1RE3C

Crystal structure of fragment d of bbetad398a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
288
structure length
288
Chain Sequence
SIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E chain
publication title BbetaGlu397 and BbetaAsp398 but not BbetaAsp432 are required for "B:b" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 82
structure length 288
sequence length 288
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1re3C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1re3C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1re3C03
1RE4A 2Q9IC 2H43B 1FZFC 2J0HA 3GHGC 2FFDB 2XNXB 4M7HA 1FZCB 1Z3UA 3BVHB 2OYIC 2J2PA 2Q9IA 1FZFA 3GHGA 4NYTA 2HLOB 2J64A 1FZGC 2OYIA 1FZAB 2FIBA 2J3GA 4JZCA 1FZGA 4R9JA 2JHIF 1T3UA 1RF1C 1LT9B 4M7FA 1JY2P 2J0GA 2A45G 1RF1A 1M1JC 1RE3B 2J3FA 1M1JA 2J3OA 2OYHC 1LTJB 1FZBC 2J1GA 2A45H 2J3FD 2J0YA 2J61A 2A45I 2OYHA 1FZEC 1FZBA 1N86C 3HUSC 2J60A 1JY3P 4EPUA 2JHKF 1N86A 1FZEA 1LWUB 3HUSA 3E1IB 2H43C 2GY7A 2FFDC 2XNXC 1FZCC 2WNPF 1FIBA 3BVHC 2Z4EB 2H43A 2XNXA 2FFDA 3H32B 2HLOC 1FZCA 1N73B 3BVHA 1FZAC 2HPCB 1JC9A 1FZDA 2HLOA 1RE4C 2J3UA 1FZAA 1LT9C 1FICA 2HODB 1LT9A 1RE3C 1RF0B 1LTJC 4ZFGA 1RE3A 1RE4B 1LTJA 1JY2O 2Q9IB 1FZFB 1LWUC 3E1IC 3GHGB 2J5ZA 2OYIB 2Z4EC 1LWUA 3E1IA 3FIBA 1W2EA 1FZGB 1Z3SA 3H32C 2JHMF 1N73C 1JY2N 4R9TA 2Z4EA 2HPCC 3H32A 1N73A 1RF1B 1JY3O 1FIDA 2HPCA 2HODC 1M1JB 2JHHC 1RF0C 2HODA 2JHLF 2J61B 1JY3N 2OYHB 1FZBB 1RF0A 2D39A 1N86B 1FZEB 3HUSB 4JYOX
chains in the Genus database with same CATH superfamily
1YQ3C 1MUUA 5CBOA 3L4FA 2HYNA 2QIWA 2J0GA 1OVVA 1KB9D 2ZJSE 2D2CC 3R2PA 1S3JA 2WPSA 1VQLP 2E76B 5KAIE 2D2CD 1YTZI 2Q3EA 2QM8A 2J58A 5AW0B 1KN7A 4BRYB 3CXHH 2P10A 1KQFB 1N86A 1NTKK 1T2KC 3E1IB 4MN4C 1LGHB 4A7PA 1S5LE 3AECC 2YO2A 4WY4B 2FYUE 5APVA 1PFIA 1SQQE 1P84E 1LP1A 2BCCJ 1ZLLA 2FYUG 1SQQG 4WVZA 2WSEJ 2P58A 3H1ID 2QRXA 2E75B 4IFMA 4PJ0E 1NAFA 3I56P 1USDA 5KAFH 1BGYD 2JEEA 1JTHB 2Q5UA 1ZXGA 2VRSA 2LKMA 3H1HJ 2D39A 2WT7A 1GW4A 3RK2C 2AXTH 3CX5D 1IFJA 1JEKA 2H43B 2WWWA 2J0HA 3H1KE 1SS1A 3II6A 3BVHB 2W6AA 4AQRD 3RK2D 1DD3A 2OYIA 3H1KG 3CCUP 1FZGA 1OX3A 4NPEA 1A02J 1VF5B 4IL6E 5CCHC 1ZW0A 2J1GA 4WB4A 1S2EA 3HE5A 5CCHD 1HGVA 3L70D 2O1JA 3JCUE 1E79H 2QJYB 4I1LA 5KLVD 3FWNA 1KMIZ 1FZDA 1LT9C 1FICA 3W67A 4U3FG 4PD4H 1LTJC 4RJTA 2J5ZA 2HR3A 4BRYA 5KTBA 4CPGA 3E1IA 2A06D 3OA7A 3G4SP 1R8EA 1LTAC 1JY3O 2WSSH 4WY4A 1DX7A 1R5LA 1YHQP 1BGYJ 3IAOA 1SQPK 1EDJA 1L0LK 3AE9C 1RE4C 3KYQA 2XDJA 3CCJP 2CPBA 3NFQA 2M3BA 4L75A 2HLOB 4H13C 4JZCA 2KLVA 2RN0A 1NU1K 2JP3A 2WITA 4U7JA 1URQC 2W6JH 3CC2P 1JTHA 2OYHC 2SPZA 1KQLA 2GUVA 1URQD 2N1TC 4C46A 4D6TJ 3CXHI 5CBNA 2O01H 1CW5A 2H43A 3VOPA 3L70J 2N1TD 2M3EA 1FOSE 3KZIH 1QGKB 3BVHA 3RK3E 1GMJA 2H88C 1RHZB 5KLVJ 4NPFX 4W7YA 1JMBA 4YXWH 2JKVA 1YI2P 4HB1A 2PGDA 2FYUD 1M1KQ 1LTTC 4B86A 1LTGC 4H44C 1SQQD 3S4RA 1H8AA 5CMZA 3KHUA 1IFMA 2CPSA 5AW3B 3R4YA 2IBZE 2LR2A 2BCCE 4H44D 1GU5A 3D6YA 2IBZG 2BCCG 1EDIA 3GF3A 3H32C 2ZYGA 1GDTA 2R44A 3SFEC 1LTSC 4AUWA 3GF7A 2HODC 3AEBC 2GM4A 1JOCA 2C9NY 1HUCA 1M90Q 1BE3J 1YQ4C 2C0XA 4JYOX 2AEJA 1EZVI 3HD7C 3ABVC 3PTZA 3A2AA 1GL2B 2WZ7A 3HD7D 3H1KD 1VQ8P 1KFNA 2WPVB 4GDOA 2JHIF 3AE8C 4M7FA 1LTIC 1RQUA 1RE3B 3A0BE 2E74C 3C1LA 1JCCA 2FFDC 2E74D 1NWQA 2C9LY 2M5AB 5CJ0A 1NVOA 3WU2H 3FGAD 2FKWB 3M9BA 2HLOA 2KOGA 4NPDA 1NGMB 1KTMA 4EOTA 5APUA 2YKPA 1JUNA 2J59M 3CI9A 2YO3A 4KT0J 5DJUB 2B88A 4PD4I 1SFCB 4Y28J 1RY3A 4DJGA 4H0LC 1R5SA 4XFJA 5KLIB 2J5UA 2H89C 1YJWP 1Z3SA 1HJ0A 1NKNA 1N2DC 4H0LD 4IOIH 1EDLA 1L0NK 1KFMA 2JHHC 1SQVE 2JO1A 3D6ZA 1IK9A 3HUSB 3TSIA 1BGYE 4L73A 1KB9H 3CMAP 1FZFC 3MUDA 2ZFCA 2Q7CA 1BGYG 2J2PA 2OYOA 1SLQA 1XTGB 1M8OB 1J1EB 4XA4A 1JY2P 3EFFK 1KYOD 3FXDA 1ZR4A 5AW6B 2I1JA 1WRGA 2A45H 1SQBD 2WPQA 1AJYA 2ZT9B 2Y9YA 2NRGA 4Y99C 3VMYA 4K3AA 3RK3C 4EI2A 4D6TE 1FS0E 1GL2A 1H88A 3L37A 4D6TG 3L70E 3RK3D 2R5BA 2QJKB 3L70G 4N3YB 1AQTA 1RE3A 5KLVE 1FBMA 1M7LA 5KLVG 3HTKB 1ZP0C 3AEEC 2IBZD 5E79H 2BCCD 5M1BA 3Q5PA 1M57D 2OQQA 2M5AA 2HPCC 2XKMA 4IFFA 3CX5H 1VQKP 1CI6B 4I6MC 3A0HE 1RF0C 5GTHE 4JQ0D 1FZEB 2Y9ZA 3VP8A 1NKZB 1SFCA 2QVAA 3CL3D 3V2PA 1IC2A 1BE3E 2FYNB 3D70A 1N8RQ 1FZAB 1BE3G 2JWAA 1N7SC 3D71A 1KZUB 2LXCB 5AW2B 1M1JC 1N7SD 2J3FA 3OAKA 2J3OA 1BCCD 1FZBC 1QL2A 3NMDA 5AW7B 2J0YA 4OGQC 2L91A 2IPPA 3TYYA 3HUSA 1SQBJ 2WSFH 2WNPF 2M0BA 4OGQD 3ITKA 3B5NB 4DOJA 1K9MQ 1VQNP 2Y0DA 3RGUA 2Z5IA 2KYVA 1YJ9P 1ZRTE 3PLNA 1JO5A 2QJPC 1PP9D 2AEFA 1J1DC 5KAFE 4UB6E 1BDCA 5CCGC 3AEDC 1T6AA 2LXBA 2XU6A 2Q9IB 5TISE 1CZQA 5CCGD 2G8YA 2FYZA 3HE4B 2FBWC 2RKLA 3RL0B 5EFWB 1EXIA 1LT1A 4GOEA 4I7ZC 3M0DC 3AE7C 3G71P 4DT0A 1SQVD 2MJZA 1KB9I 2KI7B 3GHGC 5KKZB 1N7LA 3HTKA 2BASA 4XE5B 5AVZB 1RF1C 1GTWA 3CWBJ 2Z5HA 3M9HA 2NZ2A 5APQA 2G3AA 2K1AA 1CI6A 3VP9A 1PL5A 2NPSC 2A45I 1ZV8A 3L71J 2I8DA 1GU4A 2KLUA 1FZEA 2GA1A 1BCCJ 2OARA 2YIUB 5AW1B 2XNXC 2NPSD 1FZCC 1QEXA 4WBAA 4OWFA 3LW5J 3WUTA 1P84H 4GIFA 3H1LE 4N78E 1JC9A 2K88A 4YXDC 5H2FE 1FZAA 2I1KA 3H1LG 1BSNA 2KP8A 3KQGA 4D6TD 1AQ5A 1NO4A 2QA4P 4M3LA 1JCDA 4ZMDA 1MFTA 2OTJP 1SP4A 2PFXA 1M56D 2IZ0A 1PP9J 1H0TB 1EXJA 3SWFA 1LWUC 2DW3A 1X22A 3BASA 1W2EA 3G3ZA 1SFCD 1NOHA 3IR9A 3B5NA 3RBXA 2PRRA 3CX5I 3TNUB 3NXSA 5BU5A 4O9BA 1IK7A 2KNCB 4EDFA 2OGUA 3U1AA 1PIXA 5B66E 2R3CA 2FYUK 1Y47A 1SQQK 2Q9IA 1SQXJ 1SQVJ 2K37A 1DH3A 1BE3D 1L4AB 1NTZJ 3HE4A 3Q3DA 3L72D 3JCUH 3N4XA 3CD6P 2K9YA 3KZIE 1FE6A 2IFMA 4RKUJ 1N86C 1JY3P 1OVUA 4PV1B 2WQYC 2P67A 1KYOE 3ZDMA 1W2BO 3K5BA 3L75E 3P8CD 4LGDE 2Z4EB 1Z56A 1S5LX 1N73B 2KS1B 3L75G 1SQBE 1K04A 2V7QH 2Q3IA 4ASWA 1SQBG 2W90A 3GMAA 1ZRTD 1NTME 1IFIA 3VN0A 1NTMG 1KC8Q 2E43A 1OXZA 2P2UA 3LIDA 1S4XA 2WSCH 1NTKJ 2JHMF 1IJDB 5L8RJ 2KSEA 2UWJE 2ZXEB 1QVGO 2W27A 2D2CB 3OW2O 1EZVD 5AVQB 5KJ7A 2IX7C 2YKOA 2XZRA 5GTIE 4TLFA 1G2CB 3M91A 1H0TA 1PGPA 2OYIC 1VQOP 5BU8B 1FZGC 2KSJA 3Q5RA 3H1JE 2FIBA 5APSA 5APYA 3FXEA 1VQMP 2IYOA 3TNUA 4IL6X 4BWNA 3PHLA 2KNCA 5APXA 3CWBE 3L72J 3USSA 2HFED 3CWBG 1FJKA 4LC1A 1Q81Q 2GY7A 1KILB 3JC22 3L71E 4ZKPA 2QG4A 2B87B 1BCCE 1P84I 3L71G 1EDKA 4EIJA 1NU1D 1OIPA 3IFMA 1BCCG 1L4AA 3H1LD 4N78D 3MTUE 2FXMA 2E76C 3B5ND 2KB7P 3AE1C 2XV5A 3CMEP 2WSEH 3RK2B 1JNMA 2JWDA 2E76D 3MP7B 3O8ZA 1USEA 3E1IC 4YTPC 3NTNA 2O01N 2Y0EA 4ZNCA 1RQVA 1PP9E 2IYPA 2Z4EA 4WY4C 2O3JA 4UB8H 1PP9G 5APWA 1N73A 2KS1A 1J2JB 2AXCA 4HYTB 4WY4D 3IF4A 2IDBA 2R32A 3SSUA 2ITAA 2FXPA 1WT6A 3P8MC 2E75C 4M7HA 2E5YA 5KKZC 1G1JA 2E75D 3QWOC 1PZQA 1LT9B 2YMYA 1SQXE 1PPJD 2A45G 3QH9A 1EC5A 1SQXG 1SQVG 1LTJB 1NTZE 1T8ZA 3VMZA 1GW3A 3RBZA 1SQPJ 1NTZG 1G2CA 1L0LJ 5AW9B 2Y0CA 2H43C 1PGQA 3BVHC 3PJSK 5BVZA 2W83C 2KUBA 1OZHA 3L75D 1UIIA 3SWKA 2BEZF 3B71A 2JDIH 3BATA 4IFDK 1ZOYC 1VF5C 1S1CX 2P1JA 5AVUB 3L73J 1NU1J 3FWLA 3UIAA 3H1LJ 1KV4A 1FU1A 3TK1A 1RE4B 1VF5D 1NTMD 1VL2A 1Q86Q 2QJYC 3CC7P 3MIWA 4H13B 1KILA 1L2PA 3V2RA 3KDPB 2B87A 1NTKE 3L36A 1URQB 1NTKG 5AVTB 5K5GB 2OYHB 1HVVA 1MV8A 2N1TB 3V4QA 1X9VA 2GUSA 3W68A 1MFZA 5AW8B 1FDOA 2KZJA 1KORA 3B8EB 3TGUD 2E42A 1DIPA 3PRJA 3H1JD 4HKZH 4H44B 2J60A 3AE3C 2H8PD 3CWBD 2YMKA 3A7OA 2V4HA 3V2NA 2O01J 3L72E 5AVSB 2QM7A 4C7NB 3H32B 2HLOC 3CXHE 3L72G 2L5GB 2WSCJ 3A3YB 3L71D 4PV1D 1WMKA 3Q5SA 2HODB 1K8AQ 1LT9A 3L75J 1MZ9A 3CC4P 5AVYB 3P8CE 2W8ZA 3U1CA 4OH8B 1LTJA 5CHXA 3HD7B 4YPCA 3AEFC 1OMIA 3WUUA 4L76A 1NTMJ 3MZWB 3A0HH 5GTHH 1NJIQ 1DEEG 1Q7YQ 4JPZB 1FDIA 1FOSF 1YITP 5B5EH 3EFGA 3WUVA 4DZOA 2H7HA 2E74B 3O6QB 1OW8A 3MUDC 2PAJA 1RE4A 2K9JB 2FFDB 3F89A 1LNQA 5AW4B 1EZVE 2AXTE 5KLVK 1X8YA 3E7KA 3L74E 4C7RA 1S9KE 1T3UA 1EZVG 1T2KD 2JR8A 3L74G 2ZYAA 3TDKA 4L74A 3TGUJ 1SQXD 1L0NJ 1URQA 3H1JJ 2OYHA 2IZ1A 1NTZD 1HTLC 1YTZT 4KJMA 2RH0A 4H0LB 2N1TA 4TT3H 3BCCJ 1SQPE 1GL2C 5KAIH 1L0LE 1KILC 1SQPG 4R4MA 1GL2D 1L0LG 4UB6H 3HRNA 1S5LH 2CK3H 1KILD 1RE3C 5TISH 1IO4A 1GK4A 4DCKA 4EYYQ 4BXLA 2ZXXA 1OVRA 3V4WA 5AVWB 3L73E 1FZFB 1NU1E 1OFCX 4PD4E 3H25A 1ZMEC 1A02F 3P7KA 1NHLA 3L73G 1NU1G 2M8RA 3AE6C 1JY2N 4K35A 3L35A 2WMMA 4C7NA 3H32A 1H89A 4PJ0H 1KQGB 3B4SA 3H6PA 5C39A 2HODA 2FY8A 1NTKD 3CCQP 2KK7A 1SFCC 3CCEP 3Q2YA 2R5DA 4Y99B 2ZAEB 1Z3UA 1Y9BA 3HD7A 5KLIC 2J64A 3RK3B 1CSBA 1YJNP 4R9JA 5AVVB 4JF7A 4U3FE 1QX8A 3CPWO 5TJHA 1HBWA 2J3FD 2MKVA 3HUSC 2N9BA 2YXQB 3GLMA 4JYBA 4EPUA 3O6QA 4IL6H 3EQ2A 1PPJE 3TF5A 5H2FH 1FIBA 2K9JA 2FFDA 1PGJA 1PPJG 1J1EC 2HPCB 1JB0J 3H1IJ 2IFNA 2XNDH 3CXHD 3PP5A 1LJ2A 1RF0B 2RMZA 3S1KA 3JSVC 3RL0g 4ZFGA 3C9IA 2N9YB 3E1RA 1MKMA 2ZT9C 2OTLP 1ZR2A 1QL1A 3MHVA 2KZIA 3BRVB 1K73Q 2ZT9D 4JBZA 1N7SB 5AW5B 2KXPB 3I55P 1VPCA 3IN6A 1M1JB 2K3RA 3F5HA 3OJAB 5B66H 2QSIA 2QJKC 1VQPP 1IFPA 2J61B 1FZBB 3T97B 4H13D 3V5BA 4W80A 1NYHA 4OGQB 3FX0A 4AYCA 1GZLA 1D7MA 1ZN5A 1VQ7P 2E5TA 2BEQD 3M9QA 1HGZA 1FZFA 3AE2C 3S9OA 3N7NA 4GODA 1Q2NA 3L74D 1S9KD 2QJPB 4LLHA 1J1DB 5APTA 1KYOH 1YBKA 1FZEC 4GKGA 1TU3F 3SFDC 3G6EP 3TGUE 1L0NE 1P84D 2WSFJ 1U7JA 3TGUG 1PV3A 2FYNC 3V2QA 1L0NG 4ASVA 3H1JG 1FZAC 1SQPD 1QLED 1U7MA 3BCCE 3GG2A 1L0LD 3WU2E 3BCCG 1DD4A 1X0TA 4I7ZB 5DJTB 4UB8E 3M06A 1IFNA 3GHGB 1KD1Q 4Z1MH 2Q1KA 3B5NC 3FIBA 3L73D 1HJBA 4N6JA 4PD4D 5AVRB 3H1HE 2QE7H 1RF1B 2B9BA 5GTIH 3MD0A 3CCVP 2HPCA 3H1HG 2QEXP 1DEBA 3SWYA 5CJ4A 3I5CA 4WWIA 3U59A 3WMM0 2NPSB 1RF0A 2YXRB 1SQBK 3Q1MA 1AA0A 1OW7A 1FAVA 3VTPC 1AFOA 2Q9IC 2FXOA 2XNXB 1Q90D 3VMAA 1FZCB 4RO0A 1Q82Q 1OW6A 1NTMK 1KB9E 3V6IA 1JMMA 1KQSO 1N7SA 1HF9A 3RL0C 3CCLP 3C8VA 1M1JA 1NH4A 4U3FD 3L74J 3RL0D 2J61A 1FZBA 4GT1A 3T97A 3GW6A 2JHKF 1LWUB 1FC2C 1AVYA 2WVRA 3LW5H 2FYUJ 3KXDA 3A0BH 1SQQJ 2W6BA 3CCMP 2J3UA 1NAYA 3P32A 1HWTC 2HG5D 1SVFA 1IZNB 4RESB 3H1IE 3LIEA 1VQ5P 1AVOA 1S72P 4W7ZA 3H1IG 1BDDA 2YNYA 1JY2O 3CCRP 1UIXA 5CCGA 2POHA 2KIKA 2YIUC 1VQ6P 1AV1A 1YYCA 1KILE 2Q6QA 2WPRA 2ZYDA 2ZVNB 1YIJP 1VQ4P 2YKQA 1FIDA 1PGOA 5E79E 1W5CE 5KJ7C 3AEAC 3AE5C 3AE4C 2JHLF 1JY3N 2AEMA 1BSHA 3CX5E 4R4LA 3H1KJ 3CCSP 5KJ7D 1N86B 4ZKUA 1X79B 2B89A 3M0DA 1K05A 2R3SA 1VDFA 3GHGA 4NYTA 2WTYA 4JYCA 2J3GA 4OVNF 1LP1B 2P7JA 1RF1A 1IFDA 3CLQA 3M0AA 4GOFA 1LTBC 1EQ7A 1KYOI 3BRTB 4I2LC 2NPSA 3EWKA 4U3FJ 2OTKE 1FJPA 3VMXA 2XNXA 1T3JA 1JM0A 1FZCA 1L0ND 1HH0A 1RH5B 1GD2E 1E5WA 1L4AC 1XTCC 3VYIA 3PH0A 2ZVOB 3G9RA 5CCHA 2V7QJ 1L4AD 3BCCD 2C0WA 2WT7B 3AEGC 5AVXB 1FDMA 1Y8AA 4HH2A 1VQ9P 4KHXA 4PV1C 1SQXK 2A06E 1SQVK 4QMAA 2OYIB 5B5EE 2Z4EC 1G1IA 1LWUA 2A06G 1NTZK 1FZGB 3A5TA 1N73C 4R9TA 1U57A 2IBZI 3MGNA 3KPEA 3H1HD 1GK6A 2JJLA 2O1KA 3HE5B 2PP6A 1QVFO 1OWAA 4HJGH
chains in the Genus database with same CATH topology
3TSIA 2R5DA 3M91A 4Y99B 1MUUA 1FZFC 3MUDA 2ZFCA 2Q7CA 1Z3UA 2OYIC 2J2PA 3HD7A 3L4FA 1SLQA 1XTGB 5BU8B 2J64A 1FZGC 3RK3B 1CSBA 2HYNA 2KSJA 2FIBA 1J1EB 5APSA 4R9JA 4XA4A 5APYA 5AVVB 1JY2P 2J0GA 3R2PA 4JF7A 1ZR4A 2WPSA 3TNUA 5AW6B 2I1JA 5APXA 1WRGA 2A45H 2J3FD 1HBWA 1YTZI 2WPQA 2QM8A 3HUSC 2N9BA 2J58A 2HFED 5AW0B 4JYBA 4EPUA 1FJKA 1N86A 1NTKK 4LC1A 4Y99C 1T2KC 3E1IB 2GY7A 3VMYA 3EQ2A 1LGHB 1KILB 1FIBA 2YO2A 2FFDA 4ZKPA 3RK3C 4WY4B 1GL2A 1J1EC 2HPCB 1H88A 4EIJA 2IFNA 3L37A 3IFMA 1L4AA 4N78D 3MTUE 3RK3D 2R5BA 5APVA 1PFIA 3PP5A 2FXMA 1RF0B 3B5ND 1ZLLA 4N3YB 2KB7P 4ZFGA 1RE3A 3C9IA 2XV5A 1FBMA 2WSEH 3RK2B 1M7LA 1JNMA 1ZR2A 1QL1A 3HTKB 3O8ZA 4IFMA 3E1IC 3NTNA 1NAFA 3BRVB 2Z4EA 4WY4C 1N7SB 2HPCC 5AW5B 2XKMA 4IFFA 5APWA 1N73A 1J2JB 2JEEA 4HYTB 1VPCA 1CI6B 1M1JB 1JTHB 4WY4D 3OJAB 4I6MC 2Q5UA 1RF0C 2J61B 2R32A 1FZBB 3V5BA 2VRSA 4W80A 2LKMA 2D39A 2WT7A 1FZEB 1GW4A 3RK2C 4AYCA 3VP8A 1NKZB 1SFCA 1GZLA 1WT6A 3P8MC 1IFJA 2H43B 2WWWA 1ZN5A 3CL3D 3V2PA 2J0HA 4M7HA 1IC2A 3II6A 3BVHB 2W6AA 4AQRD 3M9QA 3RK2D 1HGZA 1FZFA 2OYIA 1FZAB 1G1JA 1N7SC 1FZGA 1KZUB 1LT9B 2YMYA 3N7NA 2A45G 5AW2B 1A02J 1M1JC 1S9KD 5CCHC 1N7SD 4LLHA 2J3FA 1J1DB 3OAKA 2J3OA 1LTJB 1T8ZA 5APTA 3VMZA 1FZBC 2J1GA 4WB4A 1GW3A 1QL2A 3NMDA 5AW7B 2J0YA 3HE5A 1FZEC 5CCHD 1HGVA 4GKGA 1G2CA 2IPPA 2O1JA 5AW9B 3TYYA 3HUSA 2H43C 2WSFH 2WNPF 3BVHC 3B5NB 4DOJA 4I1LA 5BVZA 3V2QA 1FZAC 1FZDA 2Z5IA 2KYVA 1LT9C 3BATA 1FICA 1JO5A 4IFDK 2P1JA 5AVUB 1J1DC 1LTJC 3UIAA 1FU1A 3TK1A 1RE4B 5CCGC 3M06A 2XU6A 2Q9IB 1IFNA 1CZQA 3GHGB 2J5ZA 5KTBA 5CCGD 3E1IA 3B5NC 3FIBA 3MIWA 1HJBA 4N6JA 1KILA 5AVRB 2FYZA 3V2RA 3HE4B 3OA7A 1LTAC 1RF1B 1JY3O 3KDPB 4WY4A 1DX7A 3MD0A 2HPCA 3RL0B 1DEBA 3L36A 1URQB 3SWYA 5CJ4A 3I5CA 1SQPK 5AVTB 3U59A 3WMM0 2OYHB 2NPSB 1L0LK 1RF0A 3M0DC 1RE4C 1HVVA 1SQBK 1MV8A 2N1TB 1FAVA 3VTPC 3V4QA 1X9VA 1AFOA 2MJZA 3KYQA 2Q9IC 2XDJA 2CPBA 2GUSA 3GHGC 3NFQA 2XNXB 2M3BA 1FZCB 1N7LA 3HTKA 1MFZA 2BASA 2HLOB 1NTMK 5AW8B 4XE5B 4JZCA 3B8EB 1JMMA 5AVZB 1RF1C 2KLVA 1GTWA 2E42A 1N7SA 1NU1K 2Z5HA 3M9HA 2WITA 3RL0C 5APQA 1URQC 1CI6A 3VP9A 1M1JA 1JTHA 1NH4A 2OYHC 2NPSC 1KQLA 3RL0D 2A45I 2J60A 2GUVA 1FZBA 1ZV8A 4GT1A 3T97A 2J61A 1URQD 2N1TC 2H8PD 1GU4A 4C46A 2JHKF 1FZEA 1LWUB 2OARA 5AW1B 2XNXC 2NPSD 2O01H 3A7OA 1FZCC 3V2NA 4WBAA 1CW5A 5AVSB 2H43A 2QM7A 3VOPA 3LW5H 4C7NB 2N1TD 3H32B 1FOSE 2HLOC 3BVHA 4GIFA 4N78E 2L5GB 1JC9A 2W6BA 3A3YB 2J3UA 1FZAA 3P32A 2I1KA 3KQGA 2KP8A 1AQ5A 2HODB 1HWTC 2HG5D 4W7YA 1LT9A 1SVFA 1NO4A 1MZ9A 4RESB 5AVYB 4M3LA 1JCDA 3P8CE 1LTTC 3LIEA 4B86A 1LTGC 1SP4A 4W7ZA 3U1CA 4OH8B 5CMZA 1H8AA 1IFMA 1LTJA 2CPSA 5CHXA 5AW3B 2YNYA 1JY2O 3HD7B 3SWFA 5CCGA 2POHA 1LWUC 1YYCA 1GU5A 3BASA 1W2EA 3G3ZA 3H32C 2WPRA 1SFCD 1NOHA 3IR9A 3B5NA 1GDTA 1LTSC 2YKQA 1FIDA 4AUWA 1FOSF 3TNUB 2HODC 5KJ7C 3NXSA 5BU5A 4O9BA 3EFGA 2GM4A 1JOCA 4DZOA 2C9NY 2JHLF 1JY3N 2H7HA 1HUCA 3U1AA 2C0XA 5KJ7D 1N86B 4JYOX 4ZKUA 1X79B 3M0DA 2PAJA 2R3CA 1RE4A 2FYUK 3HD7C 2FFDB 1SQQK 3A2AA 5AW4B 2Q9IA 1VDFA 1GL2B 2WZ7A 3GHGA 4NYTA 2WTYA 1DH3A 5KLVK 3HD7D 4JYCA 2J3GA 1X8YA 1KFNA 1L4AB 4C7RA 1S9KE 2JHIF 1T3UA 4M7FA 3HE4A 1T2KD 1LTIC 2P7JA 1RF1A 1IFDA 3CLQA 3M0AA 1RE3B 3N4XA 1URQA 1LTBC 1EQ7A 2IFMA 3BRTB 2OYHA 1N86C 4I2LC 1JY3P 2NPSA 1HTLC 1YTZT 1JCCA 2P67A 2N1TA 2FFDC 1FJPA 1NWQA 2Z4EB 3P8CD 4LGDE 2C9LY 1Z56A 1GL2C 3VMXA 2XNXA 5CJ0A 1T3JA 1FZCA 1N73B 1HH0A 2FKWB 1GD2E 3M9BA 1E5WA 1KILC 1L4AC 1XTCC 2HLOA 2KOGA 3VYIA 1GL2D 2Q3IA 4EOTA 5CCHA 3HRNA 5APUA 2YKPA 1JUNA 2J59M 3CI9A 1KILD 1RE3C 2YO3A 1L4AD 2C0WA 2WT7B 1GK4A 1IO4A 1SFCB 1IFIA 5AVXB 1FDMA 4HH2A 3V4WA 4KHXA 1RY3A 5AVWB 3VN0A 1SQXK 1FZFB 1SQVK 2E43A 2OYIB 1OXZA 2P2UA 3LIDA 3P7KA 2WSCH 1A02F 2Z4EC 1NHLA 1G1IA 1LWUA 2M8RA 1NTZK 1Z3SA 1FZGB 3A5TA 1N73C 1JY2N 1IJDB 1NKNA 1N2DC 3L35A 2JHMF 4R9TA 4C7NA 2ZXEB 3H32A 1H89A 3MGNA 3KPEA 2W27A 1L0NK 3H6PA 1KFMA 1GK6A 2JJLA 2JHHC 2O1KA 2HODA 5AVQB 5KJ7A 3HE5B 2IX7C 2YKOA 2XZRA 2PP6A 1SFCC 1IK9A 1G2CB 1OWAA 3HUSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RE4 A;  2Q9I C;  2H43 B;  1FZF C;  2J0H A;  3GHG C;  2FFD B;  2XNX B;  4M7H A;  1FZC B;  1Z3U A;  3BVH B;  2OYI C;  2J2P A;  2Q9I A;  1FZF A;  3GHG A;  4NYT A;  2HLO B;  2J64 A;  1FZG C;  2OYI A;  1FZA B;  2FIB A;  2J3G A;  4JZC A;  1FZG A;  4R9J A;  2JHI F;  1T3U A;  1RF1 C;  1LT9 B;  4M7F A;  1JY2 P;  2J0G A;  2A45 G;  1RF1 A;  1M1J C;  1RE3 B;  2J3F A;  1M1J A;  2J3O A;  2OYH C;  1LTJ B;  1FZB C;  2J1G A;  2A45 H;  2J3F D;  2J0Y A;  2J61 A;  2A45 I;  2OYH A;  1FZE C;  1FZB A;  1N86 C;  3HUS C;  2J60 A;  1JY3 P;  4EPU A;  2JHK F;  1N86 A;  1FZE A;  1LWU B;  3HUS A;  3E1I B;  2H43 C;  2GY7 A;  2FFD C;  2XNX C;  1FZC C;  2WNP F;  1FIB A;  3BVH C;  2Z4E B;  2H43 A;  2XNX A;  2FFD A;  3H32 B;  2HLO C;  1FZC A;  1N73 B;  3BVH A;  1FZA C;  2HPC B;  1JC9 A;  1FZD A;  2HLO A;  1RE4 C;  2J3U A;  1FZA A;  1LT9 C;  1FIC A;  2HOD B;  1LT9 A;  1RE3 C;  1RF0 B;  1LTJ C;  4ZFG A;  1RE3 A;  1RE4 B;  1LTJ A;  1JY2 O;  2Q9I B;  1FZF B;  1LWU C;  3E1I C;  3GHG B;  2J5Z A;  2OYI B;  2Z4E C;  1LWU A;  3E1I A;  3FIB A;  1W2E A;  1FZG B;  1Z3S A;  3H32 C;  2JHM F;  1N73 C;  1JY2 N;  4R9T A;  2Z4E A;  2HPC C;  3H32 A;  1N73 A;  1RF1 B;  1JY3 O;  1FID A;  2HPC A;  2HOD C;  1M1J B;  2JHH C;  1RF0 C;  2HOD A;  2JHL F;  2J61 B;  1JY3 N;  2OYH B;  1FZB B;  1RF0 A;  2D39 A;  1N86 B;  1FZE B;  3HUS B;  4JYO X; 
#chains in the Genus database with same CATH topology
 1YQ3 C;  1MUU A;  5CBO A;  3L4F A;  2HYN A;  2QIW A;  2J0G A;  1OVV A;  1KB9 D;  2ZJS E;  2D2C C;  3R2P A;  1S3J A;  2WPS A;  1VQL P;  2E76 B;  5KAI E;  2D2C D;  1YTZ I;  2Q3E A;  2QM8 A;  2J58 A;  5AW0 B;  1KN7 A;  4BRY B;  3CXH H;  2P10 A;  1KQF B;  1N86 A;  1NTK K;  1T2K C;  3E1I B;  4MN4 C;  1LGH B;  4A7P A;  1S5L E;  3AEC C;  2YO2 A;  4WY4 B;  2FYU E;  5APV A;  1PFI A;  1SQQ E;  1P84 E;  1LP1 A;  2BCC J;  1ZLL A;  2FYU G;  1SQQ G;  4WVZ A;  2WSE J;  2P58 A;  3H1I D;  2QRX A;  2E75 B;  4IFM A;  4PJ0 E;  1NAF A;  3I56 P;  1USD A;  5KAF H;  1BGY D;  2JEE A;  1JTH B;  2Q5U A;  1ZXG A;  2VRS A;  2LKM A;  3H1H J;  2D39 A;  2WT7 A;  1GW4 A;  3RK2 C;  2AXT H;  3CX5 D;  1IFJ A;  1JEK A;  2H43 B;  2WWW A;  2J0H A;  3H1K E;  1SS1 A;  3II6 A;  3BVH B;  2W6A A;  4AQR D;  3RK2 D;  1DD3 A;  2OYI A;  3H1K G;  3CCU P;  1FZG A;  1OX3 A;  4NPE A;  1A02 J;  1VF5 B;  4IL6 E;  5CCH C;  1ZW0 A;  2J1G A;  4WB4 A;  1S2E A;  3HE5 A;  5CCH D;  1HGV A;  3L70 D;  2O1J A;  3JCU E;  1E79 H;  2QJY B;  4I1L A;  5KLV D;  3FWN A;  1KMI Z;  1FZD A;  1LT9 C;  1FIC A;  3W67 A;  4U3F G;  4PD4 H;  1LTJ C;  4RJT A;  2J5Z A;  2HR3 A;  4BRY A;  5KTB A;  4CPG A;  3E1I A;  2A06 D;  3OA7 A;  3G4S P;  1R8E A;  1LTA C;  1JY3 O;  2WSS H;  4WY4 A;  1DX7 A;  1R5L A;  1YHQ P;  1BGY J;  3IAO A;  1SQP K;  1EDJ A;  1L0L K;  3AE9 C;  1RE4 C;  3KYQ A;  2XDJ A;  3CCJ P;  2CPB A;  3NFQ A;  2M3B A;  4L75 A;  2HLO B;  4H13 C;  4JZC A;  2KLV A;  2RN0 A;  1NU1 K;  2JP3 A;  2WIT A;  4U7J A;  1URQ C;  2W6J H;  3CC2 P;  1JTH A;  2OYH C;  2SPZ A;  1KQL A;  2GUV A;  1URQ D;  2N1T C;  4C46 A;  4D6T J;  3CXH I;  5CBN A;  2O01 H;  1CW5 A;  2H43 A;  3VOP A;  3L70 J;  2N1T D;  2M3E A;  1FOS E;  3KZI H;  1QGK B;  3BVH A;  3RK3 E;  1GMJ A;  2H88 C;  1RHZ B;  5KLV J;  4NPF X;  4W7Y A;  1JMB A;  4YXW H;  2JKV A;  1YI2 P;  4HB1 A;  2PGD A;  2FYU D;  1M1K Q;  1LTT C;  4B86 A;  1LTG C;  4H44 C;  1SQQ D;  3S4R A;  1H8A A;  5CMZ A;  3KHU A;  1IFM A;  2CPS A;  5AW3 B;  3R4Y A;  2IBZ E;  2LR2 A;  2BCC E;  4H44 D;  1GU5 A;  3D6Y A;  2IBZ G;  2BCC G;  1EDI A;  3GF3 A;  3H32 C;  2ZYG A;  1GDT A;  2R44 A;  3SFE C;  1LTS C;  4AUW A;  3GF7 A;  2HOD C;  3AEB C;  2GM4 A;  1JOC A;  2C9N Y;  1HUC A;  1M90 Q;  1BE3 J;  1YQ4 C;  2C0X A;  4JYO X;  2AEJ A;  1EZV I;  3HD7 C;  3ABV C;  3PTZ A;  3A2A A;  1GL2 B;  2WZ7 A;  3HD7 D;  3H1K D;  1VQ8 P;  1KFN A;  2WPV B;  4GDO A;  2JHI F;  3AE8 C;  4M7F A;  1LTI C;  1RQU A;  1RE3 B;  3A0B E;  2E74 C;  3C1L A;  1JCC A;  2FFD C;  2E74 D;  1NWQ A;  2C9L Y;  2M5A B;  5CJ0 A;  1NVO A;  3WU2 H;  3FGA D;  2FKW B;  3M9B A;  2HLO A;  2KOG A;  4NPD A;  1NGM B;  1KTM A;  4EOT A;  5APU A;  2YKP A;  1JUN A;  2J59 M;  3CI9 A;  2YO3 A;  4KT0 J;  5DJU B;  2B88 A;  4PD4 I;  1SFC B;  4Y28 J;  1RY3 A;  4DJG A;  4H0L C;  1R5S A;  4XFJ A;  5KLI B;  2J5U A;  2H89 C;  1YJW P;  1Z3S A;  1HJ0 A;  1NKN A;  1N2D C;  4H0L D;  4IOI H;  1EDL A;  1L0N K;  1KFM A;  2JHH C;  1SQV E;  2JO1 A;  3D6Z A;  1IK9 A;  3HUS B;  3TSI A;  1BGY E;  4L73 A;  1KB9 H;  3CMA P;  1FZF C;  3MUD A;  2ZFC A;  2Q7C A;  1BGY G;  2J2P A;  2OYO A;  1SLQ A;  1XTG B;  1M8O B;  1J1E B;  4XA4 A;  1JY2 P;  3EFF K;  1KYO D;  3FXD A;  1ZR4 A;  5AW6 B;  2I1J A;  1WRG A;  2A45 H;  1SQB D;  2WPQ A;  1AJY A;  2ZT9 B;  2Y9Y A;  2NRG A;  4Y99 C;  3VMY A;  4K3A A;  3RK3 C;  4EI2 A;  4D6T E;  1FS0 E;  1GL2 A;  1H88 A;  3L37 A;  4D6T G;  3L70 E;  3RK3 D;  2R5B A;  2QJK B;  3L70 G;  4N3Y B;  1AQT A;  1RE3 A;  5KLV E;  1FBM A;  1M7L A;  5KLV G;  3HTK B;  1ZP0 C;  3AEE C;  2IBZ D;  5E79 H;  2BCC D;  5M1B A;  3Q5P A;  1M57 D;  2OQQ A;  2M5A A;  2HPC C;  2XKM A;  4IFF A;  3CX5 H;  1VQK P;  1CI6 B;  4I6M C;  3A0H E;  1RF0 C;  5GTH E;  4JQ0 D;  1FZE B;  2Y9Z A;  3VP8 A;  1NKZ B;  1SFC A;  2QVA A;  3CL3 D;  3V2P A;  1IC2 A;  1BE3 E;  2FYN B;  3D70 A;  1N8R Q;  1FZA B;  1BE3 G;  2JWA A;  1N7S C;  3D71 A;  1KZU B;  2LXC B;  5AW2 B;  1M1J C;  1N7S D;  2J3F A;  3OAK A;  2J3O A;  1BCC D;  1FZB C;  1QL2 A;  3NMD A;  5AW7 B;  2J0Y A;  4OGQ C;  2L91 A;  2IPP A;  3TYY A;  3HUS A;  1SQB J;  2WSF H;  2WNP F;  2M0B A;  4OGQ D;  3ITK A;  3B5N B;  4DOJ A;  1K9M Q;  1VQN P;  2Y0D A;  3RGU A;  2Z5I A;  2KYV A;  1YJ9 P;  1ZRT E;  3PLN A;  1JO5 A;  2QJP C;  1PP9 D;  2AEF A;  1J1D C;  5KAF E;  4UB6 E;  1BDC A;  5CCG C;  3AED C;  1T6A A;  2LXB A;  2XU6 A;  2Q9I B;  5TIS E;  1CZQ A;  5CCG D;  2G8Y A;  2FYZ A;  3HE4 B;  2FBW C;  2RKL A;  3RL0 B;  5EFW B;  1EXI A;  1LT1 A;  4GOE A;  4I7Z C;  3M0D C;  3AE7 C;  3G71 P;  4DT0 A;  1SQV D;  2MJZ A;  1KB9 I;  2KI7 B;  3GHG C;  5KKZ B;  1N7L A;  3HTK A;  2BAS A;  4XE5 B;  5AVZ B;  1RF1 C;  1GTW A;  3CWB J;  2Z5H A;  3M9H A;  2NZ2 A;  5APQ A;  2G3A A;  2K1A A;  1CI6 A;  3VP9 A;  1PL5 A;  2NPS C;  2A45 I;  1ZV8 A;  3L71 J;  2I8D A;  1GU4 A;  2KLU A;  1FZE A;  2GA1 A;  1BCC J;  2OAR A;  2YIU B;  5AW1 B;  2XNX C;  2NPS D;  1FZC C;  1QEX A;  4WBA A;  4OWF A;  3LW5 J;  3WUT A;  1P84 H;  4GIF A;  3H1L E;  4N78 E;  1JC9 A;  2K88 A;  4YXD C;  5H2F E;  1FZA A;  2I1K A;  3H1L G;  1BSN A;  2KP8 A;  3KQG A;  4D6T D;  1AQ5 A;  1NO4 A;  2QA4 P;  4M3L A;  1JCD A;  4ZMD A;  1MFT A;  2OTJ P;  1SP4 A;  2PFX A;  1M56 D;  2IZ0 A;  1PP9 J;  1H0T B;  1EXJ A;  3SWF A;  1LWU C;  2DW3 A;  1X22 A;  3BAS A;  1W2E A;  3G3Z A;  1SFC D;  1NOH A;  3IR9 A;  3B5N A;  3RBX A;  2PRR A;  3CX5 I;  3TNU B;  3NXS A;  5BU5 A;  4O9B A;  1IK7 A;  2KNC B;  4EDF A;  2OGU A;  3U1A A;  1PIX A;  5B66 E;  2R3C A;  2FYU K;  1Y47 A;  1SQQ K;  2Q9I A;  1SQX J;  1SQV J;  2K37 A;  1DH3 A;  1BE3 D;  1L4A B;  1NTZ J;  3HE4 A;  3Q3D A;  3L72 D;  3JCU H;  3N4X A;  3CD6 P;  2K9Y A;  3KZI E;  1FE6 A;  2IFM A;  4RKU J;  1N86 C;  1JY3 P;  1OVU A;  4PV1 B;  2WQY C;  2P67 A;  1KYO E;  3ZDM A;  1W2B O;  3K5B A;  3L75 E;  3P8C D;  4LGD E;  2Z4E B;  1Z56 A;  1S5L X;  1N73 B;  2KS1 B;  3L75 G;  1SQB E;  1K04 A;  2V7Q H;  2Q3I A;  4ASW A;  1SQB G;  2W90 A;  3GMA A;  1ZRT D;  1NTM E;  1IFI A;  3VN0 A;  1NTM G;  1KC8 Q;  2E43 A;  1OXZ A;  2P2U A;  3LID A;  1S4X A;  2WSC H;  1NTK J;  2JHM F;  1IJD B;  5L8R J;  2KSE A;  2UWJ E;  2ZXE B;  1QVG O;  2W27 A;  2D2C B;  3OW2 O;  1EZV D;  5AVQ B;  5KJ7 A;  2IX7 C;  2YKO A;  2XZR A;  5GTI E;  4TLF A;  1G2C B;  3M91 A;  1H0T A;  1PGP A;  2OYI C;  1VQO P;  5BU8 B;  1FZG C;  2KSJ A;  3Q5R A;  3H1J E;  2FIB A;  5APS A;  5APY A;  3FXE A;  1VQM P;  2IYO A;  3TNU A;  4IL6 X;  4BWN A;  3PHL A;  2KNC A;  5APX A;  3CWB E;  3L72 J;  3USS A;  2HFE D;  3CWB G;  1FJK A;  4LC1 A;  1Q81 Q;  2GY7 A;  1KIL B;  3JC2 2;  3L71 E;  4ZKP A;  2QG4 A;  2B87 B;  1BCC E;  1P84 I;  3L71 G;  1EDK A;  4EIJ A;  1NU1 D;  1OIP A;  3IFM A;  1BCC G;  1L4A A;  3H1L D;  4N78 D;  3MTU E;  2FXM A;  2E76 C;  3B5N D;  2KB7 P;  3AE1 C;  2XV5 A;  3CME P;  2WSE H;  3RK2 B;  1JNM A;  2JWD A;  2E76 D;  3MP7 B;  3O8Z A;  1USE A;  3E1I C;  4YTP C;  3NTN A;  2O01 N;  2Y0E A;  4ZNC A;  1RQV A;  1PP9 E;  2IYP A;  2Z4E A;  4WY4 C;  2O3J A;  4UB8 H;  1PP9 G;  5APW A;  1N73 A;  2KS1 A;  1J2J B;  2AXC A;  4HYT B;  4WY4 D;  3IF4 A;  2IDB A;  2R32 A;  3SSU A;  2ITA A;  2FXP A;  1WT6 A;  3P8M C;  2E75 C;  4M7H A;  2E5Y A;  5KKZ C;  1G1J A;  2E75 D;  3QWO C;  1PZQ A;  1LT9 B;  2YMY A;  1SQX E;  1PPJ D;  2A45 G;  3QH9 A;  1EC5 A;  1SQX G;  1SQV G;  1LTJ B;  1NTZ E;  1T8Z A;  3VMZ A;  1GW3 A;  3RBZ A;  1SQP J;  1NTZ G;  1G2C A;  1L0L J;  5AW9 B;  2Y0C A;  2H43 C;  1PGQ A;  3BVH C;  3PJS K;  5BVZ A;  2W83 C;  2KUB A;  1OZH A;  3L75 D;  1UII A;  3SWK A;  2BEZ F;  3B71 A;  2JDI H;  3BAT A;  4IFD K;  1ZOY C;  1VF5 C;  1S1C X;  2P1J A;  5AVU B;  3L73 J;  1NU1 J;  3FWL A;  3UIA A;  3H1L J;  1KV4 A;  1FU1 A;  3TK1 A;  1RE4 B;  1VF5 D;  1NTM D;  1VL2 A;  1Q86 Q;  2QJY C;  3CC7 P;  3MIW A;  4H13 B;  1KIL A;  1L2P A;  3V2R A;  3KDP B;  2B87 A;  1NTK E;  3L36 A;  1URQ B;  1NTK G;  5AVT B;  5K5G B;  2OYH B;  1HVV A;  1MV8 A;  2N1T B;  3V4Q A;  1X9V A;  2GUS A;  3W68 A;  1MFZ A;  5AW8 B;  1FDO A;  2KZJ A;  1KOR A;  3B8E B;  3TGU D;  2E42 A;  1DIP A;  3PRJ A;  3H1J D;  4HKZ H;  4H44 B;  2J60 A;  3AE3 C;  2H8P D;  3CWB D;  2YMK A;  3A7O A;  2V4H A;  3V2N A;  2O01 J;  3L72 E;  5AVS B;  2QM7 A;  4C7N B;  3H32 B;  2HLO C;  3CXH E;  3L72 G;  2L5G B;  2WSC J;  3A3Y B;  3L71 D;  4PV1 D;  1WMK A;  3Q5S A;  2HOD B;  1K8A Q;  1LT9 A;  3L75 J;  1MZ9 A;  3CC4 P;  5AVY B;  3P8C E;  2W8Z A;  3U1C A;  4OH8 B;  1LTJ A;  5CHX A;  3HD7 B;  4YPC A;  3AEF C;  1OMI A;  3WUU A;  4L76 A;  1NTM J;  3MZW B;  3A0H H;  5GTH H;  1NJI Q;  1DEE G;  1Q7Y Q;  4JPZ B;  1FDI A;  1FOS F;  1YIT P;  5B5E H;  3EFG A;  3WUV A;  4DZO A;  2H7H A;  2E74 B;  3O6Q B;  1OW8 A;  3MUD C;  2PAJ A;  1RE4 A;  2K9J B;  2FFD B;  3F89 A;  1LNQ A;  5AW4 B;  1EZV E;  2AXT E;  5KLV K;  1X8Y A;  3E7K A;  3L74 E;  4C7R A;  1S9K E;  1T3U A;  1EZV G;  1T2K D;  2JR8 A;  3L74 G;  2ZYA A;  3TDK A;  4L74 A;  3TGU J;  1SQX D;  1L0N J;  1URQ A;  3H1J J;  2OYH A;  2IZ1 A;  1NTZ D;  1HTL C;  1YTZ T;  4KJM A;  2RH0 A;  4H0L B;  2N1T A;  4TT3 H;  3BCC J;  1SQP E;  1GL2 C;  5KAI H;  1L0L E;  1KIL C;  1SQP G;  4R4M A;  1GL2 D;  1L0L G;  4UB6 H;  3HRN A;  1S5L H;  2CK3 H;  1KIL D;  1RE3 C;  5TIS H;  1IO4 A;  1GK4 A;  4DCK A;  4EYY Q;  4BXL A;  2ZXX A;  1OVR A;  3V4W A;  5AVW B;  3L73 E;  1FZF B;  1NU1 E;  1OFC X;  4PD4 E;  3H25 A;  1ZME C;  1A02 F;  3P7K A;  1NHL A;  3L73 G;  1NU1 G;  2M8R A;  3AE6 C;  1JY2 N;  4K35 A;  3L35 A;  2WMM A;  4C7N A;  3H32 A;  1H89 A;  4PJ0 H;  1KQG B;  3B4S A;  3H6P A;  5C39 A;  2HOD A;  2FY8 A;  1NTK D;  3CCQ P;  2KK7 A;  1SFC C;  3CCE P;  3Q2Y A;  2R5D A;  4Y99 B;  2ZAE B;  1Z3U A;  1Y9B A;  3HD7 A;  5KLI C;  2J64 A;  3RK3 B;  1CSB A;  1YJN P;  4R9J A;  5AVV B;  4JF7 A;  4U3F E;  1QX8 A;  3CPW O;  5TJH A;  1HBW A;  2J3F D;  2MKV A;  3HUS C;  2N9B A;  2YXQ B;  3GLM A;  4JYB A;  4EPU A;  3O6Q A;  4IL6 H;  3EQ2 A;  1PPJ E;  3TF5 A;  5H2F H;  1FIB A;  2K9J A;  2FFD A;  1PGJ A;  1PPJ G;  1J1E C;  2HPC B;  1JB0 J;  3H1I J;  2IFN A;  2XND H;  3CXH D;  3PP5 A;  1LJ2 A;  1RF0 B;  2RMZ A;  3S1K A;  3JSV C;  3RL0 g;  4ZFG A;  3C9I A;  2N9Y B;  3E1R A;  1MKM A;  2ZT9 C;  2OTL P;  1ZR2 A;  1QL1 A;  3MHV A;  2KZI A;  3BRV B;  1K73 Q;  2ZT9 D;  4JBZ A;  1N7S B;  5AW5 B;  2KXP B;  3I55 P;  1VPC A;  3IN6 A;  1M1J B;  2K3R A;  3F5H A;  3OJA B;  5B66 H;  2QSI A;  2QJK C;  1VQP P;  1IFP A;  2J61 B;  1FZB B;  3T97 B;  4H13 D;  3V5B A;  4W80 A;  1NYH A;  4OGQ B;  3FX0 A;  4AYC A;  1GZL A;  1D7M A;  1ZN5 A;  1VQ7 P;  2E5T A;  2BEQ D;  3M9Q A;  1HGZ A;  1FZF A;  3AE2 C;  3S9O A;  3N7N A;  4GOD A;  1Q2N A;  3L74 D;  1S9K D;  2QJP B;  4LLH A;  1J1D B;  5APT A;  1KYO H;  1YBK A;  1FZE C;  4GKG A;  1TU3 F;  3SFD C;  3G6E P;  3TGU E;  1L0N E;  1P84 D;  2WSF J;  1U7J A;  3TGU G;  1PV3 A;  2FYN C;  3V2Q A;  1L0N G;  4ASV A;  3H1J G;  1FZA C;  1SQP D;  1QLE D;  1U7M A;  3BCC E;  3GG2 A;  1L0L D;  3WU2 E;  3BCC G;  1DD4 A;  1X0T A;  4I7Z B;  5DJT B;  4UB8 E;  3M06 A;  1IFN A;  3GHG B;  1KD1 Q;  4Z1M H;  2Q1K A;  3B5N C;  3FIB A;  3L73 D;  1HJB A;  4N6J A;  4PD4 D;  5AVR B;  3H1H E;  2QE7 H;  1RF1 B;  2B9B A;  5GTI H;  3MD0 A;  3CCV P;  2HPC A;  3H1H G;  2QEX P;  1DEB A;  3SWY A;  5CJ4 A;  3I5C A;  4WWI A;  3U59 A;  3WMM 0;  2NPS B;  1RF0 A;  2YXR B;  1SQB K;  3Q1M A;  1AA0 A;  1OW7 A;  1FAV A;  3VTP C;  1AFO A;  2Q9I C;  2FXO A;  2XNX B;  1Q90 D;  3VMA A;  1FZC B;  4RO0 A;  1Q82 Q;  1OW6 A;  1NTM K;  1KB9 E;  3V6I A;  1JMM A;  1KQS O;  1N7S A;  1HF9 A;  3RL0 C;  3CCL P;  3C8V A;  1M1J A;  1NH4 A;  4U3F D;  3L74 J;  3RL0 D;  2J61 A;  1FZB A;  4GT1 A;  3T97 A;  3GW6 A;  2JHK F;  1LWU B;  1FC2 C;  1AVY A;  2WVR A;  3LW5 H;  2FYU J;  3KXD A;  3A0B H;  1SQQ J;  2W6B A;  3CCM P;  2J3U A;  1NAY A;  3P32 A;  1HWT C;  2HG5 D;  1SVF A;  1IZN B;  4RES B;  3H1I E;  3LIE A;  1VQ5 P;  1AVO A;  1S72 P;  4W7Z A;  3H1I G;  1BDD A;  2YNY A;  1JY2 O;  3CCR P;  1UIX A;  5CCG A;  2POH A;  2KIK A;  2YIU C;  1VQ6 P;  1AV1 A;  1YYC A;  1KIL E;  2Q6Q A;  2WPR A;  2ZYD A;  2ZVN B;  1YIJ P;  1VQ4 P;  2YKQ A;  1FID A;  1PGO A;  5E79 E;  1W5C E;  5KJ7 C;  3AEA C;  3AE5 C;  3AE4 C;  2JHL F;  1JY3 N;  2AEM A;  1BSH A;  3CX5 E;  4R4L A;  3H1K J;  3CCS P;  5KJ7 D;  1N86 B;  4ZKU A;  1X79 B;  2B89 A;  3M0D A;  1K05 A;  2R3S A;  1VDF A;  3GHG A;  4NYT A;  2WTY A;  4JYC A;  2J3G A;  4OVN F;  1LP1 B;  2P7J A;  1RF1 A;  1IFD A;  3CLQ A;  3M0A A;  4GOF A;  1LTB C;  1EQ7 A;  1KYO I;  3BRT B;  4I2L C;  2NPS A;  3EWK A;  4U3F J;  2OTK E;  1FJP A;  3VMX A;  2XNX A;  1T3J A;  1JM0 A;  1FZC A;  1L0N D;  1HH0 A;  1RH5 B;  1GD2 E;  1E5W A;  1L4A C;  1XTC C;  3VYI A;  3PH0 A;  2ZVO B;  3G9R A;  5CCH A;  2V7Q J;  1L4A D;  3BCC D;  2C0W A;  2WT7 B;  3AEG C;  5AVX B;  1FDM A;  1Y8A A;  4HH2 A;  1VQ9 P;  4KHX A;  4PV1 C;  1SQX K;  2A06 E;  1SQV K;  4QMA A;  2OYI B;  5B5E E;  2Z4E C;  1G1I A;  1LWU A;  2A06 G;  1NTZ K;  1FZG B;  3A5T A;  1N73 C;  4R9T A;  1U57 A;  2IBZ I;  3MGN A;  3KPE A;  3H1H D;  1GK6 A;  2JJL A;  2O1K A;  3HE5 B;  2PP6 A;  1QVF O;  1OWA A;  4HJG H; 
#chains in the Genus database with same CATH homology
 3TSI A;  2R5D A;  3M91 A;  4Y99 B;  1MUU A;  1FZF C;  3MUD A;  2ZFC A;  2Q7C A;  1Z3U A;  2OYI C;  2J2P A;  3HD7 A;  3L4F A;  1SLQ A;  1XTG B;  5BU8 B;  2J64 A;  1FZG C;  3RK3 B;  1CSB A;  2HYN A;  2KSJ A;  2FIB A;  1J1E B;  5APS A;  4R9J A;  4XA4 A;  5APY A;  5AVV B;  1JY2 P;  2J0G A;  3R2P A;  4JF7 A;  1ZR4 A;  2WPS A;  3TNU A;  5AW6 B;  2I1J A;  5APX A;  1WRG A;  2A45 H;  2J3F D;  1HBW A;  1YTZ I;  2WPQ A;  2QM8 A;  3HUS C;  2N9B A;  2J58 A;  2HFE D;  5AW0 B;  4JYB A;  4EPU A;  1FJK A;  1N86 A;  1NTK K;  4LC1 A;  4Y99 C;  1T2K C;  3E1I B;  2GY7 A;  3VMY A;  3EQ2 A;  1LGH B;  1KIL B;  1FIB A;  2YO2 A;  2FFD A;  4ZKP A;  3RK3 C;  4WY4 B;  1GL2 A;  1J1E C;  2HPC B;  1H88 A;  4EIJ A;  2IFN A;  3L37 A;  3IFM A;  1L4A A;  4N78 D;  3MTU E;  3RK3 D;  2R5B A;  5APV A;  1PFI A;  3PP5 A;  2FXM A;  1RF0 B;  3B5N D;  1ZLL A;  4N3Y B;  2KB7 P;  4ZFG A;  1RE3 A;  3C9I A;  2XV5 A;  1FBM A;  2WSE H;  3RK2 B;  1M7L A;  1JNM A;  1ZR2 A;  1QL1 A;  3HTK B;  3O8Z A;  4IFM A;  3E1I C;  3NTN A;  1NAF A;  3BRV B;  2Z4E A;  4WY4 C;  1N7S B;  2HPC C;  5AW5 B;  2XKM A;  4IFF A;  5APW A;  1N73 A;  1J2J B;  2JEE A;  4HYT B;  1VPC A;  1CI6 B;  1M1J B;  1JTH B;  4WY4 D;  3OJA B;  4I6M C;  2Q5U A;  1RF0 C;  2J61 B;  2R32 A;  1FZB B;  3V5B A;  2VRS A;  4W80 A;  2LKM A;  2D39 A;  2WT7 A;  1FZE B;  1GW4 A;  3RK2 C;  4AYC A;  3VP8 A;  1NKZ B;  1SFC A;  1GZL A;  1WT6 A;  3P8M C;  1IFJ A;  2H43 B;  2WWW A;  1ZN5 A;  3CL3 D;  3V2P A;  2J0H A;  4M7H A;  1IC2 A;  3II6 A;  3BVH B;  2W6A A;  4AQR D;  3M9Q A;  3RK2 D;  1HGZ A;  1FZF A;  2OYI A;  1FZA B;  1G1J A;  1N7S C;  1FZG A;  1KZU B;  1LT9 B;  2YMY A;  3N7N A;  2A45 G;  5AW2 B;  1A02 J;  1M1J C;  1S9K D;  5CCH C;  1N7S D;  4LLH A;  2J3F A;  1J1D B;  3OAK A;  2J3O A;  1LTJ B;  1T8Z A;  5APT A;  3VMZ A;  1FZB C;  2J1G A;  4WB4 A;  1GW3 A;  1QL2 A;  3NMD A;  5AW7 B;  2J0Y A;  3HE5 A;  1FZE C;  5CCH D;  1HGV A;  4GKG A;  1G2C A;  2IPP A;  2O1J A;  5AW9 B;  3TYY A;  3HUS A;  2H43 C;  2WSF H;  2WNP F;  3BVH C;  3B5N B;  4DOJ A;  4I1L A;  5BVZ A;  3V2Q A;  1FZA C;  1FZD A;  2Z5I A;  2KYV A;  1LT9 C;  3BAT A;  1FIC A;  1JO5 A;  4IFD K;  2P1J A;  5AVU B;  1J1D C;  1LTJ C;  3UIA A;  1FU1 A;  3TK1 A;  1RE4 B;  5CCG C;  3M06 A;  2XU6 A;  2Q9I B;  1IFN A;  1CZQ A;  3GHG B;  2J5Z A;  5KTB A;  5CCG D;  3E1I A;  3B5N C;  3FIB A;  3MIW A;  1HJB A;  4N6J A;  1KIL A;  5AVR B;  2FYZ A;  3V2R A;  3HE4 B;  3OA7 A;  1LTA C;  1RF1 B;  1JY3 O;  3KDP B;  4WY4 A;  1DX7 A;  3MD0 A;  2HPC A;  3RL0 B;  1DEB A;  3L36 A;  1URQ B;  3SWY A;  5CJ4 A;  3I5C A;  1SQP K;  5AVT B;  3U59 A;  3WMM 0;  2OYH B;  2NPS B;  1L0L K;  1RF0 A;  3M0D C;  1RE4 C;  1HVV A;  1SQB K;  1MV8 A;  2N1T B;  1FAV A;  3VTP C;  3V4Q A;  1X9V A;  1AFO A;  2MJZ A;  3KYQ A;  2Q9I C;  2XDJ A;  2CPB A;  2GUS A;  3GHG C;  3NFQ A;  2XNX B;  2M3B A;  1FZC B;  1N7L A;  3HTK A;  1MFZ A;  2BAS A;  2HLO B;  1NTM K;  5AW8 B;  4XE5 B;  4JZC A;  3B8E B;  1JMM A;  5AVZ B;  1RF1 C;  2KLV A;  1GTW A;  2E42 A;  1N7S A;  1NU1 K;  2Z5H A;  3M9H A;  2WIT A;  3RL0 C;  5APQ A;  1URQ C;  1CI6 A;  3VP9 A;  1M1J A;  1JTH A;  1NH4 A;  2OYH C;  2NPS C;  1KQL A;  3RL0 D;  2A45 I;  2J60 A;  2GUV A;  1FZB A;  1ZV8 A;  4GT1 A;  3T97 A;  2J61 A;  1URQ D;  2N1T C;  2H8P D;  1GU4 A;  4C46 A;  2JHK F;  1FZE A;  1LWU B;  2OAR A;  5AW1 B;  2XNX C;  2NPS D;  2O01 H;  3A7O A;  1FZC C;  3V2N A;  4WBA A;  1CW5 A;  5AVS B;  2H43 A;  2QM7 A;  3VOP A;  3LW5 H;  4C7N B;  2N1T D;  3H32 B;  1FOS E;  2HLO C;  3BVH A;  4GIF A;  4N78 E;  2L5G B;  1JC9 A;  2W6B A;  3A3Y B;  2J3U A;  1FZA A;  3P32 A;  2I1K A;  3KQG A;  2KP8 A;  1AQ5 A;  2HOD B;  1HWT C;  2HG5 D;  4W7Y A;  1LT9 A;  1SVF A;  1NO4 A;  1MZ9 A;  4RES B;  5AVY B;  4M3L A;  1JCD A;  3P8C E;  1LTT C;  3LIE A;  4B86 A;  1LTG C;  1SP4 A;  4W7Z A;  3U1C A;  4OH8 B;  5CMZ A;  1H8A A;  1IFM A;  1LTJ A;  2CPS A;  5CHX A;  5AW3 B;  2YNY A;  1JY2 O;  3HD7 B;  3SWF A;  5CCG A;  2POH A;  1LWU C;  1YYC A;  1GU5 A;  3BAS A;  1W2E A;  3G3Z A;  3H32 C;  2WPR A;  1SFC D;  1NOH A;  3IR9 A;  3B5N A;  1GDT A;  1LTS C;  2YKQ A;  1FID A;  4AUW A;  1FOS F;  3TNU B;  2HOD C;  5KJ7 C;  3NXS A;  5BU5 A;  4O9B A;  3EFG A;  2GM4 A;  1JOC A;  4DZO A;  2C9N Y;  2JHL F;  1JY3 N;  2H7H A;  1HUC A;  3U1A A;  2C0X A;  5KJ7 D;  1N86 B;  4JYO X;  4ZKU A;  1X79 B;  3M0D A;  2PAJ A;  2R3C A;  1RE4 A;  2FYU K;  3HD7 C;  2FFD B;  1SQQ K;  3A2A A;  5AW4 B;  2Q9I A;  1VDF A;  1GL2 B;  2WZ7 A;  3GHG A;  4NYT A;  2WTY A;  1DH3 A;  5KLV K;  3HD7 D;  4JYC A;  2J3G A;  1X8Y A;  1KFN A;  1L4A B;  4C7R A;  1S9K E;  2JHI F;  1T3U A;  4M7F A;  3HE4 A;  1T2K D;  1LTI C;  2P7J A;  1RF1 A;  1IFD A;  3CLQ A;  3M0A A;  1RE3 B;  3N4X A;  1URQ A;  1LTB C;  1EQ7 A;  2IFM A;  3BRT B;  2OYH A;  1N86 C;  4I2L C;  1JY3 P;  2NPS A;  1HTL C;  1YTZ T;  1JCC A;  2P67 A;  2N1T A;  2FFD C;  1FJP A;  1NWQ A;  2Z4E B;  3P8C D;  4LGD E;  2C9L Y;  1Z56 A;  1GL2 C;  3VMX A;  2XNX A;  5CJ0 A;  1T3J A;  1FZC A;  1N73 B;  1HH0 A;  2FKW B;  1GD2 E;  3M9B A;  1E5W A;  1KIL C;  1L4A C;  1XTC C;  2HLO A;  2KOG A;  3VYI A;  1GL2 D;  2Q3I A;  4EOT A;  5CCH A;  3HRN A;  5APU A;  2YKP A;  1JUN A;  2J59 M;  3CI9 A;  1KIL D;  1RE3 C;  2YO3 A;  1L4A D;  2C0W A;  2WT7 B;  1GK4 A;  1IO4 A;  1SFC B;  1IFI A;  5AVX B;  1FDM A;  4HH2 A;  3V4W A;  4KHX A;  1RY3 A;  5AVW B;  3VN0 A;  1SQX K;  1FZF B;  1SQV K;  2E43 A;  2OYI B;  1OXZ A;  2P2U A;  3LID A;  3P7K A;  2WSC H;  1A02 F;  2Z4E C;  1NHL A;  1G1I A;  1LWU A;  2M8R A;  1NTZ K;  1Z3S A;  1FZG B;  3A5T A;  1N73 C;  1JY2 N;  1IJD B;  1NKN A;  1N2D C;  3L35 A;  2JHM F;  4R9T A;  4C7N A;  2ZXE B;  3H32 A;  1H89 A;  3MGN A;  3KPE A;  2W27 A;  1L0N K;  3H6P A;  1KFM A;  1GK6 A;  2JJL A;  2JHH C;  2O1K A;  2HOD A;  5AVQ B;  5KJ7 A;  3HE5 B;  2IX7 C;  2YKO A;  2XZR A;  2PP6 A;  1SFC C;  1IK9 A;  1G2C B;  1OWA A;  3HUS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...