 1LEOA 2AW0A 2JOQA 1Y0HA 4J7CA 3NBPA 4F0KA 4L72B 5E0OA 3HFVA 4ECTA 2YNGB 4PWWA 2F8HA 2XLIA 4DF4A 2AGPA 2JZ5A 3TA2A 4KHPF 1J5EJ 5J1PA 2CYYA 2K3KA 2VG7A 2EC0A 4JI0J 1ZTWA 4QR0A 3MM5A 4TKTA 4TLQA 4UOGA 4CO0A 2GA7A 4RW8A 3A3OB 3L7OA 1VGYA 3R5DA 2MKYA 2R7UA 4CRJA 2HFVA 2F8EX 1NDPA 3Q86A 3ONQA 5D15A 4CTAB 1KLNA 1Q81T 2C28A 4FN5A 2RS2A 4NLYA 4KGXB 4FKYA 2HYIB 1HD0A 5L46A 3IWNC 4KAIA 1V5VA 2ZE2A 3O2IA 2GJFA 2CQ1A 4M95A 3U1MA 2FYXA 4TNOA 2ZWOA 2EKYA 1FE0A 1FERA 1WOPA 3W5XA 1RLDA 1QAYA 2BE9B 3PR5B 3JQMA 4ANDA 1RT1B 4ZJQA 5CXTA 2GO9A 3EWGA 2U1AA 1U1NA 1K9MT 4GKJF 4TQSA 2VDIA 5D0EA 4U6PA 3ZZPA 2J9CA 3GCWP 3Q2TC 3OPKA 4X65F 2EK6A 3DOLB 2R7XA 5IT4A 1B64A 1LWEB 1TUWA 4KGMA 3CJ3A 3WC2A 2OEKA 3HSJA 2PE8A 2IYIA 4R8UA 1XK8A 1S1WA 2JSXA 2LKZA 3MM7A 2QN6B 5ETPA 3CJKA 1N34J 1ZPWX 2YWHA 5IC6B 3O1LA 2AJ2A 5I3PA 2FHMA 3AXKA 2V8PA 4WZQA 2V8DA 2C3OA 2DIVA 4WE1A 3DM2A 2YX7A 4LF7F 5KFCA 2YX1A 4RW6B 2L9WA 3NGUA 3HHEA 1JLGA 1FKAF 4TYBA 2CPJA 3D5MA 2W9CA 4C8OA 3ET6B 2M8HA 3A8JA 2F65A 2JC1A 1IWGA 2CQ0A 3CD0A 4X4UA 4F4WA 2WVDA 4KQZA 3W8PA 4JI2F 3DC2A 4TY9A 3VV2B 4EI2A 4CO2A 3CE8A 2VH7A 2LU2A 4IFYB 2KXNB 1Q53A 4OX9F 1HNXJ 4IG0B 2FLPA 1HWLA 4RUAA 2QZ8A 4XTTA 4WU2A 1ZZNA 1JXLA 3B54A 1GX6A 1BLUA 2ZZNA 4RR5A 2CJAA 4AUKA 1YBAA 1TK0A 4OJGA 5DGAA 1UEUA 3HKWA 5KFBA 1Y10A 2C2OB 4ES1A 3LPYA 5CHCB 5A0YB 1MN7A 1EETA 5EX0A 1U24A 3CD5A 3K89A 1NH8A 3C16B 3HJVA 4DQQA 5L9NA 1EAYC 1VHIA 3HI9A 4TQRA 2AP6A 2E1MC 2MKJA 7FDRA 1HYSA 1KTQA 3ZTSA 1VBKA 3GWCA 1AA1B 2YKMA 5CABA 3SQGB 2P9EA 4KFBA 3PKMA 3KLFB 1RTJA 2AU0A 1CQNA 1NCLA 4J9RA 3TR5A 2FVCA 3DRSA 1FXLA 4XO0A 4OV6A 4I4BA 2WZ1A 1NJZA 2KB2A 2B4UA 2VBYA 2R8KA 4GMKA 4KGKA 2NPFA 4ZVTB 4A8MP 4ETZA 1HW8A 2JFKA 3T5JA 1VRUA 1YRTA 2VBZA 3OXFA 2OUGA 2N7CA 3PJWA 3KJQB 4ZCLA 4QU7A 5K9FA 2A10A 4ECWA 1RAHB 4C9DA 3KHHA 5B08A 4RNMA 3M32A 4DPTA 1PYSB 1VQYA 3NGDA 1RT7A 2MQQA 4C3LA 1UMJA 3AH6A 4X4QA 2ZH1A 5KFOA 4DU7A 1FRLA 2HAFA 4ICLA 3KHRA 2JH3A 2VB6A 4ZPWR 1OY6A 4P72A 4PWDB 2IMOA 1SL2A 3T9ZA 1VDHA 1TFWA 4MYTA 3FNNA 2LDYA 3AJDA 4DR4F 1PBUA 1BGXT 1WG4A 1VQSA 1S9GA 1X5PA 5H9FJ 2E66A 5CA5A 1F1BB 4Z7CA 3KK2A 2VU5A 2C2NA 5G4DA 4RJVA 2ZH9A 2XS5A 4RUCA 3BSCA 2QLBB 2M7SA 1OY8A 1WDTA 4P10A 2KJVA 3G8SA 3FK4A 4P2XA 4YMEA 2R7RA 4RWXA 1ZAWA 1RHMB 3X3UA 4J9PA 4PABA 2N4CA 2F63A 1HWUA 2IRUA 1HPZB 1XJWB 2QEXS 1IWAA 2MKSA 3OFEA 1TL4A 2ZOFA 1QE1A 3CCES 5K8NA 4NEYA 1FEHA 2GZOA 2KT2A 3H59A 2ZITA 3ZNJ1 2B51A 3MPVA 1S6PB 2OPPA 5CCLA 5HK4A 1WC6A 3OJSA 2MSTA 3TJ9A 2ZM6J 2BKOA 3BREA 5J1EA 2O1PA 4DX6A 4DLGA 2J7UA 2VC1A 2C1EB 1TMJA 4ILRA 2OSQA 4DQSA 2RDJA 3DLKB 3E51A 3I56S 4Q43A 2XBPA 3WDOA 1HNWJ 4PPDA 4DS4A 2Z8QA 4KB7A 2RRAA 4JI5J 3GYNA 5IOLA 4I2PB 4CM0A 1IKYB 1W25A 2BE2A 1NKCA 3GJRB 1YVFA 3M30B 1WF0A 1CJUA 5F0WA 1JLBA 1YZ7A 5F8GA 4BWJA 2KKHA 1L3SA 1C0TA 1Q82T 3BSOA 1Q8IA 3SFGA 2K8GA 4DX8H 3D6FB 3C14B 4DV3F 3QO9B 4DDFA 2N3LA 4EFAC 2FPHX 5ETKA 3VVUA 5IT9U 2ZBCA 4J37A 4L76A 4OI0A 4DCPB 3PHTA 2QGFB 3G86A 3FSYA 3Q8RB 2KFNA 4G1IA 3KYLA 1HBOB 3QJJA 2UXCF 5LMUF 4FS2A 3R1HA 4MTPA 4Y3CA 1NPPA 5E41A 4C8KA 2QLJB 4JI6F 4KKOA 2YVSA 1XR6A 3VAGA 2WB1D 1ROFA 3NRBA 2B9EA 2C2EA 4LSNB 1S0MA 5JVGQ 1DTQA 3NOCA 2M8DB 1WI8A 4Y2AA 4ZVSB 3U1NA 4K4VA 4JBCA 4M5NA 3FMBA 4MKVA 2W25A 4KPYA 4OI3A 1VJWA 4WYWA 1NUEA 3MXHP 2E9ZA 1R7IA 3DYAA 1TMMA 3S1TA 2Y1RI 2BJDA 3NGRA 1X4FA 1UPPA 2BKNA 1RT4B 3UN5A 4MK8A 3JAMY 1WSVA 4IFVA 2JVRA 3JQKA 2W9BA 2YY3A 1S1VA 3I96A 1URNA 4Y28C 3P5BP 4R5PA 3KK1A 3Q23A 1LV5A 4LVOP 4DSLA 4UQGA 1H38A 3TANA 3R6LB 1Z4UA 4FYDA 2BDPA 4HKQA 1S12A 4PXBA 3R8YA 2RQKA 1KHWA 1Y5NB 4OHZA 2PFFB 2KN4A 2VA3A 3JB9k 1D0EA 5AJ3J 4ZP9A 2W8LA 4DL4A 1CC7A 2RMLA 4BHQA 5HJXA 2HK2A 3M7VA 2MY8A 1HA1A 4WBFA 4ZCIA 4X66J 2MKCA 2VJVA 1FCAA 3M6VA 3I5CA 5LXRA 3CCUS 2IVMA 3W64A 3OTBA 3OR2B 4HEA9 2DGOA 3THVA 1JLFA 3BEGB 3CDUA 3V5RA 2B6AB 1U2FA 1RT3A 4JI3F 3SYZA 4Y00A 3DOKA 3HZEA 1WG5A 4LSLA 3NMRA 1Y3KA 1EIYB 2HS3A 2YNFA 3MCSA 1VC5A 3R7NB 2M4MA 3HHDA 1RBOB 2Z2LA 1FD2A 3HFZB 2E5LJ 2GX8A 3LP0A 2R8GA 2CA9A 1TKXA 3W5ZA 2NZCA 2ZH7A 1FF2A 4NCGA 4WXOA 1A0OB 4ED7A 2PEBA 4RUHA 5GVQA 1N4LA 5D77A 1F5AA 2H5IB 1VRTB 1NHKL 3EGZA 2ERRA 4WWSA 1JIHA 2B4OA 2JC0A 2FJWA 2VG5A 2AYGA 1Z1ZA 4B3SF 3AA9A 1RTDA 2AV5A 1GAOA 1P9YA 4U8VA 2VQEJ 1T11A 1CPZA 3NAIA 4CO3A 4DOZA 2H4YB 1F0XA 3THPA 3PX6A 2XMMA 1IM6A 2EBGA 4LVNP 4CLPA 1PJ6A 1VQ7S 3GIJA 3OTEA 4B9SA 5THWA 1PIEA 4ID5A 5A8KA 2CWXA 3C6UA 4ZVPB 4I0WA 3O6QA 2WHOA 2XYPB 3Q0AA 1SUQA 2M70A 2Z2ZA 4DR7J 1CS4B 4YHHJ 1G6BA 1KVJA 1K44A 2BQUA 2WBRA 1VC6A 2F9DA 2NSCA 2FVSA 3C15A 3CD6S 1RE1B 3AJ1A 4IRDA 2Y8YA 1WKKA 1FWPA 5KT7A 2QTWA 3RRGA 2W24A 4K2XA 2DNKA 2SXLA 4RW9B 4EGLA 2QLXA 2BANB 1F5CA 3UN3A 4NXMF 4DPXA 2XI2A 3MDFA 3L7UA 5B0GA 3P96A 4XDCA 1D8ZA 3QLHA 2HLTA 4OIXA 1MROA 3MMAA 3BV8A 4L6V3 4AT1B 4M94A 5BYSA 5FDLA 3TW0A 4B9UA 1U26A 1IVZA 1GNKA 2UV8G 1JKHB 2CVIA 7FD1A 2YXLA 1U7LA 3W2WA 3PRBA 3B82A 2K7KA 1SC1B 3M8PB 5LJ5Y 1GFWB 1PJ5A 3CTRA 5H9EK 5KT3A 4HHHA 4K0KF 2VQFJ 3BQ2A 3LAKA 3KHGA 4F4KA 3CT9A 2YNHA 4MAKA 2FHJD 5L39A 3QSIA 3H4BA 4LBPA 3CCMS 2I8EA 4GVLA 2JX2A 9ATCB 1UVIA 2R2TA 2O01C 4K8RA 4LF6F 3BQ1A 2V8HA 1N36F 1HIYA 3BM7A 1JJHA 3K5MA 4FXDA 3CVKA 5E3PA 1FXRA 4GO5X 4TU7A 2R7SA 2NZ4A 2VPXB 5B7WA 2OFHX 1K0VA 1JLCB 3OT9A 3HP6A 2N3OA 3IN5A 4QPXA 4KHPJ 1L3TA 3R2CJ 2HGLA 3I55S 3NWGA 3TZYA 3VGTA 4MFBA 4DPYA 2QA4S 5A6PA 1HQ2A 2OD4A 5AXKA 4CNYA 3IC1A 3T9NA 2EFPA 2C3UA 3VTIA 2QMWA 2AJ0A 2ZFHA 4GRSA 3NNAA 3IA0A 2J6UA 2DGSA 1RT2B 3QRQA 1QSSA 5KFRA 4ZJOA 1CSJA 1OSDA 5HO4A 3MAAB 1HARA 2R7OA 2KL8A 2ZD1A 4DPUA 3M8WA 3BKUA 4WPAA 5E5NA 3Q8UA 2E5GA 1LFWA 4OJ3A 3HVTA 2J8SA 4YR0A 3CJ8A 1FTRA 3PYGA 4G3IA 4ECSA 3MUMP 4F50A 1V3ZA 2PI5A 1OYEA 1BE4A 4A8XA 3H5SA 3UD3P 4F02A 2HK3A 2YX4A 4U8YA 3OHAA 2F8MA 5LT5A 4GKJJ 3DOLA 1JLQB 3PHEA 4OZ3A 5KFGA 1LWEA 1TELA 1TQLA 4X2BA 3H5YA 2L48A 3G2XA 4Z7YA 4X65J 4L3KA 3R9LA 2DNOA 1RAGB 1XNRJ 4USMA 1NKBA 3SFUA 5BR8F 2VPYB 3PO4A 4RKUC 4P71A 1X7VA 2Y3YA 3DLBA 4OMFG 1JXEA 2VICA 2V9WA 3OVAA 5CAAA 3KTQA 3IG1B 3CMAS 2NXJA 3QIPA 2ZH5A 2GO8A 1S1UB 3Q8VA 2BOPA 2E9TA 1SJ3P 2V4RA 4LF7J 1FFSB 5DLGA 3H5UA 2H48B 1S5ZA 4NLWA 4FYVB 3LTOA 3N6NA 2NPIA 3KKFA 3DXBA 3MWBA 5DZ6A 2DTJA 2IPOB 4IG0A 4X4OA 1Q7YT 2XC9A 4JI2J 3FQKA 5L9XA 4LREA 4NI2A 1LKZA 1ZTTA 4OX9J 2UUTA 5K8MA 5IC4B 3E3XA 3RZAA 5J2MA 3KLEB 1SH0A 1UPMB 1MW7A 2ZNYA 1R3NA 3I0SB 3TOQA 5K8OA 2ASJA 4WFXA 3D1OA 4LR7A 1XMQF 5AE2A 4ES3A 2C3MA 3QT6A 2GIFA 2CJQA 3HD2A 4BC7A 3OLAA 3OV7A 2J0XA 1O51A 1DJ0A 1KDNA 2ZUAA 3MD3A 4O3SA 5KG3A 5GAEU 2RF2B 2I5JB 1FDDA 5JVHQ 1UKUA 1SKWA 3W1YC 3GZ7A 3KLFA 4FNHA 4DN0A 1HBNB 2FJAB 1PILA 3TEGA 2MZTA 5KTQA 2HQIA 2X7IA 1R0AA 4X4NA 1E6VB 4A47A 4G1QB 2HQCA 3GB0A 2CJ9A 4UTGA 3IRXB 2HZCA 2QT7A 3UNYA 3EZUA 2IIHA 2CWKA 4HTIA 3IM9A 1M0SA 5IXUA 1JJCB 2VHGA 4ECUA 2CQCA 3SBMA 3DOMB 2V68A 2DPJA 1LQ9A 1RWWB 4Y34A 1TL5A 2DNNA 3E2EA 2PC6A 4KGZB 4H4KC 2K7JA 3GU0A 3CJRA 3PIPQ 4DSEA 2D3OR 2NXCA 3QAUA 1FD8A 3HHLB 3NG8A 1CJKA 3MEGA 3BQ0A 4PXDA 4TY8A 2RU3A 2V2QA 4QQBA 4OYAA 4LBHA 3ENAA 2NLWA 3L09A 4E2FB 2LYVA 2CQGA 4J9UE 4DX7A 4CZCA 3KK3A 2DCLA 1N5YB 1NB2A 2VD3A 3ZZ0A 2DNRA 2VBWA 3M2VB 5D6GA 2LLZA 4DR4J 3VAKA 2MKHA 2QG9B 1IQZA 1PCAA 2JEIA 2CQPA 1G2EA 2DEIA 2IDLA 5HLFB 5A2QY 2DJWA 4U7UD 3R5CA 2M9KA 2DB1A 2CNOB 2ROGA 4IOBA 4ZPCA 1KKHA 3M9MB 2HWHA 1HI1A 2UUBF 4WK3A 1S72S 2IRYA 5DG9A 4C11A 1HPZA 2RHQB 4I69A 2YQ0A 3Q2SC 2KI2A 2Q79A 1OSCA 3MAQA 4J9OA 1ZS6A 2M2BA 4WFAQ 2HNZA 5ETNA 3TI0A 3LO3A 1RAJA 3CDAA 3BGRB 2KDOA 4CYUA 4I2QB 3EM1A 3MM8B 1B7FA 3S8SA 2CG4A 5KFVA 1HLWA 1VQ6S 1M5VC 2KO1A 4X84A 1S6PA 4I1TA 5FD1A 4U9RA 4TU9A 3P5TL 2JHEA 3ETMA 4OYPA 4RO0A 3DU6A 1RTIB 3FBEA 4JV2A 3WX4A 5K14A 2M5YA 3DDNA 1KRPA 4JI7F 1SJRA 5D4OA 1NSPA 1JLAB 1B3TA 1NHUA 1VBZA 2V2KA 3KLIB 3O5TB 4UOFA 1H72C 2XWXA 3L7PA 2KXFA 3KJFB 1RZMA 2V4JB 3RBZA 1RAAB 3M30A 5KFIA 3KNGA 1UWAA 4N56A 1S9FA 3CC2S 5ITHA 4XPEA 3D9BA 1DLOB 1WF1A 3SMZA 1F9FA 1OJ4A 1RCXB 3BGOP 3FSIA 3C14A 3VQTA 3HFKA 1WKJA 3T5LA 4CLTA 3NNHA 4DV3J 3HXMA 3KUGA 3I9ZA 1EQ0A 2ASLA 4P7TA 1HBOA 2K1RB 1T05B 1E6YB 3GCXP 2R8HA 2DHHA 3BR9A 1RHKB 5E7OB 1R0BG 2UUWA 2UXCJ 5LMUJ 1N5QA 3M6WA 3T41A 1YLXA 1KNZA 2EI5A 3GV8B 3UR3C 2E1AA 3CCLS 2P2CB 4EO8A 4JI6J 4MK7A 3IM8A 2MKIA 2UVVA 2LP4A 5EHHA 3R2DJ 1RWMB 5L1JA 3CPWR 3G96A 2ZUGA 3KDNA 1VIOA 2J0SD 2F5GA 3OR1A 4YOEA 1CULB 4IG3B 3O44A 3B4DA 4HDHA 3UCGA 4CT9A 3GLJA 1T0TV 3IO1A 2Z0GA 2R2RA 3L4BC 1RK8A 9RUBA 1R8PA 3ITHA 1LW2A 5D0GA 2EK1A 2M88A 5HVGA 3G87A 1LWCB 3HVAA 5ETMA 2MJUA 4PWUA 4U96A 3MUVP 1SV5A 1SL1A 5HMZA 1IBKF 4USWA 1D9DA 3AHPA 1UVMA 1I6JA 2WOMB 3H40A 4YP3A 2PD1A 5HVFA 1QJHA 5KFHA 4D3GA 2YQ1A 1R27B 2BACA 4FKXA 3BN4A 3DRYA 1TU0B 1S0OA 2ATCB 1UEKA 1EP4A 2MEWA 4J9SA 5CYQB 5DDQC 4C97A 4LR9A 2HKEA 1GMUA 2XSFA 1VQMS 4IH7A 2HFOA 1YKWA 2UUCF 4PYDA 4ED4A 2DY9A 1NK0A 4MK9A 4ZP7A 3M4XA 5IM0A 2OAUA 5KT6A 2HMIB 3J80U 4DUYF 3K2YA 1S1XA 2E7WA 2ADCA 2LFVA 4IO9Q 3R7SB 1Z2LA 2HSEB 1TFYA 3W5YA 2DVIA 2H9ZA 2RRNA 4JI3J 4NLQA 2ZH3A 3FVYA 4ENOA 4OI4A 3MMCB 2WCXA 4IDKB 5F8MA 3GJQB 1CBKA 3HHLC 2WBMA 4OZ5A 2VIHA 2V2ZA 3N28A 3MR7A 2UV8A 2ZOMA 1MWZA 1FRMA 1FRKA 5L1LA 4EYIB 2CPFA 2R8IA 3N6LA 1X4DA 3F56A 2DXDA 3NMAA 5U47A 3MURP 3G82B 5EUHA 1W26A 2KYXA 3I87A 1WC1A 4ZDNA 3MR6A 4B3SJ 4M5GA 1G4CA 2DITA 4WYLA 3DRRB 1J5OA 2RVJA 5DG8A 2QC3A 3DGPA 4OZ2A 2DGXA 4M5DB 1NDKA 1HQEB 3JXOA 1RXOB 2DO4A 2ZNZA 1IKWA 1UAWA 4O23A 1U45A 2JEJA 2Y8WA 3LWLA 2DGQA 3HD1A 2AHOB 2GAHC 4DZ6A 2E7VA 2HBZB 5CD4H 2OGUA 4AD6A 1WDDA 7AT1B 4ANCA 3OTOF 3OSNA 1P8GA 2V8VA 1JNZB 1CVJA 1KOOA 1B4SA 4EBDA 3CJ5A 1R31A 4B08A 5J2PB 2O67A 3QFHA 3IBCB 4HACB 1VI7A 1RHQB 2BW2A 2WVEA 2MZQA 2PO4A 4J5OA 3GTYX 1V9OA 1RBLA 1WHXA 2MZSA 3GV5B 5KFPA 1B7YB 1WC4A 3CMQA 1TV6B 4N77A 1HHQA 4J91A 3DI6B 4NXMJ 1U49A 2FB0A 2G13A 2ASYA 1GXTA 4UY85 2FJEB 3PX0A 1U0HB 3SDEA 1JXVA 3ILIA 5E33A 4C2MA 2AGQA 3M8PA 5B0AA 1HBUB 4B9VA 3HDSA 2HFUA 2NUUG 3P45B 4EZ9A 5D8HB 3W2VA 4DV1F 3D2WA 1UVLA 5CYJA 2A2DA 2RSQA 2CRLA 1C4AA 4OZJA 4X64F 3ICLA 5AXMA 3WZ0A 3GR0A 1HQUB 4K0KJ 1RQ0A 1VQ8S 3LUYA 3ZZTA 1IR0A 2V34A 3NLCA 4W4MA 4O44B 3Q8PB 1F60B 2OO4A 3PYDA 1KVKA 4IR9A 1RAEB 2V8GA 4LF6J 3MM9B 1N36J 1LNQA 2KHCA 2YWKA 3FRZA 4RZRA 2FGOA 2J9DA 2JLEA 3C19A 4NYPA 3QGGA 3MCMA 1NK7A 2Y9HA 2DBBA 3BGFA 4OHXA 2UVRA 4I64A 1NMEB 4O3NA 1T8EA 4YQWA 1YBUA 1WOSA 2WAQD 1XR7A 4HI2A 1S57A 3GG0A 1DTTA 2IC3A 3G4SS 1V6HA 3KWMA 4DSIA 4U67Q 3AAWB 3KNAA 4PG4A 4O4RA 1HL6A 2AJFE 1RWVB 3RB3A 2UZAA 1JLEA 2RH3A 2XHWA 1SQFA 1RT2A 1VMBA 3FCVA 4G6VB 3PIOQ 2VOOA 1WUUA 3QQCD 3NCRA 4LRBA 4FF4A 1IKXB 3MPYA 3SCIE 2CDRB 5HBMB 4NA2A 3C6TA 4K50A 1VQOS 4USVA 4MJKA 3PFOA 1GX5A 4DV4F 5DRKA 3CCSS 1SJ1A 4LF2A 5IQQA 1XMOF 2KH9A 2HHVA 4CDIA 5KFQA 1O5JA 1QUPA 3QSYB 1H7XA 2DR8A 3UDCA 3GMGA 3UVJB 4DR3F 4ECRA 3DFEA 1NK4A 2NCKL 3NGTA 1VQKS 4K2JA 1Q78A 1BQMB 2DNHA 3I5AA 4PAAA 2VKZG 2W2NP 2FZKB 3FZ2A 3HLUA 1JLQA 3JTNA 2Z2MA 5I4MA 4OHWA 4CLFA 1FEEA 4BWMA 4Y2IA 1PJ7A 1R0CB 2KT3A 2RKIA 3EGNA 3SIPB 1JJ4A 4TLRA 1D9FA 3EPGA 1OS5A 4YB5A 1S10A 2PA8D 1BD6A 3IS9A 3AB2B 3MPUB 1HKAA 3ISZA 1GMWA 3GYXB 4ILLA 4RU2A 3FGVA 5BR8J 2BA9A 4DFMA 3C3LA 1NDLA 2KXHA 3F73A 4LMZA 5EDWA 2XNRA 1YJ7A 4ECVA 1DY3A 3ISNC 1Y4ZB 1DQAA 3TNVA 3IMQJ 3HM9A 1RP5A 2KFYA 4DCOB 3SQOP 2HRUA 4R25A 3TWZA 2W7OA 3MMBB 3CJQA 4M5KA 5AXLA 3TAMB 3GR1A 4IO1A 5KFSA 3TUZC 4C0HA 1FNMA 2QYGA 2EFVA 5EWEA 2W7AA 5T7LA 2CIMA 2VPZB 3MHYA 1TKDA 2IM2A 2DRDA 2IBKA 4Q45A 1SIZA 1XBWA 1XERA 3FBFA 2HFNA 4F0MA 3D3BJ 2G0JA 1YRUA 1ZAVA 4I68A 3CCQS 1SKRA 1UVKA 2AZ3A 4QR1A 2W8KA 1TL1B 1WKLA 3TJ8A 4JYAF 4WF9Q 3QGIA 3PG9A 3R5GA 3JYTA 2F1FA 2RE1A 3SCKE 3K5OA 3E01B 4NX9A 2XGPA 1RT6B 4WCEQ 3AY0A 4EZ6A 1RTHB 5HP1B 2GJIA 3CEDA 1XMQJ 1HNIB 1SH3A 2VFVA 3H0PA 2W4DA 3EZ5A 2X1FA 1BQNB 2J76E 2I5JA 3CB4A 4DFJA 1U1OA 2LCWA 2E1CA 2BYCA 3TVZA 4ER8A 2FVRA 2ZHBA 5D0HA 1HBNA 2NQPA 5G0RA 4FF3A 1GXLA 2D3ZA 3TAPA 3QYYA 1E6VA 4DUTA 3D28A 3FUYA 2I6WA 3FCWA 2IAJB 2XY7A 3DHWC 4G1QA 5B0BA 4OYIA 1F3VA 3C46A 2A2CA 4ED6A 1REGX 1Y00A 1T03B 5D3GB 3M8ZA 4WFNQ 2HAIA 2D74B 5KFAA 2OMLA 2HHHF 3BB5A 5D78A 3DOMA 4KHMA 5KG6A 2MB0B 2KZMA 1TUGB 5CCMA 2D3UA 2BMBA 3H20A 4LQ9A 5HQ8A 3RB6A 3HO1A 2YH1A 3EVMA 1U8WA 3NCPA 1NK5A 1LWFA 1FESA 2YNIA 2NREA 4L75A 2XCAA 4WIIA 4CT8A 4DV0F 1N33F 2PI4A 5HROA 1T9TA 2I1RA 4S0MA 3HHLA 1ULRA 3RU0A 5GMEA 2FLNA 3VCDA 2CJYB 3AXMA 1KLMB 2H54B 4YS2A 1WOOA 4O0IA 4DHVA 4LF4F 2Q6BA 4ZA1A 1M5SA 3DN9A 4C7QA 4I6YA 1NSQA 3R6GB 3RYLA 3TVYA 1N6QB 3HMJG 4NLGA 4KBIA 3CIMA 3CDWA 4ILMA 3MGJA 5EGYA 3Q89A 3HK2A 1NZ8A 2H5JB 2KTQA 1U2CA 4WZMA 1TK5A 3O8WA 4FDFA 5FLXY 4KT0C 3R1LA 4B3TF 1M5PC 2FJBB 5M2RA 2HVIA 5HLFA 1RWXB 2XHCA 2ZVIA 5KOWA 2JWNA 3EMTA 3CDEA 4P2FA 3VAIA 5ETRA 1F9EB 1TAUA 2XNQA 1QUVA 1HNVA 2HHSA 2UUBJ 5KFDA 4IH6A 2WK4A 4ZIWA 2YKNA 2MQ8A 1P1TA 2MXYA 2CQ3A 1MU2A 3VF0B 3BGRA 4EBCA 3BBBA 1HMVB 2LEPA 3TQEA 3DRPB 2FTRA 3I31A 2AWZA 5HI7A 1IJFB 3RW7A 4UY8T 3OL9A 1IBMF 2G1DA 4GC6A 2XLJA 2AGOA 1LOUA 3M2UA 3RTVA 4K4ZA 1NJIT 4O4GA 1P27B 3ETOA 3HT3A 3BR8A 2MSSA 1KQGB 2IFXA 2CFXA 2ADBA 3KJNB 3K5LA 1JLAA 1NK9A 2UXDF 1S1TB 3AA8A 2J9DE 4CH7A 5ETSA 1T3NA 3KLIA 2V9KA 4JI7J 1OIAA 1N0VC 3T19A 3NBPB 2V4JA 2NXEA 2QX0A 3GFHA 2V0NA 1M5HA 2DKOB 1RWKB 3DLHA 1R43A 3NNCA 4O3QA 3PFEA 4DG1A 1N54B 2HEKA 2VG7B 1FNXH 4ED2A 4OLOA 1GH8A 3TARA 1UWBB 2XMJA 4F7VA 1T94A 4NA3A 1XMBA 3DRXA 3MM5B 1H0HB 1DARA 3G71S 5C7PA 2KFZA 4ZVQB 3P3DA 2DEJA 3P8BB 1IJEB 3AD8C 4UUXA 4RW8B 2W01A 1OYDA 3PW2A 3JSRA 3HJFA 2GVDB 2BVZA 3M6XA 4FBUA 1K1QA 2G4BA 1RKIA 2CQBA 2HNDB 4EU0A 4NRTA 1RJJA 2BJ3A 1JQGA 4DL6A 4QIFA 1U1LA 4PR6A 2J9EA 1X4GA 4KYZA 4Z2XA 2C3PA 1E6YA 3HULA 3VVTA 3TUIC 2LU1A 2R9LA 2ASDA 2OLWA 2GVZA 1KN6A 4OLPA 3MECA 3OTCA 2DNGA 1B0TA 4NYOA 1FDBA 2AJ1A 4CO1A 4ECXA 2C22A 4QWEA 4IRCA 3WQPA 3HX9A 3HSZA 3UPFA 3GSDA 1CLFA 1NXIA 1ZBTA 2E1PA 3VGVA 1WJ9A 1Q79A 5F8IA 2P5VA 1P6TA 1VQ5S 3I82A 5DETA 1TL7A 1I3OB 4F3OA 2R7WA 1CULA 1Q16B 3L3CA 2Q3PA 2GAGC 1X4HA 3N01A 1JB0C 2I38A 3MCOA 4DZDA 1NM2A 4J9KA 4RL1A 1GTEA 1MMDA 4QJVA 2VFUA 1QVGR 2XQCA 3QNWB 5K5MA 3IR5B 5C2CA 1LWCA 4KY3A 4CWBA 4D3HA 3ADAC 2EW9A 2C2KB 3S6EA 1WHYA 1HD1A 5CD4A 4DPOA 2C3YA 2VJUA 5KAKA 1XNRF 2F7VA 3D68A 4G65A 2HBYB 1RHUB 4ZPTR 2MDAA 4R8UB 3K57A 1IBKJ 8ATCB 3QZ8A 5IV3A 2GMJA 4P6QA 4GO7X 2KG1A 3IAS9 2FC9A 4Q44A 3M2RA 3V6HA 2WONA 5LL6d 4WE1B 1KFSA 3US5A 4LUBA 2AJ4A 4RNOA 3A8KA 3KJVA 1EZZB 2V67A 3OFGA 2K06A 2CZVC 5KG2A 5F8JA 5A2QU 1JLGB 3GIIA 3CCTA 1MN9A 3MTJA 4PG7A 4CCHA 3FEZA 2EEYA 1NK6A 2ZH2A 2YPYA 4NXNF 1DHMA 3R7BB 2QJ3A 3HF5A 1OPIA 1DQ9A 2WW4A 1AXQA 1RKJA 1X4AA 5F9LA 2UUCJ 2QFJA 2HHUA 1L5UA 4C8MA 2V5HG 3JS9A 1N8RT 4QIWD 1KONA 3FCHA 3GYGA 2XG8A 1TL3B 3QT5A 3TAQA 2DIUA 2F40A 2C2DA 2YKPA 2GFFA 2F4FA 1NLKL 4DUYJ 1W2IA 3ENWA 4RUBA 4NMLA 4N41A 4MH8A 2CKWA 4KC5A 3ZZRA 4CP5A 2MZ1A 1EETB 5DO2A 3MMCA 4I67A 4URQU 1FJEB 4AFFA 3FDSA 4NCBA 5JUMA 1CJTA 3KUHA 1F2GA 2DCUB 4DSKA 1N5TA 4ITSA 1LXNA 5JXSA 1C1CA 3D6TB 1ZPVA 1Q86T 1RTJB 2DNLA 3A1YG 3M05A 2HHTA 4FZVA 1FX4A 2FHKA 1DURA 4RBUA 1PAUB 3JTOA 5C24A 1R6VA 2DRBA 1K0TA 2JDJA 1FDAA 3MPWA 1MMNA 2HFZA 5L38A 1SL0A 1Q1KA 2XSJB 3SXLA 3S7RA 4V19X 3PDNA 1VRUB 2Y1JA 2ROPA 1X0FA 1WF2A 3J7Z5 2X1GA 4ZHRA 4RNNA 3G6XA 2Z58B 2CPDA 3K17A 5D4PA 3KXDA 3M32B 2KRRA 5EWFA 5F8NA 1H2TZ 3PM9A 4N5SA 3T5KA 4OI1A 3CW2C 1T9VA 3ZTOA 1RWPB 3NKYA 5GAEI 1T7PA 4ICLB 3CDBA 1U1PA 1U8SA 1YG0A 2WVBA 3PW0A 3OTOJ 2DHAA 4HACA 1HR0F 2YWWA 3KOAA 3V2UC 1VQ4S 2JFDA 2IA6A 3DXSX 4J9QA 3AOBA 1NK8A 2HQFA 3ZNUA 4QWBA 4CLZA 2HLUA 1P9QC 5KG7A 1TKZB 2JEGA 5C42A 3QMQA 4UUWA 2I0XA 5GAGU 2DR6A 1WD6A 1S9GB 1QD1A 5KFKA 3KK2B 2IM3A 1WTFA 2OEMA 1HBUA 1LK7A 3OL8A 3LAMA 3CULA 1NAQA 4USKA 5F0UA 1OO0B 4IH5A 1NSAA 1RAOA 4PQAA 2XY6A 1XNQF 2DNMA 2DGUA 4DV1J 2HS4A 3BGLA 4IR1A 3QWPA 2CPXA 1LWXA 1FK9B 5HSPA 1A9NB 1BQXA 1QE1B 1ZZFA 4X64J 1XR5A 1I5OB 3KG1A 2VC0A 4AXIA 2JNJA 5KFMA 2OPPB 1Q5VA 2JEFA 1FWKA 2BXJA 2R2UA 3VAMA 3AFGA 5J1EB 3M9NB 4DR1F 4KTQA 3QPIA 2ZDPA 1VQNS 3T6BA 3FJ2A 1TKTA 2QE5A 5HMWA 1XIQA 3TZZA 3M1VB 2R42A 2HS0A 4F04B 4ATNA 4NLDA 3ZO7A 3K0JA 1EKSA 1HI0P 2MHEA 4OYMA 5CYMA 4WKYA 4OHYA 4X62F 5L1KA 2CDQA 4UW2A 2CPEA 4ZOSA 1CJUB 1JLBB 1UW4A 2DGVA 3IFEA 3OD2A 1IKXA 2XYHB 4YDXA 4URSA 4NLUA 4OI2A 5DS7A 2FLLA 3V4MA 3GFXA 1EKRA 4I6WA 3SSRA 2QLWA 4J90A 2VF3A 2L9NA 2R7TA 4USUA 3ZTQA 1HBMA 1TZ0A 4JP8A 2BQ3A 3ZZYA 5B0DA 4ED3A 4OJ1A 5A8WB 1SC6A 4DV4J 1S6QB 1N52B 1WI6A 5GMKa 2D41A 1ELOA 3BS9A 1XMOJ 1VBXA 2A6MA 4BBYA 1RWOB 3D66A 1BQMA 4DR3J 3M8QB 4ZN1A 2ATLA 3RBDA 2EFGA 4ETXA 1DTQB 3BGUA 5CQGA 2B7BB 4WJBA 1APSA 2YKOA 1R8AA 3BZQA 3QGHA 5IWAF 4F0HA 3DLEB 3TX8A 3ENQA 2G9OA 5RUBA 4DQRA 5LXYA 3J81Y 2IYGA 5HL7Q 3MI7X 4DJBA 2U2FA 3DYAB 4LRDA 3C2PA 3Q22A 1RTZA 3EPIA 2OELA 4B9MA 4WTYA 2DO0A 3VAFA 4C4WA 1S7IA 2MHNA 4U95A 2HWIA 2E29A 2GW8A 2ZBIA 2NXNA 2W9BB 4FYWB 1OQ3A 4ZCKA 2XM3A 1RU1A 3RAXA 3PNIA 3Q24A 4GVBA 1VS3A 2VDHA 1EARA 3RRKA 2CADA 4LQ3A 3KK1B 4B3OA 3D1QA 2AMCB 4HI1A 3J7YU 4DUZF 2XMKA 2RU9A 2EG2A 5MAOA 2KM8B 3DLGA 3PRVA 1U6FA 1B70B 3FFIA 4C6AA 1TL1A 4NA1A 2ZDOA 5CZVA 4OX7A 4M5HA 4YB6A 5IT0A 5A6WA 4F4AA 4KHRA 4PG8A 4M63A 1U1MA 4JYAJ 5J2NA 4M5IA 4JV5F 1FKPB 2KRBA 2ILZA 2K3IA 2P6SA 4N47A 1RTHA 4ECQA 2F9JA 4LRCA 4XK8C 4AL6A 1RT5B 2RRBA 4PCQA 4Q0BA 3LP2B 2C2RA 3THTA 2DH7A 1BQNA 3QIDA 1JLFB 1AT1B 2B56A 1RYRA 3BYRA 2MQMA 1RT3B 1X8DA 1CC8A 4IYQA 1IBCB 1H7WA 2YNFB 1KTVA 2QO3A 1FFGB 4H4MA 3LP0B 3EUNA 1TKXB 3MR5A 3MCNA 3BF4A 4JI1F 4NCGB 4A8KA 4TN2A 4CLWA 1QM9A 2OEJA 1U4BA 1WELA 4IOCQ 1WORA 1FFWB 1AFIA 3PW5A 2VG5B 2XY5A 1AROP 2JRSA 4I7FB 2FHOB 2HHHJ 1QSLA 2ZJPQ 1GQEA 3HHNB 2XMTA 3FC9A 1S9EA 3FBCA 1HHSA 3SCJE 3DNCA 4U7UK 2QFIA 2MLXA 5KFLA 4WP9A 2LECA 4DV0J 4TU8A 4AL7A 1N33J 2UXBF 1FTCA 1N5VA 2AX1A 2QRRA 4DWIA 3DMJA 3GIMA 2BM0A 4DR5J 3POTA 3KLGB 3NGKA 4P75A 4MT1A 1PSDA 2HGNA 4RW7B 5KFFA 2LQ8A 1N6QA 4LF4J 3BH7B 1Y11A 4QW8A 4ID5B 3C6UB 3V4IB 3AOAA 1WACA 3WHIA 3DDKA 2ZH6A 5AT1B 2X1BA 3N0VA 1HFEL 1U48A 1NPRA 2OSRA 3MM6A 2BUNA 1SUQB 3ENVA 3LW5C 5C25A 2ZH4A 2ACMA 2EVZA 3V6DA 2CNKB 5HQMA 2VODA 3H90A 3C15B 1X9WA 4PRFA 2QL9B 1ZA2B 2EFOA 5DLFA 4FP9A 2FLOA 4B3TJ 1EJ7L 2OH2A 1UW9A 4FYYB 2CZ4A 3VWSA 2UVWA 1TVRB 3A13A 4DR6F 2DT9A 3I4HX 3D67A 2OTJS 2VFSA 4C8NA 1LW0A 3QLHB 2Z56B 5E3RA 5ETQA 2FZGB 3GP9A 1REVB 1ZM2A 2LEBA 2WVFA 5FDLB 3J81j 2ZKUA 2BJ7A 2FY8A 1NJWA 2QSWA 1N32F 3W2WB 1S76D 2WSCC 4OJHA 3OUYA 3ZTPA 4DLEA 5LMNF 1DFDA 2B7CB 5L8RC 1IBMJ 2BBEA 5I3UB 4TVAB 4KSEB 1RYSA 1O0PA 2B5JB 2G0IA 2EWHA 4ERDA 2ZC3A 1VHFA 1EB0A 2GMLA 1N0UA 1KQSR 2UXDJ 1U1KA 2KYZA 1HWIA 2YNGA 3CJTA 3A8EA 4F3MA 3PX4A 2J6TA 1HHTP 1UWBA 1FWLA 3PXGa 3HT0A 3ZFVA 3G6ES 1YJ9S 5DGBA 1KEKA 2GVDA 2J7KA 4MFBB 2HNDA 4YR2A 1BUXA 1IBLF 3KMQA 2R3VA 1UCNA 2GS8A 1VLOA 2L3MA 4DL7A 4MKYA 1FKOB 2Y0SD 1VISA 1VYAA 2DHGA 4CNZA 4CTAA 1XN9A 4OZ0A 3SEOA 1FRIA 2BRLA 4F2RA 4QIEA 4ECYA 1ZA1B 2FJDB 3W63A 3QZ7A 4RBVA 1D9AA 4ED0A 3H98A 2ZD1B 2OJ3A 4DI6A 1ICEB 2G0CA 1BY9A 3HVTB 1C4CA 2RD5C 2H4WB 2RQCA 3K58A 1UFKA 1WNEA 1RT1A 1QDUB 2J0WA 4YB7A 1AYEA 2XZDB 3H5XA 3CIZA 1NHVA 2V94A 1UZDA 1UTAA 2EXUA 2PMHA 2IY5B 5I3QA 2AEMA 4V19J 1RA7A 3RRHA 2HZAA 2KM8C 2ZEJA 2RNEA 2YTCA 4NLRA 4WXWA 2K2PA 2XS2A 2VG6B 2ZH8A 1RWUA 1VBYA 3H42A 4WK1A 5J2QB 3OLBA 1C0UB 3W62A 3MPDA 2Q6CA 3TRGA 3R3TA 3RB0A 1RHRB 2OPRB 2B9WA 1QSYA 5HMXA 3MFHA 4ZS6A 4QWAA 2XGQA 1VQPS 5FLXU 4KV8B 3QIPB 1NPKA 3B8HA 5ADZA 3OXLA 4RW6A 2WW8A 3SI8A 1G1XA 5GADI 3TUJC 2YQ3A 3ZTRA 1UL3A 2N7YA 2AZ1A 2KU7A 2QL7B 4USTA 3ET6A 4B3RF 4USHA 1Y7PA 3ULHA 3UO0A 2CNLB 1X5SA 3DLLQ 4JB8B 1HWJA 3HVRA 4NXNJ 4K4YA 1ZM3A 4QWCA 4IFYA 3V81B 1KP6A 4JV0A 2GIQA 4NI2B 1TL3A 2RS8A 1LFPA 1YQHA 4IUFA 2MLYA 3NWRA 2VUGA 2W2PP 1T02A 2EFQA 1IQTA 2E5HA 3DKDA 5J2MB 4C0BA 2XO6A 4DV2F 3R5AA 2V69A 2BJ8A 3QGPA 5A0YA 5KFZA 2DH9A 1CJVB 3C16A 3VGUA 1MLAA 3W8GA 2KVQE 1GTHA 4LR8A 2A3JA 4M8LA 3CJ4A 4NZ7A 5KFEA 1J27A 3MF5A 3NS6A 3D6MB 3FEYB 1X4BA 1KWMA 4EEYA 1H74A 2EPIA 3SQGA 3RJMB 5B09A 4OFZA 1IR2A 5ETOA 4H4OB 2ZKTA 2PN6A 3VHQA 1F5BA 3UD4P 2QA4G 2AIRB 5ETVA 1RADB 3MD1A 1R0AB 4NZ0A 4QYZJ 4ED8A 2BW7A 3CCRS 1K47A 4KH1B 3MAHA 4X4VA 3QBCA 2YWFA 3LANA 2XSJA 4MMOA 3BH6B 4CH0S 5B0FA 4ES2A 4AXJA 2AD9A 4F4ZA 4NCAA 2LA4A 5LSOA 1X4EA 2MGZB 1Q8KA 1S7HA 3QATA 4RU9A 5BYQA 1URRA 2HG4A 2HGMA 3RAQA 1FJCA 3VQSA 2XTJP 2DR9A 1QTMA 1TUVA 1ZETA 1CJKB 3MEGB 1U47A 4BS2A 2DRAA 1UFLA 3OFFA 4TY8B 2I2YA 4WIQA 3G6VA 1SJFA 4KE5A 4ZK7M 3M9OB 4PZVA 1RISA 4OI6A 4PWDA 4NLSA 1KBRA 4WP3A 4PG5A 2HHQA 3ZC4A 1HR0J 1TKZA 2GQ2A 3KK3B 4FF2A 2BM1A 1OPZA 5DZ7A 2XEXA 3SZ2A 4DX5A 2HVDA 3KHLA 4LFAF 4C0OC 2JL9A 4DL3A 3CJ2A 5IV4A 5DJBA 1T9YA 3GFYA 1D8YA 3PEJA 1KHVA 1F2HA 3TZWA 1UA0A 2FHJA 4M5LA 1NH7A 4RW4B 4C11B 3LH2S 1WEYA 2VASA 1I51B 5AE3A 3F0NA 1KSPA 4B3MJ 1FK9A 2PMZD 4Z37A 1XNQJ 2W4CA 3E8OA 1UZHA 3RR8A 2HNZB 5KG0A 3J80Y 5HAOA 3FSXA 4CYUB 4MKBA 1FJGF 4I56A 4LF5F 4YB1P 1FA0A 2C42A 2OI2A 4KIAA 3HVWA 1SQEA 3UR0A 1YTYA 4A4JA 3TVKA 3H2VE 3BPSP 4RX6A 3CJSA 4B17A 5K14B 4LFBF 3W65A 2Z30B 1I94F 3CMES 4HDGA 3R5JB 5KFXA 1R8HA 4QBUA 1NKEA 5IZHA 4DR1J 3M1VA 4AQYF 1IN0A 1PAEX 4CH1A 2PFDA 4OV1A 2W2QP 3DLKA 2XYGB 4QZVB 2PGCA 4N76A 4HL9A 4KO0B 4WU3A 5IQ6A 4I2PA 1IKYA 3B78A 3EZOA 5E2QA 1WWHA 3CO9A 3DDIA 3G8TA 3LF0A 3IAM9 2AEJA 3TEHB 2A0FB 4DQIA 4X62J 5E3AA 1AZSB 2YWEA 4CLYA 3ILOA 4RWWA 3PR4A 3QO9A 1NZAA 1QAXA 3MMJA 5A8WA 4USJC 3GV7B 2QYCA 2KJWA 1S6QA 2CQ4A 3AD7C 4DS5A 1GMVA 5E3CA 2EG1A 2Y1IA 4RBTA 1MWYA 2CQDA 1RUSA 4HTJA 4LF9F 2B4PA 2J7WA 1BWVA 2AQ4A 4KJIA 3M8QA 3WBZA 1IUJA 3RBXA 4LSNA 2ALZA 2HPUA 4MIBA 1QTNB 3DLEA 3KUEA 5K8PA 2EBEA 4BC9A 3OBIA 3TUPA 3OR1B 4K59A 2LQBA 5IWAJ 1HNZF 2HHXA 2X3DA 6AT1B 2NSBA 1ZAXA 5H1SV 1YJNS 1X5OA 2AYBA 3UW1A 1RT4A 2D1CA 1CEZA 3ITHB 1LW2B 4N7TA 4ZPVR 2BJ9A 4X4PA 4U7CA 4J9VA 3GIRA 4ZLJA 4HT5A 1SV5B 1U0SA 2CQIA 1C1BB 5F9NA 4GC7A 2R4FA 2BQRA 4LF8F 4F4YA 3TP2A 1D1UA 2JLGA 2RAQA 1K1SA 3LQVA 2BV3A 2PEHA 2Q1LA 4A8QA 3T5HA 3N9UC 1PYTA 4PKDB
chains in the Genus database with same CATH topology
2QLFB 2H5IB 1RE1B 1PYOB 2QLBB 3KJNB 3IBFB 2C2OB 2CJXB 3GJRB 3KJQB 4LSZB 3R5JB 2H48B 3P4UB 3SIPB 3R7SB 1RWPB 1I3OB 1BMQB 1RWXB 1RHMB 5IC6B 1RWVB 3P45B 2Y1LB 2DKOB 1QTNB 3EDRB 2XYGB 1RWKB 1RHKB 3R7BB 3NS7B 1IBCB 2FQQB 2CNNB 1F9EB 1RWOB 2CDRB 3GJSB 3D6FB 4ZVRB 2P2CB 1RHRB 1PAUB 3EDQB 2H4YB 3GJQB 4DCJB 4ZVQB 3QNWB 2HBZB 3D6HB 5IC4B 2QL5B 2XZTB 4DCPB 1SC3B 1RWMB 4DCOB 2C2KB 1RHJB 1I51B 2CJYB 2H65B 2H54B 3KJFB 1SC1B 1GFWB 2CNKB 3D6MB 3R6LB 1RWWB 3R7NB 1SC4B 1ICEB 3IBCB 2CNOB 2H51B 2QL9B 4ZVPB 2Y0BB 1RHQB 2QLJB 2HBYB 2XYPB 3R6GB 1RHUB 2QL7B 1RWNB 4ZVOB 2H4WB 3RJMB 2HBRB 2C1EB 2HBQB 5K20B 3GJTB 1QDUB 4ZVTB 2CNLB 4ZVUB 2C2ZB 2C2MB 2XZDB 1NMEB 2H5JB 2XYHB 4JB8B 4ZVSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLF B;  2H5I B;  1RE1 B;  1PYO B;  2QLB B;  3KJN B;  3IBF B;  2C2O B;  2CJX B;  3GJR B;  3KJQ B;  4LSZ B;  3R5J B;  2H48 B;  3P4U B;  3SIP B;  3R7S B;  1RWP B;  1I3O B;  1BMQ B;  1RWX B;  1RHM B;  5IC6 B;  1RWV B;  3P45 B;  2Y1L B;  2DKO B;  1QTN B;  3EDR B;  2XYG B;  1RWK B;  1RHK B;  3R7B B;  3NS7 B;  1IBC B;  2FQQ B;  2CNN B;  1F9E B;  1RWO B;  2CDR B;  3GJS B;  3D6F B;  4ZVR B;  2P2C B;  1RHR B;  1PAU B;  3EDQ B;  2H4Y B;  3GJQ B;  4DCJ B;  4ZVQ B;  3QNW B;  2HBZ B;  3D6H B;  5IC4 B;  2QL5 B;  2XZT B;  4DCP B;  1SC3 B;  1RWM B;  4DCO B;  2C2K B;  1RHJ B;  1I51 B;  2CJY B;  2H65 B;  2H54 B;  3KJF B;  1SC1 B;  1GFW B;  2CNK B;  3D6M B;  3R6L B;  1RWW B;  3R7N B;  1SC4 B;  1ICE B;  3IBC B;  2CNO B;  2H51 B;  2QL9 B;  4ZVP B;  2Y0B B;  1RHQ B;  2QLJ B;  2HBY B;  2XYP B;  3R6G B;  1RHU B;  2QL7 B;  1RWN B;  4ZVO B;  2H4W B;  3RJM B;  2HBR B;  2C1E B;  2HBQ B;  5K20 B;  3GJT B;  1QDU B;  4ZVT B;  2CNL B;  4ZVU B;  2C2Z B;  2C2M B;  2XZD B;  1NME B;  2H5J B;  2XYH B;  4JB8 B;  4ZVS B; 
#chains in the Genus database with same CATH topology
 2ABY A;  3L95 X;  1FDN A;  3P49 B;  3GIL A;  1EP4 B;  2Q66 A;  1RDR A;  4OL8 A;  2VFT A;  5DDP C;  3DCA A;  4DUZ J;  5I42 B;  3DU5 A;  1SBR A;  4LF1 A;  1IXK A;  3PW4 A;  2B43 A;  1H6K X;  5M2U A;  4OZ1 A;  2IVY A;  2OKQ A;  3PYE A;  1S77 D;  4PUO B;  4UZC A;  3EYZ A;  4ZVG A;  2MY7 A;  3PZP A;  1FKP A;  1SJQ A;  5L1I A;  3OW2 R;  5IM0 B;  2IJF A;  1RT5 A;  4JV5 J;  3LP2 A;  3PV8 A;  1L3K A;  1RSC A;  1N48 A;  3TA1 A;  2P9C A;  1JNR B;  3OR2 A;  1VRQ C;  1Q0N A;  3M8Y A;  2OPS B;  1S1X B;  2A6O A;  2OPQ B;  4DF8 A;  2IHR 1;  4DSJ A;  4OHV A;  4W92 B;  1M5O C;  2B6A A;  5BJR A;  2DXF A;  5KG1 A;  1G7C B;  4NOH A;  4QYR A;  2F4V F;  3CC7 S;  4ED1 A;  4P2M A;  3N5B A;  2WTF A;  1KFD A;  5IFM A;  3C66 A;  2HHP A;  1X9S A;  1YX2 A;  3LWM A;  2GGP B;  2X3G A;  2CPZ A;  1B0P A;  3IWL A;  4P7V A;  3UCZ P;  4H54 A;  3FMW A;  4EMD A;  1U1R A;  1S6O A;  2OFG X;  2ZZT A;  2QSF A;  3CO0 P;  2VKR A;  3AOD A;  4JI1 J;  1VRT A;  2FUG 9;  1GT8 A;  2XCP A;  1N5S A;  4I7F A;  1AUS L;  1SQG A;  2D7S A;  3NL0 A;  2F3J A;  3G8Q A;  4C48 A;  2WB4 A;  2H5E A;  3CSK A;  3RB4 A;  1TK8 A;  5EN1 A;  1YRX A;  2FC8 A;  3MR2 A;  2HIQ A;  3SV4 A;  3AOC A;  3GG1 A;  4XIU A;  3M8R A;  3G9C A;  3KDO A;  3H8Y A;  4NEZ A;  3C8Y A;  3RUB L;  1J5O B;  1WC5 A;  6FD1 A;  1KQF B;  3KLG A;  4B9N A;  3A3P B;  2B8P A;  1U25 A;  2UXB J;  3DGP B;  1U02 A;  4RW7 A;  4ZLN A;  1SKS A;  2UVU A;  3U27 A;  4QPT A;  1U6Z A;  1IKW B;  3V4I A;  1L3V A;  5KT2 A;  3EXY A;  1Y9O A;  5E3Q A;  3DHX A;  3G6Y A;  6FDR A;  2RDI A;  4JI4 F;  1CS4 A;  1R89 A;  3T1Y F;  1KC8 T;  2LXF A;  1SVD A;  3K7R A;  1S97 A;  3SSQ A;  2FIU A;  4ELU A;  2RIL A;  4USI A;  3J81 U;  2CJK A;  4Y0F A;  2HNY B;  2ZBP A;  3BKT A;  4RW9 A;  5SUH A;  3K8W A;  2OTL S;  3TX0 A;  2PII A;  2YPZ A;  2P6T A;  1QVF R;  2HZV A;  2Q43 A;  4H4K A;  2BAN A;  3WIV A;  2ZJQ Q;  1MWQ A;  4JV1 A;  4K4W A;  1TVR A;  1KQK A;  4DFK A;  4O3P A;  2D3O 1;  3GFZ A;  3JAM U;  5KFT A;  3W7B A;  2APO A;  4HH1 A;  1FT8 A;  1IR1 A;  4AL5 A;  4GKK F;  4DR6 J;  1REV A;  1RB0 A;  4NE9 C;  3KFW X;  4DPW A;  3SDE B;  1AB8 A;  4FYX B;  4LFC F;  1F9H A;  3QT7 A;  1JKH A;  4K4U A;  2LQJ A;  3PW7 A;  3MEE B;  4NLO A;  4Q8F A;  1VR6 A;  3MED B;  3W2V B;  4BLG A;  1N32 J;  3Q8Q B;  5DDR C;  4C8L A;  3A8I A;  2CQ2 A;  2W2M P;  3UNG C;  2MQN A;  5I3U A;  1WHV A;  5LMN J;  4UOC A;  2XUL A;  4P9S A;  1YGY A;  4JOU A;  4KR0 B;  5KFN A;  2KVI A;  2B5J A;  3CWJ A;  3FZB A;  4KH0 B;  1VOM A;  3N6M A;  2ILY A;  2XMA A;  2MZJ A;  4HLB A;  5BYR A;  4DV6 F;  4LIR A;  2H3E B;  2GV1 A;  5FJ4 A;  1IM4 A;  3BN7 A;  3T1H F;  5HN0 A;  3W61 A;  5M2P A;  3VAL A;  1JLC A;  4K5R A;  2M52 A;  2MJN A;  4XDD A;  1KR4 A;  1CG2 A;  2V63 A;  5C2G A;  4PXE A;  2XMV A;  1SKU B;  3UDL A;  3KLV A;  1O6X A;  3NY0 A;  3R27 A;  5GAG I;  1S49 A;  1DTT B;  2W2O P;  4CI0 B;  3KLH B;  2IC3 B;  2WRM A;  3BO3 A;  1FKO A;  3U02 A;  4G1P A;  3W9H A;  1IBL J;  2W9A A;  1JLE B;  1H2U X;  2YH0 A;  1NRK A;  4ZVE A;  2CXE A;  1B99 A;  4NLT A;  3D0H E;  3CUN A;  4YY3 F;  3AD9 C;  5CH7 B;  2YKA A;  2LXI A;  3D4J A;  5DM7 Q;  4R0E A;  1JWW A;  3MAA A;  1Q95 G;  3PJ9 A;  3C6T B;  4EUV A;  4FF1 A;  4OYO A;  4ZIV A;  3TQ1 A;  4EO6 A;  5KFU A;  1S59 A;  1U09 A;  5GAD U;  1H73 A;  1I1G A;  1Y5I B;  2CUY A;  1F6T A;  1F3F A;  1WG1 A;  3CCJ S;  3W9J A;  3HKZ D;  2O66 A;  1W2B R;  3EDQ B;  2FZC B;  1X9M A;  2CPH A;  2AEF A;  1RHJ B;  4Y2C A;  3AJ2 A;  3RR7 A;  3PAC A;  2CAJ A;  3EGV A;  1AUD A;  4FXV A;  2DR5 A;  3R5B A;  4IRK A;  2VG6 A;  3IBW A;  2EFN A;  5KT4 A;  4FS1 A;  2E1R A;  2LXU A;  1VQL S;  2FJX A;  2RKI B;  2AKW B;  5J2Q A;  1C0U A;  1IKV B;  4WFZ A;  4NLP A;  3ELH A;  3MTK A;  3UN2 A;  3PVX A;  2AX0 A;  3IS9 B;  5LJ3 Y;  4DL2 A;  2B3T B;  4ZCM A;  2OPR A;  1JMT A;  3K5P A;  1EHW A;  2HVH A;  3CCV S;  4ZIT A;  2EKN A;  3IG1 A;  4KV8 A;  2A18 A;  2KHD A;  2VV5 A;  2BAB A;  2BR0 A;  4CLU A;  1S1U A;  4MYU A;  2J5A A;  2MMY A;  3JSB A;  4K5S A;  1XC9 A;  2AYM A;  1PC5 A;  3CCW A;  5KT5 A;  2CZ9 A;  1X0P A;  5T7L B;  5MLC V;  2IM1 A;  2VOP A;  4IOA Q;  2MQP A;  3CNQ P;  4B3R J;  3BO2 A;  2MPU A;  5CZX A;  1A7G E;  2FGC A;  4LRA A;  3A3N B;  3V81 A;  3LGM A;  3DLJ A;  3OQ2 A;  4DR2 F;  3UDV A;  1FX2 A;  4PYA A;  2H51 B;  4ZP8 A;  3NOG A;  5AE1 A;  4J9N A;  1CQM A;  3UI3 A;  5ETT A;  2O3D A;  4QIG A;  1VCT A;  2OP5 A;  4NZ6 A;  3CCZ A;  3KLE A;  3BSA A;  2VBX A;  2R8J A;  3I0S A;  5IS2 A;  3JYT B;  4PQU B;  4NAS A;  3RG6 A;  1CJV A;  3Q8S B;  2B8Q A;  2NXU A;  4DV2 J;  1M5K C;  4MIW A;  1RI7 A;  3H2L A;  3T3F A;  1GXU A;  1NO8 A;  4O3R A;  3UD5 A;  5DDO C;  4OQJ A;  4F4X A;  2B0G A;  4CIO A;  2W4P A;  3NGS A;  5JJB A;  2RF2 A;  3ILL A;  3LAL A;  3PEH A;  3H2U B;  4F26 A;  2JVO A;  4PPZ A;  1BXN A;  5EX3 A;  4E8U A;  1M1K T;  3AQP A;  4H4O A;  4FXW A;  4EK2 A;  2XI3 A;  5G0R B;  2HUR A;  3K5N A;  5JMN A;  5F3T A;  1SC3 B;  4BDP A;  2UU9 F;  2WSE C;  1PG5 B;  4KRW A;  3D1H A;  1W7W A;  2RUS A;  3J7Y I;  3T1A A;  2ZC4 A;  3I9V 9;  3Q83 A;  4YFU A;  2RQM A;  5H9F K;  3IRX A;  4DV7 F;  5D0R A;  4ZVO B;  5B0E A;  2DHS A;  4Y6I A;  2DHX A;  2HQD A;  4OX6 A;  1NB7 A;  4ZLP A;  4IKA A;  4NLX A;  2FVP A;  1YK9 A;  2MGZ A;  3LP1 B;  3KMS A;  2PA3 A;  1PYO B;  3IBF B;  4UQT A;  2NYH A;  2CJX B;  2J8A A;  4WP8 A;  1LWF B;  4F36 A;  1AW0 A;  2YNI B;  1XEZ A;  4UF4 A;  1QAI A;  1ZH5 A;  1AFJ A;  5SZT A;  5HRO B;  4ZVH A;  2CVE A;  3IR7 B;  4FBT A;  1TTH B;  4Q5V A;  4CLS A;  4EYH B;  2UUA F;  1A6L A;  2G2O A;  2LMI A;  1S99 A;  4DR5 F;  1M1G A;  4JI8 F;  4DV5 F;  2R7V A;  2FJV A;  1V3R A;  1YDL A;  1RCO B;  4L74 A;  3OVS A;  4C8Y A;  3RGI A;  2HRT A;  2CG8 A;  2FVQ A;  1VK8 A;  4DMZ A;  3N4W A;  2RQ4 A;  3CD7 A;  4PEO A;  1QLN A;  2W1B A;  2VA2 A;  5GAH I;  2VZ9 A;  4K4T A;  3GSI A;  1FHT A;  3PRD A;  2ROE A;  4QW9 A;  1N5Y A;  3ZXW A;  1NDC A;  5B0C A;  4X4R A;  4LT6 A;  3M2V A;  1JX4 A;  1FXD A;  1JK9 B;  4CLL A;  2ZHA A;  2IMW P;  1MNE A;  2IJR A;  4QCL A;  4C8Z A;  5A8R B;  4F2S A;  4LFA J;  2ZBR A;  1NBE B;  3JSY A;  2DK2 A;  3I4P A;  2GJ2 A;  1NU4 A;  1UJ5 A;  4RW4 A;  4M5M A;  2DPI A;  3D0G E;  1HNV B;  1T95 A;  2NUH A;  2XMW A;  4KPC A;  3ZZU A;  5DQG A;  1SJ4 P;  3BDP A;  2MQO A;  2YKN B;  1VFJ A;  4LBI A;  1UA1 A;  4Q7A A;  4L3N A;  2HVE A;  1MU2 B;  1FRH A;  1WC0 A;  4Y2M A;  4I2Q A;  3I6P A;  3MM8 A;  3OJU A;  2HWT A;  3W9I A;  3JSM B;  3BJY A;  4C3M A;  3EGW B;  2BOA A;  3BDE A;  3TA0 A;  4ELT A;  1S0V A;  3QRP A;  1PKU A;  1S79 A;  3BYP A;  1UEV A;  4Y65 A;  1FJG J;  4LF5 J;  2VL1 A;  4ZLL A;  1NSK L;  1RTI A;  2V6A A;  3M2U B;  3I0R B;  4O4G B;  4M5J A;  2JLF A;  3B6B A;  1O8B A;  4I6A A;  1KD1 T;  3J7A 1;  4A8O A;  4LFB J;  1H3D A;  3R97 A;  3VAH A;  2QA2 A;  2DGT A;  1I94 J;  1P1L A;  1FRX A;  4KO0 A;  3VGS A;  3GJT B;  4AQY J;  1ZOT A;  1KS2 A;  2CPI A;  1J5E F;  1H98 A;  4JI0 F;  1T9U A;  2XZW A;  1X31 C;  2CJB A;  4HHU A;  1EQM A;  4DSF A;  4DG1 B;  2GHP A;  1DLO A;  4BCA A;  4ZJL A;  3D7S B;  1AZS A;  2QMX A;  1X60 A;  1HW9 A;  2DR7 A;  1HWK A;  4F25 A;  4FVM A;  4FPI A;  2Z57 B;  3UQS A;  4YDD B;  5F8H A;  1NJY A;  3NP5 A;  3WX8 A;  5DM6 Q;  2GCF A;  3OL7 A;  2K1R A;  4X4T A;  1T05 A;  3QAE A;  1Z2Z A;  3OFH A;  3CJ0 A;  2A1B A;  3GE9 A;  2GVZ B;  2GC8 A;  5H9E J;  3MEC B;  2VON A;  1SB6 A;  2H65 B;  3GON A;  3O3L A;  2V4Q A;  2DD8 S;  2GHV C;  1FI4 A;  1SH2 A;  1FNO A;  3GPA A;  1Q4R A;  4LRF A;  1VLY A;  4LF9 J;  2XWY A;  2OD6 A;  3PJX A;  1YJR A;  1FVS A;  3U7J A;  4CO5 A;  4Q2M A;  2ZE2 B;  4J9M A;  4KGV B;  1H2V Z;  2XMU A;  1SXL A;  2AYE A;  1TL7 B;  3H25 A;  8RUC A;  1KOH A;  4DL5 A;  4IG3 A;  1FVQ A;  1Q8B A;  4TYA A;  1VK3 A;  1GEH A;  2KT5 A;  1K8A T;  4B9T A;  3CGI A;  1ACM B;  1OMS A;  3F41 A;  4MIA A;  2DYA A;  2OHD A;  4NMX A;  3OSP A;  3L9Z A;  4L73 A;  1HNZ J;  4B02 A;  1PC4 A;  3BBC A;  2RUG A;  3VZH A;  1FE4 A;  5HAT A;  2BKP A;  1C1B A;  3I32 A;  2CNN B;  4DU8 A;  1SPB P;  1UFW A;  2BE7 D;  2WOM A;  4NWB A;  2E7X A;  1GK8 A;  3EE3 A;  4ZPB A;  5HQL A;  4ZN3 A;  1SCJ B;  1N34 F;  5D4N A;  4LF8 J;  1S1W B;  3MM7 B;  3FEX B;  3VR1 A;  1YJV A;  3BSN A;  2Z4P A;  2XLK A;  3M2R B;  3CJK B;  1BC6 A;  3OHB A;  2XB2 D;  2WON B;  1GMW D;  5CYQ A;  1SC4 B;  1YIT S;  3EVW A;  5I42 A;  4FVC A;  1YI2 S;  3DM2 B;  3KJV B;  3LA0 A;  3PY8 A;  4DEZ A;  2N4D A;  2E9R X;  3P6Y C;  4YN3 B;  3NEK A;  3PO5 A;  5HAN A;  4PUO A;  2W9C B;  2R2S A;  4PXC A;  4DFP A;  5DQH A;  4RNH A;  3QT8 A;  3QJP A;  2LQ9 A;  1HNX F;  4A8F A;  2P9G A;  5GMD A;  1L3U A;  4Q2L A;  2HMI A;  1UP1 A;  2PSZ A;  2OPS A;  2HFS A;  1XTZ A;  2HQ3 A;  2OPQ A;  1HI8 A;  3ZZO A;  2HW3 A;  1BHN A;  1M1H A;  2RHS B;  4HVZ A;  2LVW A;  3LGH A;  5F8L A;  1YSJ A;  1Q5Y A;  2M3D A;  3D6H B;  1MG7 A;  4QWD A;  5EWG A;  2GGP A;  2BX6 A;  2F4V J;  2D9O A;  1YJW S;  3TZX A;  1YIJ S;  2MQL A;  3A4T A;  1CJT B;  2G1H A;  1RAB B;  4IDK A;  1VJQ A;  3M8S A;  2FDN A;  2J0Q D;  1LK5 A;  2LEA A;  1SI9 A;  3OXG A;  1JJ2 R;  1HYS B;  3OL6 A;  4URG A;  3BKF A;  2DH8 A;  5D4L A;  1C1C B;  4F67 A;  2YKM B;  1TP7 A;  4KFB B;  5IT9 Y;  2COL A;  4NYZ A;  3G82 A;  4ELV A;  4CQ1 A;  4C3K A;  4MKA A;  3DRS B;  4V1A k;  2VFR A;  5C24 B;  4IQX A;  2E44 A;  4J9L A;  4OZL A;  4DXL A;  4HHJ A;  1VQ9 S;  3FQL A;  3DRR A;  4LIW A;  2M0G B;  5A76 A;  4O0N A;  2RT3 A;  1BWE A;  2BJE A;  3B4M A;  4M5D A;  1HQE A;  1DBD A;  2QL5 B;  2QMU B;  5LSR A;  4ZHR B;  2E5I A;  2IVF B;  1YBT A;  1VC0 A;  1UJ4 A;  3MZI A;  4JUZ A;  4A8S A;  3OTD A;  1RGV A;  5KFY A;  3TYT A;  1N56 A;  2YBV A;  3IXQ A;  2OMO A;  2HHW A;  1PGZ A;  2ZWP A;  1PO6 A;  4TXS A;  3IGV A;  1RT7 B;  4JI4 J;  2DIS A;  2FY1 A;  2HBQ B;  3T1Y J;  3HHL D;  5LM7 E;  3I5B A;  5C5J A;  2HNY A;  4WFB Q;  4WKR A;  4UZB A;  5J2P A;  1RA6 A;  2AF6 A;  3D3C J;  2NYI A;  2V2V A;  1D09 B;  1RU2 A;  1TV6 A;  3LGN A;  5C42 B;  4HH0 A;  3HSG A;  3DI6 A;  3GIK A;  2GNK A;  3BPD A;  1Q7L B;  2KG0 A;  4QR2 A;  3KG4 A;  3CC4 S;  4EWT A;  2QV6 A;  5KOX A;  1R6Y A;  1U0H A;  5ETL A;  3GQC A;  4GKK J;  4ZVR B;  3MUT P;  4OZN A;  3T6J A;  4IQM A;  3W66 A;  4DCJ B;  5LOQ A;  3MEE A;  2MZR A;  2ZBQ A;  4LFC J;  8AT1 B;  3MED A;  2XZT B;  1NJX A;  3QWU A;  4XPC A;  1T9X A;  2IBO A;  5AXN A;  4CLK A;  2MYF A;  4B3M F;  3VAJ A;  1RAC B;  3ILJ A;  4RLE A;  4P2S A;  2POK A;  3QFW A;  4B9L A;  1HQU A;  4ALZ A;  4E0D A;  2V50 A;  4E98 A;  3AQO A;  4EBE A;  4O44 A;  2C2Z B;  1WEZ A;  3N79 A;  3PKY A;  2WVC A;  3V6K A;  5FII A;  3D54 A;  1TR0 A;  2ZM6 F;  1S0N A;  3MM9 A;  1XWL A;  3MR3 A;  4DV6 J;  2O5D A;  3P4U B;  4F8R A;  3IRW P;  3T1H J;  4A46 A;  1BMQ B;  1OY9 A;  2MLZ A;  3EDR B;  1U2R A;  1HNW F;  1TKT B;  4JI5 F;  2RJZ A;  1B0V A;  3KLH A;  3FBB A;  4ED5 A;  3GJS B;  4OYX A;  3S01 A;  2GHW A;  2B9X A;  2AJQ A;  3EVO A;  2ZJR Q;  5DG7 A;  4QOT A;  2LQ5 A;  5CYM B;  2BE2 B;  1Y3J A;  1ZM4 A;  2QA1 A;  5HJY A;  2HVZ A;  1R8C A;  4XAK A;  4FPR A;  4UOH A;  2BRK A;  4P73 A;  5HBM A;  2I9S A;  3TO8 A;  5F3Z A;  3MOJ B;  2ALY B;  1C0T B;  4QIV A;  4YY3 J;  5T41 A;  4Y2K A;  3HCX A;  1OQ6 A;  4C98 A;  1HBM B;  3BO4 A;  2ACY A;  3AB4 B;  4DL0 C;  2ZVS A;  3UE2 A;  4P74 A;  2BEF A;  2YKQ A;  3UVJ A;  1WSR A;  2L08 A;  1R8B A;  3WIU A;  3KG0 A;  3DGV A;  2HIY A;  2GQQ A;  4NL5 A;  4OX8 A;  4WFY A;  2UP1 A;  3TJA A;  4KKO B;  4ID8 A;  2NS1 B;  3D0I E;  1WTB A;  2LA6 A;  4QU6 A;  2RB7 A;  1IKV A;  4W98 A;  4RNF A;  2D9P A;  2RDD A;  1D3W A;  4A8W A;  1DQ8 A;  5KFJ A;  5BXI A;  2L9D A;  2HRY A;  2DGW A;  1U1Q A;  2GQC A;  1VIX A;  4LJM A;  3SSS A;  2ZZM A;  4ZP6 A;  3PCO B;  3HHK A;  4OYZ A;  3HZG A;  1V3S A;  2IA0 A;  4CM2 A;  2Y0B B;  1YHQ S;  1OWX A;  1SIW B;  2AT1 B;  1RWN B;  4IFV B;  2P8I A;  3EXC X;  3H4D A;  1YZ6 A;  3W60 A;  3MMB A;  2Z2Y B;  1DAX A;  3TAM A;  2G2Y A;  4ZVU B;  1FO1 A;  1UET A;  4OYB A;  5F41 A;  1S1V B;  1T9W A;  2MKK A;  2IDE A;  3V6J A;  4RPF A;  4GVB B;  1T3O A;  4ECZ A;  1TAQ A;  4R5P B;  4B3O B;  2D69 A;  2BJ1 A;  4PG6 A;  1QAJ A;  4A8Y A;  1FRJ A;  4ZPD A;  4QYZ K;  1V5I B;  1X5T A;  3IP0 A;  4W90 B;  5AJ3 F;  1U6B A;  3DLG B;  2HQG A;  3BBF A;  3FFI B;  3W3S A;  1LXJ A;  2FQQ B;  3UFC X;  1QY7 A;  4A48 A;  2W7P A;  1XQI A;  4DR2 J;  1UJ6 A;  2NR0 A;  3RBE A;  2ZHO A;  4HYK A;  4YR3 A;  4X66 F;  1MML A;  3FKB A;  1DRZ A;  2X51 A;  1YWX A;  4PQU A;  4FNI A;  5J2N B;  3AT1 B;  3E01 A;  1UVN A;  2CPY A;  3SV3 A;  1YJT A;  3VZI A;  1RT6 A;  4DBQ A;  2LDI A;  3UCU P;  5KFW A;  4O3O A;  5HP1 A;  5KG4 A;  1M90 T;  3J7A N;  1HNI A;  4Q0B B;  3MEK A;  3U1L A;  3ZZZ A;  2N82 B;  3QRR A;  3ISN D;  2FD2 A;  2CQH A;  2YWG A;  2XS7 A;  4NRU A;  4AE5 A;  2KZZ A;  1K73 T;  1PBA A;  1WHW A;  2PT0 A;  4ANE A;  3IGN A;  5GAH U;  5HMY A;  3DOK B;  2E5L F;  4LSL B;  2DY1 A;  5T14 A;  1DZ5 A;  4LSZ B;  2IM0 A;  2L41 A;  4H4M B;  1Q8L A;  3LPE A;  4HR2 A;  2IAJ A;  4HT7 A;  3RW6 A;  2UU9 J;  2GMH A;  3EJM A;  2EC2 A;  5KG5 A;  3NXZ A;  3JQJ A;  1YJU A;  3RAM A;  1KVI A;  1RAF B;  1T03 A;  5D3G A;  4AYB D;  3HSD A;  3UWT A;  4DV7 J;  3EIC A;  1UVJ A;  2DNZ A;  4ZPA A;  3UDE A;  3LP1 A;  2E5J A;  4F3Q A;  2WSF C;  2VQE F;  2R7Q A;  1S9E B;  2IJN A;  2OIH A;  2VPW B;  1RLC L;  1NEE A;  2XO7 A;  3MFI A;  1RTD B;  4UT4 A;  1NND A;  3NS5 A;  5J1N A;  2HBR B;  2PDA A;  2ZOG A;  4CO4 A;  5K20 B;  3H7H B;  1KLM A;  3DMJ B;  3HPO A;  4K4S A;  2C2M B;  2UUA J;  4Q8E A;  3NCQ A;  3POT B;  1S4F A;  2B4V A;  4JI8 J;  4DV5 J;  3OVB A;  1MSW D;  1J2V A;  5HVH A;  3X1L B;  1X4C A;  2DNP A;  4NPO A;  3SCL E;  1ITP A;  4DR7 F;  5A8K B;  2J6S A;  2BZ2 A;  2DXE A;  4YHH F;  3F44 A;  4M1K A;  3MM6 B;  2GIR A;  2H1Y A;  5C25 B;  2JJ4 D;  2G2Z A;  3FRY A;  3J7Z T;  3MOZ A;  3V6D B;  3K8V A;  1FJ7 A;  3A12 A;  4YUD A;  1EX8 A;  5A8R A;  3IWX A;  2MTL A;  3QJL A;  4NLV A;  2DNY A;  4OYW A;  4K7Q A;  3NAH A;  4DQP A;  4N8O A;  4DN9 A;  4R0J A;  3CF5 Q;  3CXC R;  4K4X A;  2IRX A;  3K59 A;  1ZYQ A;  3M6U A;  2X1A A;  2QIF A;  1S4E A;  1LW0 B;  1RBA A;  1RAI B;  1Y5L B;  3WC0 A;  1C2P A;  1MRO B;  5DQI A;  3MMA B;  1HMV A;  3DRP A;  4ZVF A;  4WTO B;  3EX7 B;  2QLF B;  3JSM A;  3Q8Y A;  1WC3 A;  3IR6 B;  3LOU A;  3JTP A;  4X4S A;  4ZKA A;  3OUY B;  1S6U A;  2B9Y A;  1S48 A;  2VQF F;  1ZM9 A;  4YEA A;  3I0R A;  1N88 A;  4ZMM A;  3N5F A;  2DNQ A;  2Y1L B;  4P52 A;  3PTW A;  1WEX A;  5LSL A;  2YNH B;  3NS7 B;  2RIJ A;  1G3O A;  1S1T A;  4N8N A;  3PYF A;  2PMW A;  1LEO A;  2AW0 A;  2JOQ A;  1Y0H A;  4J7C A;  3NBP A;  4F0K A;  4L72 B;  5E0O A;  3HFV A;  4ECT A;  2YNG B;  4PWW A;  2F8H A;  2XLI A;  4DF4 A;  2AGP A;  2JZ5 A;  3TA2 A;  4KHP F;  1J5E J;  5J1P A;  2CYY A;  2K3K A;  2VG7 A;  2EC0 A;  4JI0 J;  1ZTW A;  4QR0 A;  3MM5 A;  4TKT A;  4TLQ A;  4UOG A;  4CO0 A;  2GA7 A;  4RW8 A;  3A3O B;  3L7O A;  1VGY A;  3R5D A;  2MKY A;  2R7U A;  4CRJ A;  2HFV A;  2F8E X;  1NDP A;  3Q86 A;  3ONQ A;  5D15 A;  4CTA B;  1KLN A;  1Q81 T;  2C28 A;  4FN5 A;  2RS2 A;  4NLY A;  4KGX B;  4FKY A;  2HYI B;  1HD0 A;  5L46 A;  3IWN C;  4KAI A;  1V5V A;  2ZE2 A;  3O2I A;  2GJF A;  2CQ1 A;  4M95 A;  3U1M A;  2FYX A;  4TNO A;  2ZWO A;  2EKY A;  1FE0 A;  1FER A;  1WOP A;  3W5X A;  1RLD A;  1QAY A;  2BE9 B;  3PR5 B;  3JQM A;  4AND A;  1RT1 B;  4ZJQ A;  5CXT A;  2GO9 A;  3EWG A;  2U1A A;  1U1N A;  1K9M T;  4GKJ F;  4TQS A;  2VDI A;  5D0E A;  4U6P A;  3ZZP A;  2J9C A;  3GCW P;  3Q2T C;  3OPK A;  4X65 F;  2EK6 A;  3DOL B;  2R7X A;  5IT4 A;  1B64 A;  1LWE B;  1TUW A;  4KGM A;  3CJ3 A;  3WC2 A;  2OEK A;  3HSJ A;  2PE8 A;  2IYI A;  4R8U A;  1XK8 A;  1S1W A;  2JSX A;  2LKZ A;  3MM7 A;  2QN6 B;  5ETP A;  3CJK A;  1N34 J;  1ZPW X;  2YWH A;  5IC6 B;  3O1L A;  2AJ2 A;  5I3P A;  2FHM A;  3AXK A;  2V8P A;  4WZQ A;  2V8D A;  2C3O A;  2DIV A;  4WE1 A;  3DM2 A;  2YX7 A;  4LF7 F;  5KFC A;  2YX1 A;  4RW6 B;  2L9W A;  3NGU A;  3HHE A;  1JLG A;  1FKA F;  4TYB A;  2CPJ A;  3D5M A;  2W9C A;  4C8O A;  3ET6 B;  2M8H A;  3A8J A;  2F65 A;  2JC1 A;  1IWG A;  2CQ0 A;  3CD0 A;  4X4U A;  4F4W A;  2WVD A;  4KQZ A;  3W8P A;  4JI2 F;  3DC2 A;  4TY9 A;  3VV2 B;  4EI2 A;  4CO2 A;  3CE8 A;  2VH7 A;  2LU2 A;  4IFY B;  2KXN B;  1Q53 A;  4OX9 F;  1HNX J;  4IG0 B;  2FLP A;  1HWL A;  4RUA A;  2QZ8 A;  4XTT A;  4WU2 A;  1ZZN A;  1JXL A;  3B54 A;  1GX6 A;  1BLU A;  2ZZN A;  4RR5 A;  2CJA A;  4AUK A;  1YBA A;  1TK0 A;  4OJG A;  5DGA A;  1UEU A;  3HKW A;  5KFB A;  1Y10 A;  2C2O B;  4ES1 A;  3LPY A;  5CHC B;  5A0Y B;  1MN7 A;  1EET A;  5EX0 A;  1U24 A;  3CD5 A;  3K89 A;  1NH8 A;  3C16 B;  3HJV A;  4DQQ A;  5L9N A;  1EAY C;  1VHI A;  3HI9 A;  4TQR A;  2AP6 A;  2E1M C;  2MKJ A;  7FDR A;  1HYS A;  1KTQ A;  3ZTS A;  1VBK A;  3GWC A;  1AA1 B;  2YKM A;  5CAB A;  3SQG B;  2P9E A;  4KFB A;  3PKM A;  3KLF B;  1RTJ A;  2AU0 A;  1CQN A;  1NCL A;  4J9R A;  3TR5 A;  2FVC A;  3DRS A;  1FXL A;  4XO0 A;  4OV6 A;  4I4B A;  2WZ1 A;  1NJZ A;  2KB2 A;  2B4U A;  2VBY A;  2R8K A;  4GMK A;  4KGK A;  2NPF A;  4ZVT B;  4A8M P;  4ETZ A;  1HW8 A;  2JFK A;  3T5J A;  1VRU A;  1YRT A;  2VBZ A;  3OXF A;  2OUG A;  2N7C A;  3PJW A;  3KJQ B;  4ZCL A;  4QU7 A;  5K9F A;  2A10 A;  4ECW A;  1RAH B;  4C9D A;  3KHH A;  5B08 A;  4RNM A;  3M32 A;  4DPT A;  1PYS B;  1VQY A;  3NGD A;  1RT7 A;  2MQQ A;  4C3L A;  1UMJ A;  3AH6 A;  4X4Q A;  2ZH1 A;  5KFO A;  4DU7 A;  1FRL A;  2HAF A;  4ICL A;  3KHR A;  2JH3 A;  2VB6 A;  4ZPW R;  1OY6 A;  4P72 A;  4PWD B;  2IMO A;  1SL2 A;  3T9Z A;  1VDH A;  1TFW A;  4MYT A;  3FNN A;  2LDY A;  3AJD A;  4DR4 F;  1PBU A;  1BGX T;  1WG4 A;  1VQS A;  1S9G A;  1X5P A;  5H9F J;  2E66 A;  5CA5 A;  1F1B B;  4Z7C A;  3KK2 A;  2VU5 A;  2C2N A;  5G4D A;  4RJV A;  2ZH9 A;  2XS5 A;  4RUC A;  3BSC A;  2QLB B;  2M7S A;  1OY8 A;  1WDT A;  4P10 A;  2KJV A;  3G8S A;  3FK4 A;  4P2X A;  4YME A;  2R7R A;  4RWX A;  1ZAW A;  1RHM B;  3X3U A;  4J9P A;  4PAB A;  2N4C A;  2F63 A;  1HWU A;  2IRU A;  1HPZ B;  1XJW B;  2QEX S;  1IWA A;  2MKS A;  3OFE A;  1TL4 A;  2ZOF A;  1QE1 A;  3CCE S;  5K8N A;  4NEY A;  1FEH A;  2GZO A;  2KT2 A;  3H59 A;  2ZIT A;  3ZNJ 1;  2B51 A;  3MPV A;  1S6P B;  2OPP A;  5CCL A;  5HK4 A;  1WC6 A;  3OJS A;  2MST A;  3TJ9 A;  2ZM6 J;  2BKO A;  3BRE A;  5J1E A;  2O1P A;  4DX6 A;  4DLG A;  2J7U A;  2VC1 A;  2C1E B;  1TMJ A;  4ILR A;  2OSQ A;  4DQS A;  2RDJ A;  3DLK B;  3E51 A;  3I56 S;  4Q43 A;  2XBP A;  3WDO A;  1HNW J;  4PPD A;  4DS4 A;  2Z8Q A;  4KB7 A;  2RRA A;  4JI5 J;  3GYN A;  5IOL A;  4I2P B;  4CM0 A;  1IKY B;  1W25 A;  2BE2 A;  1NKC A;  3GJR B;  1YVF A;  3M30 B;  1WF0 A;  1CJU A;  5F0W A;  1JLB A;  1YZ7 A;  5F8G A;  4BWJ A;  2KKH A;  1L3S A;  1C0T A;  1Q82 T;  3BSO A;  1Q8I A;  3SFG A;  2K8G A;  4DX8 H;  3D6F B;  3C14 B;  4DV3 F;  3QO9 B;  4DDF A;  2N3L A;  4EFA C;  2FPH X;  5ETK A;  3VVU A;  5IT9 U;  2ZBC A;  4J37 A;  4L76 A;  4OI0 A;  4DCP B;  3PHT A;  2QGF B;  3G86 A;  3FSY A;  3Q8R B;  2KFN A;  4G1I A;  3KYL A;  1HBO B;  3QJJ A;  2UXC F;  5LMU F;  4FS2 A;  3R1H A;  4MTP A;  4Y3C A;  1NPP A;  5E41 A;  4C8K A;  2QLJ B;  4JI6 F;  4KKO A;  2YVS A;  1XR6 A;  3VAG A;  2WB1 D;  1ROF A;  3NRB A;  2B9E A;  2C2E A;  4LSN B;  1S0M A;  5JVG Q;  1DTQ A;  3NOC A;  2M8D B;  1WI8 A;  4Y2A A;  4ZVS B;  3U1N A;  4K4V A;  4JBC A;  4M5N A;  3FMB A;  4MKV A;  2W25 A;  4KPY A;  4OI3 A;  1VJW A;  4WYW A;  1NUE A;  3MXH P;  2E9Z A;  1R7I A;  3DYA A;  1TMM A;  3S1T A;  2Y1R I;  2BJD A;  3NGR A;  1X4F A;  1UPP A;  2BKN A;  1RT4 B;  3UN5 A;  4MK8 A;  3JAM Y;  1WSV A;  4IFV A;  2JVR A;  3JQK A;  2W9B A;  2YY3 A;  1S1V A;  3I96 A;  1URN A;  4Y28 C;  3P5B P;  4R5P A;  3KK1 A;  3Q23 A;  1LV5 A;  4LVO P;  4DSL A;  4UQG A;  1H38 A;  3TAN A;  3R6L B;  1Z4U A;  4FYD A;  2BDP A;  4HKQ A;  1S12 A;  4PXB A;  3R8Y A;  2RQK A;  1KHW A;  1Y5N B;  4OHZ A;  2PFF B;  2KN4 A;  2VA3 A;  3JB9 k;  1D0E A;  5AJ3 J;  4ZP9 A;  2W8L A;  4DL4 A;  1CC7 A;  2RML A;  4BHQ A;  5HJX A;  2HK2 A;  3M7V A;  2MY8 A;  1HA1 A;  4WBF A;  4ZCI A;  4X66 J;  2MKC A;  2VJV A;  1FCA A;  3M6V A;  3I5C A;  5LXR A;  3CCU S;  2IVM A;  3W64 A;  3OTB A;  3OR2 B;  4HEA 9;  2DGO A;  3THV A;  1JLF A;  3BEG B;  3CDU A;  3V5R A;  2B6A B;  1U2F A;  1RT3 A;  4JI3 F;  3SYZ A;  4Y00 A;  3DOK A;  3HZE A;  1WG5 A;  4LSL A;  3NMR A;  1Y3K A;  1EIY B;  2HS3 A;  2YNF A;  3MCS A;  1VC5 A;  3R7N B;  2M4M A;  3HHD A;  1RBO B;  2Z2L A;  1FD2 A;  3HFZ B;  2E5L J;  2GX8 A;  3LP0 A;  2R8G A;  2CA9 A;  1TKX A;  3W5Z A;  2NZC A;  2ZH7 A;  1FF2 A;  4NCG A;  4WXO A;  1A0O B;  4ED7 A;  2PEB A;  4RUH A;  5GVQ A;  1N4L A;  5D77 A;  1F5A A;  2H5I B;  1VRT B;  1NHK L;  3EGZ A;  2ERR A;  4WWS A;  1JIH A;  2B4O A;  2JC0 A;  2FJW A;  2VG5 A;  2AYG A;  1Z1Z A;  4B3S F;  3AA9 A;  1RTD A;  2AV5 A;  1GAO A;  1P9Y A;  4U8V A;  2VQE J;  1T11 A;  1CPZ A;  3NAI A;  4CO3 A;  4DOZ A;  2H4Y B;  1F0X A;  3THP A;  3PX6 A;  2XMM A;  1IM6 A;  2EBG A;  4LVN P;  4CLP A;  1PJ6 A;  1VQ7 S;  3GIJ A;  3OTE A;  4B9S A;  5THW A;  1PIE A;  4ID5 A;  5A8K A;  2CWX A;  3C6U A;  4ZVP B;  4I0W A;  3O6Q A;  2WHO A;  2XYP B;  3Q0A A;  1SUQ A;  2M70 A;  2Z2Z A;  4DR7 J;  1CS4 B;  4YHH J;  1G6B A;  1KVJ A;  1K44 A;  2BQU A;  2WBR A;  1VC6 A;  2F9D A;  2NSC A;  2FVS A;  3C15 A;  3CD6 S;  1RE1 B;  3AJ1 A;  4IRD A;  2Y8Y A;  1WKK A;  1FWP A;  5KT7 A;  2QTW A;  3RRG A;  2W24 A;  4K2X A;  2DNK A;  2SXL A;  4RW9 B;  4EGL A;  2QLX A;  2BAN B;  1F5C A;  3UN3 A;  4NXM F;  4DPX A;  2XI2 A;  3MDF A;  3L7U A;  5B0G A;  3P96 A;  4XDC A;  1D8Z A;  3QLH A;  2HLT A;  4OIX A;  1MRO A;  3MMA A;  3BV8 A;  4L6V 3;  4AT1 B;  4M94 A;  5BYS A;  5FDL A;  3TW0 A;  4B9U A;  1U26 A;  1IVZ A;  1GNK A;  2UV8 G;  1JKH B;  2CVI A;  7FD1 A;  2YXL A;  1U7L A;  3W2W A;  3PRB A;  3B82 A;  2K7K A;  1SC1 B;  3M8P B;  5LJ5 Y;  1GFW B;  1PJ5 A;  3CTR A;  5H9E K;  5KT3 A;  4HHH A;  4K0K F;  2VQF J;  3BQ2 A;  3LAK A;  3KHG A;  4F4K A;  3CT9 A;  2YNH A;  4MAK A;  2FHJ D;  5L39 A;  3QSI A;  3H4B A;  4LBP A;  3CCM S;  2I8E A;  4GVL A;  2JX2 A;  9ATC B;  1UVI A;  2R2T A;  2O01 C;  4K8R A;  4LF6 F;  3BQ1 A;  2V8H A;  1N36 F;  1HIY A;  3BM7 A;  1JJH A;  3K5M A;  4FXD A;  3CVK A;  5E3P A;  1FXR A;  4GO5 X;  4TU7 A;  2R7S A;  2NZ4 A;  2VPX B;  5B7W A;  2OFH X;  1K0V A;  1JLC B;  3OT9 A;  3HP6 A;  2N3O A;  3IN5 A;  4QPX A;  4KHP J;  1L3T A;  3R2C J;  2HGL A;  3I55 S;  3NWG A;  3TZY A;  3VGT A;  4MFB A;  4DPY A;  2QA4 S;  5A6P A;  1HQ2 A;  2OD4 A;  5AXK A;  4CNY A;  3IC1 A;  3T9N A;  2EFP A;  2C3U A;  3VTI A;  2QMW A;  2AJ0 A;  2ZFH A;  4GRS A;  3NNA A;  3IA0 A;  2J6U A;  2DGS A;  1RT2 B;  3QRQ A;  1QSS A;  5KFR A;  4ZJO A;  1CSJ A;  1OSD A;  5HO4 A;  3MAA B;  1HAR A;  2R7O A;  2KL8 A;  2ZD1 A;  4DPU A;  3M8W A;  3BKU A;  4WPA A;  5E5N A;  3Q8U A;  2E5G A;  1LFW A;  4OJ3 A;  3HVT A;  2J8S A;  4YR0 A;  3CJ8 A;  1FTR A;  3PYG A;  4G3I A;  4ECS A;  3MUM P;  4F50 A;  1V3Z A;  2PI5 A;  1OYE A;  1BE4 A;  4A8X A;  3H5S A;  3UD3 P;  4F02 A;  2HK3 A;  2YX4 A;  4U8Y A;  3OHA A;  2F8M A;  5LT5 A;  4GKJ J;  3DOL A;  1JLQ B;  3PHE A;  4OZ3 A;  5KFG A;  1LWE A;  1TEL A;  1TQL A;  4X2B A;  3H5Y A;  2L48 A;  3G2X A;  4Z7Y A;  4X65 J;  4L3K A;  3R9L A;  2DNO A;  1RAG B;  1XNR J;  4USM A;  1NKB A;  3SFU A;  5BR8 F;  2VPY B;  3PO4 A;  4RKU C;  4P71 A;  1X7V A;  2Y3Y A;  3DLB A;  4OMF G;  1JXE A;  2VIC A;  2V9W A;  3OVA A;  5CAA A;  3KTQ A;  3IG1 B;  3CMA S;  2NXJ A;  3QIP A;  2ZH5 A;  2GO8 A;  1S1U B;  3Q8V A;  2BOP A;  2E9T A;  1SJ3 P;  2V4R A;  4LF7 J;  1FFS B;  5DLG A;  3H5U A;  2H48 B;  1S5Z A;  4NLW A;  4FYV B;  3LTO A;  3N6N A;  2NPI A;  3KKF A;  3DXB A;  3MWB A;  5DZ6 A;  2DTJ A;  2IPO B;  4IG0 A;  4X4O A;  1Q7Y T;  2XC9 A;  4JI2 J;  3FQK A;  5L9X A;  4LRE A;  4NI2 A;  1LKZ A;  1ZTT A;  4OX9 J;  2UUT A;  5K8M A;  5IC4 B;  3E3X A;  3RZA A;  5J2M A;  3KLE B;  1SH0 A;  1UPM B;  1MW7 A;  2ZNY A;  1R3N A;  3I0S B;  3TOQ A;  5K8O A;  2ASJ A;  4WFX A;  3D1O A;  4LR7 A;  1XMQ F;  5AE2 A;  4ES3 A;  2C3M A;  3QT6 A;  2GIF A;  2CJQ A;  3HD2 A;  4BC7 A;  3OLA A;  3OV7 A;  2J0X A;  1O51 A;  1DJ0 A;  1KDN A;  2ZUA A;  3MD3 A;  4O3S A;  5KG3 A;  5GAE U;  2RF2 B;  2I5J B;  1FDD A;  5JVH Q;  1UKU A;  1SKW A;  3W1Y C;  3GZ7 A;  3KLF A;  4FNH A;  4DN0 A;  1HBN B;  2FJA B;  1PIL A;  3TEG A;  2MZT A;  5KTQ A;  2HQI A;  2X7I A;  1R0A A;  4X4N A;  1E6V B;  4A47 A;  4G1Q B;  2HQC A;  3GB0 A;  2CJ9 A;  4UTG A;  3IRX B;  2HZC A;  2QT7 A;  3UNY A;  3EZU A;  2IIH A;  2CWK A;  4HTI A;  3IM9 A;  1M0S A;  5IXU A;  1JJC B;  2VHG A;  4ECU A;  2CQC A;  3SBM A;  3DOM B;  2V68 A;  2DPJ A;  1LQ9 A;  1RWW B;  4Y34 A;  1TL5 A;  2DNN A;  3E2E A;  2PC6 A;  4KGZ B;  4H4K C;  2K7J A;  3GU0 A;  3CJR A;  3PIP Q;  4DSE A;  2D3O R;  2NXC A;  3QAU A;  1FD8 A;  3HHL B;  3NG8 A;  1CJK A;  3MEG A;  3BQ0 A;  4PXD A;  4TY8 A;  2RU3 A;  2V2Q A;  4QQB A;  4OYA A;  4LBH A;  3ENA A;  2NLW A;  3L09 A;  4E2F B;  2LYV A;  2CQG A;  4J9U E;  4DX7 A;  4CZC A;  3KK3 A;  2DCL A;  1N5Y B;  1NB2 A;  2VD3 A;  3ZZ0 A;  2DNR A;  2VBW A;  3M2V B;  5D6G A;  2LLZ A;  4DR4 J;  3VAK A;  2MKH A;  2QG9 B;  1IQZ A;  1PCA A;  2JEI A;  2CQP A;  1G2E A;  2DEI A;  2IDL A;  5HLF B;  5A2Q Y;  2DJW A;  4U7U D;  3R5C A;  2M9K A;  2DB1 A;  2CNO B;  2ROG A;  4IOB A;  4ZPC A;  1KKH A;  3M9M B;  2HWH A;  1HI1 A;  2UUB F;  4WK3 A;  1S72 S;  2IRY A;  5DG9 A;  4C11 A;  1HPZ A;  2RHQ B;  4I69 A;  2YQ0 A;  3Q2S C;  2KI2 A;  2Q79 A;  1OSC A;  3MAQ A;  4J9O A;  1ZS6 A;  2M2B A;  4WFA Q;  2HNZ A;  5ETN A;  3TI0 A;  3LO3 A;  1RAJ A;  3CDA A;  3BGR B;  2KDO A;  4CYU A;  4I2Q B;  3EM1 A;  3MM8 B;  1B7F A;  3S8S A;  2CG4 A;  5KFV A;  1HLW A;  1VQ6 S;  1M5V C;  2KO1 A;  4X84 A;  1S6P A;  4I1T A;  5FD1 A;  4U9R A;  4TU9 A;  3P5T L;  2JHE A;  3ETM A;  4OYP A;  4RO0 A;  3DU6 A;  1RTI B;  3FBE A;  4JV2 A;  3WX4 A;  5K14 A;  2M5Y A;  3DDN A;  1KRP A;  4JI7 F;  1SJR A;  5D4O A;  1NSP A;  1JLA B;  1B3T A;  1NHU A;  1VBZ A;  2V2K A;  3KLI B;  3O5T B;  4UOF A;  1H72 C;  2XWX A;  3L7P A;  2KXF A;  3KJF B;  1RZM A;  2V4J B;  3RBZ A;  1RAA B;  3M30 A;  5KFI A;  3KNG A;  1UWA A;  4N56 A;  1S9F A;  3CC2 S;  5ITH A;  4XPE A;  3D9B A;  1DLO B;  1WF1 A;  3SMZ A;  1F9F A;  1OJ4 A;  1RCX B;  3BGO P;  3FSI A;  3C14 A;  3VQT A;  3HFK A;  1WKJ A;  3T5L A;  4CLT A;  3NNH A;  4DV3 J;  3HXM A;  3KUG A;  3I9Z A;  1EQ0 A;  2ASL A;  4P7T A;  1HBO A;  2K1R B;  1T05 B;  1E6Y B;  3GCX P;  2R8H A;  2DHH A;  3BR9 A;  1RHK B;  5E7O B;  1R0B G;  2UUW A;  2UXC J;  5LMU J;  1N5Q A;  3M6W A;  3T41 A;  1YLX A;  1KNZ A;  2EI5 A;  3GV8 B;  3UR3 C;  2E1A A;  3CCL S;  2P2C B;  4EO8 A;  4JI6 J;  4MK7 A;  3IM8 A;  2MKI A;  2UVV A;  2LP4 A;  5EHH A;  3R2D J;  1RWM B;  5L1J A;  3CPW R;  3G96 A;  2ZUG A;  3KDN A;  1VIO A;  2J0S D;  2F5G A;  3OR1 A;  4YOE A;  1CUL B;  4IG3 B;  3O44 A;  3B4D A;  4HDH A;  3UCG A;  4CT9 A;  3GLJ A;  1T0T V;  3IO1 A;  2Z0G A;  2R2R A;  3L4B C;  1RK8 A;  9RUB A;  1R8P A;  3ITH A;  1LW2 A;  5D0G A;  2EK1 A;  2M88 A;  5HVG A;  3G87 A;  1LWC B;  3HVA A;  5ETM A;  2MJU A;  4PWU A;  4U96 A;  3MUV P;  1SV5 A;  1SL1 A;  5HMZ A;  1IBK F;  4USW A;  1D9D A;  3AHP A;  1UVM A;  1I6J A;  2WOM B;  3H40 A;  4YP3 A;  2PD1 A;  5HVF A;  1QJH A;  5KFH A;  4D3G A;  2YQ1 A;  1R27 B;  2BAC A;  4FKX A;  3BN4 A;  3DRY A;  1TU0 B;  1S0O A;  2ATC B;  1UEK A;  1EP4 A;  2MEW A;  4J9S A;  5CYQ B;  5DDQ C;  4C97 A;  4LR9 A;  2HKE A;  1GMU A;  2XSF A;  1VQM S;  4IH7 A;  2HFO A;  1YKW A;  2UUC F;  4PYD A;  4ED4 A;  2DY9 A;  1NK0 A;  4MK9 A;  4ZP7 A;  3M4X A;  5IM0 A;  2OAU A;  5KT6 A;  2HMI B;  3J80 U;  4DUY F;  3K2Y A;  1S1X A;  2E7W A;  2ADC A;  2LFV A;  4IO9 Q;  3R7S B;  1Z2L A;  2HSE B;  1TFY A;  3W5Y A;  2DVI A;  2H9Z A;  2RRN A;  4JI3 J;  4NLQ A;  2ZH3 A;  3FVY A;  4ENO A;  4OI4 A;  3MMC B;  2WCX A;  4IDK B;  5F8M A;  3GJQ B;  1CBK A;  3HHL C;  2WBM A;  4OZ5 A;  2VIH A;  2V2Z A;  3N28 A;  3MR7 A;  2UV8 A;  2ZOM A;  1MWZ A;  1FRM A;  1FRK A;  5L1L A;  4EYI B;  2CPF A;  2R8I A;  3N6L A;  1X4D A;  3F56 A;  2DXD A;  3NMA A;  5U47 A;  3MUR P;  3G82 B;  5EUH A;  1W26 A;  2KYX A;  3I87 A;  1WC1 A;  4ZDN A;  3MR6 A;  4B3S J;  4M5G A;  1G4C A;  2DIT A;  4WYL A;  3DRR B;  1J5O A;  2RVJ A;  5DG8 A;  2QC3 A;  3DGP A;  4OZ2 A;  2DGX A;  4M5D B;  1NDK A;  1HQE B;  3JXO A;  1RXO B;  2DO4 A;  2ZNZ A;  1IKW A;  1UAW A;  4O23 A;  1U45 A;  2JEJ A;  2Y8W A;  3LWL A;  2DGQ A;  3HD1 A;  2AHO B;  2GAH C;  4DZ6 A;  2E7V A;  2HBZ B;  5CD4 H;  2OGU A;  4AD6 A;  1WDD A;  7AT1 B;  4ANC A;  3OTO F;  3OSN A;  1P8G A;  2V8V A;  1JNZ B;  1CVJ A;  1KOO A;  1B4S A;  4EBD A;  3CJ5 A;  1R31 A;  4B08 A;  5J2P B;  2O67 A;  3QFH A;  3IBC B;  4HAC B;  1VI7 A;  1RHQ B;  2BW2 A;  2WVE A;  2MZQ A;  2PO4 A;  4J5O A;  3GTY X;  1V9O A;  1RBL A;  1WHX A;  2MZS A;  3GV5 B;  5KFP A;  1B7Y B;  1WC4 A;  3CMQ A;  1TV6 B;  4N77 A;  1HHQ A;  4J91 A;  3DI6 B;  4NXM J;  1U49 A;  2FB0 A;  2G13 A;  2ASY A;  1GXT A;  4UY8 5;  2FJE B;  3PX0 A;  1U0H B;  3SDE A;  1JXV A;  3ILI A;  5E33 A;  4C2M A;  2AGQ A;  3M8P A;  5B0A A;  1HBU B;  4B9V A;  3HDS A;  2HFU A;  2NUU G;  3P45 B;  4EZ9 A;  5D8H B;  3W2V A;  4DV1 F;  3D2W A;  1UVL A;  5CYJ A;  2A2D A;  2RSQ A;  2CRL A;  1C4A A;  4OZJ A;  4X64 F;  3ICL A;  5AXM A;  3WZ0 A;  3GR0 A;  1HQU B;  4K0K J;  1RQ0 A;  1VQ8 S;  3LUY A;  3ZZT A;  1IR0 A;  2V34 A;  3NLC A;  4W4M A;  4O44 B;  3Q8P B;  1F60 B;  2OO4 A;  3PYD A;  1KVK A;  4IR9 A;  1RAE B;  2V8G A;  4LF6 J;  3MM9 B;  1N36 J;  1LNQ A;  2KHC A;  2YWK A;  3FRZ A;  4RZR A;  2FGO A;  2J9D A;  2JLE A;  3C19 A;  4NYP A;  3QGG A;  3MCM A;  1NK7 A;  2Y9H A;  2DBB A;  3BGF A;  4OHX A;  2UVR A;  4I64 A;  1NME B;  4O3N A;  1T8E A;  4YQW A;  1YBU A;  1WOS A;  2WAQ D;  1XR7 A;  4HI2 A;  1S57 A;  3GG0 A;  1DTT A;  2IC3 A;  3G4S S;  1V6H A;  3KWM A;  4DSI A;  4U67 Q;  3AAW B;  3KNA A;  4PG4 A;  4O4R A;  1HL6 A;  2AJF E;  1RWV B;  3RB3 A;  2UZA A;  1JLE A;  2RH3 A;  2XHW A;  1SQF A;  1RT2 A;  1VMB A;  3FCV A;  4G6V B;  3PIO Q;  2VOO A;  1WUU A;  3QQC D;  3NCR A;  4LRB A;  4FF4 A;  1IKX B;  3MPY A;  3SCI E;  2CDR B;  5HBM B;  4NA2 A;  3C6T A;  4K50 A;  1VQO S;  4USV A;  4MJK A;  3PFO A;  1GX5 A;  4DV4 F;  5DRK A;  3CCS S;  1SJ1 A;  4LF2 A;  5IQQ A;  1XMO F;  2KH9 A;  2HHV A;  4CDI A;  5KFQ A;  1O5J A;  1QUP A;  3QSY B;  1H7X A;  2DR8 A;  3UDC A;  3GMG A;  3UVJ B;  4DR3 F;  4ECR A;  3DFE A;  1NK4 A;  2NCK L;  3NGT A;  1VQK S;  4K2J A;  1Q78 A;  1BQM B;  2DNH A;  3I5A A;  4PAA A;  2VKZ G;  2W2N P;  2FZK B;  3FZ2 A;  3HLU A;  1JLQ A;  3JTN A;  2Z2M A;  5I4M A;  4OHW A;  4CLF A;  1FEE A;  4BWM A;  4Y2I A;  1PJ7 A;  1R0C B;  2KT3 A;  2RKI A;  3EGN A;  3SIP B;  1JJ4 A;  4TLR A;  1D9F A;  3EPG A;  1OS5 A;  4YB5 A;  1S10 A;  2PA8 D;  1BD6 A;  3IS9 A;  3AB2 B;  3MPU B;  1HKA A;  3ISZ A;  1GMW A;  3GYX B;  4ILL A;  4RU2 A;  3FGV A;  5BR8 J;  2BA9 A;  4DFM A;  3C3L A;  1NDL A;  2KXH A;  3F73 A;  4LMZ A;  5EDW A;  2XNR A;  1YJ7 A;  4ECV A;  1DY3 A;  3ISN C;  1Y4Z B;  1DQA A;  3TNV A;  3IMQ J;  3HM9 A;  1RP5 A;  2KFY A;  4DCO B;  3SQO P;  2HRU A;  4R25 A;  3TWZ A;  2W7O A;  3MMB B;  3CJQ A;  4M5K A;  5AXL A;  3TAM B;  3GR1 A;  4IO1 A;  5KFS A;  3TUZ C;  4C0H A;  1FNM A;  2QYG A;  2EFV A;  5EWE A;  2W7A A;  5T7L A;  2CIM A;  2VPZ B;  3MHY A;  1TKD A;  2IM2 A;  2DRD A;  2IBK A;  4Q45 A;  1SIZ A;  1XBW A;  1XER A;  3FBF A;  2HFN A;  4F0M A;  3D3B J;  2G0J A;  1YRU A;  1ZAV A;  4I68 A;  3CCQ S;  1SKR A;  1UVK A;  2AZ3 A;  4QR1 A;  2W8K A;  1TL1 B;  1WKL A;  3TJ8 A;  4JYA F;  4WF9 Q;  3QGI A;  3PG9 A;  3R5G A;  3JYT A;  2F1F A;  2RE1 A;  3SCK E;  3K5O A;  3E01 B;  4NX9 A;  2XGP A;  1RT6 B;  4WCE Q;  3AY0 A;  4EZ6 A;  1RTH B;  5HP1 B;  2GJI A;  3CED A;  1XMQ J;  1HNI B;  1SH3 A;  2VFV A;  3H0P A;  2W4D A;  3EZ5 A;  2X1F A;  1BQN B;  2J76 E;  2I5J A;  3CB4 A;  4DFJ A;  1U1O A;  2LCW A;  2E1C A;  2BYC A;  3TVZ A;  4ER8 A;  2FVR A;  2ZHB A;  5D0H A;  1HBN A;  2NQP A;  5G0R A;  4FF3 A;  1GXL A;  2D3Z A;  3TAP A;  3QYY A;  1E6V A;  4DUT A;  3D28 A;  3FUY A;  2I6W A;  3FCW A;  2IAJ B;  2XY7 A;  3DHW C;  4G1Q A;  5B0B A;  4OYI A;  1F3V A;  3C46 A;  2A2C A;  4ED6 A;  1REG X;  1Y00 A;  1T03 B;  5D3G B;  3M8Z A;  4WFN Q;  2HAI A;  2D74 B;  5KFA A;  2OML A;  2HHH F;  3BB5 A;  5D78 A;  3DOM A;  4KHM A;  5KG6 A;  2MB0 B;  2KZM A;  1TUG B;  5CCM A;  2D3U A;  2BMB A;  3H20 A;  4LQ9 A;  5HQ8 A;  3RB6 A;  3HO1 A;  2YH1 A;  3EVM A;  1U8W A;  3NCP A;  1NK5 A;  1LWF A;  1FES A;  2YNI A;  2NRE A;  4L75 A;  2XCA A;  4WII A;  4CT8 A;  4DV0 F;  1N33 F;  2PI4 A;  5HRO A;  1T9T A;  2I1R A;  4S0M A;  3HHL A;  1ULR A;  3RU0 A;  5GME A;  2FLN A;  3VCD A;  2CJY B;  3AXM A;  1KLM B;  2H54 B;  4YS2 A;  1WOO A;  4O0I A;  4DHV A;  4LF4 F;  2Q6B A;  4ZA1 A;  1M5S A;  3DN9 A;  4C7Q A;  4I6Y A;  1NSQ A;  3R6G B;  3RYL A;  3TVY A;  1N6Q B;  3HMJ G;  4NLG A;  4KBI A;  3CIM A;  3CDW A;  4ILM A;  3MGJ A;  5EGY A;  3Q89 A;  3HK2 A;  1NZ8 A;  2H5J B;  2KTQ A;  1U2C A;  4WZM A;  1TK5 A;  3O8W A;  4FDF A;  5FLX Y;  4KT0 C;  3R1L A;  4B3T F;  1M5P C;  2FJB B;  5M2R A;  2HVI A;  5HLF A;  1RWX B;  2XHC A;  2ZVI A;  5KOW A;  2JWN A;  3EMT A;  3CDE A;  4P2F A;  3VAI A;  5ETR A;  1F9E B;  1TAU A;  2XNQ A;  1QUV A;  1HNV A;  2HHS A;  2UUB J;  5KFD A;  4IH6 A;  2WK4 A;  4ZIW A;  2YKN A;  2MQ8 A;  1P1T A;  2MXY A;  2CQ3 A;  1MU2 A;  3VF0 B;  3BGR A;  4EBC A;  3BBB A;  1HMV B;  2LEP A;  3TQE A;  3DRP B;  2FTR A;  3I31 A;  2AWZ A;  5HI7 A;  1IJF B;  3RW7 A;  4UY8 T;  3OL9 A;  1IBM F;  2G1D A;  4GC6 A;  2XLJ A;  2AGO A;  1LOU A;  3M2U A;  3RTV A;  4K4Z A;  1NJI T;  4O4G A;  1P27 B;  3ETO A;  3HT3 A;  3BR8 A;  2MSS A;  1KQG B;  2IFX A;  2CFX A;  2ADB A;  3KJN B;  3K5L A;  1JLA A;  1NK9 A;  2UXD F;  1S1T B;  3AA8 A;  2J9D E;  4CH7 A;  5ETS A;  1T3N A;  3KLI A;  2V9K A;  4JI7 J;  1OIA A;  1N0V C;  3T19 A;  3NBP B;  2V4J A;  2NXE A;  2QX0 A;  3GFH A;  2V0N A;  1M5H A;  2DKO B;  1RWK B;  3DLH A;  1R43 A;  3NNC A;  4O3Q A;  3PFE A;  4DG1 A;  1N54 B;  2HEK A;  2VG7 B;  1FNX H;  4ED2 A;  4OLO A;  1GH8 A;  3TAR A;  1UWB B;  2XMJ A;  4F7V A;  1T94 A;  4NA3 A;  1XMB A;  3DRX A;  3MM5 B;  1H0H B;  1DAR A;  3G71 S;  5C7P A;  2KFZ A;  4ZVQ B;  3P3D A;  2DEJ A;  3P8B B;  1IJE B;  3AD8 C;  4UUX A;  4RW8 B;  2W01 A;  1OYD A;  3PW2 A;  3JSR A;  3HJF A;  2GVD B;  2BVZ A;  3M6X A;  4FBU A;  1K1Q A;  2G4B A;  1RKI A;  2CQB A;  2HND B;  4EU0 A;  4NRT A;  1RJJ A;  2BJ3 A;  1JQG A;  4DL6 A;  4QIF A;  1U1L A;  4PR6 A;  2J9E A;  1X4G A;  4KYZ A;  4Z2X A;  2C3P A;  1E6Y A;  3HUL A;  3VVT A;  3TUI C;  2LU1 A;  2R9L A;  2ASD A;  2OLW A;  2GVZ A;  1KN6 A;  4OLP A;  3MEC A;  3OTC A;  2DNG A;  1B0T A;  4NYO A;  1FDB A;  2AJ1 A;  4CO1 A;  4ECX A;  2C22 A;  4QWE A;  4IRC A;  3WQP A;  3HX9 A;  3HSZ A;  3UPF A;  3GSD A;  1CLF A;  1NXI A;  1ZBT A;  2E1P A;  3VGV A;  1WJ9 A;  1Q79 A;  5F8I A;  2P5V A;  1P6T A;  1VQ5 S;  3I82 A;  5DET A;  1TL7 A;  1I3O B;  4F3O A;  2R7W A;  1CUL A;  1Q16 B;  3L3C A;  2Q3P A;  2GAG C;  1X4H A;  3N01 A;  1JB0 C;  2I38 A;  3MCO A;  4DZD A;  1NM2 A;  4J9K A;  4RL1 A;  1GTE A;  1MMD A;  4QJV A;  2VFU A;  1QVG R;  2XQC A;  3QNW B;  5K5M A;  3IR5 B;  5C2C A;  1LWC A;  4KY3 A;  4CWB A;  4D3H A;  3ADA C;  2EW9 A;  2C2K B;  3S6E A;  1WHY A;  1HD1 A;  5CD4 A;  4DPO A;  2C3Y A;  2VJU A;  5KAK A;  1XNR F;  2F7V A;  3D68 A;  4G65 A;  2HBY B;  1RHU B;  4ZPT R;  2MDA A;  4R8U B;  3K57 A;  1IBK J;  8ATC B;  3QZ8 A;  5IV3 A;  2GMJ A;  4P6Q A;  4GO7 X;  2KG1 A;  3IAS 9;  2FC9 A;  4Q44 A;  3M2R A;  3V6H A;  2WON A;  5LL6 d;  4WE1 B;  1KFS A;  3US5 A;  4LUB A;  2AJ4 A;  4RNO A;  3A8K A;  3KJV A;  1EZZ B;  2V67 A;  3OFG A;  2K06 A;  2CZV C;  5KG2 A;  5F8J A;  5A2Q U;  1JLG B;  3GII A;  3CCT A;  1MN9 A;  3MTJ A;  4PG7 A;  4CCH A;  3FEZ A;  2EEY A;  1NK6 A;  2ZH2 A;  2YPY A;  4NXN F;  1DHM A;  3R7B B;  2QJ3 A;  3HF5 A;  1OPI A;  1DQ9 A;  2WW4 A;  1AXQ A;  1RKJ A;  1X4A A;  5F9L A;  2UUC J;  2QFJ A;  2HHU A;  1L5U A;  4C8M A;  2V5H G;  3JS9 A;  1N8R T;  4QIW D;  1KON A;  3FCH A;  3GYG A;  2XG8 A;  1TL3 B;  3QT5 A;  3TAQ A;  2DIU A;  2F40 A;  2C2D A;  2YKP A;  2GFF A;  2F4F A;  1NLK L;  4DUY J;  1W2I A;  3ENW A;  4RUB A;  4NML A;  4N41 A;  4MH8 A;  2CKW A;  4KC5 A;  3ZZR A;  4CP5 A;  2MZ1 A;  1EET B;  5DO2 A;  3MMC A;  4I67 A;  4URQ U;  1FJE B;  4AFF A;  3FDS A;  4NCB A;  5JUM A;  1CJT A;  3KUH A;  1F2G A;  2DCU B;  4DSK A;  1N5T A;  4ITS A;  1LXN A;  5JXS A;  1C1C A;  3D6T B;  1ZPV A;  1Q86 T;  1RTJ B;  2DNL A;  3A1Y G;  3M05 A;  2HHT A;  4FZV A;  1FX4 A;  2FHK A;  1DUR A;  4RBU A;  1PAU B;  3JTO A;  5C24 A;  1R6V A;  2DRB A;  1K0T A;  2JDJ A;  1FDA A;  3MPW A;  1MMN A;  2HFZ A;  5L38 A;  1SL0 A;  1Q1K A;  2XSJ B;  3SXL A;  3S7R A;  4V19 X;  3PDN A;  1VRU B;  2Y1J A;  2ROP A;  1X0F A;  1WF2 A;  3J7Z 5;  2X1G A;  4ZHR A;  4RNN A;  3G6X A;  2Z58 B;  2CPD A;  3K17 A;  5D4P A;  3KXD A;  3M32 B;  2KRR A;  5EWF A;  5F8N A;  1H2T Z;  3PM9 A;  4N5S A;  3T5K A;  4OI1 A;  3CW2 C;  1T9V A;  3ZTO A;  1RWP B;  3NKY A;  5GAE I;  1T7P A;  4ICL B;  3CDB A;  1U1P A;  1U8S A;  1YG0 A;  2WVB A;  3PW0 A;  3OTO J;  2DHA A;  4HAC A;  1HR0 F;  2YWW A;  3KOA A;  3V2U C;  1VQ4 S;  2JFD A;  2IA6 A;  3DXS X;  4J9Q A;  3AOB A;  1NK8 A;  2HQF A;  3ZNU A;  4QWB A;  4CLZ A;  2HLU A;  1P9Q C;  5KG7 A;  1TKZ B;  2JEG A;  5C42 A;  3QMQ A;  4UUW A;  2I0X A;  5GAG U;  2DR6 A;  1WD6 A;  1S9G B;  1QD1 A;  5KFK A;  3KK2 B;  2IM3 A;  1WTF A;  2OEM A;  1HBU A;  1LK7 A;  3OL8 A;  3LAM A;  3CUL A;  1NAQ A;  4USK A;  5F0U A;  1OO0 B;  4IH5 A;  1NSA A;  1RAO A;  4PQA A;  2XY6 A;  1XNQ F;  2DNM A;  2DGU A;  4DV1 J;  2HS4 A;  3BGL A;  4IR1 A;  3QWP A;  2CPX A;  1LWX A;  1FK9 B;  5HSP A;  1A9N B;  1BQX A;  1QE1 B;  1ZZF A;  4X64 J;  1XR5 A;  1I5O B;  3KG1 A;  2VC0 A;  4AXI A;  2JNJ A;  5KFM A;  2OPP B;  1Q5V A;  2JEF A;  1FWK A;  2BXJ A;  2R2U A;  3VAM A;  3AFG A;  5J1E B;  3M9N B;  4DR1 F;  4KTQ A;  3QPI A;  2ZDP A;  1VQN S;  3T6B A;  3FJ2 A;  1TKT A;  2QE5 A;  5HMW A;  1XIQ A;  3TZZ A;  3M1V B;  2R42 A;  2HS0 A;  4F04 B;  4ATN A;  4NLD A;  3ZO7 A;  3K0J A;  1EKS A;  1HI0 P;  2MHE A;  4OYM A;  5CYM A;  4WKY A;  4OHY A;  4X62 F;  5L1K A;  2CDQ A;  4UW2 A;  2CPE A;  4ZOS A;  1CJU B;  1JLB B;  1UW4 A;  2DGV A;  3IFE A;  3OD2 A;  1IKX A;  2XYH B;  4YDX A;  4URS A;  4NLU A;  4OI2 A;  5DS7 A;  2FLL A;  3V4M A;  3GFX A;  1EKR A;  4I6W A;  3SSR A;  2QLW A;  4J90 A;  2VF3 A;  2L9N A;  2R7T A;  4USU A;  3ZTQ A;  1HBM A;  1TZ0 A;  4JP8 A;  2BQ3 A;  3ZZY A;  5B0D A;  4ED3 A;  4OJ1 A;  5A8W B;  1SC6 A;  4DV4 J;  1S6Q B;  1N52 B;  1WI6 A;  5GMK a;  2D41 A;  1ELO A;  3BS9 A;  1XMO J;  1VBX A;  2A6M A;  4BBY A;  1RWO B;  3D66 A;  1BQM A;  4DR3 J;  3M8Q B;  4ZN1 A;  2ATL A;  3RBD A;  2EFG A;  4ETX A;  1DTQ B;  3BGU A;  5CQG A;  2B7B B;  4WJB A;  1APS A;  2YKO A;  1R8A A;  3BZQ A;  3QGH A;  5IWA F;  4F0H A;  3DLE B;  3TX8 A;  3ENQ A;  2G9O A;  5RUB A;  4DQR A;  5LXY A;  3J81 Y;  2IYG A;  5HL7 Q;  3MI7 X;  4DJB A;  2U2F A;  3DYA B;  4LRD A;  3C2P A;  3Q22 A;  1RTZ A;  3EPI A;  2OEL A;  4B9M A;  4WTY A;  2DO0 A;  3VAF A;  4C4W A;  1S7I A;  2MHN A;  4U95 A;  2HWI A;  2E29 A;  2GW8 A;  2ZBI A;  2NXN A;  2W9B B;  4FYW B;  1OQ3 A;  4ZCK A;  2XM3 A;  1RU1 A;  3RAX A;  3PNI A;  3Q24 A;  4GVB A;  1VS3 A;  2VDH A;  1EAR A;  3RRK A;  2CAD A;  4LQ3 A;  3KK1 B;  4B3O A;  3D1Q A;  2AMC B;  4HI1 A;  3J7Y U;  4DUZ F;  2XMK A;  2RU9 A;  2EG2 A;  5MAO A;  2KM8 B;  3DLG A;  3PRV A;  1U6F A;  1B70 B;  3FFI A;  4C6A A;  1TL1 A;  4NA1 A;  2ZDO A;  5CZV A;  4OX7 A;  4M5H A;  4YB6 A;  5IT0 A;  5A6W A;  4F4A A;  4KHR A;  4PG8 A;  4M63 A;  1U1M A;  4JYA J;  5J2N A;  4M5I A;  4JV5 F;  1FKP B;  2KRB A;  2ILZ A;  2K3I A;  2P6S A;  4N47 A;  1RTH A;  4ECQ A;  2F9J A;  4LRC A;  4XK8 C;  4AL6 A;  1RT5 B;  2RRB A;  4PCQ A;  4Q0B A;  3LP2 B;  2C2R A;  3THT A;  2DH7 A;  1BQN A;  3QID A;  1JLF B;  1AT1 B;  2B56 A;  1RYR A;  3BYR A;  2MQM A;  1RT3 B;  1X8D A;  1CC8 A;  4IYQ A;  1IBC B;  1H7W A;  2YNF B;  1KTV A;  2QO3 A;  1FFG B;  4H4M A;  3LP0 B;  3EUN A;  1TKX B;  3MR5 A;  3MCN A;  3BF4 A;  4JI1 F;  4NCG B;  4A8K A;  4TN2 A;  4CLW A;  1QM9 A;  2OEJ A;  1U4B A;  1WEL A;  4IOC Q;  1WOR A;  1FFW B;  1AFI A;  3PW5 A;  2VG5 B;  2XY5 A;  1ARO P;  2JRS A;  4I7F B;  2FHO B;  2HHH J;  1QSL A;  2ZJP Q;  1GQE A;  3HHN B;  2XMT A;  3FC9 A;  1S9E A;  3FBC A;  1HHS A;  3SCJ E;  3DNC A;  4U7U K;  2QFI A;  2MLX A;  5KFL A;  4WP9 A;  2LEC A;  4DV0 J;  4TU8 A;  4AL7 A;  1N33 J;  2UXB F;  1FTC A;  1N5V A;  2AX1 A;  2QRR A;  4DWI A;  3DMJ A;  3GIM A;  2BM0 A;  4DR5 J;  3POT A;  3KLG B;  3NGK A;  4P75 A;  4MT1 A;  1PSD A;  2HGN A;  4RW7 B;  5KFF A;  2LQ8 A;  1N6Q A;  4LF4 J;  3BH7 B;  1Y11 A;  4QW8 A;  4ID5 B;  3C6U B;  3V4I B;  3AOA A;  1WAC A;  3WHI A;  3DDK A;  2ZH6 A;  5AT1 B;  2X1B A;  3N0V A;  1HFE L;  1U48 A;  1NPR A;  2OSR A;  3MM6 A;  2BUN A;  1SUQ B;  3ENV A;  3LW5 C;  5C25 A;  2ZH4 A;  2ACM A;  2EVZ A;  3V6D A;  2CNK B;  5HQM A;  2VOD A;  3H90 A;  3C15 B;  1X9W A;  4PRF A;  2QL9 B;  1ZA2 B;  2EFO A;  5DLF A;  4FP9 A;  2FLO A;  4B3T J;  1EJ7 L;  2OH2 A;  1UW9 A;  4FYY B;  2CZ4 A;  3VWS A;  2UVW A;  1TVR B;  3A13 A;  4DR6 F;  2DT9 A;  3I4H X;  3D67 A;  2OTJ S;  2VFS A;  4C8N A;  1LW0 A;  3QLH B;  2Z56 B;  5E3R A;  5ETQ A;  2FZG B;  3GP9 A;  1REV B;  1ZM2 A;  2LEB A;  2WVF A;  5FDL B;  3J81 j;  2ZKU A;  2BJ7 A;  2FY8 A;  1NJW A;  2QSW A;  1N32 F;  3W2W B;  1S76 D;  2WSC C;  4OJH A;  3OUY A;  3ZTP A;  4DLE A;  5LMN F;  1DFD A;  2B7C B;  5L8R C;  1IBM J;  2BBE A;  5I3U B;  4TVA B;  4KSE B;  1RYS A;  1O0P A;  2B5J B;  2G0I A;  2EWH A;  4ERD A;  2ZC3 A;  1VHF A;  1EB0 A;  2GML A;  1N0U A;  1KQS R;  2UXD J;  1U1K A;  2KYZ A;  1HWI A;  2YNG A;  3CJT A;  3A8E A;  4F3M A;  3PX4 A;  2J6T A;  1HHT P;  1UWB A;  1FWL A;  3PXG a;  3HT0 A;  3ZFV A;  3G6E S;  1YJ9 S;  5DGB A;  1KEK A;  2GVD A;  2J7K A;  4MFB B;  2HND A;  4YR2 A;  1BUX A;  1IBL F;  3KMQ A;  2R3V A;  1UCN A;  2GS8 A;  1VLO A;  2L3M A;  4DL7 A;  4MKY A;  1FKO B;  2Y0S D;  1VIS A;  1VYA A;  2DHG A;  4CNZ A;  4CTA A;  1XN9 A;  4OZ0 A;  3SEO A;  1FRI A;  2BRL A;  4F2R A;  4QIE A;  4ECY A;  1ZA1 B;  2FJD B;  3W63 A;  3QZ7 A;  4RBV A;  1D9A A;  4ED0 A;  3H98 A;  2ZD1 B;  2OJ3 A;  4DI6 A;  1ICE B;  2G0C A;  1BY9 A;  3HVT B;  1C4C A;  2RD5 C;  2H4W B;  2RQC A;  3K58 A;  1UFK A;  1WNE A;  1RT1 A;  1QDU B;  2J0W A;  4YB7 A;  1AYE A;  2XZD B;  3H5X A;  3CIZ A;  1NHV A;  2V94 A;  1UZD A;  1UTA A;  2EXU A;  2PMH A;  2IY5 B;  5I3Q A;  2AEM A;  4V19 J;  1RA7 A;  3RRH A;  2HZA A;  2KM8 C;  2ZEJ A;  2RNE A;  2YTC A;  4NLR A;  4WXW A;  2K2P A;  2XS2 A;  2VG6 B;  2ZH8 A;  1RWU A;  1VBY A;  3H42 A;  4WK1 A;  5J2Q B;  3OLB A;  1C0U B;  3W62 A;  3MPD A;  2Q6C A;  3TRG A;  3R3T A;  3RB0 A;  1RHR B;  2OPR B;  2B9W A;  1QSY A;  5HMX A;  3MFH A;  4ZS6 A;  4QWA A;  2XGQ A;  1VQP S;  5FLX U;  4KV8 B;  3QIP B;  1NPK A;  3B8H A;  5ADZ A;  3OXL A;  4RW6 A;  2WW8 A;  3SI8 A;  1G1X A;  5GAD I;  3TUJ C;  2YQ3 A;  3ZTR A;  1UL3 A;  2N7Y A;  2AZ1 A;  2KU7 A;  2QL7 B;  4UST A;  3ET6 A;  4B3R F;  4USH A;  1Y7P A;  3ULH A;  3UO0 A;  2CNL B;  1X5S A;  3DLL Q;  4JB8 B;  1HWJ A;  3HVR A;  4NXN J;  4K4Y A;  1ZM3 A;  4QWC A;  4IFY A;  3V81 B;  1KP6 A;  4JV0 A;  2GIQ A;  4NI2 B;  1TL3 A;  2RS8 A;  1LFP A;  1YQH A;  4IUF A;  2MLY A;  3NWR A;  2VUG A;  2W2P P;  1T02 A;  2EFQ A;  1IQT A;  2E5H A;  3DKD A;  5J2M B;  4C0B A;  2XO6 A;  4DV2 F;  3R5A A;  2V69 A;  2BJ8 A;  3QGP A;  5A0Y A;  5KFZ A;  2DH9 A;  1CJV B;  3C16 A;  3VGU A;  1MLA A;  3W8G A;  2KVQ E;  1GTH A;  4LR8 A;  2A3J A;  4M8L A;  3CJ4 A;  4NZ7 A;  5KFE A;  1J27 A;  3MF5 A;  3NS6 A;  3D6M B;  3FEY B;  1X4B A;  1KWM A;  4EEY A;  1H74 A;  2EPI A;  3SQG A;  3RJM B;  5B09 A;  4OFZ A;  1IR2 A;  5ETO A;  4H4O B;  2ZKT A;  2PN6 A;  3VHQ A;  1F5B A;  3UD4 P;  2QA4 G;  2AIR B;  5ETV A;  1RAD B;  3MD1 A;  1R0A B;  4NZ0 A;  4QYZ J;  4ED8 A;  2BW7 A;  3CCR S;  1K47 A;  4KH1 B;  3MAH A;  4X4V A;  3QBC A;  2YWF A;  3LAN A;  2XSJ A;  4MMO A;  3BH6 B;  4CH0 S;  5B0F A;  4ES2 A;  4AXJ A;  2AD9 A;  4F4Z A;  4NCA A;  2LA4 A;  5LSO A;  1X4E A;  2MGZ B;  1Q8K A;  1S7H A;  3QAT A;  4RU9 A;  5BYQ A;  1URR A;  2HG4 A;  2HGM A;  3RAQ A;  1FJC A;  3VQS A;  2XTJ P;  2DR9 A;  1QTM A;  1TUV A;  1ZET A;  1CJK B;  3MEG B;  1U47 A;  4BS2 A;  2DRA A;  1UFL A;  3OFF A;  4TY8 B;  2I2Y A;  4WIQ A;  3G6V A;  1SJF A;  4KE5 A;  4ZK7 M;  3M9O B;  4PZV A;  1RIS A;  4OI6 A;  4PWD A;  4NLS A;  1KBR A;  4WP3 A;  4PG5 A;  2HHQ A;  3ZC4 A;  1HR0 J;  1TKZ A;  2GQ2 A;  3KK3 B;  4FF2 A;  2BM1 A;  1OPZ A;  5DZ7 A;  2XEX A;  3SZ2 A;  4DX5 A;  2HVD A;  3KHL A;  4LFA F;  4C0O C;  2JL9 A;  4DL3 A;  3CJ2 A;  5IV4 A;  5DJB A;  1T9Y A;  3GFY A;  1D8Y A;  3PEJ A;  1KHV A;  1F2H A;  3TZW A;  1UA0 A;  2FHJ A;  4M5L A;  1NH7 A;  4RW4 B;  4C11 B;  3LH2 S;  1WEY A;  2VAS A;  1I51 B;  5AE3 A;  3F0N A;  1KSP A;  4B3M J;  1FK9 A;  2PMZ D;  4Z37 A;  1XNQ J;  2W4C A;  3E8O A;  1UZH A;  3RR8 A;  2HNZ B;  5KG0 A;  3J80 Y;  5HAO A;  3FSX A;  4CYU B;  4MKB A;  1FJG F;  4I56 A;  4LF5 F;  4YB1 P;  1FA0 A;  2C42 A;  2OI2 A;  4KIA A;  3HVW A;  1SQE A;  3UR0 A;  1YTY A;  4A4J A;  3TVK A;  3H2V E;  3BPS P;  4RX6 A;  3CJS A;  4B17 A;  5K14 B;  4LFB F;  3W65 A;  2Z30 B;  1I94 F;  3CME S;  4HDG A;  3R5J B;  5KFX A;  1R8H A;  4QBU A;  1NKE A;  5IZH A;  4DR1 J;  3M1V A;  4AQY F;  1IN0 A;  1PAE X;  4CH1 A;  2PFD A;  4OV1 A;  2W2Q P;  3DLK A;  2XYG B;  4QZV B;  2PGC A;  4N76 A;  4HL9 A;  4KO0 B;  4WU3 A;  5IQ6 A;  4I2P A;  1IKY A;  3B78 A;  3EZO A;  5E2Q A;  1WWH A;  3CO9 A;  3DDI A;  3G8T A;  3LF0 A;  3IAM 9;  2AEJ A;  3TEH B;  2A0F B;  4DQI A;  4X62 J;  5E3A A;  1AZS B;  2YWE A;  4CLY A;  3ILO A;  4RWW A;  3PR4 A;  3QO9 A;  1NZA A;  1QAX A;  3MMJ A;  5A8W A;  4USJ C;  3GV7 B;  2QYC A;  2KJW A;  1S6Q A;  2CQ4 A;  3AD7 C;  4DS5 A;  1GMV A;  5E3C A;  2EG1 A;  2Y1I A;  4RBT A;  1MWY A;  2CQD A;  1RUS A;  4HTJ A;  4LF9 F;  2B4P A;  2J7W A;  1BWV A;  2AQ4 A;  4KJI A;  3M8Q A;  3WBZ A;  1IUJ A;  3RBX A;  4LSN A;  2ALZ A;  2HPU A;  4MIB A;  1QTN B;  3DLE A;  3KUE A;  5K8P A;  2EBE A;  4BC9 A;  3OBI A;  3TUP A;  3OR1 B;  4K59 A;  2LQB A;  5IWA J;  1HNZ F;  2HHX A;  2X3D A;  6AT1 B;  2NSB A;  1ZAX A;  5H1S V;  1YJN S;  1X5O A;  2AYB A;  3UW1 A;  1RT4 A;  2D1C A;  1CEZ A;  3ITH B;  1LW2 B;  4N7T A;  4ZPV R;  2BJ9 A;  4X4P A;  4U7C A;  4J9V A;  3GIR A;  4ZLJ A;  4HT5 A;  1SV5 B;  1U0S A;  2CQI A;  1C1B B;  5F9N A;  4GC7 A;  2R4F A;  2BQR A;  4LF8 F;  4F4Y A;  3TP2 A;  1D1U A;  2JLG A;  2RAQ A;  1K1S A;  3LQV A;  2BV3 A;  2PEH A;  2Q1L A;  4A8Q A;  3T5H A;  3N9U C;  1PYT A;  4PKD B; 
#chains in the Genus database with same CATH homology
 2QLF B;  2H5I B;  1RE1 B;  1PYO B;  2QLB B;  3KJN B;  3IBF B;  2C2O B;  2CJX B;  3GJR B;  3KJQ B;  4LSZ B;  3R5J B;  2H48 B;  3P4U B;  3SIP B;  3R7S B;  1RWP B;  1I3O B;  1BMQ B;  1RWX B;  1RHM B;  5IC6 B;  1RWV B;  3P45 B;  2Y1L B;  2DKO B;  1QTN B;  3EDR B;  2XYG B;  1RWK B;  1RHK B;  3R7B B;  3NS7 B;  1IBC B;  2FQQ B;  2CNN B;  1F9E B;  1RWO B;  2CDR B;  3GJS B;  3D6F B;  4ZVR B;  2P2C B;  1RHR B;  1PAU B;  3EDQ B;  2H4Y B;  3GJQ B;  4DCJ B;  4ZVQ B;  3QNW B;  2HBZ B;  3D6H B;  5IC4 B;  2QL5 B;  2XZT B;  4DCP B;  1SC3 B;  1RWM B;  4DCO B;  2C2K B;  1RHJ B;  1I51 B;  2CJY B;  2H65 B;  2H54 B;  3KJF B;  1SC1 B;  1GFW B;  2CNK B;  3D6M B;  3R6L B;  1RWW B;  3R7N B;  1SC4 B;  1ICE B;  3IBC B;  2CNO B;  2H51 B;  2QL9 B;  4ZVP B;  2Y0B B;  1RHQ B;  2QLJ B;  2HBY B;  2XYP B;  3R6G B;  1RHU B;  2QL7 B;  1RWN B;  4ZVO B;  2H4W B;  3RJM B;  2HBR B;  2C1E B;  2HBQ B;  5K20 B;  3GJT B;  1QDU B;  4ZVT B;  2CNL B;  4ZVU B;  2C2Z B;  2C2M B;  2XZD B;  1NME B;  2H5J B;  2XYH B;  4JB8 B;  4ZVS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...