1RE3C

Crystal structure of fragment d of bbetad398a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
288
structure length
288
Chain Sequence
SIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title BbetaGlu397 and BbetaAsp398 but not BbetaAsp432 are required for "B:b" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 82
structure length 288
sequence length 288
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1re3C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1re3C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1re3C03
1FIBA 2OYIB 1FZGB 1N73C 1JY2N 2HLOB 2J61A 3GHGA 1JY3O 1FZEA 1M1JA 1Z3UA 2OYHA 2OYIC 2A45I 1FZEB 3H32A 1JY2O 2OYIA 2OYHC 2FIBA 1M1JC 1JC9A 1FZGA 4EPUA 1RF1A 2A45H 4NYTA 3HUSC 2J64A 1FZDA 2J0HA 2J60A 2XNXC 2H43A 1LT9A 2JHKF 4M7HA 2HLOA 1N86A 2XNXB 1FZFC 1LT9C 2JHIF 2J1GA 4JZCA 1Z3SA 1N86B 1FZEC 2FFDA 1T3UA 2J2PA 1RE3A 1FZAB 2D39A 2OYHB 4ZFGA 2Q9IB 1RF1B 1LWUA 1N86C 2JHMF 2A45G 2HODB 1RF0C 3HUSA 2J3FA 2JHHC 2FFDC 1N73B 1FZBB 2J0GA 1RF0B 2Q9IA 2HODC 3BVHA 2J5ZA 1RE4A 3HUSB 1FZCB 2HPCB 2Q9IC 2HPCA 1FZAC 2JHLF 1RF1C 1JY2P 2HPCC 1W2EA 4R9TA 2HLOC 4JYOX 2Z4EB 3BVHB 1LTJB 1FZFB 1FZCA 3E1IC 1N73A 1FZBA 2J3FD 1RE3B 2H43C 3GHGB 2J61B 2WNPF 1FZBC 3E1IA 3E1IB 4M7FA 2Z4EA 1RE4B 2J0YA 1RF0A 2J3UA 1LWUB 2J3GA 2Z4EC 1FZGC 2GY7A 1LWUC 1LTJA 1FZFA 1RE4C 2HODA 2XNXA 1JY3N 1FZCC 1FICA 1JY3P 2H43B 1RE3C 3H32B 3GHGC 1FIDA 1FZAA 1LT9B 1M1JB 2J3OA 3FIBA 4R9JA 1LTJC 2FFDB 3BVHC 3H32C
chains in the Genus database with same CATH superfamily
4U3FE 2Q6QA 3MUDC 1S3JA 2OYIC 1ZR2A 2IBZE 3BRVB 4W7YA 5AW7B 3USSA 4RO0A 1DEEG 3LW5J 4PJ0E 1G2CB 1Q7YQ 2YNYA 2VRSA 3KQGA 1LWUA 4XE5B 2QJYC 4L74A 2LR2A 2KSJA 4D6TG 3D70A 1DD3A 1YJWP 2RH0A 3EFFK 1XTCC 2KUBA 2J0GA 1DH3A 1DX7A 1T8ZA 3A5TA 1YITP 1YQ4C 4H44B 3CCQP 1NAFA 3I55P 1Y9BA 3TYYA 5B5EE 2FYUJ 2P58A 2WVRA 3OAKA 1FAVA 3BVHB 2W6JH 1FZBA 2ITAA 3RK3B 2PP6A 1KYOH 3MZWB 4DOJA 3I56P 5AW6B 2GY7A 1BGYD 3O6QA 3CMAP 1BSHA 5AVQB 1K04A 2OYOA 2K9JA 2HODA 1R8EA 3RL0g 4WWIA 4EI2A 5AVUB 2XU6A 2WMMA 1X22A 3VOPA 2FYNB 3TGUG 2B87A 1PP9E 3M0DC 1SQXG 3RK3C 1L0LD 2H43A 3AE3C 2D39A 2KZIA 3IR9A 3GW6A 2L91A 3TDKA 1M1KQ 4JPZB 2J3FA 2KB7P 1GW3A 3ZDMA 1S2EA 1YTZI 5APVA 5APUA 1JNMA 5KJ7A 4WB4A 2OQQA 1PFIA 2QJYB 2G8YA 1FBMA 2L5GB 1L0LG 1FDIA 5AW1B 3L72E 3AEBC 3AE2C 5GTIH 1JCDA 3H1KE 3CXHE 4PV1C 3E1IB 1GK6A 3E7KA 2P10A 3WUUA 3R2PA 2WT7A 5E79H 4IL6H 5AW5B 1OW8A 4GDOA 2OARA 3Q5PA 1WMKA 3CCUP 2NPSD 1SQBK 3AEDC 1YHQP 3HTKA 1LTBC 1M1JB 3U1CA 4LC1A 1AA0A 2E76B 2K3RA 3RK2D 4GOFA 2WSEH 1OVVA 3RBXA 2Y0EA 4BRYB 3LW5H 3H25A 1RF1A 2KS1B 1MKMA 4OGQD 2Y0DA 1JM0A 1LT9C 1VQNP 1Z3SA 1HGZA 2FFDA 1S72P 1GU5A 3CXHH 2OYHB 2ZYDA 1L0LE 1FOSF 2GUSA 5KLVD 1JOCA 1MFTA 2NPSC 3H1IJ 1M7LA 2M3BA 2N1TC 4YXDC 1GL2D 1KILB 1LGHB 1SVFA 2N1TB 5AW0B 1JY2P 4H13C 2W6BA 3SSUA 4JYBA 1KILA 3U59A 1AV1A 2H8PD 3WMM0 3ABVC 3V6IA 1BCCJ 2J61B 1PP9G 4M7FA 1KFMA 1L4AB 3P32A 1LWUC 3MGNA 1ZXGA 1FZFA 4A7PA 1JY3N 2Q1KA 1FZCC 1VL2A 3GHGC 5KLVG 1VQOP 3V5BA 1LT9B 4L76A 5EFWB 2J3OA 1RH5B 1OVRA 2KS1A 5AVRB 5C39A 2ZT9B 2R5BA 3L71G 1M1JA 3H1JD 1RQVA 1U7JA 1PPJG 2XZRA 1HTLC 3G6EP 2J60A 2WSCJ 3L72D 1NJIQ 1JO5A 1EDLA 1IFDA 1IO4A 1EZVG 1N86B 1Q90D 3BCCE 4H13D 1PGPA 2HODB 2IBZI 2E74D 1FDMA 4PD4I 2K9YA 3FX0A 3A0BH 3I5CA 4HB1A 1OXZA 1KB9I 1GL2B 1KILD 1W2EA 2P7JA 4PD4D 1BE3J 2DW3A 3U1AA 3CCSP 1VF5D 5KLVJ 1NTZD 3CX5I 5CBNA 5KLVE 2IPPA 3L72G 1OW6A 3RGUA 1EDKA 1BDCA 1KB9D 2D2CB 2FXMA 2HR3A 4AUWA 1J1DC 1VF5C 3CCJP 3C8VA 3OW2O 1FZGC 4LLHA 1NO4A 2I1JA 3RK2C 2C0WA 1L0LK 1JY3P 1U7MA 3JCUH 3B71A 5AVXB 3H1HD 2OTLP 1RY3A 2AEJA 3B5NB 1S5LH 3TSIA 1SQXD 4WVZA 1NKNA 1SQPK 1NTKD 3OJAB 1YBKA 2K9JB 3JC22 3BASA 3CI9A 1X79B 2MKVA 2A06G 3FXEA 3HD7C 1N86A 3KHUA 4I2LC 2FYUE 3D6YA 1WT6A 1FZAB 1NTKK 1R5LA 3OA7A 1NTMJ 1NKZB 2R32A 1WRGA 3H1HG 3L73J 3HRNA 3HE4B 2CPBA 3RL0B 2P2UA 1NU1E 2KP8A 3CCLP 4WY4D 1BGYJ 1CI6B 4WY4B 4AQRD 1LTIC 1KB9E 5CMZA 2M5AA 4N3YB 3CL3D 3H1LG 3HE5A 2FY8A 3H1ID 1Z56A 4W80A 5GTIE 1NU1K 2BCCE 4RKUJ 1LWUB 2Z4EC 1DEBA 1CZQA 2QM8A 3L74E 1L0LJ 2Z5HA 1ZN5A 3BVHC 2YKQA 2E5YA 1SQVK 2R44A 1BSNA 2OYIB 4DT0A 1EQ7A 5AVYB 1VF5B 2RN0A 2JJLA 1JY2O 1PGQA 1CI6A 4K35A 1TU3F 2Y9ZA 2GA1A 1ZR4A 2KI7B 2YXRB 2J0HA 4OGQC 1DD4A 4ASVA 2V7QJ 3SWFA 2XNXB 1FOSE 1URQA 1BCCE 4H44D 2BEQD 1S9KD 3D6ZA 1SQVD 1NTKJ 1YYCA 1L4AD 3QWOC 1NVOA 5TISE 2FFDC 2HODC 2B89A 1Q81Q 5AVSB 3CWBJ 3PRJA 2ZAEB 2M0BA 1SQQJ 2RMZA 3T97B 3S9OA 4OWFA 2ZXEB 2IYPA 1N73A 2W27A 2J58A 3WUTA 3E1IA 3VP8A 2CPSA 2JR8A 3EFGA 2KLUA 3V2NA 1HJ0A 1GZLA 1PV3A 4U7JA 1KD1Q 5APXA 3S1KA 2W83C 1RE4C 5APTA 3L70J 1SQPD 3P7KA 1QEXA 1HGVA 1FICA 1OW7A 2V7QH 2XDJA 2LXCB 3L74J 2OTJP 1OZHA 3GG2A 4W7ZA 1JTHB 2WSFH 1Y47A 1FE6A 3TNUA 1JY2N 3VYIA 2HLOB 3LIDA 1E79H 4Y99C 1FJKA 3M0DA 3TF5A 2ZFCA 1NU1D 1K73Q 1NHLA 1HVVA 3HUSC 1URQD 1L0NG 1LT9A 2JHKF 3IFMA 2E5TA 1PIXA 3A3YB 1SQBE 4JZCA 1BE3D 1LTSC 4PD4E 2JO1A 2JHMF 2NRGA 3W68A 2WZ7A 2MJZA 2NPSA 3SWYA 2Q9IA 1RE4A 3AE7C 3SFEC 3T97A 3A7OA 3VN0A 1KC8Q 3L75J 1NU1G 1NTZK 3HD7A 2WTYA 1T3JA 5CCGD 3O6QB 2WPRA 5AW3B 2POHA 2W8ZA 3W67A 1NOHA 2JP3A 2AEFA 3FGAD 1EZVE 4IFMA 2XKMA 2QE7H 2J3GA 3M91A 1LTGC 3VTPC 2K88A 1CSBA 2R5DA 2D2CC 1VQ9P 1IK7A 1Q86Q 1EXJA 1FIDA 4I7ZB 5AVVB 4R9JA 1L4AA 1FIBA 1HJBA 3BATA 1KQGB 4BRYA 1NTKG 2IZ0A 2J61A 2WT7B 3G71P 2WSCH 2A45I 5AW8B 2IZ1A 4H44C 2A06D 2OYIA 2J59M 1KZUB 2IYOA 3NFQA 3HD7B 4NYTA 1G1JA 2XNXC 1KQSO 1NYHA 3V2RA 1SFCD 2KIKA 2Y0CA 4OH8B 4C7NA 1EXIA 2YXQB 2Q9IB 3K5BA 1L0NK 4Y28J 3G3ZA 3G9RA 4L75A 2YIUC 2Y9YA 5CJ0A 2SPZA 3L70E 1J1EC 3KXDA 1JCCA 1LTAC 1J1EB 4HJGH 4UB8H 2HPCA 3AECC 4YTPC 1SFCA 3IF4A 3N7NA 1NTMG 1X8YA 2ZT9C 1ZRTD 3CCMP 1GTWA 4JYOX 2Z4EB 4HH2A 4EIJA 1USEA 3R4YA 4IFFA 1D7MA 1M8OB 1S5LE 2H43C 1W5CE 1FZBC 1M57D 1JUNA 3PTZA 1M56D 1SQXJ 3FWLA 1PP9D 3CPWO 2UWJE 4K3AA 3CC7P 1N7LA 1LNQA 2ZYGA 3H1LE 1J2JB 4KT0J 4ZNCA 1P84E 3HE4A 3H32B 1NGMB 2CK3H 3M9HA 2JKVA 4AYCA 5APYA 1QL2A 1YI2P 4QMAA 1FZEA 1LJ2A 1NTMD 3H1JJ 1SQBD 1SQVE 1Q82Q 2O3JA 1SQPJ 1SFCC 1X9VA 3HD7D 3L37A 3SWKA 3KZIE 2FYUD 1CW5A 1N7SD 5CJ4A 2XNDH 3M9BA 1BGYE 2J2PA 3PP5A 2KNCA 1EZVD 2FBWC 2WPQA 3TK1A 1K9MQ 1ZOYC 2ZXXA 5CHXA 3CXHD 1FZBB 2QJKB 3GF7A 4PD4H 3CX5D 1PGJA 5CCHD 2I8DA 1FZCB 4GOEA 2Q7CA 5KKZB 4LGDE 1T2KD 1UIXA 2WPVB 2WWWA 2Q3IA 1T6AA 3Q1MA 1L4AC 1OIPA 1KB9H 2WSFJ 3KPEA 3CC2P 1VQPP 3CXHI 1KMIZ 3SFDC 1FZFB 2ZVOB 4U3FG 1J1DB 3UIAA 4IOIH 2WNPF 1NTZG 2O1JA 3O8ZA 1GMJA 1OX3A 1NU1J 3B5ND 1SQXK 2Z4EA 1UIIA 1RF0A 1GL2A 1QVFO 3H1KD 5CBOA 5K5GB 2YMYA 4H0LB 1JMBA 1FU1A 3L75G 1QGKB 4L73A 3HE5B 2PRRA 3L4FA 1KILE 1FDOA 4I7ZC 3BCCD 3CCRP 1JC9A 4U3FD 2HFED 4GT1A 4C7RA 5H2FH 1KQFB 1URQC 3M06A 2JHIF 3A0BE 3AE5C 2IX7C 3RL0D 1K8AQ 3C9IA 3WUVA 2P67A 4ZKUA 1RF1B 5CCGA 3H1KG 3GMAA 2JHHC 1H8AA 1Q2NA 4TT3H 1HWTC 2J5ZA 3L74D 3HUSB 4BXLA 1DIPA 2QEXP 2Q9IC 3L73E 4R4LA 1G2CA 2QG4A 2JDIH 1MV8A 1P84I 2N1TA 1KORA 3MP7B 4ZKPA 1EDIA 3QH9A 2O01H 5KLIC 1NTME 4RESB 3Q2YA 2YKOA 4DCKA 2KLVA 4IL6X 4UB8E 1JMMA 2J3FD 1VDFA 1RE3B 2YMKA 2IFNA 4C7NB 4NPEA 1RE4B 5KTBA 3H1LD 3CCVP 2N1TD 2BCCG 3M9QA 5L8RJ 5KJ7D 4GODA 1AJYA 2Q3EA 2PFXA 1FZFC 1LTTC 1VQ8P 1N73C 2FKWB 1VQ6P 1ZW0A 1FS0E 4JF7A 1MZ9A 2OYHA 2BEZF 1GW4A 1JTHA 1L0NJ 1YJ9P 1SQQG 1SLQA 4EPUA 3AE8C 1BDDA 1FZDA 2QJPB 4JQ0D 1A02F 3VMZA 5CCGC 4DZOA 2WITA 2RKLA 4XFJA 1IFMA 5TISH 2Z5IA 2IDBA 2BCCD 1QVGO 1SQVG 1RF0C 2B87B 1N73B 5B66H 3TGUJ 4H0LD 3HTKB 1LP1B 3KYQA 4H13B 3CWBD 1XTGB 4WBAA 2HPCC 2NPSB 1SQQD 3H1JG 4PV1D 1KTMA 1BCCG 2K37A 3WU2E 3E1IC 2E76D 4IFDK 3AEFC 1N7SB 5KAFH 2JEEA 2AEMA 2E75B 5KAIH 2B88A 2B9BA 2E75D 2XNXA 4IL6E 1H0TB 3RK3E 4DJGA 2H43B 2E42A 4M3LA 1AQTA 2AXTE 1LTJC 3H1LJ 4OGQB 2E75C 5BU5A 2WQYC 2KXPB 4EDFA 1JY3O 4I1LA 2KK7A 4EOTA 3AEAC 2IBZG 1ZP0C 1BCCD 3RL0C 2H89C 3S4RA 2FIBA 1RQUA 2ZYAA 1NWQA 2P1JA 3FXDA 2YIUB 3AE1C 2C9LY 1HH0A 1L0ND 1RE3A 1IFIA 1YJNP 2HYNA 2PAJA 1SS1A 2W6AA 1GDTA 1AQ5A 1RF0B 4HYTB 1M90Q 3BVHA 4WY4A 3L71D 3TGUE 4PJ0H 1PPJE 4ZMDA 2JHLF 1EZVI 2M5AB 2IBZD 3H1KJ 3P8MC 3MIWA 4R9TA 2BASA 3L72J 1KYOI 1EDJA 3PLNA 4ASWA 1BGYG 4YPCA 5AVWB 3RK2B 1N8RQ 2JWAA 2HG5D 3VMAA 3CLQA 1KQLA 1KILC 1LTJA 1H89A 1KYOD 4RJTA 1H88A 5CCHC 1RE3C 3IAOA 1QX8A 1FZAA 1KN7A 3V4WA 3L70D 4Z1MH 2E74C 4N6JA 2Q5UA 3F5HA 3BCCG 1YIJP 4PV1B 1NTMK 4BWNA 1FZGA 2N9BA 1N7SC 2A45H 1GU4A 4D6TJ 2E74B 1IZNB 3B5NA 4D6TE 2J1GA 3AEGC 3AEEC 1IFPA 1E5WA 4EYYQ 4ZFGA 3L75E 1L2PA 2FXPA 5APWA 4B86A 2QA4P 1AFOA 1OVUA 3L74G 3Q5SA 4NPFX 3CX5E 5KLVK 3CMEP 3L70G 3PH0A 5AW2B 5APSA 1G1IA 1FZAC 1QL1A 2HLOC 1H0TA 3EQ2A 3BCCJ 5B5EH 1VQ5P 1FZCA 3L71J 3PJSK 2WPSA 1LT1A 2QJPC 3GHGB 3NTNA 1SQPE 3MD0A 1NAYA 1P84D 2FYNC 1USDA 1N7SA 2ZT9D 1S1CX 2J3UA 1BE3E 1N2DC 2C0XA 1PP9J 2KNCB 5M1BA 4XA4A 3F89A 4U3FJ 1GD2E 1IFNA 3P8CD 1OFCX 1KFNA 2QIWA 1FZGB 2R3SA 2QSIA 3GHGA 1OMIA 1IK9A 1FZEB 3H32A 2OYHC 2O01N 4KHXA 1U57A 3H1IG 1ZMEC 2KYVA 1HUCA 2YO2A 1VQLP 2ZJSE 3JCUE 1SQQE 1VQ4P 5KAFE 4TLFA 2M8RA 5H2FE 2QJKC 1IC2A 2V4HA 5APQA 1SQPG 3CWBG 2QM7A 3CD6P 2HPCB 3LIEA 1OWAA 1SQXE 2KSEA 1RF1C 1HF9A 2M3EA 1VPCA 1NTZJ 3Q3DA 2N9YB 5DJUB 4C46A 5TJHA 3FWNA 1VQ7P 3V2QA 2LKMA 2QRXA 5KAIE 3JSVC 1AVOA 1JB0J 2QVAA 1ZRTE 4GIFA 3MHVA 5KLIB 1R5SA 1L0NE 1A02J 2OGUA 3H1JE 2FXOA 3AE4C 3H1HJ 3L73G 1VQMP 3H1IE 2O01J 5GTHH 1AVYA 1NH4A 2FFDB 1SP4A 3MTUE 3NXSA 1K05A 4KJMA 1PPJD 1Y8AA 2BCCJ 2R3CA 1MFZA 2OTKE 3GF3A 4CPGA 1Z3UA 1IJDB 3L36A 3L75D 1S9KE 4OVNF 1M1JC 3M0AA 1X0TA 1VQKP 3L71E 2E76C 3TGUD 1S4XA 3KDPB 1KV4A 2HLOA 3Q5RA 2WSEJ 3TNUB 2A06E 1FZEC 5AW9B 2GUVA 4UB6H 1GL2C 3L73D 2NZ2A 4H0LC 1PGOA 3II6A 3VP9A 1YTZT 2O1KA 3D71A 3BRTB 3AE9C 3L35A 3N4XA 3IN6A 5AVZB 3CX5H 3B5NC 1P84H 2I1KA 3G4SP 4JYCA 1LP1A 3V2PA 3E1RA 2JWDA 2ZVNB 1FJPA 1FC2C 1BE3G 1PZQA 3B8EB 3A2AA 4O9BA 3WU2H 1HBWA 1ZLLA 1T2KC 3CC4P 2YO3A 5BU8B 3H6PA 2E43A 4UB6E 2IFMA 3A0HE 4GKGA 5CCHA 1W2BO 1KYOE 3FIBA 1S5LX 3C1LA 5KJ7C 3H32C 2D2CD 1URQB 2J5UA 3AE6C 3RBZA 1MUUA 2G3AA 2GM4A 1ZV8A 5B66E 4YXWH 4NPDA 5AW4B 1JEKA 2J64A 2WSSH 1SQVJ 4M7HA 4HKZH 1PL5A 2AXCA 1EC5A 1T3UA 2AXTH 1RHZB 5DJTB 5GTHE 3B4SA 3GLMA 1N86C 3CWBE 2A45G 2W90A 5E79E 3HUSA 2FYZA 4JBZA 3PHLA 3H1HE 3VMYA 1IFJA 2K1AA 3V4QA 2PGDA 2KZJA 2H7HA 1NTKE 3CCEP 5AVTB 2H88C 2FYUK 2KOGA 1SQBG 1LTJB 3P8CE 1QLED 5KKZC 1SQBJ 3MUDA 5BVZA 1YQ3C 2FYUG 1NTZE 3RK3D 3VMXA 4MN4C 2C9NY 4Y99B 2J0YA 1SQQK 2XV5A 1GK4A 4R4MA 4WY4C 3A0HH 3KZIH 4I6MC 3ITKA 2LXBA 4N78E 4D6TD 3NMDA 1SFCB 2YKPA 3EWKA 4N78D
chains in the Genus database with same CATH topology
4AYCA 5APYA 1RY3A 4N6JA 2Q5UA 3B5NB 1QL2A 3TSIA 1FZEA 2OYIC 1NKNA 1ZR2A 1SQPK 1NTMK 3BRVB 3OJAB 1FZGA 1SFCC 3BASA 1X9VA 3CI9A 2N9BA 1X79B 1N7SC 2A45H 3HD7D 3L37A 4W7YA 1GU4A 5AW7B 1CW5A 1N7SD 3B5NA 3HD7C 1N86A 4I2LC 5CJ4A 1G2CB 2J1GA 3M9BA 1WT6A 2YNYA 2J2PA 3PP5A 1NTKK 2VRSA 3KQGA 1E5WA 1FZAB 3OA7A 4ZFGA 1NKZB 1LWUA 2R32A 4XE5B 5APWA 2WPQA 3TK1A 4B86A 1WRGA 1AFOA 2KSJA 5KLVK 5CHXA 1XTCC 1FZBB 2J0GA 1DH3A 3HRNA 5AW2B 1DX7A 5APSA 5CCHD 1FZCB 1G1IA 2Q7CA 1T8ZA 3HE4B 2CPBA 3A5TA 4LGDE 1T2KD 1FZAC 3RL0B 2P2UA 1QL1A 1NAFA 2KP8A 2WWWA 2Q3IA 4WY4D 1L4AC 3TYYA 3KPEA 1CI6B 2HLOC 4WY4B 3OAKA 4AQRD 3EQ2A 1FAVA 1LTIC 3BVHB 1FZFB 1FZCA 5CMZA 2WPSA 1J1DB 3UIAA 1FZBA 4N3YB 3CL3D 3GHGB 3NTNA 3HE5A 3MD0A 2WNPF 1Z56A 3O8ZA 2O1JA 2PP6A 3RK3B 1N7SA 3B5ND 1SQXK 4W80A 4DOJA 2Z4EA 5AW6B 1NU1K 1RF0A 2J3UA 1LWUB 2Z4EC 1N2DC 2C0XA 2GY7A 1DEBA 5AVQB 4XA4A 1GL2A 2HODA 1CZQA 1GD2E 2QM8A 2Z5HA 1ZN5A 5AVUB 1IFNA 2XU6A 3BVHC 3P8CD 2YKQA 2OYIB 1SQVK 1KFNA 2YMYA 1FZGB 1EQ7A 1FU1A 3HE5B 3GHGA 3VOPA 5AVYB 1IK9A 3L4FA 2JJLA 1FZEB 3H32A 1JY2O 2OYHC 3M0DC 1JC9A 2HFED 4GT1A 3RK3C 1CI6A 4C7RA 4KHXA 1ZR4A 2J0HA 1URQC 2H43A 2KYVA 1HUCA 3M06A 3SWFA 2XNXB 2YO2A 1FOSE 2JHIF 1URQA 2IX7C 3RL0D 1S9KD 1YYCA 1L4AD 3C9IA 2D39A 2P67A 3IR9A 4ZKUA 2M8RA 1RF1B 5CCGA 1IC2A 2J3FA 2JHHC 1H8AA 2FFDC 2KB7P 5APQA 1GW3A 2QM7A 1YTZI 2HODC 5APVA 1HWTC 5APUA 1JNMA 2J5ZA 3HUSB 5KJ7A 4WB4A 5AVSB 2HPCB 2Q9IC 3LIEA 1OWAA 1G2CA 1PFIA 1MV8A 1RF1C 2N1TA 1FBMA 1VPCA 4ZKPA 2L5GB 2O01H 4RESB 2YKOA 5AW1B 4C46A 2ZXEB 2KLVA 1N73A 2W27A 3V2QA 2LKMA 2J58A 1JMMA 2J3FD 1VDFA 1RE3B 2IFNA 1JCDA 3E1IA 3VP8A 3E1IB 4C7NB 1GK6A 2CPSA 3EFGA 1RE4B 3V2NA 5KTBA 1GZLA 3R2PA 4GIFA 5AW5B 2WT7A 5APXA 1A02J 2OARA 2N1TD 1RE4C 5APTA 2NPSD 3M9QA 1FICA 1SQBK 3P7KA 1HGVA 5KJ7D 2XDJA 3HTKA 1LTBC 1M1JB 3U1CA 4LC1A 1FZFC 1NH4A 1LTTC 3MTUE 1SP4A 4W7ZA 2FFDB 1JTHB 2WSFH 3NXSA 3TNUA 1N73C 3RK2D 2FKWB 1JY2N 3VYIA 2HLOB 2WSEH 3LIDA 4Y99C 1FJKA 4JF7A 2R3CA 1MFZA 3M0DA 1Z3UA 1MZ9A 2OYHA 2ZFCA 1IJDB 3L36A 1GW4A 1JTHA 3LW5H 1S9KE 1M1JC 1SLQA 1NHLA 4EPUA 1HVVA 1RF1A 3M0AA 3HUSC 1A02F 1FZDA 1URQD 3KDPB 1LT9A 3VMZA 2JHKF 2HLOA 5CCGC 4DZOA 3IFMA 3TNUB 1LT9C 3A3YB 2WITA 4JZCA 1Z3SA 1LTSC 1HGZA 2FFDA 1FZEC 5AW9B 1GU5A 1IFMA 2OYHB 2Z5IA 2GUVA 1GL2C 2JHMF 1RF0C 1FOSF 2GUSA 2WZ7A 1N73B 2MJZA 2NPSA 3SWYA 3II6A 2Q9IA 3VP9A 1JOCA 1RE4A 3HTKB 1YTZT 3T97A 2NPSC 3KYQA 1M7LA 2O1KA 3A7OA 2M3BA 3VN0A 1XTGB 2N1TC 3BRTB 1GL2D 1KILB 1LGHB 1SVFA 3L35A 2N1TB 4WBAA 5AW0B 1JY2P 3N4XA 2HPCC 2NPSB 5AVZB 2W6BA 1NTZK 4JYBA 3B5NC 3HD7A 1KILA 3U59A 2I1KA 2H8PD 2WTYA 1T3JA 3WMM0 5CCGD 4JYCA 3V2PA 2WPRA 5AW3B 3E1IC 4IFDK 2POHA 1FJPA 1N7SB 2J61B 1NOHA 4M7FA 3B8EB 2JEEA 1KFMA 3A2AA 4IFMA 1L4AB 3P32A 2XKMA 4O9BA 2J3GA 3M91A 1LWUC 1LTGC 3MGNA 1FZFA 3VTPC 1HBWA 1ZLLA 1T2KC 2YO3A 5BU8B 1CSBA 2XNXA 3H6PA 1JY3N 2R5DA 1FZCC 2E43A 2H43B 2E42A 3GHGC 2IFMA 4GKGA 4M3LA 5CCHA 1FIDA 3V5BA 1LT9B 5AVVB 2J3OA 3FIBA 5KJ7C 4R9JA 1LTJC 1L4AA 3H32C 1FIBA 1HJBA 1URQB 5AVRB 3BATA 5BU5A 2R5BA 1MUUA 2J61A 2WT7B 1JY3O 4I1LA 2GM4A 1M1JA 1ZV8A 2WSCH 2A45I 5AW8B 4EOTA 3RL0C 2OYIA 2FIBA 2J59M 1KZUB 3NFQA 3HD7B 2XZRA 5AW4B 4NYTA 1G1JA 2J64A 1HTLC 2J60A 2XNXC 3V2RA 1NWQA 4M7HA 2P1JA 1SFCD 1JO5A 1IFDA 1IO4A 4OH8B 4C7NA 1N86B 2C9LY 1HH0A 1T3UA 1RE3A 2Q9IB 1IFIA 1L0NK 3G3ZA 1N86C 2HYNA 2PAJA 2A45G 2HODB 5CJ0A 1FDMA 3HUSA 2FYZA 1J1EC 2W6AA 3VMYA 1JCCA 1LTAC 1GDTA 1AQ5A 4HYTB 1RF0B 1IFJA 1J1EB 3I5CA 3BVHA 4WY4A 3V4QA 1OXZA 2HPCA 2JHLF 1GL2B 1KILD 2H7HA 1SFCA 3P8MC 1W2EA 2P7JA 3MIWA 3N7NA 4R9TA 5AVTB 3U1AA 1X8YA 2BASA 1GTWA 2FYUK 4JYOX 2Z4EB 2KOGA 4HH2A 1LTJB 4EIJA 3P8CE 4IFFA 2IPPA 3MUDA 5BVZA 2H43C 2FXMA 3RK3D 3VMXA 1FZBC 4AUWA 1J1DC 2C9NY 4Y99B 5AVWB 1JUNA 3RK2B 2J0YA 1SQQK 2HG5D 3CLQA 2XV5A 1GK4A 4WY4C 1FZGC 4LLHA 1KQLA 1KILC 1LTJA 4I6MC 1NO4A 1N7LA 2I1JA 3RK2C 2C0WA 1H89A 1J2JB 1L0LK 1JY3P 1H88A 5CCHC 1RE3C 4N78E 3HE4A 3H32B 3NMDA 1SFCB 1FZAA 2YKPA 3M9HA 5AVXB 4N78D 3V4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIB A;  2OYI B;  1FZG B;  1N73 C;  1JY2 N;  2HLO B;  2J61 A;  3GHG A;  1JY3 O;  1FZE A;  1M1J A;  1Z3U A;  2OYH A;  2OYI C;  2A45 I;  1FZE B;  3H32 A;  1JY2 O;  2OYI A;  2OYH C;  2FIB A;  1M1J C;  1JC9 A;  1FZG A;  4EPU A;  1RF1 A;  2A45 H;  4NYT A;  3HUS C;  2J64 A;  1FZD A;  2J0H A;  2J60 A;  2XNX C;  2H43 A;  1LT9 A;  2JHK F;  4M7H A;  2HLO A;  1N86 A;  2XNX B;  1FZF C;  1LT9 C;  2JHI F;  2J1G A;  4JZC A;  1Z3S A;  1N86 B;  1FZE C;  2FFD A;  1T3U A;  2J2P A;  1RE3 A;  1FZA B;  2D39 A;  2OYH B;  4ZFG A;  2Q9I B;  1RF1 B;  1LWU A;  1N86 C;  2JHM F;  2A45 G;  2HOD B;  1RF0 C;  3HUS A;  2J3F A;  2JHH C;  2FFD C;  1N73 B;  1FZB B;  2J0G A;  1RF0 B;  2Q9I A;  2HOD C;  3BVH A;  2J5Z A;  1RE4 A;  3HUS B;  1FZC B;  2HPC B;  2Q9I C;  2HPC A;  1FZA C;  2JHL F;  1RF1 C;  1JY2 P;  2HPC C;  1W2E A;  4R9T A;  2HLO C;  4JYO X;  2Z4E B;  3BVH B;  1LTJ B;  1FZF B;  1FZC A;  3E1I C;  1N73 A;  1FZB A;  2J3F D;  1RE3 B;  2H43 C;  3GHG B;  2J61 B;  2WNP F;  1FZB C;  3E1I A;  3E1I B;  4M7F A;  2Z4E A;  1RE4 B;  2J0Y A;  1RF0 A;  2J3U A;  1LWU B;  2J3G A;  2Z4E C;  1FZG C;  2GY7 A;  1LWU C;  1LTJ A;  1FZF A;  1RE4 C;  2HOD A;  2XNX A;  1JY3 N;  1FZC C;  1FIC A;  1JY3 P;  2H43 B;  1RE3 C;  3H32 B;  3GHG C;  1FID A;  1FZA A;  1LT9 B;  1M1J B;  2J3O A;  3FIB A;  4R9J A;  1LTJ C;  2FFD B;  3BVH C;  3H32 C; 
#chains in the Genus database with same CATH topology
 4U3F E;  2Q6Q A;  3MUD C;  1S3J A;  2OYI C;  1ZR2 A;  2IBZ E;  3BRV B;  4W7Y A;  5AW7 B;  3USS A;  4RO0 A;  1DEE G;  3LW5 J;  4PJ0 E;  1G2C B;  1Q7Y Q;  2YNY A;  2VRS A;  3KQG A;  1LWU A;  4XE5 B;  2QJY C;  4L74 A;  2LR2 A;  2KSJ A;  4D6T G;  3D70 A;  1DD3 A;  1YJW P;  2RH0 A;  3EFF K;  1XTC C;  2KUB A;  2J0G A;  1DH3 A;  1DX7 A;  1T8Z A;  3A5T A;  1YIT P;  1YQ4 C;  4H44 B;  3CCQ P;  1NAF A;  3I55 P;  1Y9B A;  3TYY A;  5B5E E;  2FYU J;  2P58 A;  2WVR A;  3OAK A;  1FAV A;  3BVH B;  2W6J H;  1FZB A;  2ITA A;  3RK3 B;  2PP6 A;  1KYO H;  3MZW B;  4DOJ A;  3I56 P;  5AW6 B;  2GY7 A;  1BGY D;  3O6Q A;  3CMA P;  1BSH A;  5AVQ B;  1K04 A;  2OYO A;  2K9J A;  2HOD A;  1R8E A;  3RL0 g;  4WWI A;  4EI2 A;  5AVU B;  2XU6 A;  2WMM A;  1X22 A;  3VOP A;  2FYN B;  3TGU G;  2B87 A;  1PP9 E;  3M0D C;  1SQX G;  3RK3 C;  1L0L D;  2H43 A;  3AE3 C;  2D39 A;  2KZI A;  3IR9 A;  3GW6 A;  2L91 A;  3TDK A;  1M1K Q;  4JPZ B;  2J3F A;  2KB7 P;  1GW3 A;  3ZDM A;  1S2E A;  1YTZ I;  5APV A;  5APU A;  1JNM A;  5KJ7 A;  4WB4 A;  2OQQ A;  1PFI A;  2QJY B;  2G8Y A;  1FBM A;  2L5G B;  1L0L G;  1FDI A;  5AW1 B;  3L72 E;  3AEB C;  3AE2 C;  5GTI H;  1JCD A;  3H1K E;  3CXH E;  4PV1 C;  3E1I B;  1GK6 A;  3E7K A;  2P10 A;  3WUU A;  3R2P A;  2WT7 A;  5E79 H;  4IL6 H;  5AW5 B;  1OW8 A;  4GDO A;  2OAR A;  3Q5P A;  1WMK A;  3CCU P;  2NPS D;  1SQB K;  3AED C;  1YHQ P;  3HTK A;  1LTB C;  1M1J B;  3U1C A;  4LC1 A;  1AA0 A;  2E76 B;  2K3R A;  3RK2 D;  4GOF A;  2WSE H;  1OVV A;  3RBX A;  2Y0E A;  4BRY B;  3LW5 H;  3H25 A;  1RF1 A;  2KS1 B;  1MKM A;  4OGQ D;  2Y0D A;  1JM0 A;  1LT9 C;  1VQN P;  1Z3S A;  1HGZ A;  2FFD A;  1S72 P;  1GU5 A;  3CXH H;  2OYH B;  2ZYD A;  1L0L E;  1FOS F;  2GUS A;  5KLV D;  1JOC A;  1MFT A;  2NPS C;  3H1I J;  1M7L A;  2M3B A;  2N1T C;  4YXD C;  1GL2 D;  1KIL B;  1LGH B;  1SVF A;  2N1T B;  5AW0 B;  1JY2 P;  4H13 C;  2W6B A;  3SSU A;  4JYB A;  1KIL A;  3U59 A;  1AV1 A;  2H8P D;  3WMM 0;  3ABV C;  3V6I A;  1BCC J;  2J61 B;  1PP9 G;  4M7F A;  1KFM A;  1L4A B;  3P32 A;  1LWU C;  3MGN A;  1ZXG A;  1FZF A;  4A7P A;  1JY3 N;  2Q1K A;  1FZC C;  1VL2 A;  3GHG C;  5KLV G;  1VQO P;  3V5B A;  1LT9 B;  4L76 A;  5EFW B;  2J3O A;  1RH5 B;  1OVR A;  2KS1 A;  5AVR B;  5C39 A;  2ZT9 B;  2R5B A;  3L71 G;  1M1J A;  3H1J D;  1RQV A;  1U7J A;  1PPJ G;  2XZR A;  1HTL C;  3G6E P;  2J60 A;  2WSC J;  3L72 D;  1NJI Q;  1JO5 A;  1EDL A;  1IFD A;  1IO4 A;  1EZV G;  1N86 B;  1Q90 D;  3BCC E;  4H13 D;  1PGP A;  2HOD B;  2IBZ I;  2E74 D;  1FDM A;  4PD4 I;  2K9Y A;  3FX0 A;  3A0B H;  3I5C A;  4HB1 A;  1OXZ A;  1KB9 I;  1GL2 B;  1KIL D;  1W2E A;  2P7J A;  4PD4 D;  1BE3 J;  2DW3 A;  3U1A A;  3CCS P;  1VF5 D;  5KLV J;  1NTZ D;  3CX5 I;  5CBN A;  5KLV E;  2IPP A;  3L72 G;  1OW6 A;  3RGU A;  1EDK A;  1BDC A;  1KB9 D;  2D2C B;  2FXM A;  2HR3 A;  4AUW A;  1J1D C;  1VF5 C;  3CCJ P;  3C8V A;  3OW2 O;  1FZG C;  4LLH A;  1NO4 A;  2I1J A;  3RK2 C;  2C0W A;  1L0L K;  1JY3 P;  1U7M A;  3JCU H;  3B71 A;  5AVX B;  3H1H D;  2OTL P;  1RY3 A;  2AEJ A;  3B5N B;  1S5L H;  3TSI A;  1SQX D;  4WVZ A;  1NKN A;  1SQP K;  1NTK D;  3OJA B;  1YBK A;  2K9J B;  3JC2 2;  3BAS A;  3CI9 A;  1X79 B;  2MKV A;  2A06 G;  3FXE A;  3HD7 C;  1N86 A;  3KHU A;  4I2L C;  2FYU E;  3D6Y A;  1WT6 A;  1FZA B;  1NTK K;  1R5L A;  3OA7 A;  1NTM J;  1NKZ B;  2R32 A;  1WRG A;  3H1H G;  3L73 J;  3HRN A;  3HE4 B;  2CPB A;  3RL0 B;  2P2U A;  1NU1 E;  2KP8 A;  3CCL P;  4WY4 D;  1BGY J;  1CI6 B;  4WY4 B;  4AQR D;  1LTI C;  1KB9 E;  5CMZ A;  2M5A A;  4N3Y B;  3CL3 D;  3H1L G;  3HE5 A;  2FY8 A;  3H1I D;  1Z56 A;  4W80 A;  5GTI E;  1NU1 K;  2BCC E;  4RKU J;  1LWU B;  2Z4E C;  1DEB A;  1CZQ A;  2QM8 A;  3L74 E;  1L0L J;  2Z5H A;  1ZN5 A;  3BVH C;  2YKQ A;  2E5Y A;  1SQV K;  2R44 A;  1BSN A;  2OYI B;  4DT0 A;  1EQ7 A;  5AVY B;  1VF5 B;  2RN0 A;  2JJL A;  1JY2 O;  1PGQ A;  1CI6 A;  4K35 A;  1TU3 F;  2Y9Z A;  2GA1 A;  1ZR4 A;  2KI7 B;  2YXR B;  2J0H A;  4OGQ C;  1DD4 A;  4ASV A;  2V7Q J;  3SWF A;  2XNX B;  1FOS E;  1URQ A;  1BCC E;  4H44 D;  2BEQ D;  1S9K D;  3D6Z A;  1SQV D;  1NTK J;  1YYC A;  1L4A D;  3QWO C;  1NVO A;  5TIS E;  2FFD C;  2HOD C;  2B89 A;  1Q81 Q;  5AVS B;  3CWB J;  3PRJ A;  2ZAE B;  2M0B A;  1SQQ J;  2RMZ A;  3T97 B;  3S9O A;  4OWF A;  2ZXE B;  2IYP A;  1N73 A;  2W27 A;  2J58 A;  3WUT A;  3E1I A;  3VP8 A;  2CPS A;  2JR8 A;  3EFG A;  2KLU A;  3V2N A;  1HJ0 A;  1GZL A;  1PV3 A;  4U7J A;  1KD1 Q;  5APX A;  3S1K A;  2W83 C;  1RE4 C;  5APT A;  3L70 J;  1SQP D;  3P7K A;  1QEX A;  1HGV A;  1FIC A;  1OW7 A;  2V7Q H;  2XDJ A;  2LXC B;  3L74 J;  2OTJ P;  1OZH A;  3GG2 A;  4W7Z A;  1JTH B;  2WSF H;  1Y47 A;  1FE6 A;  3TNU A;  1JY2 N;  3VYI A;  2HLO B;  3LID A;  1E79 H;  4Y99 C;  1FJK A;  3M0D A;  3TF5 A;  2ZFC A;  1NU1 D;  1K73 Q;  1NHL A;  1HVV A;  3HUS C;  1URQ D;  1L0N G;  1LT9 A;  2JHK F;  3IFM A;  2E5T A;  1PIX A;  3A3Y B;  1SQB E;  4JZC A;  1BE3 D;  1LTS C;  4PD4 E;  2JO1 A;  2JHM F;  2NRG A;  3W68 A;  2WZ7 A;  2MJZ A;  2NPS A;  3SWY A;  2Q9I A;  1RE4 A;  3AE7 C;  3SFE C;  3T97 A;  3A7O A;  3VN0 A;  1KC8 Q;  3L75 J;  1NU1 G;  1NTZ K;  3HD7 A;  2WTY A;  1T3J A;  5CCG D;  3O6Q B;  2WPR A;  5AW3 B;  2POH A;  2W8Z A;  3W67 A;  1NOH A;  2JP3 A;  2AEF A;  3FGA D;  1EZV E;  4IFM A;  2XKM A;  2QE7 H;  2J3G A;  3M91 A;  1LTG C;  3VTP C;  2K88 A;  1CSB A;  2R5D A;  2D2C C;  1VQ9 P;  1IK7 A;  1Q86 Q;  1EXJ A;  1FID A;  4I7Z B;  5AVV B;  4R9J A;  1L4A A;  1FIB A;  1HJB A;  3BAT A;  1KQG B;  4BRY A;  1NTK G;  2IZ0 A;  2J61 A;  2WT7 B;  3G71 P;  2WSC H;  2A45 I;  5AW8 B;  2IZ1 A;  4H44 C;  2A06 D;  2OYI A;  2J59 M;  1KZU B;  2IYO A;  3NFQ A;  3HD7 B;  4NYT A;  1G1J A;  2XNX C;  1KQS O;  1NYH A;  3V2R A;  1SFC D;  2KIK A;  2Y0C A;  4OH8 B;  4C7N A;  1EXI A;  2YXQ B;  2Q9I B;  3K5B A;  1L0N K;  4Y28 J;  3G3Z A;  3G9R A;  4L75 A;  2YIU C;  2Y9Y A;  5CJ0 A;  2SPZ A;  3L70 E;  1J1E C;  3KXD A;  1JCC A;  1LTA C;  1J1E B;  4HJG H;  4UB8 H;  2HPC A;  3AEC C;  4YTP C;  1SFC A;  3IF4 A;  3N7N A;  1NTM G;  1X8Y A;  2ZT9 C;  1ZRT D;  3CCM P;  1GTW A;  4JYO X;  2Z4E B;  4HH2 A;  4EIJ A;  1USE A;  3R4Y A;  4IFF A;  1D7M A;  1M8O B;  1S5L E;  2H43 C;  1W5C E;  1FZB C;  1M57 D;  1JUN A;  3PTZ A;  1M56 D;  1SQX J;  3FWL A;  1PP9 D;  3CPW O;  2UWJ E;  4K3A A;  3CC7 P;  1N7L A;  1LNQ A;  2ZYG A;  3H1L E;  1J2J B;  4KT0 J;  4ZNC A;  1P84 E;  3HE4 A;  3H32 B;  1NGM B;  2CK3 H;  3M9H A;  2JKV A;  4AYC A;  5APY A;  1QL2 A;  1YI2 P;  4QMA A;  1FZE A;  1LJ2 A;  1NTM D;  3H1J J;  1SQB D;  1SQV E;  1Q82 Q;  2O3J A;  1SQP J;  1SFC C;  1X9V A;  3HD7 D;  3L37 A;  3SWK A;  3KZI E;  2FYU D;  1CW5 A;  1N7S D;  5CJ4 A;  2XND H;  3M9B A;  1BGY E;  2J2P A;  3PP5 A;  2KNC A;  1EZV D;  2FBW C;  2WPQ A;  3TK1 A;  1K9M Q;  1ZOY C;  2ZXX A;  5CHX A;  3CXH D;  1FZB B;  2QJK B;  3GF7 A;  4PD4 H;  3CX5 D;  1PGJ A;  5CCH D;  2I8D A;  1FZC B;  4GOE A;  2Q7C A;  5KKZ B;  4LGD E;  1T2K D;  1UIX A;  2WPV B;  2WWW A;  2Q3I A;  1T6A A;  3Q1M A;  1L4A C;  1OIP A;  1KB9 H;  2WSF J;  3KPE A;  3CC2 P;  1VQP P;  3CXH I;  1KMI Z;  3SFD C;  1FZF B;  2ZVO B;  4U3F G;  1J1D B;  3UIA A;  4IOI H;  2WNP F;  1NTZ G;  2O1J A;  3O8Z A;  1GMJ A;  1OX3 A;  1NU1 J;  3B5N D;  1SQX K;  2Z4E A;  1UII A;  1RF0 A;  1GL2 A;  1QVF O;  3H1K D;  5CBO A;  5K5G B;  2YMY A;  4H0L B;  1JMB A;  1FU1 A;  3L75 G;  1QGK B;  4L73 A;  3HE5 B;  2PRR A;  3L4F A;  1KIL E;  1FDO A;  4I7Z C;  3BCC D;  3CCR P;  1JC9 A;  4U3F D;  2HFE D;  4GT1 A;  4C7R A;  5H2F H;  1KQF B;  1URQ C;  3M06 A;  2JHI F;  3A0B E;  3AE5 C;  2IX7 C;  3RL0 D;  1K8A Q;  3C9I A;  3WUV A;  2P67 A;  4ZKU A;  1RF1 B;  5CCG A;  3H1K G;  3GMA A;  2JHH C;  1H8A A;  1Q2N A;  4TT3 H;  1HWT C;  2J5Z A;  3L74 D;  3HUS B;  4BXL A;  1DIP A;  2QEX P;  2Q9I C;  3L73 E;  4R4L A;  1G2C A;  2QG4 A;  2JDI H;  1MV8 A;  1P84 I;  2N1T A;  1KOR A;  3MP7 B;  4ZKP A;  1EDI A;  3QH9 A;  2O01 H;  5KLI C;  1NTM E;  4RES B;  3Q2Y A;  2YKO A;  4DCK A;  2KLV A;  4IL6 X;  4UB8 E;  1JMM A;  2J3F D;  1VDF A;  1RE3 B;  2YMK A;  2IFN A;  4C7N B;  4NPE A;  1RE4 B;  5KTB A;  3H1L D;  3CCV P;  2N1T D;  2BCC G;  3M9Q A;  5L8R J;  5KJ7 D;  4GOD A;  1AJY A;  2Q3E A;  2PFX A;  1FZF C;  1LTT C;  1VQ8 P;  1N73 C;  2FKW B;  1VQ6 P;  1ZW0 A;  1FS0 E;  4JF7 A;  1MZ9 A;  2OYH A;  2BEZ F;  1GW4 A;  1JTH A;  1L0N J;  1YJ9 P;  1SQQ G;  1SLQ A;  4EPU A;  3AE8 C;  1BDD A;  1FZD A;  2QJP B;  4JQ0 D;  1A02 F;  3VMZ A;  5CCG C;  4DZO A;  2WIT A;  2RKL A;  4XFJ A;  1IFM A;  5TIS H;  2Z5I A;  2IDB A;  2BCC D;  1QVG O;  1SQV G;  1RF0 C;  2B87 B;  1N73 B;  5B66 H;  3TGU J;  4H0L D;  3HTK B;  1LP1 B;  3KYQ A;  4H13 B;  3CWB D;  1XTG B;  4WBA A;  2HPC C;  2NPS B;  1SQQ D;  3H1J G;  4PV1 D;  1KTM A;  1BCC G;  2K37 A;  3WU2 E;  3E1I C;  2E76 D;  4IFD K;  3AEF C;  1N7S B;  5KAF H;  2JEE A;  2AEM A;  2E75 B;  5KAI H;  2B88 A;  2B9B A;  2E75 D;  2XNX A;  4IL6 E;  1H0T B;  3RK3 E;  4DJG A;  2H43 B;  2E42 A;  4M3L A;  1AQT A;  2AXT E;  1LTJ C;  3H1L J;  4OGQ B;  2E75 C;  5BU5 A;  2WQY C;  2KXP B;  4EDF A;  1JY3 O;  4I1L A;  2KK7 A;  4EOT A;  3AEA C;  2IBZ G;  1ZP0 C;  1BCC D;  3RL0 C;  2H89 C;  3S4R A;  2FIB A;  1RQU A;  2ZYA A;  1NWQ A;  2P1J A;  3FXD A;  2YIU B;  3AE1 C;  2C9L Y;  1HH0 A;  1L0N D;  1RE3 A;  1IFI A;  1YJN P;  2HYN A;  2PAJ A;  1SS1 A;  2W6A A;  1GDT A;  1AQ5 A;  1RF0 B;  4HYT B;  1M90 Q;  3BVH A;  4WY4 A;  3L71 D;  3TGU E;  4PJ0 H;  1PPJ E;  4ZMD A;  2JHL F;  1EZV I;  2M5A B;  2IBZ D;  3H1K J;  3P8M C;  3MIW A;  4R9T A;  2BAS A;  3L72 J;  1KYO I;  1EDJ A;  3PLN A;  4ASW A;  1BGY G;  4YPC A;  5AVW B;  3RK2 B;  1N8R Q;  2JWA A;  2HG5 D;  3VMA A;  3CLQ A;  1KQL A;  1KIL C;  1LTJ A;  1H89 A;  1KYO D;  4RJT A;  1H88 A;  5CCH C;  1RE3 C;  3IAO A;  1QX8 A;  1FZA A;  1KN7 A;  3V4W A;  3L70 D;  4Z1M H;  2E74 C;  4N6J A;  2Q5U A;  3F5H A;  3BCC G;  1YIJ P;  4PV1 B;  1NTM K;  4BWN A;  1FZG A;  2N9B A;  1N7S C;  2A45 H;  1GU4 A;  4D6T J;  2E74 B;  1IZN B;  3B5N A;  4D6T E;  2J1G A;  3AEG C;  3AEE C;  1IFP A;  1E5W A;  4EYY Q;  4ZFG A;  3L75 E;  1L2P A;  2FXP A;  5APW A;  4B86 A;  2QA4 P;  1AFO A;  1OVU A;  3L74 G;  3Q5S A;  4NPF X;  3CX5 E;  5KLV K;  3CME P;  3L70 G;  3PH0 A;  5AW2 B;  5APS A;  1G1I A;  1FZA C;  1QL1 A;  2HLO C;  1H0T A;  3EQ2 A;  3BCC J;  5B5E H;  1VQ5 P;  1FZC A;  3L71 J;  3PJS K;  2WPS A;  1LT1 A;  2QJP C;  3GHG B;  3NTN A;  1SQP E;  3MD0 A;  1NAY A;  1P84 D;  2FYN C;  1USD A;  1N7S A;  2ZT9 D;  1S1C X;  2J3U A;  1BE3 E;  1N2D C;  2C0X A;  1PP9 J;  2KNC B;  5M1B A;  4XA4 A;  3F89 A;  4U3F J;  1GD2 E;  1IFN A;  3P8C D;  1OFC X;  1KFN A;  2QIW A;  1FZG B;  2R3S A;  2QSI A;  3GHG A;  1OMI A;  1IK9 A;  1FZE B;  3H32 A;  2OYH C;  2O01 N;  4KHX A;  1U57 A;  3H1I G;  1ZME C;  2KYV A;  1HUC A;  2YO2 A;  1VQL P;  2ZJS E;  3JCU E;  1SQQ E;  1VQ4 P;  5KAF E;  4TLF A;  2M8R A;  5H2F E;  2QJK C;  1IC2 A;  2V4H A;  5APQ A;  1SQP G;  3CWB G;  2QM7 A;  3CD6 P;  2HPC B;  3LIE A;  1OWA A;  1SQX E;  2KSE A;  1RF1 C;  1HF9 A;  2M3E A;  1VPC A;  1NTZ J;  3Q3D A;  2N9Y B;  5DJU B;  4C46 A;  5TJH A;  3FWN A;  1VQ7 P;  3V2Q A;  2LKM A;  2QRX A;  5KAI E;  3JSV C;  1AVO A;  1JB0 J;  2QVA A;  1ZRT E;  4GIF A;  3MHV A;  5KLI B;  1R5S A;  1L0N E;  1A02 J;  2OGU A;  3H1J E;  2FXO A;  3AE4 C;  3H1H J;  3L73 G;  1VQM P;  3H1I E;  2O01 J;  5GTH H;  1AVY A;  1NH4 A;  2FFD B;  1SP4 A;  3MTU E;  3NXS A;  1K05 A;  4KJM A;  1PPJ D;  1Y8A A;  2BCC J;  2R3C A;  1MFZ A;  2OTK E;  3GF3 A;  4CPG A;  1Z3U A;  1IJD B;  3L36 A;  3L75 D;  1S9K E;  4OVN F;  1M1J C;  3M0A A;  1X0T A;  1VQK P;  3L71 E;  2E76 C;  3TGU D;  1S4X A;  3KDP B;  1KV4 A;  2HLO A;  3Q5R A;  2WSE J;  3TNU B;  2A06 E;  1FZE C;  5AW9 B;  2GUV A;  4UB6 H;  1GL2 C;  3L73 D;  2NZ2 A;  4H0L C;  1PGO A;  3II6 A;  3VP9 A;  1YTZ T;  2O1K A;  3D71 A;  3BRT B;  3AE9 C;  3L35 A;  3N4X A;  3IN6 A;  5AVZ B;  3CX5 H;  3B5N C;  1P84 H;  2I1K A;  3G4S P;  4JYC A;  1LP1 A;  3V2P A;  3E1R A;  2JWD A;  2ZVN B;  1FJP A;  1FC2 C;  1BE3 G;  1PZQ A;  3B8E B;  3A2A A;  4O9B A;  3WU2 H;  1HBW A;  1ZLL A;  1T2K C;  3CC4 P;  2YO3 A;  5BU8 B;  3H6P A;  2E43 A;  4UB6 E;  2IFM A;  3A0H E;  4GKG A;  5CCH A;  1W2B O;  1KYO E;  3FIB A;  1S5L X;  3C1L A;  5KJ7 C;  3H32 C;  2D2C D;  1URQ B;  2J5U A;  3AE6 C;  3RBZ A;  1MUU A;  2G3A A;  2GM4 A;  1ZV8 A;  5B66 E;  4YXW H;  4NPD A;  5AW4 B;  1JEK A;  2J64 A;  2WSS H;  1SQV J;  4M7H A;  4HKZ H;  1PL5 A;  2AXC A;  1EC5 A;  1T3U A;  2AXT H;  1RHZ B;  5DJT B;  5GTH E;  3B4S A;  3GLM A;  1N86 C;  3CWB E;  2A45 G;  2W90 A;  5E79 E;  3HUS A;  2FYZ A;  4JBZ A;  3PHL A;  3H1H E;  3VMY A;  1IFJ A;  2K1A A;  3V4Q A;  2PGD A;  2KZJ A;  2H7H A;  1NTK E;  3CCE P;  5AVT B;  2H88 C;  2FYU K;  2KOG A;  1SQB G;  1LTJ B;  3P8C E;  1QLE D;  5KKZ C;  1SQB J;  3MUD A;  5BVZ A;  1YQ3 C;  2FYU G;  1NTZ E;  3RK3 D;  3VMX A;  4MN4 C;  2C9N Y;  4Y99 B;  2J0Y A;  1SQQ K;  2XV5 A;  1GK4 A;  4R4M A;  4WY4 C;  3A0H H;  3KZI H;  4I6M C;  3ITK A;  2LXB A;  4N78 E;  4D6T D;  3NMD A;  1SFC B;  2YKP A;  3EWK A;  4N78 D; 
#chains in the Genus database with same CATH homology
 4AYC A;  5APY A;  1RY3 A;  4N6J A;  2Q5U A;  3B5N B;  1QL2 A;  3TSI A;  1FZE A;  2OYI C;  1NKN A;  1ZR2 A;  1SQP K;  1NTM K;  3BRV B;  3OJA B;  1FZG A;  1SFC C;  3BAS A;  1X9V A;  3CI9 A;  2N9B A;  1X79 B;  1N7S C;  2A45 H;  3HD7 D;  3L37 A;  4W7Y A;  1GU4 A;  5AW7 B;  1CW5 A;  1N7S D;  3B5N A;  3HD7 C;  1N86 A;  4I2L C;  5CJ4 A;  1G2C B;  2J1G A;  3M9B A;  1WT6 A;  2YNY A;  2J2P A;  3PP5 A;  1NTK K;  2VRS A;  3KQG A;  1E5W A;  1FZA B;  3OA7 A;  4ZFG A;  1NKZ B;  1LWU A;  2R32 A;  4XE5 B;  5APW A;  2WPQ A;  3TK1 A;  4B86 A;  1WRG A;  1AFO A;  2KSJ A;  5KLV K;  5CHX A;  1XTC C;  1FZB B;  2J0G A;  1DH3 A;  3HRN A;  5AW2 B;  1DX7 A;  5APS A;  5CCH D;  1FZC B;  1G1I A;  2Q7C A;  1T8Z A;  3HE4 B;  2CPB A;  3A5T A;  4LGD E;  1T2K D;  1FZA C;  3RL0 B;  2P2U A;  1QL1 A;  1NAF A;  2KP8 A;  2WWW A;  2Q3I A;  4WY4 D;  1L4A C;  3TYY A;  3KPE A;  1CI6 B;  2HLO C;  4WY4 B;  3OAK A;  4AQR D;  3EQ2 A;  1FAV A;  1LTI C;  3BVH B;  1FZF B;  1FZC A;  5CMZ A;  2WPS A;  1J1D B;  3UIA A;  1FZB A;  4N3Y B;  3CL3 D;  3GHG B;  3NTN A;  3HE5 A;  3MD0 A;  2WNP F;  1Z56 A;  3O8Z A;  2O1J A;  2PP6 A;  3RK3 B;  1N7S A;  3B5N D;  1SQX K;  4W80 A;  4DOJ A;  2Z4E A;  5AW6 B;  1NU1 K;  1RF0 A;  2J3U A;  1LWU B;  2Z4E C;  1N2D C;  2C0X A;  2GY7 A;  1DEB A;  5AVQ B;  4XA4 A;  1GL2 A;  2HOD A;  1CZQ A;  1GD2 E;  2QM8 A;  2Z5H A;  1ZN5 A;  5AVU B;  1IFN A;  2XU6 A;  3BVH C;  3P8C D;  2YKQ A;  2OYI B;  1SQV K;  1KFN A;  2YMY A;  1FZG B;  1EQ7 A;  1FU1 A;  3HE5 B;  3GHG A;  3VOP A;  5AVY B;  1IK9 A;  3L4F A;  2JJL A;  1FZE B;  3H32 A;  1JY2 O;  2OYH C;  3M0D C;  1JC9 A;  2HFE D;  4GT1 A;  3RK3 C;  1CI6 A;  4C7R A;  4KHX A;  1ZR4 A;  2J0H A;  1URQ C;  2H43 A;  2KYV A;  1HUC A;  3M06 A;  3SWF A;  2XNX B;  2YO2 A;  1FOS E;  2JHI F;  1URQ A;  2IX7 C;  3RL0 D;  1S9K D;  1YYC A;  1L4A D;  3C9I A;  2D39 A;  2P67 A;  3IR9 A;  4ZKU A;  2M8R A;  1RF1 B;  5CCG A;  1IC2 A;  2J3F A;  2JHH C;  1H8A A;  2FFD C;  2KB7 P;  5APQ A;  1GW3 A;  2QM7 A;  1YTZ I;  2HOD C;  5APV A;  1HWT C;  5APU A;  1JNM A;  2J5Z A;  3HUS B;  5KJ7 A;  4WB4 A;  5AVS B;  2HPC B;  2Q9I C;  3LIE A;  1OWA A;  1G2C A;  1PFI A;  1MV8 A;  1RF1 C;  2N1T A;  1FBM A;  1VPC A;  4ZKP A;  2L5G B;  2O01 H;  4RES B;  2YKO A;  5AW1 B;  4C46 A;  2ZXE B;  2KLV A;  1N73 A;  2W27 A;  3V2Q A;  2LKM A;  2J58 A;  1JMM A;  2J3F D;  1VDF A;  1RE3 B;  2IFN A;  1JCD A;  3E1I A;  3VP8 A;  3E1I B;  4C7N B;  1GK6 A;  2CPS A;  3EFG A;  1RE4 B;  3V2N A;  5KTB A;  1GZL A;  3R2P A;  4GIF A;  5AW5 B;  2WT7 A;  5APX A;  1A02 J;  2OAR A;  2N1T D;  1RE4 C;  5APT A;  2NPS D;  3M9Q A;  1FIC A;  1SQB K;  3P7K A;  1HGV A;  5KJ7 D;  2XDJ A;  3HTK A;  1LTB C;  1M1J B;  3U1C A;  4LC1 A;  1FZF C;  1NH4 A;  1LTT C;  3MTU E;  1SP4 A;  4W7Z A;  2FFD B;  1JTH B;  2WSF H;  3NXS A;  3TNU A;  1N73 C;  3RK2 D;  2FKW B;  1JY2 N;  3VYI A;  2HLO B;  2WSE H;  3LID A;  4Y99 C;  1FJK A;  4JF7 A;  2R3C A;  1MFZ A;  3M0D A;  1Z3U A;  1MZ9 A;  2OYH A;  2ZFC A;  1IJD B;  3L36 A;  1GW4 A;  1JTH A;  3LW5 H;  1S9K E;  1M1J C;  1SLQ A;  1NHL A;  4EPU A;  1HVV A;  1RF1 A;  3M0A A;  3HUS C;  1A02 F;  1FZD A;  1URQ D;  3KDP B;  1LT9 A;  3VMZ A;  2JHK F;  2HLO A;  5CCG C;  4DZO A;  3IFM A;  3TNU B;  1LT9 C;  3A3Y B;  2WIT A;  4JZC A;  1Z3S A;  1LTS C;  1HGZ A;  2FFD A;  1FZE C;  5AW9 B;  1GU5 A;  1IFM A;  2OYH B;  2Z5I A;  2GUV A;  1GL2 C;  2JHM F;  1RF0 C;  1FOS F;  2GUS A;  2WZ7 A;  1N73 B;  2MJZ A;  2NPS A;  3SWY A;  3II6 A;  2Q9I A;  3VP9 A;  1JOC A;  1RE4 A;  3HTK B;  1YTZ T;  3T97 A;  2NPS C;  3KYQ A;  1M7L A;  2O1K A;  3A7O A;  2M3B A;  3VN0 A;  1XTG B;  2N1T C;  3BRT B;  1GL2 D;  1KIL B;  1LGH B;  1SVF A;  3L35 A;  2N1T B;  4WBA A;  5AW0 B;  1JY2 P;  3N4X A;  2HPC C;  2NPS B;  5AVZ B;  2W6B A;  1NTZ K;  4JYB A;  3B5N C;  3HD7 A;  1KIL A;  3U59 A;  2I1K A;  2H8P D;  2WTY A;  1T3J A;  3WMM 0;  5CCG D;  4JYC A;  3V2P A;  2WPR A;  5AW3 B;  3E1I C;  4IFD K;  2POH A;  1FJP A;  1N7S B;  2J61 B;  1NOH A;  4M7F A;  3B8E B;  2JEE A;  1KFM A;  3A2A A;  4IFM A;  1L4A B;  3P32 A;  2XKM A;  4O9B A;  2J3G A;  3M91 A;  1LWU C;  1LTG C;  3MGN A;  1FZF A;  3VTP C;  1HBW A;  1ZLL A;  1T2K C;  2YO3 A;  5BU8 B;  1CSB A;  2XNX A;  3H6P A;  1JY3 N;  2R5D A;  1FZC C;  2E43 A;  2H43 B;  2E42 A;  3GHG C;  2IFM A;  4GKG A;  4M3L A;  5CCH A;  1FID A;  3V5B A;  1LT9 B;  5AVV B;  2J3O A;  3FIB A;  5KJ7 C;  4R9J A;  1LTJ C;  1L4A A;  3H32 C;  1FIB A;  1HJB A;  1URQ B;  5AVR B;  3BAT A;  5BU5 A;  2R5B A;  1MUU A;  2J61 A;  2WT7 B;  1JY3 O;  4I1L A;  2GM4 A;  1M1J A;  1ZV8 A;  2WSC H;  2A45 I;  5AW8 B;  4EOT A;  3RL0 C;  2OYI A;  2FIB A;  2J59 M;  1KZU B;  3NFQ A;  3HD7 B;  2XZR A;  5AW4 B;  4NYT A;  1G1J A;  2J64 A;  1HTL C;  2J60 A;  2XNX C;  3V2R A;  1NWQ A;  4M7H A;  2P1J A;  1SFC D;  1JO5 A;  1IFD A;  1IO4 A;  4OH8 B;  4C7N A;  1N86 B;  2C9L Y;  1HH0 A;  1T3U A;  1RE3 A;  2Q9I B;  1IFI A;  1L0N K;  3G3Z A;  1N86 C;  2HYN A;  2PAJ A;  2A45 G;  2HOD B;  5CJ0 A;  1FDM A;  3HUS A;  2FYZ A;  1J1E C;  2W6A A;  3VMY A;  1JCC A;  1LTA C;  1GDT A;  1AQ5 A;  4HYT B;  1RF0 B;  1IFJ A;  1J1E B;  3I5C A;  3BVH A;  4WY4 A;  3V4Q A;  1OXZ A;  2HPC A;  2JHL F;  1GL2 B;  1KIL D;  2H7H A;  1SFC A;  3P8M C;  1W2E A;  2P7J A;  3MIW A;  3N7N A;  4R9T A;  5AVT B;  3U1A A;  1X8Y A;  2BAS A;  1GTW A;  2FYU K;  4JYO X;  2Z4E B;  2KOG A;  4HH2 A;  1LTJ B;  4EIJ A;  3P8C E;  4IFF A;  2IPP A;  3MUD A;  5BVZ A;  2H43 C;  2FXM A;  3RK3 D;  3VMX A;  1FZB C;  4AUW A;  1J1D C;  2C9N Y;  4Y99 B;  5AVW B;  1JUN A;  3RK2 B;  2J0Y A;  1SQQ K;  2HG5 D;  3CLQ A;  2XV5 A;  1GK4 A;  4WY4 C;  1FZG C;  4LLH A;  1KQL A;  1KIL C;  1LTJ A;  4I6M C;  1NO4 A;  1N7L A;  2I1J A;  3RK2 C;  2C0W A;  1H89 A;  1J2J B;  1L0L K;  1JY3 P;  1H88 A;  5CCH C;  1RE3 C;  4N78 E;  3HE4 A;  3H32 B;  3NMD A;  1SFC B;  1FZA A;  2YKP A;  3M9H A;  5AVX B;  4N78 D;  3V4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...