1RE3C

Crystal structure of fragment d of bbetad398a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
288
structure length
288
Chain Sequence
b'SIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E chain
publication title BbetaGlu397 and BbetaAsp398 but not BbetaAsp432 are required for "B:b" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 82
structure length 288
sequence length 288
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1re3C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1re3C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1re3C03
4NYTA 1FZCC 1FIDA 1RF1A 1RF1B 2H43C 3H32A 3H32B 1W2EA 1FZDA 2Q9IA 2J2PA 3E1IC 2Q9IB 2A45G 2JHKF 1M1JC 1N86B 1RE3A 1RE3B 4M7HA 1Z3SA 2HODB 2HODA 1FZFA 1FZFB 1RE4A 1RE4B 1FZEA 1FZEB 1FZCA 1FZCB 2A45H 1FZBA 2A45I 1FZBB 1JY2O 2J3FA 2H43A 4JZCA 2H43B 3E1IA 1FZAC 2J64A 3E1IB 2HLOA 2HLOB 2J3FD 1JY2P 2J0GA 1M1JA 1M1JB 2J5ZA 1FZBC 3BVHC 1N73C 2XNXC 2HLOC 1JY2N 1JC9A 2JHMF 2J3OA 1LTJC 2JHIF 1FZAA 1FZAB 3GHGC 1FZGC 1T3UA 1LT9A 1LT9B 2GY7A 3BVHA 1N73A 2OYIC 1N73B 2J1GA 2J61B 2J61A 3BVHB 2FIBA 1Z3UA 2XNXA 2XNXB 1LT9C 4M7FA 1FICA 1LTJA 1LTJB 1JY3O 2OYHA 3HUSC 2OYHB 1JY3P 3GHGA 3GHGB 1FZGA 2J0YA 2J3GA 1FZGB 2Z4EC 1RF0C 2OYHC 1LWUC 4JYOX 2OYIA 2OYIB 2HPCC 2FFDC 1FIBA 2JHHC 4ZFGA 3HUSB 3HUSA 4EPUA 1N86C 3FIBA 1RF1C 2Z4EA 1RF0A 1RF0B 2J0HA 2Z4EB 1LWUB 1LWUA 2J60A 3H32C 2HPCA 2HPCB 2D39A 2Q9IC 4R9TA 2JHLF 2J3UA 1RE3C 2FFDB 2FFDA 2HODC 1FZFC 2WNPF 1JY3N 1RE4C 1FZEC 4R9JA 1N86A
chains in the Genus database with same CATH superfamily
1OMIA 1GW3A 5KAIE 4PV1C 2D2CD 4PJ0E 1USEA 2E75D 1SFCB 4K35A 2YKQA 3RL0B 3L4FA 1LTGC 1S1CX 1H8AA 1AVOA 4JZCA 1QVFO 4Z1MH 3PP5A 4W7YA 2VRSA 1K73Q 3L75G 3H1IJ 1BE3E 3L74G 3AE7C 4Y28J 1AJYA 4B86A 1VQNP 1WMKA 3K5BA 3HD7D 1IJDB 3GHGC 2WT7A 2WT7B 5K5GB 3RGUA 3E1RA 1T2KC 1LT9C 1URQD 1YQ3C 2GUVA 4I6MC 2W8ZA 3I56P 1NU1G 2E5TA 3MHVA 1LWUC 2OYIA 2OYIB 4N3YB 2UWJE 2WPVB 4H0LC 1VQ5P 1KC8Q 2P67A 4EPUA 1GL2D 3CL3D 1HGVA 1MFTA 2D39A 2M0BA 1S9KE 5AW6B 3VP9A 1Q90D 1EC5A 3MUDC 1QL2A 2HODC 3L73E 3V4WA 1SQVD 3F5HA 5AW0B 1SQQK 1J1EB 3SWYA 2JWDA 1FBMA 2PGDA 2WZ7A 1NTKK 2AXTH 3BCCE 3EFGA 4L75A 3OA7A 2Q3EA 1M57D 4GKGA 2A45H 1DEBA 4OGQD 1L4AA 1JY2O 1L4AB 5APYA 1KB9I 3L37A 3AEDC 3M0DC 3VP8A 2J5ZA 1M1JA 1M1JB 3ABVC 4PV1D 1YIJP 3M9HA 1KB9E 4RESB 2E76B 5AVTB 3I5CA 2M3EA 5AW3B 3L72G 4WBAA 3PJSK 1BCCJ 1YJWP 3H1IE 2E5YA 1N2DC 2KZJA 3EFFK 3A5TA 4IL6H 1HBWA 1FICA 5KAFE 5B5EE 3AE1C 2J5UA 2NPSC 3RK3B 3CCSP 1K05A 1W2BO 5KLVD 2WMMA 1SQPJ 2XKMA 4JYOX 1NH4A 1OVVA 1IC2A 1ZOYC 1JOCA 4LGDE 4YTPC 1T2KD 1ZN5A 2FFDC 3M0AA 5TISH 5CCGA 3H1JJ 4OH8B 2IZ1A 5AW8B 1L0LK 5C39A 2W27A 3H32C 5CBOA 4ZNCA 3JCUE 3S9OA 1RE4C 3TGUJ 1SQXD 4GIFA 3CWBD 4H0LD 4NYTA 4DZOA 1RF1A 1RF1B 1T3JA 2M5AA 4GT1A 3L70D 5APWA 2FY8A 1NTZJ 1BE3G 2BEZF 3L71J 3R2PA 3D70A 2IFMA 4NPEA 4Y99C 2J64A 5BU5A 4LLHA 1DIPA 2ZFCA 3BVHC 2XNXC 3CXHI 1IFMA 2H8PD 1KILE 2QJYB 1LT1A 3TNUA 3TNUB 3CXHE 2P10A 2NZ2A 1K8AQ 1Z3UA 3PRJA 4M7FA 1VQ9P 3L75J 2YIUB 1KN7A 1JY3P 5APXA 4JPZB 2OYHC 1YI2P 1BDCA 1WRGA 1UIXA 2YMKA 1T6AA 3L73G 1HUCA 3BRVB 2QSIA 1RF0A 2QIWA 2KYVA 2XNDH 1RF0B 2NPSD 1VF5B 1S5LH 1SP4A 3TSIA 1FOSE 3H1JE 4U3FD 3G3ZA 3BCCG 1BSHA 4BRYA 4BRYB 2BCCD 4W7ZA 2K88A 2FYUD 2JJLA 5AVWB 3GG2A 1OVUA 3U1CA 3VMZA 1U7MA 2QE7H 3CCEP 1J1DB 1OW6A 2YKOA 1R5SA 5KJ7D 3V2NA 3MIWA 5CBNA 2WWWA 3H1IG 2HG5D 2HLOA 1QL1A 4ASVA 2HLOB 3AECC 2ZYDA 2I1KA 2SPZA 3L71E 5CCHA 2ZXXA 4HYTB 4HKZH 2C9LY 2H89C 2J3OA 1LTJC 1T3UA 1VQOP 2FYNB 5AVXB 2OQQA 2I1JA 1PV3A 2W6AA 1EDKA 4L76A 3OAKA 3TK1A 1KFMA 2W90A 3TF5A 1IFJA 3H1KJ 5AW4B 1NKZB 3P8CE 2XZRA 2WSEH 3SFEC 1SQXK 1FE6A 1OFCX 3AE9C 4JBZA 3LW5H 2KSJA 3CC4P 4R9TA 3RK3E 4N6JA 3H1HD 3IFMA 1N86A 1N86B 1X0TA 2IDBA 2H43C 1DD3A 3CX5I 2E74C 4XFJA 3AEGC 2KOGA 2RKLA 1VQPP 2IBZD 2WSCH 3CX5E 1NWQA 1LTBC 2KUBA 4JYBA 1VQ6P 2R3CA 2QA4P 2E42A 3GLMA 3Q5RA 1CSBA 2WPSA 4M3LA 4WY4A 4WY4B 4CPGA 3F89A 1KD1Q 3EWKA 3RK2B 1JC9A 1JCCA 1KZUB 5H2FH 4C46A 1SQBJ 1BGYD 1BE3J 1LTIC 1A02F 2LR2A 1XTGB 1HWTC 1SQVG 3OW2O 4RJTA 2HFED 1FS0E 2PRRA 4WVZA 4BXLA 3CPWO 4AQRD 1U7JA 1N7SC 1R5LA 2ZT9B 3H1JG 3H1KE 1HVVA 2RH0A 2E75B 2V7QH 2IYPA 3SWFA 2K1AA 1L0ND 2Z4EA 2Z4EB 1TU3F 5BU8B 3WUVA 3H1LE 4JF7A 3C9IA 2O01H 3AE6C 1SFCC 1SS1A 4N78D 3MP7B 3RL0C 2B87A 2B87B 3LIEA 2P1JA 1GD2E 3L73J 3BASA 3HTKA 3HTKB 4AUWA 1RE3A 1RE3B 3L71G 3HD7A 3HD7B 2QEXP 5GTIE 3WU2H 2NRGA 5KLVG 1JM0A 1JO5A 1PPJE 1URQB 1URQA 2FXMA 2KZIA 3BCCJ 1FZBC 1KILA 1KILB 2WQYC 1L0LD 1AA0A 5L8RJ 2FYZA 3PH0A 3GF3A 2JHIF 2WITA 1EXJA 3CLQA 1NTMJ 4TLFA 1GL2B 1GL2A 3VN0A 2OYIC 2J61B 2J61A 3CWBG 1AV1A 2WSFH 2Y0CA 2WTYA 1KYOD 1SQBE 3B5ND 2QM8A 4OWFA 1VQKP 1YTZT 2AEMA 4ASWA 1JMMA 1P84D 4PD4D 1N7SD 3A3YB 2Y9YA 3RBZA 1S2EA 5AVYB 3AEBC 1SLQA 2Q9IA 2Q9IB 1OIPA 1M1JC 1NAFA 2Y0EA 1Q7YQ 3V5BA 4I7ZB 2E76C 5AW2B 3LIDA 4ZKUA 1KTMA 1FZEA 1WT6A 1FZEB 1M56D 1SFCD 3FWLA 3RL0D 1H0TA 1H0TB 2J3FA 1SQQE 2LKMA 3GMAA 4K3AA 1PL5A 1GMJA 1NVOA 3AE3C 1VQ4P 1VQMP 4DCKA 1NTKE 1SVFA 5CJ0A 2CK3H 3II6A 2N1TD 2KS1A 2KS1B 1IFDA 1LT9A 1LT9B 5AVQB 1KYOH 2YO3A 1RQUA 1Q86Q 3H1KG 2P7JA 1JTHB 1JTHA 1SQPD 1L0NK 4XA4A 5CCGC 1NTME 4U7JA 3A2AA 4GOEA 2J0YA 3H1LG 3JSVC 4KHXA 5AVVB 4H0LB 1FDIA 3M91A 1FIBA 3HUSB 1P84H 3HUSA 3M06A 3VMAA 1EZVD 1SQVJ 4PD4H 3SFDC 2AXCA 4R4LA 1RF1C 2HPCA 2HPCB 3TGUD 3V2PA 2PP6A 1ZR4A 3KZIH 1J2JB 4D6TE 1PPJG 1GU5A 2O3JA 1W2EA 3SWKA 5KTBA 1ZRTD 4XE5B 2ZVNB 4ZMDA 3KDPB 4IOIH 1FZCA 1FZCB 2QJYC 1G2CB 1G2CA 1OW8A 2A45I 1KQGB 2AXTE 4YPCA 4OVNF 2FKWB 1JY2P 2Y9ZA 1JNMA 1ZV8A 2M5AB 3OJAB 4UB8H 1SQBG 3EQ2A 3C8VA 1AQTA 1FJKA 2E76D 2YIUC 1FZAA 1FZAB 3L75D 1N73A 1N73B 5KLVJ 1USDA 2FIBA 4BWNA 2NPSA 3L74D 2ITAA 4LC1A 1PZQA 4H44B 4IL6E 5APSA 1RF0C 1VF5C 1M8OB 3KZIE 4EIJA 4ZFGA 1PP9D 3MD0A 2LXCB 2Q6QA 3CWBJ 5CCGD 1NU1D 5TISE 5KJ7A 2J60A 3L70J 1J1DC 2C0XA 2QG4A 1YITP 1BGYG 5GTHH 4RO0A 1SQVE 1IFNA 1RHZB 3A7OA 2C9NY 2IX7C 4MN4C 1SQQG 2IPPA 2J2PA 4JYCA 3BATA 5CCHC 4EDFA 4GOFA 1M7LA 1NTKG 2YKPA 1PGQA 5TJHA 4IFMA 2FYNC 2J0GA 3NTNA 1GZLA 4TT3H 1SQPK 5DJUB 1HJBA 5AVRB 1ZR2A 4C7RA 1NTMG 3CCUP 4I2LC 4QMAA 2FXOA 3CCJP 2GY7A 3N7NA 2I8DA 3PLNA 1PGJA 1CW5A 1Q81Q 4H13B 5APUA 3JC22 2OYHA 2OYHB 3L72D 3AE5C 2R44A 2WSEJ 1FZGA 1FZGB 2Z5HA 3V2QA 1CZQA 5AW7B 5KLVE 2YMYA 1L2PA 5AVZB 3B71A 5APVA 1NTZK 2Q7CA 4D6TG 3AEFC 2BEQD 4U3FJ 1N86C 2BCCJ 1Y8AA 1NJIQ 1ZRTE 2FYUJ 1HJ0A 1KQLA 4UB6H 5E79H 1QLED 3KHUA 1VF5D 4EOTA 2W6JH 3G4SP 1S5LE 1G1JA 1SQXE 3H1LJ 1FDOA 3CWBE 1YYCA 1H88A 4EI2A 2WSCJ 3L70E 1ZXGA 2Y0DA 2A45G 5EFWB 2A06D 4WY4C 1AVYA 1GK6A 2KLVA 1LP1B 1LP1A 1EQ7A 3A0BH 1VQLP 4HJGH 3A0HH 2JDIH 3IN6A 3UIAA 2B89A 3M9BA 2GM4A 3C1LA 5CMZA 3L36A 3E1IA 3E1IB 1IK9A 1YBKA 1NO4A 1W5CE 3PTZA 3M9QA 1BE3D 3IAOA 5KKZB 5CCHD 2MKVA 3Q2YA 1LTSC 4C7NA 4C7NB 2J1GA 3ITKA 2ZT9C 1X8YA 3TDKA 5B66H 1S4XA 1NU1K 1DEEG 1YJ9P 2Z4EC 1GDTA 3Q1MA 3SSUA 2C0WA 1DD4A 3CMEP 2K37A 4I1LA 1NGMB 3USSA 3KQGA 2O01J 2K3RA 3H6PA 2J3UA 1RE3C 3HD7C 4U3FE 2HR3A 2N9YB 2WNPF 2P2UA 2BCCE 1PIXA 3WMM0 5KAIH 2FYUE 4PJ0H 1Q2NA 1BSNA 2D2CB 1EDIA 1FOSF 3B4SA 2IFNA 2POHA 2QJPB 3H25A 1NKNA 2AEJA 1JCDA 1FZFA 1JB0J 1KILC 1FZFB 2KLUA 3BCCD 2QJKB 3RBXA 3IR9A 1AQ5A 3GW6A 2JO1A 1BGYJ 2PAJA 3B5NA 3B5NB 3IF4A 3HE5B 3HE5A 1GL2C 4DOJA 2QVAA 1EZVG 1KB9D 2R5DA 4WY4D 2P58A 1JY2N 1SQQJ 2KNCA 2KNCB 5B66E 2FXPA 2Q5UA 3VMXA 2JP3A 2KXPB 3H1ID 5H2FE 1JMBA 1NHLA 1NTKJ 3AEEC 1HGZA 1YHQP 3D6ZA 2E74D 1KQFB 3CC2P 5AW1B 3FXEA 1LJ2A 2IZ0A 3BRTB 3S1KA 2FBWC 1SQXG 2ZT9D 3G9RA 1FDMA 2JEEA 2G3AA 2A06E 2ZYGA 1IO4A 3L70G 3NMDA 1ZMEC 2CPBA 1SFCA 2WPQA 2RN0A 2Q9IC 1YTZI 1LTTC 4JQ0D 1EDLA 3H1HE 4I7ZC 1JY3N 1KQSO 1FU1A 2KSEA 4KJMA 1FZEC 3D6YA 1ZW0A 3FXDA 1FIDA 1GTWA 2IBZI 4D6TJ 1SQBK 2PFXA 3O6QA 3O6QB 5AVSB 1J1EC 2M8RA 3NXSA 5KLIB 2YNYA 2IBZE 2N1TB 2N1TA 1VQ7P 3S4RA 4OGQB 1L0LJ 1QVGO 1FZBA 1FZBB 1KB9H 5AVUB 2YXQB 1HH0A 2ZAEB 3WU2E 4PV1B 2R32A 1L4AC 1PP9G 2KIKA 1IZNB 1Z56A 3KYQA 1KILD 2M3BA 3U1AA 1BGYE 4HH2A 1FJPA 3CXHD 2XDJA 1PGPA 2R5BA 4O9BA 5AW5B 5KAFH 5B5EH 1CI6B 1CI6A 3HUSC 3U59A 1BCCD 3GHGA 3GHGB 1OX3A 4L73A 2HPCC 3RK3C 1Y47A 4L74A 2E43A 4GODA 4U3FG 1D7MA 2BCCG 1S72P 1X9VA 2JHHC 2FYUG 1BDDA 2WSSH 3JCUH 1L0NE 1LWUA 1LWUB 3KPEA 4HB1A 4NPDA 1HTLC 1YJNP 1RY3A 2JHLF 1XTCC 4W80A 4N78E 3H1JD 2H7HA 1FZCC 1MZ9A 2GA1A 1MV8A 2CPSA 2GUSA 2J58A 3B8EB 4EYYQ 1NTMK 3MUDA 4M7HA 3FX0A 2HODB 2HODA 1K9MQ 3D71A 1OVRA 1A02J 2OYOA 2KK7A 1QX8A 1E79H 1NTZD 1FZAC 2O1JA 2J3FD 1N73C 2B9BA 1RH5B 3L71D 2HYNA 1L0LE 3CXHH 5APTA 3QWOC 2WPRA 4GDOA 1N8RQ 1Q82Q 4H44C 1OXZA 1RQVA 3M0DA 4IL6X 1KYOI 2N9BA 4ZKPA 1L4AD 3HE4A 3HE4B 5APQA 1KYOE 4WB4A 2YXRB 1DX7A 1QGKB 1JY3O 1EDJA 2A06G 1MUUA 3VYIA 1MFZA 4YXDC 1JEKA 5KJ7C 1MKMA 1PFIA 3P8CD 4KT0J 2DW3A 3G6EP 2JKVA 3H1HG 1P84I 2NPSB 1OWAA 1S3JA 4PD4I 1P84E 3GF7A 2IBZG 4PD4E 1GU4A 2ZYAA 3P8MC 3RK3D 2K9YA 2FFDB 2FFDA 1E5WA 4R9JA 3VMYA 2L91A 3MGNA 3NFQA 3H32A 3H32B 1JUNA 1IFPA 1SQXJ 2R3SA 3CX5D 1RE4A 1RE4B 1KMIZ 2XU6A 2OTKE 2IYOA 2KI7B 3G71P 3CC7P 2Z5IA 1LNQA 3AE2C 1BCCE 2HLOC 4H13C 2BASA 3L74J 1OW7A 3FWNA 3O8ZA 4UB8E 4Y99B 2V4HA 1FZGC 1SQVK 1KORA 3CD6P 3BVHA 3BVHB 2XNXA 1FAVA 2OTLP 2K9JB 2K9JA 2XNXB 2WVRA 3CCVP 1SQPE 1Y9BA 4IFFA 3V6IA 1HF9A 3MTUE 1L0NG 1PP9J 2JR8A 2XV5A 2J3GA 2LXBA 1NU1J 4H44D 1YQ4C 1IFIA 3W68A 3HRNA 1EZVI 1N7LA 3E7KA 3H1KD 4AYCA 1EZVE 1LTAC 1S5LX 2J0HA 3CI9A 4DJGA 3TGUE 3H1LD 3CCLP 1VQ8P 3VTPC 1NTZE 1M1KQ 1EXIA 3LW5J 3Q3DA 2W83C 3WUUA 5GTHE 3CX5H 3E1IC 5M1BA 3R4YA 1ZLLA 1Z3SA 1L0LG 3ZDMA 5KLVK 2JWAA 2O01N 5KKZC 4NPFX 2YO2A 1PPJD 5BVZA 1FC2C 2ZVOB 4A7PA 1X79B 2Q1KA 3L72J 3RK2C 5AW9B 3L75E 1AFOA 1OZHA 3L74E 1QEXA 1LTJA 1LTJB 5DJTB 1SQBD 5CHXA 3AE4C 3T97B 3T97A 4H13D 1DH3A 3TYYA 1NYHA 3L35A 4DT0A 1IK7A 3FGAD 2O1KA 1H89A 1PP9E 2L5GB 3AE8C 1LGHB 3Q5SA 3W67A 4YXWH 3N4XA 1NU1E 2D2CC 2E75C 3CCQP 1GK4A 3CCMP 2OGUA 2QJPC 1FZFC 4UB6E 5E79E 3Q5PA 3QH9A 2V7QJ 2QJKC 1T8ZA 1VL2A 1UIIA 4WWIA 3H1HJ 1FZDA 1G1IA 5GTIH 3B5NC 2JHKF 3CMAP 1PGOA 1BCCG 1S9KD 1KV4A 2B88A 3A0BE 2H43A 2H43B 3MZWB 3L73D 5CJ4A 3RL0g 2E74B 3P7KA 1KFNA 1SQQD 3A0HE 1R8EA 4IFDK 1URQC 1GW4A 4RKUJ 3CCRP 1SQPG 2JHMF 1ZP0C 1K04A 1NTKD 3V4QA 2QM7A 1NOHA 3WUTA 2ZJSE 1VDFA 1NAYA 2FYUK 1U57A 3KXDA 3I55P 3VOPA 2MJZA 3L72E 1NTMD 2H88C 4R4MA 2RMZA 3AEAC 3TGUG 3RK2D 2J59M 2ZXEB 2OARA 2WSFJ 3V2RA 2QRXA 2AEFA 2W6BA 1M90Q 1NTZG 2OTJP 3FIBA 3P32A 3PHLA 1VPCA 2KB7P 1N7SB 1N7SA 5KLIC 1X22A 2Q3IA 1L0NJ 2N1TC 4D6TD 2KP8A 2G8YA 4OGQC
chains in the Genus database with same CATH topology
1FZCC 1MZ9A 3A7OA 2C9NY 2IX7C 1MV8A 2CPSA 2GUSA 2H43C 2IPPA 2J58A 1GW3A 2J2PA 2KOGA 4JYCA 3B8EB 3BATA 1NTMK 3MUDA 4M7HA 2WSCH 5CCHC 1NWQA 1SFCB 1LTBC 2HODB 2HODA 2YKQA 4JYBA 3RL0B 1M7LA 3L4FA 1A02J 1LTGC 2YKPA 2R3CA 1H8AA 2E42A 4JZCA 3PP5A 4W7YA 2VRSA 1FZAC 1CSBA 2WPSA 4IFMA 2O1JA 4M3LA 2J3FD 2J0GA 3NTNA 4WY4A 4WY4B 1GZLA 1N73C 1SQPK 2HYNA 2H7HA 1HJBA 3RK2B 5AVRB 1JCCA 1KZUB 4B86A 4C46A 1JC9A 5APTA 1ZR2A 2WPRA 4C7RA 4I2LC 3HD7D 1LTIC 1IJDB 1OXZA 3GHGC 3M0DA 1A02F 2WT7A 2WT7B 2GY7A 3N7NA 1XTGB 2N9BA 4ZKPA 1HWTC 1T2KC 1CW5A 2HFED 1LT9C 1L4AD 3HE4A 3HE4B 1URQD 5APQA 4WB4A 1DX7A 5APUA 1JY3O 2GUVA 4I6MC 2OYHA 2OYHB 1MUUA 1FZGA 1FZGB 2Z5HA 1MFZA 3V2QA 3VYIA 1CZQA 5AW7B 2YMYA 4AQRD 1LWUC 5KJ7C 1PFIA 1N7SC 2OYIA 2OYIB 5AVZB 3P8CD 5APVA 1IFNA 1NTZK 2Q7CA 4N3YB 1HVVA 2P67A 4EPUA 1GL2D 1N86C 3CL3D 2NPSB 3SWFA 1OWAA 1HGVA 2Z4EA 2Z4EB 1KQLA 5BU8B 2D39A 1S9KE 4JF7A 5AW6B 3VP9A 1GU4A 3P8MC 3C9IA 3RK3D 2O01H 4EOTA 1SFCC 4N78D 2FFDB 2FFDA 1QL2A 2HODC 3RL0C 1G1JA 3V4WA 1E5WA 4R9JA 3LIEA 3VMYA 5AW0B 1YYCA 1SQQK 1J1EB 2P1JA 3SWYA 1H88A 3MGNA 1GD2E 1FBMA 3NFQA 3H32A 3H32B 1JUNA 2WZ7A 3BASA 3HTKA 3HTKB 2A45G 4AUWA 4WY4C 1RE3A 1N86B 1RE3B 1GK6A 2KLVA 3HD7A 3HD7B 1EQ7A 1NTKK 1RE4A 1RE4B 3EFGA 3OA7A 3UIAA 2XU6A 4GKGA 1JO5A 2A45H 1DEBA 1L4AB 1JY2O 1L4AA 1URQB 1URQA 3M9BA 5APYA 2GM4A 5CMZA 2FXMA 3E1IA 3L36A 3E1IB 3L37A 1IK9A 3M0DC 3VP8A 1NO4A 2J5ZA 1M1JA 1M1JB 2Z5IA 1FZBC 3M9HA 3M9QA 1KILA 1KILB 4RESB 2HLOC 5AVTB 2BASA 3I5CA 5AW3B 5CCHD 2FYZA 4WBAA 2JHIF 3O8ZA 2WITA 3CLQA 4Y99B 1FZGC 1LTSC 4C7NA 1SQVK 4C7NB 1GL2A 1GL2B 3VN0A 3BVHA 2OYIC 2J1GA 3BVHB 2J61B 2J61A 1N2DC 2XNXA 1FAVA 2XNXB 2WSFH 3A5TA 1X8YA 2WTYA 1HBWA 1FICA 3B5ND 4IFFA 2QM8A 1NU1K 3MTUE 2NPSC 3RK3B 2XV5A 2J3GA 2Z4EC 2XKMA 4JYOX 1NH4A 1IC2A 1IFIA 1GDTA 1YTZT 3HRNA 1JOCA 4LGDE 2C0WA 1T2KD 1N7LA 1ZN5A 4AYCA 2FFDC 3M0AA 5CCGA 1LTAC 4I1LA 4OH8B 5AW8B 1L0LK 2J0HA 3CI9A 1JMMA 2W27A 3KQGA 3H32C 3H6PA 2J3UA 1N7SD 1RE3C 3A3YB 3HD7C 2WNPF 2P2UA 3VTPC 1RE4C 3WMM0 4GIFA 4NYTA 4DZOA 5AVYB 1RF1A 1RF1B 1T3JA 4GT1A 5APWA 1FOSF 1SLQA 2Q9IA 3E1IC 2Q9IB 2IFNA 1M1JC 1NAFA 2POHA 1ZLLA 1NKNA 3V5BA 1Z3SA 1JCDA 1FZFA 5KLVK 1KILC 1FZFB 5AW2B 3LIDA 4ZKUA 1FZEA 1WT6A 1FZEB 3R2PA 2YO2A 1SFCD 3RL0D 2IFMA 3IR9A 2J3FA 1AQ5A 4Y99C 2J64A 3B5NA 3B5NB 2PAJA 2LKMA 4LLHA 5BU5A 2ZFCA 3HE5B 3HE5A 1GL2C 4DOJA 3BVHC 5BVZA 2XNXC 2R5DA 1X79B 4WY4D 1JY2N 1IFMA 2H8PD 1SVFA 5CJ0A 2Q5UA 3VMXA 3TNUA 3TNUB 3II6A 2N1TD 3RK2C 1IFDA 1LT9A 1LT9B 5AW9B 5AVQB 1NHLA 1AFOA 2YO3A 1Z3UA 1HGZA 4M7FA 2P7JA 1JTHB 1JTHA 1LTJA 1L0NK 1LTJB 5CHXA 3T97A 4XA4A 5CCGC 1DH3A 1JY3P 3A2AA 5AW1B 2J0YA 3TYYA 5APXA 2OYHC 3L35A 4KHXA 5AVVB 1WRGA 3BRTB 3M91A 2O1KA 1FIBA 1H89A 2L5GB 3HUSB 3HUSA 1FDMA 1HUCA 3M06A 3BRVB 1LGHB 2JEEA 1RF1C 3N4XA 1IO4A 3NMDA 1RF0A 1RF0B 2KYVA 2CPBA 2NPSD 2HPCA 2HPCB 1SFCA 2WPQA 2Q9IC 1SP4A 1YTZI 3V2PA 1GK4A 3TSIA 1LTTC 2PP6A 1ZR4A 1J2JB 1FOSE 3G3ZA 1FZFC 1JY3N 1FU1A 4W7ZA 1FZEC 1FIDA 1T8ZA 1GU5A 1GTWA 2JJLA 5AVWB 3U1CA 3VMZA 1W2EA 1SQBK 1FZDA 1G1IA 3B5NC 5AVSB 5KTBA 1J1DB 1J1EC 2M8RA 3NXSA 2JHKF 2YNYA 2N1TB 2N1TA 2YKOA 4XE5B 1S9KD 3KDPB 5KJ7D 3V2NA 1FZCA 1FZCB 3MIWA 1G2CB 1G2CA 1FZBA 2A45I 1FZBB 2WWWA 2H43A 2H43B 5AVUB 5CJ4A 1HH0A 3P7KA 1KFNA 2HG5D 2FKWB 2HLOA 1QL1A 2R32A 1JY2P 4IFDK 2HLOB 2I1KA 1JNMA 1ZV8A 1L4AC 1URQC 3OJAB 1GW4A 5CCHA 1Z56A 4HYTB 3EQ2A 2JHMF 2C9LY 3KYQA 2J3OA 1LTJC 1FJKA 1KILD 2M3BA 3U1AA 4HH2A 2QM7A 1NOHA 3V4QA 1FJPA 1FZAA 1FZAB 2XDJA 1T3UA 1VDFA 5AVXB 2FYUK 2I1JA 1N73A 1N73B 2R5BA 4O9BA 5AW5B 2FIBA 2W6AA 3VOPA 2NPSA 3OAKA 3TK1A 2MJZA 1KFMA 1CI6B 1CI6A 3HUSC 1IFJA 4LC1A 3U59A 3GHGA 3GHGB 5APSA 5AW4B 1RF0C 1NKZB 2HPCC 3RK2D 3P8CE 2XZRA 2J59M 2WSEH 2ZXEB 3RK3C 2OARA 2E43A 3V2RA 1SQXK 2W6BA 4EIJA 1X9VA 2JHHC 4ZFGA 3FIBA 3P32A 3MD0A 5CCGD 3LW5H 2KSJA 1VPCA 5KJ7A 1LWUA 1LWUB 2KB7P 1N7SB 1N7SA 2J60A 3KPEA 1J1DC 1HTLC 4R9TA 2C0XA 1RY3A 2JHLF 2Q3IA 2N1TC 1XTCC 4W80A 4N78E 4N6JA 2KP8A 3IFMA 1N86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NYT A;  1FZC C;  1FID A;  1RF1 A;  1RF1 B;  2H43 C;  3H32 A;  3H32 B;  1W2E A;  1FZD A;  2Q9I A;  2J2P A;  3E1I C;  2Q9I B;  2A45 G;  2JHK F;  1M1J C;  1N86 B;  1RE3 A;  1RE3 B;  4M7H A;  1Z3S A;  2HOD B;  2HOD A;  1FZF A;  1FZF B;  1RE4 A;  1RE4 B;  1FZE A;  1FZE B;  1FZC A;  1FZC B;  2A45 H;  1FZB A;  2A45 I;  1FZB B;  1JY2 O;  2J3F A;  2H43 A;  4JZC A;  2H43 B;  3E1I A;  1FZA C;  2J64 A;  3E1I B;  2HLO A;  2HLO B;  2J3F D;  1JY2 P;  2J0G A;  1M1J A;  1M1J B;  2J5Z A;  1FZB C;  3BVH C;  1N73 C;  2XNX C;  2HLO C;  1JY2 N;  1JC9 A;  2JHM F;  2J3O A;  1LTJ C;  2JHI F;  1FZA A;  1FZA B;  3GHG C;  1FZG C;  1T3U A;  1LT9 A;  1LT9 B;  2GY7 A;  3BVH A;  1N73 A;  2OYI C;  1N73 B;  2J1G A;  2J61 B;  2J61 A;  3BVH B;  2FIB A;  1Z3U A;  2XNX A;  2XNX B;  1LT9 C;  4M7F A;  1FIC A;  1LTJ A;  1LTJ B;  1JY3 O;  2OYH A;  3HUS C;  2OYH B;  1JY3 P;  3GHG A;  3GHG B;  1FZG A;  2J0Y A;  2J3G A;  1FZG B;  2Z4E C;  1RF0 C;  2OYH C;  1LWU C;  4JYO X;  2OYI A;  2OYI B;  2HPC C;  2FFD C;  1FIB A;  2JHH C;  4ZFG A;  3HUS B;  3HUS A;  4EPU A;  1N86 C;  3FIB A;  1RF1 C;  2Z4E A;  1RF0 A;  1RF0 B;  2J0H A;  2Z4E B;  1LWU B;  1LWU A;  2J60 A;  3H32 C;  2HPC A;  2HPC B;  2D39 A;  2Q9I C;  4R9T A;  2JHL F;  2J3U A;  1RE3 C;  2FFD B;  2FFD A;  2HOD C;  1FZF C;  2WNP F;  1JY3 N;  1RE4 C;  1FZE C;  4R9J A;  1N86 A; 
#chains in the Genus database with same CATH topology
 1OMI A;  1GW3 A;  5KAI E;  4PV1 C;  2D2C D;  4PJ0 E;  1USE A;  2E75 D;  1SFC B;  4K35 A;  2YKQ A;  3RL0 B;  3L4F A;  1LTG C;  1S1C X;  1H8A A;  1AVO A;  4JZC A;  1QVF O;  4Z1M H;  3PP5 A;  4W7Y A;  2VRS A;  1K73 Q;  3L75 G;  3H1I J;  1BE3 E;  3L74 G;  3AE7 C;  4Y28 J;  1AJY A;  4B86 A;  1VQN P;  1WMK A;  3K5B A;  3HD7 D;  1IJD B;  3GHG C;  2WT7 A;  2WT7 B;  5K5G B;  3RGU A;  3E1R A;  1T2K C;  1LT9 C;  1URQ D;  1YQ3 C;  2GUV A;  4I6M C;  2W8Z A;  3I56 P;  1NU1 G;  2E5T A;  3MHV A;  1LWU C;  2OYI A;  2OYI B;  4N3Y B;  2UWJ E;  2WPV B;  4H0L C;  1VQ5 P;  1KC8 Q;  2P67 A;  4EPU A;  1GL2 D;  3CL3 D;  1HGV A;  1MFT A;  2D39 A;  2M0B A;  1S9K E;  5AW6 B;  3VP9 A;  1Q90 D;  1EC5 A;  3MUD C;  1QL2 A;  2HOD C;  3L73 E;  3V4W A;  1SQV D;  3F5H A;  5AW0 B;  1SQQ K;  1J1E B;  3SWY A;  2JWD A;  1FBM A;  2PGD A;  2WZ7 A;  1NTK K;  2AXT H;  3BCC E;  3EFG A;  4L75 A;  3OA7 A;  2Q3E A;  1M57 D;  4GKG A;  2A45 H;  1DEB A;  4OGQ D;  1L4A A;  1JY2 O;  1L4A B;  5APY A;  1KB9 I;  3L37 A;  3AED C;  3M0D C;  3VP8 A;  2J5Z A;  1M1J A;  1M1J B;  3ABV C;  4PV1 D;  1YIJ P;  3M9H A;  1KB9 E;  4RES B;  2E76 B;  5AVT B;  3I5C A;  2M3E A;  5AW3 B;  3L72 G;  4WBA A;  3PJS K;  1BCC J;  1YJW P;  3H1I E;  2E5Y A;  1N2D C;  2KZJ A;  3EFF K;  3A5T A;  4IL6 H;  1HBW A;  1FIC A;  5KAF E;  5B5E E;  3AE1 C;  2J5U A;  2NPS C;  3RK3 B;  3CCS P;  1K05 A;  1W2B O;  5KLV D;  2WMM A;  1SQP J;  2XKM A;  4JYO X;  1NH4 A;  1OVV A;  1IC2 A;  1ZOY C;  1JOC A;  4LGD E;  4YTP C;  1T2K D;  1ZN5 A;  2FFD C;  3M0A A;  5TIS H;  5CCG A;  3H1J J;  4OH8 B;  2IZ1 A;  5AW8 B;  1L0L K;  5C39 A;  2W27 A;  3H32 C;  5CBO A;  4ZNC A;  3JCU E;  3S9O A;  1RE4 C;  3TGU J;  1SQX D;  4GIF A;  3CWB D;  4H0L D;  4NYT A;  4DZO A;  1RF1 A;  1RF1 B;  1T3J A;  2M5A A;  4GT1 A;  3L70 D;  5APW A;  2FY8 A;  1NTZ J;  1BE3 G;  2BEZ F;  3L71 J;  3R2P A;  3D70 A;  2IFM A;  4NPE A;  4Y99 C;  2J64 A;  5BU5 A;  4LLH A;  1DIP A;  2ZFC A;  3BVH C;  2XNX C;  3CXH I;  1IFM A;  2H8P D;  1KIL E;  2QJY B;  1LT1 A;  3TNU A;  3TNU B;  3CXH E;  2P10 A;  2NZ2 A;  1K8A Q;  1Z3U A;  3PRJ A;  4M7F A;  1VQ9 P;  3L75 J;  2YIU B;  1KN7 A;  1JY3 P;  5APX A;  4JPZ B;  2OYH C;  1YI2 P;  1BDC A;  1WRG A;  1UIX A;  2YMK A;  1T6A A;  3L73 G;  1HUC A;  3BRV B;  2QSI A;  1RF0 A;  2QIW A;  2KYV A;  2XND H;  1RF0 B;  2NPS D;  1VF5 B;  1S5L H;  1SP4 A;  3TSI A;  1FOS E;  3H1J E;  4U3F D;  3G3Z A;  3BCC G;  1BSH A;  4BRY A;  4BRY B;  2BCC D;  4W7Z A;  2K88 A;  2FYU D;  2JJL A;  5AVW B;  3GG2 A;  1OVU A;  3U1C A;  3VMZ A;  1U7M A;  2QE7 H;  3CCE P;  1J1D B;  1OW6 A;  2YKO A;  1R5S A;  5KJ7 D;  3V2N A;  3MIW A;  5CBN A;  2WWW A;  3H1I G;  2HG5 D;  2HLO A;  1QL1 A;  4ASV A;  2HLO B;  3AEC C;  2ZYD A;  2I1K A;  2SPZ A;  3L71 E;  5CCH A;  2ZXX A;  4HYT B;  4HKZ H;  2C9L Y;  2H89 C;  2J3O A;  1LTJ C;  1T3U A;  1VQO P;  2FYN B;  5AVX B;  2OQQ A;  2I1J A;  1PV3 A;  2W6A A;  1EDK A;  4L76 A;  3OAK A;  3TK1 A;  1KFM A;  2W90 A;  3TF5 A;  1IFJ A;  3H1K J;  5AW4 B;  1NKZ B;  3P8C E;  2XZR A;  2WSE H;  3SFE C;  1SQX K;  1FE6 A;  1OFC X;  3AE9 C;  4JBZ A;  3LW5 H;  2KSJ A;  3CC4 P;  4R9T A;  3RK3 E;  4N6J A;  3H1H D;  3IFM A;  1N86 A;  1N86 B;  1X0T A;  2IDB A;  2H43 C;  1DD3 A;  3CX5 I;  2E74 C;  4XFJ A;  3AEG C;  2KOG A;  2RKL A;  1VQP P;  2IBZ D;  2WSC H;  3CX5 E;  1NWQ A;  1LTB C;  2KUB A;  4JYB A;  1VQ6 P;  2R3C A;  2QA4 P;  2E42 A;  3GLM A;  3Q5R A;  1CSB A;  2WPS A;  4M3L A;  4WY4 A;  4WY4 B;  4CPG A;  3F89 A;  1KD1 Q;  3EWK A;  3RK2 B;  1JC9 A;  1JCC A;  1KZU B;  5H2F H;  4C46 A;  1SQB J;  1BGY D;  1BE3 J;  1LTI C;  1A02 F;  2LR2 A;  1XTG B;  1HWT C;  1SQV G;  3OW2 O;  4RJT A;  2HFE D;  1FS0 E;  2PRR A;  4WVZ A;  4BXL A;  3CPW O;  4AQR D;  1U7J A;  1N7S C;  1R5L A;  2ZT9 B;  3H1J G;  3H1K E;  1HVV A;  2RH0 A;  2E75 B;  2V7Q H;  2IYP A;  3SWF A;  2K1A A;  1L0N D;  2Z4E A;  2Z4E B;  1TU3 F;  5BU8 B;  3WUV A;  3H1L E;  4JF7 A;  3C9I A;  2O01 H;  3AE6 C;  1SFC C;  1SS1 A;  4N78 D;  3MP7 B;  3RL0 C;  2B87 A;  2B87 B;  3LIE A;  2P1J A;  1GD2 E;  3L73 J;  3BAS A;  3HTK A;  3HTK B;  4AUW A;  1RE3 A;  1RE3 B;  3L71 G;  3HD7 A;  3HD7 B;  2QEX P;  5GTI E;  3WU2 H;  2NRG A;  5KLV G;  1JM0 A;  1JO5 A;  1PPJ E;  1URQ B;  1URQ A;  2FXM A;  2KZI A;  3BCC J;  1FZB C;  1KIL A;  1KIL B;  2WQY C;  1L0L D;  1AA0 A;  5L8R J;  2FYZ A;  3PH0 A;  3GF3 A;  2JHI F;  2WIT A;  1EXJ A;  3CLQ A;  1NTM J;  4TLF A;  1GL2 B;  1GL2 A;  3VN0 A;  2OYI C;  2J61 B;  2J61 A;  3CWB G;  1AV1 A;  2WSF H;  2Y0C A;  2WTY A;  1KYO D;  1SQB E;  3B5N D;  2QM8 A;  4OWF A;  1VQK P;  1YTZ T;  2AEM A;  4ASW A;  1JMM A;  1P84 D;  4PD4 D;  1N7S D;  3A3Y B;  2Y9Y A;  3RBZ A;  1S2E A;  5AVY B;  3AEB C;  1SLQ A;  2Q9I A;  2Q9I B;  1OIP A;  1M1J C;  1NAF A;  2Y0E A;  1Q7Y Q;  3V5B A;  4I7Z B;  2E76 C;  5AW2 B;  3LID A;  4ZKU A;  1KTM A;  1FZE A;  1WT6 A;  1FZE B;  1M56 D;  1SFC D;  3FWL A;  3RL0 D;  1H0T A;  1H0T B;  2J3F A;  1SQQ E;  2LKM A;  3GMA A;  4K3A A;  1PL5 A;  1GMJ A;  1NVO A;  3AE3 C;  1VQ4 P;  1VQM P;  4DCK A;  1NTK E;  1SVF A;  5CJ0 A;  2CK3 H;  3II6 A;  2N1T D;  2KS1 A;  2KS1 B;  1IFD A;  1LT9 A;  1LT9 B;  5AVQ B;  1KYO H;  2YO3 A;  1RQU A;  1Q86 Q;  3H1K G;  2P7J A;  1JTH B;  1JTH A;  1SQP D;  1L0N K;  4XA4 A;  5CCG C;  1NTM E;  4U7J A;  3A2A A;  4GOE A;  2J0Y A;  3H1L G;  3JSV C;  4KHX A;  5AVV B;  4H0L B;  1FDI A;  3M91 A;  1FIB A;  3HUS B;  1P84 H;  3HUS A;  3M06 A;  3VMA A;  1EZV D;  1SQV J;  4PD4 H;  3SFD C;  2AXC A;  4R4L A;  1RF1 C;  2HPC A;  2HPC B;  3TGU D;  3V2P A;  2PP6 A;  1ZR4 A;  3KZI H;  1J2J B;  4D6T E;  1PPJ G;  1GU5 A;  2O3J A;  1W2E A;  3SWK A;  5KTB A;  1ZRT D;  4XE5 B;  2ZVN B;  4ZMD A;  3KDP B;  4IOI H;  1FZC A;  1FZC B;  2QJY C;  1G2C B;  1G2C A;  1OW8 A;  2A45 I;  1KQG B;  2AXT E;  4YPC A;  4OVN F;  2FKW B;  1JY2 P;  2Y9Z A;  1JNM A;  1ZV8 A;  2M5A B;  3OJA B;  4UB8 H;  1SQB G;  3EQ2 A;  3C8V A;  1AQT A;  1FJK A;  2E76 D;  2YIU C;  1FZA A;  1FZA B;  3L75 D;  1N73 A;  1N73 B;  5KLV J;  1USD A;  2FIB A;  4BWN A;  2NPS A;  3L74 D;  2ITA A;  4LC1 A;  1PZQ A;  4H44 B;  4IL6 E;  5APS A;  1RF0 C;  1VF5 C;  1M8O B;  3KZI E;  4EIJ A;  4ZFG A;  1PP9 D;  3MD0 A;  2LXC B;  2Q6Q A;  3CWB J;  5CCG D;  1NU1 D;  5TIS E;  5KJ7 A;  2J60 A;  3L70 J;  1J1D C;  2C0X A;  2QG4 A;  1YIT P;  1BGY G;  5GTH H;  4RO0 A;  1SQV E;  1IFN A;  1RHZ B;  3A7O A;  2C9N Y;  2IX7 C;  4MN4 C;  1SQQ G;  2IPP A;  2J2P A;  4JYC A;  3BAT A;  5CCH C;  4EDF A;  4GOF A;  1M7L A;  1NTK G;  2YKP A;  1PGQ A;  5TJH A;  4IFM A;  2FYN C;  2J0G A;  3NTN A;  1GZL A;  4TT3 H;  1SQP K;  5DJU B;  1HJB A;  5AVR B;  1ZR2 A;  4C7R A;  1NTM G;  3CCU P;  4I2L C;  4QMA A;  2FXO A;  3CCJ P;  2GY7 A;  3N7N A;  2I8D A;  3PLN A;  1PGJ A;  1CW5 A;  1Q81 Q;  4H13 B;  5APU A;  3JC2 2;  2OYH A;  2OYH B;  3L72 D;  3AE5 C;  2R44 A;  2WSE J;  1FZG A;  1FZG B;  2Z5H A;  3V2Q A;  1CZQ A;  5AW7 B;  5KLV E;  2YMY A;  1L2P A;  5AVZ B;  3B71 A;  5APV A;  1NTZ K;  2Q7C A;  4D6T G;  3AEF C;  2BEQ D;  4U3F J;  1N86 C;  2BCC J;  1Y8A A;  1NJI Q;  1ZRT E;  2FYU J;  1HJ0 A;  1KQL A;  4UB6 H;  5E79 H;  1QLE D;  3KHU A;  1VF5 D;  4EOT A;  2W6J H;  3G4S P;  1S5L E;  1G1J A;  1SQX E;  3H1L J;  1FDO A;  3CWB E;  1YYC A;  1H88 A;  4EI2 A;  2WSC J;  3L70 E;  1ZXG A;  2Y0D A;  2A45 G;  5EFW B;  2A06 D;  4WY4 C;  1AVY A;  1GK6 A;  2KLV A;  1LP1 B;  1LP1 A;  1EQ7 A;  3A0B H;  1VQL P;  4HJG H;  3A0H H;  2JDI H;  3IN6 A;  3UIA A;  2B89 A;  3M9B A;  2GM4 A;  3C1L A;  5CMZ A;  3L36 A;  3E1I A;  3E1I B;  1IK9 A;  1YBK A;  1NO4 A;  1W5C E;  3PTZ A;  3M9Q A;  1BE3 D;  3IAO A;  5KKZ B;  5CCH D;  2MKV A;  3Q2Y A;  1LTS C;  4C7N A;  4C7N B;  2J1G A;  3ITK A;  2ZT9 C;  1X8Y A;  3TDK A;  5B66 H;  1S4X A;  1NU1 K;  1DEE G;  1YJ9 P;  2Z4E C;  1GDT A;  3Q1M A;  3SSU A;  2C0W A;  1DD4 A;  3CME P;  2K37 A;  4I1L A;  1NGM B;  3USS A;  3KQG A;  2O01 J;  2K3R A;  3H6P A;  2J3U A;  1RE3 C;  3HD7 C;  4U3F E;  2HR3 A;  2N9Y B;  2WNP F;  2P2U A;  2BCC E;  1PIX A;  3WMM 0;  5KAI H;  2FYU E;  4PJ0 H;  1Q2N A;  1BSN A;  2D2C B;  1EDI A;  1FOS F;  3B4S A;  2IFN A;  2POH A;  2QJP B;  3H25 A;  1NKN A;  2AEJ A;  1JCD A;  1FZF A;  1JB0 J;  1KIL C;  1FZF B;  2KLU A;  3BCC D;  2QJK B;  3RBX A;  3IR9 A;  1AQ5 A;  3GW6 A;  2JO1 A;  1BGY J;  2PAJ A;  3B5N A;  3B5N B;  3IF4 A;  3HE5 B;  3HE5 A;  1GL2 C;  4DOJ A;  2QVA A;  1EZV G;  1KB9 D;  2R5D A;  4WY4 D;  2P58 A;  1JY2 N;  1SQQ J;  2KNC A;  2KNC B;  5B66 E;  2FXP A;  2Q5U A;  3VMX A;  2JP3 A;  2KXP B;  3H1I D;  5H2F E;  1JMB A;  1NHL A;  1NTK J;  3AEE C;  1HGZ A;  1YHQ P;  3D6Z A;  2E74 D;  1KQF B;  3CC2 P;  5AW1 B;  3FXE A;  1LJ2 A;  2IZ0 A;  3BRT B;  3S1K A;  2FBW C;  1SQX G;  2ZT9 D;  3G9R A;  1FDM A;  2JEE A;  2G3A A;  2A06 E;  2ZYG A;  1IO4 A;  3L70 G;  3NMD A;  1ZME C;  2CPB A;  1SFC A;  2WPQ A;  2RN0 A;  2Q9I C;  1YTZ I;  1LTT C;  4JQ0 D;  1EDL A;  3H1H E;  4I7Z C;  1JY3 N;  1KQS O;  1FU1 A;  2KSE A;  4KJM A;  1FZE C;  3D6Y A;  1ZW0 A;  3FXD A;  1FID A;  1GTW A;  2IBZ I;  4D6T J;  1SQB K;  2PFX A;  3O6Q A;  3O6Q B;  5AVS B;  1J1E C;  2M8R A;  3NXS A;  5KLI B;  2YNY A;  2IBZ E;  2N1T B;  2N1T A;  1VQ7 P;  3S4R A;  4OGQ B;  1L0L J;  1QVG O;  1FZB A;  1FZB B;  1KB9 H;  5AVU B;  2YXQ B;  1HH0 A;  2ZAE B;  3WU2 E;  4PV1 B;  2R32 A;  1L4A C;  1PP9 G;  2KIK A;  1IZN B;  1Z56 A;  3KYQ A;  1KIL D;  2M3B A;  3U1A A;  1BGY E;  4HH2 A;  1FJP A;  3CXH D;  2XDJ A;  1PGP A;  2R5B A;  4O9B A;  5AW5 B;  5KAF H;  5B5E H;  1CI6 B;  1CI6 A;  3HUS C;  3U59 A;  1BCC D;  3GHG A;  3GHG B;  1OX3 A;  4L73 A;  2HPC C;  3RK3 C;  1Y47 A;  4L74 A;  2E43 A;  4GOD A;  4U3F G;  1D7M A;  2BCC G;  1S72 P;  1X9V A;  2JHH C;  2FYU G;  1BDD A;  2WSS H;  3JCU H;  1L0N E;  1LWU A;  1LWU B;  3KPE A;  4HB1 A;  4NPD A;  1HTL C;  1YJN P;  1RY3 A;  2JHL F;  1XTC C;  4W80 A;  4N78 E;  3H1J D;  2H7H A;  1FZC C;  1MZ9 A;  2GA1 A;  1MV8 A;  2CPS A;  2GUS A;  2J58 A;  3B8E B;  4EYY Q;  1NTM K;  3MUD A;  4M7H A;  3FX0 A;  2HOD B;  2HOD A;  1K9M Q;  3D71 A;  1OVR A;  1A02 J;  2OYO A;  2KK7 A;  1QX8 A;  1E79 H;  1NTZ D;  1FZA C;  2O1J A;  2J3F D;  1N73 C;  2B9B A;  1RH5 B;  3L71 D;  2HYN A;  1L0L E;  3CXH H;  5APT A;  3QWO C;  2WPR A;  4GDO A;  1N8R Q;  1Q82 Q;  4H44 C;  1OXZ A;  1RQV A;  3M0D A;  4IL6 X;  1KYO I;  2N9B A;  4ZKP A;  1L4A D;  3HE4 A;  3HE4 B;  5APQ A;  1KYO E;  4WB4 A;  2YXR B;  1DX7 A;  1QGK B;  1JY3 O;  1EDJ A;  2A06 G;  1MUU A;  3VYI A;  1MFZ A;  4YXD C;  1JEK A;  5KJ7 C;  1MKM A;  1PFI A;  3P8C D;  4KT0 J;  2DW3 A;  3G6E P;  2JKV A;  3H1H G;  1P84 I;  2NPS B;  1OWA A;  1S3J A;  4PD4 I;  1P84 E;  3GF7 A;  2IBZ G;  4PD4 E;  1GU4 A;  2ZYA A;  3P8M C;  3RK3 D;  2K9Y A;  2FFD B;  2FFD A;  1E5W A;  4R9J A;  3VMY A;  2L91 A;  3MGN A;  3NFQ A;  3H32 A;  3H32 B;  1JUN A;  1IFP A;  1SQX J;  2R3S A;  3CX5 D;  1RE4 A;  1RE4 B;  1KMI Z;  2XU6 A;  2OTK E;  2IYO A;  2KI7 B;  3G71 P;  3CC7 P;  2Z5I A;  1LNQ A;  3AE2 C;  1BCC E;  2HLO C;  4H13 C;  2BAS A;  3L74 J;  1OW7 A;  3FWN A;  3O8Z A;  4UB8 E;  4Y99 B;  2V4H A;  1FZG C;  1SQV K;  1KOR A;  3CD6 P;  3BVH A;  3BVH B;  2XNX A;  1FAV A;  2OTL P;  2K9J B;  2K9J A;  2XNX B;  2WVR A;  3CCV P;  1SQP E;  1Y9B A;  4IFF A;  3V6I A;  1HF9 A;  3MTU E;  1L0N G;  1PP9 J;  2JR8 A;  2XV5 A;  2J3G A;  2LXB A;  1NU1 J;  4H44 D;  1YQ4 C;  1IFI A;  3W68 A;  3HRN A;  1EZV I;  1N7L A;  3E7K A;  3H1K D;  4AYC A;  1EZV E;  1LTA C;  1S5L X;  2J0H A;  3CI9 A;  4DJG A;  3TGU E;  3H1L D;  3CCL P;  1VQ8 P;  3VTP C;  1NTZ E;  1M1K Q;  1EXI A;  3LW5 J;  3Q3D A;  2W83 C;  3WUU A;  5GTH E;  3CX5 H;  3E1I C;  5M1B A;  3R4Y A;  1ZLL A;  1Z3S A;  1L0L G;  3ZDM A;  5KLV K;  2JWA A;  2O01 N;  5KKZ C;  4NPF X;  2YO2 A;  1PPJ D;  5BVZ A;  1FC2 C;  2ZVO B;  4A7P A;  1X79 B;  2Q1K A;  3L72 J;  3RK2 C;  5AW9 B;  3L75 E;  1AFO A;  1OZH A;  3L74 E;  1QEX A;  1LTJ A;  1LTJ B;  5DJT B;  1SQB D;  5CHX A;  3AE4 C;  3T97 B;  3T97 A;  4H13 D;  1DH3 A;  3TYY A;  1NYH A;  3L35 A;  4DT0 A;  1IK7 A;  3FGA D;  2O1K A;  1H89 A;  1PP9 E;  2L5G B;  3AE8 C;  1LGH B;  3Q5S A;  3W67 A;  4YXW H;  3N4X A;  1NU1 E;  2D2C C;  2E75 C;  3CCQ P;  1GK4 A;  3CCM P;  2OGU A;  2QJP C;  1FZF C;  4UB6 E;  5E79 E;  3Q5P A;  3QH9 A;  2V7Q J;  2QJK C;  1T8Z A;  1VL2 A;  1UII A;  4WWI A;  3H1H J;  1FZD A;  1G1I A;  5GTI H;  3B5N C;  2JHK F;  3CMA P;  1PGO A;  1BCC G;  1S9K D;  1KV4 A;  2B88 A;  3A0B E;  2H43 A;  2H43 B;  3MZW B;  3L73 D;  5CJ4 A;  3RL0 g;  2E74 B;  3P7K A;  1KFN A;  1SQQ D;  3A0H E;  1R8E A;  4IFD K;  1URQ C;  1GW4 A;  4RKU J;  3CCR P;  1SQP G;  2JHM F;  1ZP0 C;  1K04 A;  1NTK D;  3V4Q A;  2QM7 A;  1NOH A;  3WUT A;  2ZJS E;  1VDF A;  1NAY A;  2FYU K;  1U57 A;  3KXD A;  3I55 P;  3VOP A;  2MJZ A;  3L72 E;  1NTM D;  2H88 C;  4R4M A;  2RMZ A;  3AEA C;  3TGU G;  3RK2 D;  2J59 M;  2ZXE B;  2OAR A;  2WSF J;  3V2R A;  2QRX A;  2AEF A;  2W6B A;  1M90 Q;  1NTZ G;  2OTJ P;  3FIB A;  3P32 A;  3PHL A;  1VPC A;  2KB7 P;  1N7S B;  1N7S A;  5KLI C;  1X22 A;  2Q3I A;  1L0N J;  2N1T C;  4D6T D;  2KP8 A;  2G8Y A;  4OGQ C; 
#chains in the Genus database with same CATH homology
 1FZC C;  1MZ9 A;  3A7O A;  2C9N Y;  2IX7 C;  1MV8 A;  2CPS A;  2GUS A;  2H43 C;  2IPP A;  2J58 A;  1GW3 A;  2J2P A;  2KOG A;  4JYC A;  3B8E B;  3BAT A;  1NTM K;  3MUD A;  4M7H A;  2WSC H;  5CCH C;  1NWQ A;  1SFC B;  1LTB C;  2HOD B;  2HOD A;  2YKQ A;  4JYB A;  3RL0 B;  1M7L A;  3L4F A;  1A02 J;  1LTG C;  2YKP A;  2R3C A;  1H8A A;  2E42 A;  4JZC A;  3PP5 A;  4W7Y A;  2VRS A;  1FZA C;  1CSB A;  2WPS A;  4IFM A;  2O1J A;  4M3L A;  2J3F D;  2J0G A;  3NTN A;  4WY4 A;  4WY4 B;  1GZL A;  1N73 C;  1SQP K;  2HYN A;  2H7H A;  1HJB A;  3RK2 B;  5AVR B;  1JCC A;  1KZU B;  4B86 A;  4C46 A;  1JC9 A;  5APT A;  1ZR2 A;  2WPR A;  4C7R A;  4I2L C;  3HD7 D;  1LTI C;  1IJD B;  1OXZ A;  3GHG C;  3M0D A;  1A02 F;  2WT7 A;  2WT7 B;  2GY7 A;  3N7N A;  1XTG B;  2N9B A;  4ZKP A;  1HWT C;  1T2K C;  1CW5 A;  2HFE D;  1LT9 C;  1L4A D;  3HE4 A;  3HE4 B;  1URQ D;  5APQ A;  4WB4 A;  1DX7 A;  5APU A;  1JY3 O;  2GUV A;  4I6M C;  2OYH A;  2OYH B;  1MUU A;  1FZG A;  1FZG B;  2Z5H A;  1MFZ A;  3V2Q A;  3VYI A;  1CZQ A;  5AW7 B;  2YMY A;  4AQR D;  1LWU C;  5KJ7 C;  1PFI A;  1N7S C;  2OYI A;  2OYI B;  5AVZ B;  3P8C D;  5APV A;  1IFN A;  1NTZ K;  2Q7C A;  4N3Y B;  1HVV A;  2P67 A;  4EPU A;  1GL2 D;  1N86 C;  3CL3 D;  2NPS B;  3SWF A;  1OWA A;  1HGV A;  2Z4E A;  2Z4E B;  1KQL A;  5BU8 B;  2D39 A;  1S9K E;  4JF7 A;  5AW6 B;  3VP9 A;  1GU4 A;  3P8M C;  3C9I A;  3RK3 D;  2O01 H;  4EOT A;  1SFC C;  4N78 D;  2FFD B;  2FFD A;  1QL2 A;  2HOD C;  3RL0 C;  1G1J A;  3V4W A;  1E5W A;  4R9J A;  3LIE A;  3VMY A;  5AW0 B;  1YYC A;  1SQQ K;  1J1E B;  2P1J A;  3SWY A;  1H88 A;  3MGN A;  1GD2 E;  1FBM A;  3NFQ A;  3H32 A;  3H32 B;  1JUN A;  2WZ7 A;  3BAS A;  3HTK A;  3HTK B;  2A45 G;  4AUW A;  4WY4 C;  1RE3 A;  1N86 B;  1RE3 B;  1GK6 A;  2KLV A;  3HD7 A;  3HD7 B;  1EQ7 A;  1NTK K;  1RE4 A;  1RE4 B;  3EFG A;  3OA7 A;  3UIA A;  2XU6 A;  4GKG A;  1JO5 A;  2A45 H;  1DEB A;  1L4A B;  1JY2 O;  1L4A A;  1URQ B;  1URQ A;  3M9B A;  5APY A;  2GM4 A;  5CMZ A;  2FXM A;  3E1I A;  3L36 A;  3E1I B;  3L37 A;  1IK9 A;  3M0D C;  3VP8 A;  1NO4 A;  2J5Z A;  1M1J A;  1M1J B;  2Z5I A;  1FZB C;  3M9H A;  3M9Q A;  1KIL A;  1KIL B;  4RES B;  2HLO C;  5AVT B;  2BAS A;  3I5C A;  5AW3 B;  5CCH D;  2FYZ A;  4WBA A;  2JHI F;  3O8Z A;  2WIT A;  3CLQ A;  4Y99 B;  1FZG C;  1LTS C;  4C7N A;  1SQV K;  4C7N B;  1GL2 A;  1GL2 B;  3VN0 A;  3BVH A;  2OYI C;  2J1G A;  3BVH B;  2J61 B;  2J61 A;  1N2D C;  2XNX A;  1FAV A;  2XNX B;  2WSF H;  3A5T A;  1X8Y A;  2WTY A;  1HBW A;  1FIC A;  3B5N D;  4IFF A;  2QM8 A;  1NU1 K;  3MTU E;  2NPS C;  3RK3 B;  2XV5 A;  2J3G A;  2Z4E C;  2XKM A;  4JYO X;  1NH4 A;  1IC2 A;  1IFI A;  1GDT A;  1YTZ T;  3HRN A;  1JOC A;  4LGD E;  2C0W A;  1T2K D;  1N7L A;  1ZN5 A;  4AYC A;  2FFD C;  3M0A A;  5CCG A;  1LTA C;  4I1L A;  4OH8 B;  5AW8 B;  1L0L K;  2J0H A;  3CI9 A;  1JMM A;  2W27 A;  3KQG A;  3H32 C;  3H6P A;  2J3U A;  1N7S D;  1RE3 C;  3A3Y B;  3HD7 C;  2WNP F;  2P2U A;  3VTP C;  1RE4 C;  3WMM 0;  4GIF A;  4NYT A;  4DZO A;  5AVY B;  1RF1 A;  1RF1 B;  1T3J A;  4GT1 A;  5APW A;  1FOS F;  1SLQ A;  2Q9I A;  3E1I C;  2Q9I B;  2IFN A;  1M1J C;  1NAF A;  2POH A;  1ZLL A;  1NKN A;  3V5B A;  1Z3S A;  1JCD A;  1FZF A;  5KLV K;  1KIL C;  1FZF B;  5AW2 B;  3LID A;  4ZKU A;  1FZE A;  1WT6 A;  1FZE B;  3R2P A;  2YO2 A;  1SFC D;  3RL0 D;  2IFM A;  3IR9 A;  2J3F A;  1AQ5 A;  4Y99 C;  2J64 A;  3B5N A;  3B5N B;  2PAJ A;  2LKM A;  4LLH A;  5BU5 A;  2ZFC A;  3HE5 B;  3HE5 A;  1GL2 C;  4DOJ A;  3BVH C;  5BVZ A;  2XNX C;  2R5D A;  1X79 B;  4WY4 D;  1JY2 N;  1IFM A;  2H8P D;  1SVF A;  5CJ0 A;  2Q5U A;  3VMX A;  3TNU A;  3TNU B;  3II6 A;  2N1T D;  3RK2 C;  1IFD A;  1LT9 A;  1LT9 B;  5AW9 B;  5AVQ B;  1NHL A;  1AFO A;  2YO3 A;  1Z3U A;  1HGZ A;  4M7F A;  2P7J A;  1JTH B;  1JTH A;  1LTJ A;  1L0N K;  1LTJ B;  5CHX A;  3T97 A;  4XA4 A;  5CCG C;  1DH3 A;  1JY3 P;  3A2A A;  5AW1 B;  2J0Y A;  3TYY A;  5APX A;  2OYH C;  3L35 A;  4KHX A;  5AVV B;  1WRG A;  3BRT B;  3M91 A;  2O1K A;  1FIB A;  1H89 A;  2L5G B;  3HUS B;  3HUS A;  1FDM A;  1HUC A;  3M06 A;  3BRV B;  1LGH B;  2JEE A;  1RF1 C;  3N4X A;  1IO4 A;  3NMD A;  1RF0 A;  1RF0 B;  2KYV A;  2CPB A;  2NPS D;  2HPC A;  2HPC B;  1SFC A;  2WPQ A;  2Q9I C;  1SP4 A;  1YTZ I;  3V2P A;  1GK4 A;  3TSI A;  1LTT C;  2PP6 A;  1ZR4 A;  1J2J B;  1FOS E;  3G3Z A;  1FZF C;  1JY3 N;  1FU1 A;  4W7Z A;  1FZE C;  1FID A;  1T8Z A;  1GU5 A;  1GTW A;  2JJL A;  5AVW B;  3U1C A;  3VMZ A;  1W2E A;  1SQB K;  1FZD A;  1G1I A;  3B5N C;  5AVS B;  5KTB A;  1J1D B;  1J1E C;  2M8R A;  3NXS A;  2JHK F;  2YNY A;  2N1T B;  2N1T A;  2YKO A;  4XE5 B;  1S9K D;  3KDP B;  5KJ7 D;  3V2N A;  1FZC A;  1FZC B;  3MIW A;  1G2C B;  1G2C A;  1FZB A;  2A45 I;  1FZB B;  2WWW A;  2H43 A;  2H43 B;  5AVU B;  5CJ4 A;  1HH0 A;  3P7K A;  1KFN A;  2HG5 D;  2FKW B;  2HLO A;  1QL1 A;  2R32 A;  1JY2 P;  4IFD K;  2HLO B;  2I1K A;  1JNM A;  1ZV8 A;  1L4A C;  1URQ C;  3OJA B;  1GW4 A;  5CCH A;  1Z56 A;  4HYT B;  3EQ2 A;  2JHM F;  2C9L Y;  3KYQ A;  2J3O A;  1LTJ C;  1FJK A;  1KIL D;  2M3B A;  3U1A A;  4HH2 A;  2QM7 A;  1NOH A;  3V4Q A;  1FJP A;  1FZA A;  1FZA B;  2XDJ A;  1T3U A;  1VDF A;  5AVX B;  2FYU K;  2I1J A;  1N73 A;  1N73 B;  2R5B A;  4O9B A;  5AW5 B;  2FIB A;  2W6A A;  3VOP A;  2NPS A;  3OAK A;  3TK1 A;  2MJZ A;  1KFM A;  1CI6 B;  1CI6 A;  3HUS C;  1IFJ A;  4LC1 A;  3U59 A;  3GHG A;  3GHG B;  5APS A;  5AW4 B;  1RF0 C;  1NKZ B;  2HPC C;  3RK2 D;  3P8C E;  2XZR A;  2J59 M;  2WSE H;  2ZXE B;  3RK3 C;  2OAR A;  2E43 A;  3V2R A;  1SQX K;  2W6B A;  4EIJ A;  1X9V A;  2JHH C;  4ZFG A;  3FIB A;  3P32 A;  3MD0 A;  5CCG D;  3LW5 H;  2KSJ A;  1VPC A;  5KJ7 A;  1LWU A;  1LWU B;  2KB7 P;  1N7S B;  1N7S A;  2J60 A;  3KPE A;  1J1D C;  1HTL C;  4R9T A;  2C0X A;  1RY3 A;  2JHL F;  2Q3I A;  2N1T C;  1XTC C;  4W80 A;  4N78 E;  4N6J A;  2KP8 A;  3IFM A;  1N86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...