1RE4A

Crystal structure of fragment d of bbetad398a fibrinogen
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title BbetaGlu397 and BbetaAsp398 but not BbetaAsp432 are required for "B:b" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 24
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1re4A00
3HUSA 2XNXA 1N73A 2HPCB 1M1JA 1LT9A 1RF0C 2FFDC 1RF1C 3GHGC 1JY2N 3HUSB 2HPCA 2Q9IA 2OYHB 2A45H 1FZFA 1LT9B 1JY2P 1FZCB 1LTJB 1RE3C 2FFDA 3GHGB 1FZAA 1JY3O 1JY3P 3H32A 1LWUB 1RF1B 1FZCC 2H43A 2HODA 1M1JB 2OYHC 3E1IA 1LWUC 1LT9C 1M1JC 1RF0A 1JY2O 2Z4EA 1LTJC 3BVHA 2OYIA 2OYIB 3GHGA 1LTJA 2OYIC 2HLOA 1FZGA 1RE4A 3HUSC 2A45G 2OYHA 2A45I 1RF1A 1N73C 2HODB 1FZEA 1LWUA 1FZBA 3H32B 1N86A 1JY3N 1N73B 1FZCA 1RE4C 1W2EA 1RE3A 2FFDB 1T3UA
chains in the Genus database with same CATH superfamily
2IDBA 1AJYA 3EFGA 3UIAA 3HUSB 3L75D 5KTBA 2L91A 2OTJP 3PP5A 3WU2E 1VPCA 1H8AA 3MD0A 3D70A 2QSIA 1ZRTE 2FYNB 3AEBC 4WBAA 1JO5A 1SQQJ 3Q2YA 1N7SD 2FKWB 1SQVJ 2ZVNB 2N1TA 1FC2C 3C9IA 5KLIC 2R5DA 1KQGB 2I1KA 1QLED 2JO1A 2M3BA 3E1IA 3FWNA 4LC1A 5AW6B 3CPWO 1OFCX 2WITA 4U3FJ 3CMAP 1LTJC 1L0ND 5APUA 1S9KE 3MUDA 4K35A 3IN6A 4H44B 1PL5A 1L4AB 1RHZB 2FXOA 1G1IA 2XV5A 1MZ9A 3H6PA 4UB8E 2BCCD 3H1JG 2P10A 3H1HJ 3MGNA 5KLVE 5M1BA 3M0AA 1LTAC 3BRVB 1NU1D 1W2EA 2KK7A 4HH2A 1M8OB 3V4QA 2FYUK 3C1LA 5B5EH 4L75A 3SFDC 1M1JA 1LT9A 2KZJA 1JCCA 4I7ZC 1IFIA 2FYUJ 2W6AA 1FZFA 2V4HA 3CX5E 1T8ZA 3H1IJ 3CMEP 1FS0E 2O01H 1JY3P 1TU3F 2WSEJ 2R32A 1YI2P 3L71G 2WT7A 1HBWA 1U57A 1S5LX 1T6AA 5AW0B 2AXCA 3GF3A 2FFDA 2Z5IA 2E43A 1SQPK 3B5NA 1IFPA 1OX3A 3KQGA 3MZWB 3AE3C 1S4XA 1E5WA 1KFNA 2A06G 2WWWA 3L74E 4OGQD 1ZRTD 4N6JA 1FAVA 1HJ0A 1NH4A 1NTZK 5CJ0A 4YXDC 1N7LA 1CW5A 4JYCA 3I55P 1VQ9P 1PPJE 5CBNA 1DD4A 1EDKA 1UIIA 1M56D 2PRRA 2QM7A 4HKZH 1USEA 4YPCA 1OW8A 4PV1C 2FY8A 4H13C 1RF1C 1ZP0C 2N9BA 2QIWA 1NO4A 3CXHI 3HTKA 3H1IG 1RQUA 3KYQA 2W90A 4OVNF 4C46A 5BU5A 2MKVA 2HPCA 4CPGA 2W27A 3H1LG 1NAFA 1URQA 2OYOA 2KSEA 2WPRA 3NMDA 2YMYA 2JDIH 4JQ0D 1U7JA 3O6QB 1CI6B 1YJ9P 2R44A 3H1KE 2M5AA 3AE7C 1URQD 1EDIA 4WWIA 1M1JB 5AW3B 2OYHC 1DX7A 3AE5C 5K5GB 3L73G 1LJ2A 4HB1A 4WY4A 1MFZA 1LGHB 3RBXA 1NTMD 2V7QH 2IBZG 3HUSC 3L72D 3A0BH 2AEFA 1KB9D 1YTZI 2Y0EA 5KLVJ 3G71P 3SWFA 2HODB 1VQ8P 4Y28J 4B86A 5KJ7C 3M9HA 4IL6E 1H0TA 1RE4C 1ZR4A 2W6JH 3AEAC 1NTKG 2H8PD 5AVQB 5AW1B 1L4AD 1T3UA 2Q1KA 3HE5A 3KDPB 3PH0A 2Q6QA 5CJ4A 2Q7CA 1QVGO 1N8RQ 2J58A 4WY4C 2V7QJ 1JMBA 1SQPD 5AVXB 2LXBA 3BCCG 2KIKA 2IZ1A 1Q82Q 3VMAA 1KILB 1KYOE 2NZ2A 1ZLLA 3BRTB 3A2AA 1PPJD 3G3ZA 3HD7D 3P8MC 4R4MA 3I56P 3AEFC 3A5TA 1FDOA 1KV4A 1VQPP 1NU1G 1BDCA 1RF0A 4ZMDA 4H13D 4Y99C 4WVZA 3GHGA 1LTTC 5CCHD 1LTJA 2C9NY 3CWBJ 3HE4B 3KXDA 1MKMA 3RK3B 4D6TJ 3A7OA 1PGOA 1PP9E 2R5BA 1LTGC 1NTKJ 1OVRA 1PV3A 3HD7B 5E79H 3U59A 1FU1A 1KD1Q 5H2FE 1KILD 2DW3A 2M8RA 1M1KQ 3CCEP 1U7MA 1BGYJ 4OGQB 1BGYE 3RBZA 1PGPA 1PP9J 1QEXA 1RF0C 3WUVA 1JCDA 2KXPB 3LIDA 1KORA 1SQQK 1SQQG 1WMKA 5KJ7D 1S5LE 1JY2P 2JP3A 4TT3H 3Q5SA 4C7RA 2P7JA 1VL2A 2OTLP 2KLUA 2FYUE 1FZCC 1M57D 2KSJA 4U3FG 2JR8A 1HGVA 2AXTH 1K05A 2HG5D 1JNMA 3A0HE 3B5NC 3AEEC 3HRNA 3L75G 2B9BA 1MV8A 3USSA 1R8EA 3F89A 2B87B 2KS1B 5APYA 3R2PA 3CC7P 5KAFH 3CXHH 4H0LB 4DJGA 2A06E 1R5SA 1ZW0A 3A3YB 3AEGC 1WRGA 3ZDMA 2XNDH 4IL6H 3MP7B 1SQXJ 1ZXGA 2LKMA 1EXJA 3SFEC 4L76A 3T97B 1T2KD 2JJLA 3B5ND 4IFDK 1P84I 3N4XA 3P8CE 1DEEG 3H1KD 3HTKB 4H44D 4PD4H 1NTKD 1RQVA 1SQBG 2Q5UA 4O9BA 4XFJA 5APQA 1K04A 2O1KA 3IAOA 3RK3E 5CCGC 3AEDC 3CWBD 2IFNA 3HD7A 1VQMP 4IOIH 3VP8A 1HTLC 3II6A 1SFCB 1YITP 2AEJA 5KLVK 4DT0A 3H25A 2L5GB 2WSCH 3CC2P 1URQC 1ZMEC 3D6YA 1SQPG 1NYHA 2BEZF 1JY2O 4ASVA 3TGUE 2Z4EA 1M90Q 4BXLA 3H1JJ 3D6ZA 3AECC 1SQXG 2WTYA 2OYHA 1LT1A 5KAIH 2W83C 1LTBC 2JWAA 2ZYDA 3VOPA 4GIFA 4EDFA 2K9JB 1N73C 2WSCJ 1UIXA 3QWOC 1AA0A 1SQBJ 1FDIA 3L37A 2FFDB 2WT7B 2UWJE 2BEQD 1OZHA 1L2PA 3V5BA 5AVWB 1OIPA 2E75C 1K9MQ 2RMZA 1VQKP 4AUWA 2O01N 1NTMJ 1RY3A 3L72J 5KAIE 4BRYA 1ZN5A 1JTHB 2ZT9C 2XZRA 3CCVP 1PPJG 2ZXEB 2Z5HA 3TNUB 1GW3A 1N7SA 3C8VA 5AVZB 1VF5D 1X0TA 2VRSA 4RKUJ 1PFIA 3CC4P 1YJNP 5B5EE 1M1JC 1SQBD 1IK9A 2FYZA 1KB9I 3H1IE 2OTKE 4ZKUA 1CSBA 2OYIC 1Q2NA 4GOFA 3RL0D 1DIPA 2A45G 2ZT9B 2RKLA 4PJ0H 2RH0A 3M9BA 1Z56A 5TISH 2Y9ZA 5EFWB 1VQLP 2BCCG 3H1JD 1N73B 3V2RA 3FXDA 1YJWP 2E75B 4Z1MH 1BE3E 1CZQA 1W5CE 2E76C 1IFMA 4RO0A 4NPFX 4UB6H 3HUSA 4Y99B 5APSA 5AW5B 3CCRP 1YYCA 2FFDC 2YIUC 1NKNA 1JY2N 2JKVA 1EZVE 2ZJSE 4PJ0E 3V2PA 2P1JA 2IBZI 3OW2O 1AFOA 2QJKC 3BASA 1SFCC 1NKZB 1HGZA 1P84D 2FBWC 1XTGB 2M0BA 4HJGH 2K88A 4JBZA 1NGMB 3RK2D 3H1KJ 2YIUB 3NTNA 1SQXK 1DEBA 2CPBA 2JEEA 3CWBG 1L4AA 1FOSE 3CI9A 1BCCG 2AEMA 1SQXD 1L0NE 1ZOYC 3M91A 4L73A 3VN0A 1FZGA 2R3CA 2FYUD 3MTUE 3H32B 1N7SB 1VQ6P 1IC2A 5AW4B 4KJMA 1YIJP 1N2DC 4I7ZB 2D2CB 4WY4D 1P84H 1NU1E 2IYOA 2YNYA 3E7KA 1FJKA 3PLNA 5AVRB 1SQBE 2I8DA 3KZIH 3L35A 1YQ4C 2KNCA 1EZVI 4GOEA 2E74D 1GL2A 1L0LE 4HYTB 2WQYC 3EWKA 4NPDA 3VMYA 5CCGD 1SQVG 3SWKA 3B71A 2QEXP 1OW6A 1FZCB 5CCHC 1S5LH 1FZAA 2E76D 1NAYA 3R4YA 1LWUB 4QMAA 2IZ0A 4H44C 3GW6A 4U3FD 3JCUH 5APXA 5KJ7A 2PGDA 3KPEA 1HWTC 1S2EA 2KP8A 2WMMA 1Y8AA 1J1DB 1PP9D 1SQPE 1VQ7P 1BGYD 2KLVA 3HD7C 1KQFB 1SQQD 1EDLA 1YHQP 1XTCC 1MUUA 3EQ2A 3LIEA 4D6TG 3G6EP 1X79B 3H1HG 1SQXE 4U7JA 4D6TD 2A45I 2N1TB 1H89A 3S4RA 2YXRB 1LWUA 4IL6X 4RJTA 2Y0DA 3L70E 1FOSF 3CCQP 1KMIZ 2SPZA 3L75E 2HPCB 2E5TA 2WPQA 1ZR2A 3TGUD 1BCCD 1FE6A 3CXHE 3LW5H 2IX7C 3M9QA 4C7NB 2O1JA 2WSFJ 2E74C 3O6QA 2NPSB 1LT9B 1KILE 2QM8A 1OVVA 3L4FA 1AQ5A 1BDDA 1RE3C 4WY4B 5C39A 1QL2A 1YBKA 1AV1A 1JM0A 1SQPJ 1L0LK 2GUVA 3NFQA 2HR3A 3VMXA 2YMKA 3BATA 2P67A 2HODA 3L71J 2ZYAA 3AE1C 2J59M 3PJSK 3CCMP 2Q3IA 1S1CX 1NTKE 2H88C 3BCCD 5GTHH 1H88A 2OYIA 1EXIA 2NPSC 3Q5RA 1RE4A 1Y9BA 3EFFK 3TK1A 1GDTA 1IO4A 5KLVD 2D2CD 1DH3A 3RK2B 1NTME 2BCCE 2K37A 1KYOI 1OWAA 1GK4A 2GA1A 2QRXA 2ZYGA 3L72E 3P7KA 5AW9B 1CI6A 4KHXA 1LP1A 1GW4A 2N9YB 2FXMA 2E74B 1NTMK 2WPVB 2YO3A 3OAKA 1WT6A 3S1KA 5CBOA 4GODA 5AW8B 1NTKK 3M06A 3F5HA 3M0DC 3TDKA 1S9KD 2OYHB 1LNQA 2A45H 3H1JE 4OGQC 5APTA 2NRGA 2D2CC 1LTIC 3GHGB 4EI2A 1G2CB 1JY3O 3VYIA 1SFCD 3JCUE 4TLFA 4EOTA 4PV1B 1RF1B 4ZNCA 1VQNP 1S72P 3RK3D 1OVUA 4NPEA 3A0HH 2G3AA 2XKMA 4ASWA 1J1EB 1A02J 1L4AC 1SFCA 2B87A 2KS1A 3H1LD 3ITKA 1QX8A 1SP4A 3WU2H 1EC5A 2IFMA 2WSSH 3FXEA 3B4SA 3L73E 3B5NB 3L73J 2YKOA 1KN7A 5GTIE 3VP9A 3IFMA 1RH5B 1FZBA 1R5LA 2CPSA 4LLHA 1KQLA 3GG2A 4YXWH 3V2QA 2J5UA 2XDJA 1KILA 1LTSC 2KZIA 2K3RA 2NPSD 3MUDC 5AVYB 3D71A 1SQVK 4U3FE 3RL0B 3CCLP 1SS1A 2IBZD 4UB6E 2Q3EA 3JC22 1G1JA 2MJZA 4C7NA 4EIJA 1OW7A 4IFFA 5GTIH 2QA4P 1SQVE 4UB8H 5APVA 3Q5PA 2E75D 1NTZG 3H1ID 3CX5H 4ZKPA 1M7LA 1AVOA 2QJKB 3H32A 1D7MA 1IK7A 3KHUA 1W2BO 3WMM0 5TJHA 2GUSA 1VDFA 1SVFA 2M5AB 1HUCA 3IF4A 3P8CD 1LT9C 4I1LA 1Q81Q 1IFNA 2OYIB 1GL2D 1NU1J 4R4LA 4D6TE 5APWA 4BRYB 4DZOA 2A06D 1X9VA 3H1HD 1Q86Q 1USDA 3JSVC 2BCCJ 1VQ4P 5E79E 5AVSB 1GK6A 3G9RA 4I6MC 1PZQA 4DOJA 3HE4A 3WUUA 2E42A 1FDMA 2E76B 2QJPB 1L0NJ 1PP9G 3ABVC 3CX5D 2Q9IA 2G8YA 1KQSO 1P84E 2OQQA 3B8EB 4YTPC 5AVTB 5KKZC 1BGYG 3HE5B 1FBMA 4N3YB 1SQVD 4PD4D 2POHA 3MHVA 3OJAB 1KYOD 4L74A 3SWYA 3W67A 2FYUG 4GKGA 4BWNA 3AE9C 4GDOA 1IFJA 3PRJA 4IFMA 5KLIB 3L75J 3L70D 2WZ7A 1QL1A 2E5YA 5DJUB 1X22A 3RK2C 3CCUP 3VMZA 3TF5A 1VQOP 2QVAA 2IYPA 1SLQA 1T3JA 3AE2C 2AXTE 3L70J 4K3AA 1J1DC 3L36A 3CCJP 2C0WA 2WSFH 3IR9A 4JYBA 3SSUA 3CL3D 5DJTB 2NPSA 1NJIQ 2P58A 3CCSP 5KAFE 3TNUA 3NXSA 2B88A 1PGJA 4N78D 1L0LD 1HF9A 4PV1D 4OH8B 1GD2E 2JWDA 4MN4C 5KKZB 1X8YA 2ZT9D 3AE6C 3PTZA 1Q90D 3RL0g 4A7PA 1H0TB 4I2LC 3WUTA 1JMMA 2CK3H 2KYVA 4AYCA 2ZXXA 2P2UA 2XU6A 1NVOA 2C0XA 1N7SC 1KB9H 2LXCB 3H1HE 1YTZT 3M0DA 1G2CA 1VF5B 2PFXA 1ZV8A 3L74G 5TISE 1QGKB 3T97A 3FWLA 1OXZA 3RL0C 3L70G 1NTZD 1NWQA 1J2JB 2YO2A 2N1TC 4W80A 2KI7B 1K8AQ 1PIXA 2ITAA 1BE3G 1KZUB 3BVHA 4W7YA 1BSHA 4AQRD 1KB9E 3KZIE 2W6BA 2HLOA 2QE7H 2K9JA 3V2NA 2ZVOB 3O8ZA 5BU8B 4RESB 3GLMA 2OARA 2QJYB 4N78E 5B66E 3FGAD 1NHLA 3S9OA 3V4WA 1JB0J 1JY3N 1MFTA 5KLVG 3Q3DA 2C9LY 1J1EC 2GM4A 1AVYA 1KC8Q 1IJDB 2FYNC 5CMZA 1GTWA 1HJBA 1JUNA 1JOCA 1JEKA 5GTHE 2KB7P 1BE3D 1GL2B 2Y0CA 1EZVD 2LR2A 2R3SA 3GHGC 1HVVA 2PAJA 2ZAEB 1SQBK 3CWBE 3L74J 2YKQA 3L73D 3V6IA 5B66H 3Q1MA 1NTZE 1BCCE 1LTJB 3CLQA 3CX5I 3CXHD 5BVZA 1T2KC 1EDJA 1NTMG 3L72G 3H1LJ 1KTMA 3L71E 3MIWA 2ZFCA 4WB4A 2BASA 1Y47A 3GF7A 3L74D 1BE3J 4DCKA 3LW5J 2N1TD 4GT1A 3U1AA 1LWUC 1VQ5P 4H0LC 1GU4A 1QVFO 1L0NK 1HH0A 2QJYC 4H13B 4M3LA 1IFDA 2Y9YA 3PHLA 3A0BE 2M3EA 5AVUB 3AE4C 2O01J 2WSEH 3BCCE 3TYYA 3QH9A 1L0LG 1RF1A 2H7HA 1FZEA 2YKPA 2HYNA 4OWFA 1FJPA 1N86A 2K1AA 1GMJA 1OMIA 5CHXA 1FZCA 1GZLA 1DD3A 1GL2C 2H89C 3TGUG 1RE3A 1BSNA 4H0LD 3W68A 4JPZB 2XNXA 1N73A 5CCHA 1K73Q 5AW7B 1S3JA 2K9YA 3RK3C 2OGUA 1NTZJ 1LP1B 2I1JA 2QG4A 3I5CA 2YXQB 4LGDE 3G4SP 2IPPA 3H1LE 1KILC 2O3JA 3CD6P 1KYOH 1EZVG 3GMAA 1URQB 2PP6A 4XA4A 2QJPC 3BCCJ 3P32A 4KT0J 5AW2B 3U1CA 3H1KG 2KUBA 4XE5B 2RN0A 1KFMA 1A02F 3FX0A 1PGQA 3L71D 3N7NA 4W7ZA 5H2FH 2H43A 4PD4E 2HFED 3VTPC 2W8ZA 2KOGA 2FXPA 1YQ3C 1JTHA 3RGUA 2B89A 1L0LJ 1IZNB 5CCGA 1SQQE 3AE8C 3E1RA 1NOHA 2IBZE 2WPSA 2KNCB 3OA7A 1BCCJ 1L0NG 1E79H 1NU1K 1VF5C 3K5BA 1AQTA 3TGUJ 2WVRA 5L8RJ 1EQ7A 5AVVB 1Q7YQ 4JF7A 1GU5A 4EYYQ 3TSIA 4PD4I
chains in the Genus database with same CATH topology
3EFGA 3UIAA 3HUSB 5KTBA 3PP5A 1VPCA 1H8AA 3MD0A 4WBAA 1JO5A 1N7SD 2FKWB 2N1TA 3C9IA 2R5DA 2I1KA 5AW6B 4LC1A 2M3BA 3E1IA 1GU5A 2WITA 1LTJC 5APUA 1S9KE 3MUDA 1L4AB 1G1IA 2XV5A 1MZ9A 3H6PA 3MGNA 3M0AA 1LTAC 3BRVB 4HH2A 1W2EA 3V4QA 2WT7B 2FYUK 1M1JA 1LT9A 1JCCA 1IFIA 2W6AA 1FZFA 1T8ZA 2O01H 1JY3P 2R32A 2WT7A 1HBWA 5AW0B 2FFDA 2Z5IA 1SQPK 3B5NA 3KQGA 1E5WA 1KFNA 2WWWA 4N6JA 1FAVA 1NH4A 1NTZK 5CJ0A 1CW5A 1N7LA 4JYCA 2QM7A 1RF1C 2N9BA 4C46A 1NO4A 5BU5A 3HTKA 3KYQA 2HPCA 2W27A 1NAFA 1URQA 3NMDA 2WPRA 2YMYA 1CI6B 1URQD 1M1JB 5AW3B 2OYHC 1DX7A 4WY4A 1MFZA 1LGHB 3HUSC 1YTZI 3SWFA 2HODB 4B86A 5KJ7C 3M9HA 1RE4C 1ZR4A 2H8PD 5AVQB 5AW1B 1L4AD 1T3UA 3KDPB 3HE5A 5CJ4A 2Q7CA 2J58A 4WY4C 5AVXB 1KILB 1ZLLA 3BRTB 3A2AA 3HD7D 3G3ZA 3P8MC 3A5TA 1RF0A 4Y99C 3GHGA 1LTTC 5CCHD 1LTJA 2C9NY 3HE4B 3RK3B 3A7OA 2R5BA 1LTGC 3HD7B 3U59A 1FU1A 1KILD 2M8RA 1RF0C 1JCDA 3LIDA 1SQQK 5KJ7D 1JY2P 4C7RA 2P7JA 1FZCC 2KSJA 1HGVA 2HG5D 1JNMA 3HRNA 3B5NC 1MV8A 5APYA 3R2PA 3A3YB 1WRGA 2LKMA 1T2KD 2JJLA 3B5ND 4IFDK 3N4XA 3P8CE 3HTKB 2Q5UA 4O9BA 5APQA 2O1KA 5CCGC 2IFNA 3HD7A 3VP8A 1HTLC 3II6A 1SFCB 5KLVK 2L5GB 2WSCH 1URQC 1JY2O 2Z4EA 2OYHA 2WTYA 2E43A 1N73C 1LTBC 3VOPA 4GIFA 3L37A 2FFDB 3V5BA 5AVWB 4AUWA 1RY3A 1ZN5A 1JTHB 2XZRA 2ZXEB 2Z5HA 3TNUB 1GW3A 1N7SA 5AVZB 2VRSA 1PFIA 1M1JC 1IK9A 2FYZA 4ZKUA 1CSBA 2OYIC 3RL0D 2A45G 3M9BA 1Z56A 1N73B 3V2RA 1CZQA 5APSA 1IFMA 5AW5B 4Y99B 3HUSA 1YYCA 2FFDC 1NKNA 1JY2N 3V2PA 2P1JA 1AFOA 3BASA 1SFCC 1NKZB 1HGZA 1XTGB 3RK2D 3NTNA 1SQXK 1DEBA 2CPBA 2JEEA 1L4AA 1FOSE 3CI9A 3M91A 1FZGA 3VN0A 2R3CA 3MTUE 3H32B 1N7SB 1IC2A 5AW4B 1N2DC 4WY4D 2YNYA 1FJKA 5AVRB 3L35A 1GL2A 4HYTB 3VMYA 5CCGD 1FZCB 5CCHC 1FZAA 1LWUB 5APXA 5KJ7A 3KPEA 1HWTC 2KP8A 1J1DB 2KLVA 3HD7C 1XTCC 1MUUA 3EQ2A 3LIEA 1X79B 1H89A 2A45I 2N1TB 1LWUA 1FOSF 2HPCB 2WPQA 1ZR2A 3LW5H 4C7NB 2IX7C 3M9QA 2O1JA 2NPSB 1LT9B 1AQ5A 2QM8A 3L4FA 1RE3C 4WY4B 1QL2A 3VMXA 1L0LK 2GUVA 3NFQA 3BATA 2P67A 2HODA 2J59M 2Q3IA 1H88A 2OYIA 2NPSC 1RE4A 1GDTA 3TK1A 1IO4A 1DH3A 3RK2B 1OWAA 3P7KA 1GK4A 5AW9B 1CI6A 4KHXA 1GW4A 2FXMA 2YO3A 1NTMK 3OAKA 1WT6A 5AW8B 1NTKK 3M06A 3M0DC 1S9KD 2OYHB 2A45H 5APTA 1LTIC 3GHGB 1G2CB 1JY3O 3VYIA 1SFCD 4EOTA 1RF1B 3RK3D 2XKMA 1A02J 1J1EB 1L4AC 1SFCA 1SP4A 2IFMA 3B5NB 2YKOA 3VP9A 3IFMA 1FZBA 4LLHA 2CPSA 1KQLA 3V2QA 2XDJA 5AVYB 1KILA 1LTSC 2NPSD 1SQVK 3RL0B 1G1JA 2MJZA 4C7NA 4EIJA 4IFFA 5APVA 4ZKPA 1M7LA 3H32A 3WMM0 2GUSA 1VDFA 1SVFA 1HUCA 3P8CD 1LT9C 4I1LA 2OYIB 1IFNA 1GL2D 5APWA 4DZOA 1X9VA 5AVSB 1GK6A 4I6MC 4DOJA 3HE4A 2E42A 1FDMA 2Q9IA 3B8EB 5AVTB 3HE5B 1FBMA 4N3YB 2POHA 3SWYA 3OJAB 4GKGA 4IFMA 1IFJA 3RK2C 2WZ7A 1QL1A 3VMZA 1SLQA 1T3JA 1J1DC 3L36A 2C0WA 2WSFH 3IR9A 4JYBA 3CL3D 2NPSA 3TNUA 3NXSA 4N78D 4OH8B 1GD2E 1X8YA 4I2LC 1JMMA 2KYVA 4AYCA 2P2UA 2XU6A 2C0XA 1N7SC 3M0DA 1YTZT 1G2CA 1ZV8A 3T97A 1OXZA 3RL0C 1NWQA 1J2JB 2YO2A 2N1TC 4W80A 1KZUB 3BVHA 4W7YA 4AQRD 2W6BA 2HLOA 3V2NA 5BU8B 3O8ZA 4RESB 2OARA 4N78E 1NHLA 3V4WA 1JY3N 2C9LY 2GM4A 1J1EC 1IJDB 5CMZA 1GTWA 1JUNA 1HJBA 1JOCA 2KB7P 1GL2B 3GHGC 1HVVA 2PAJA 1SQBK 2YKQA 3CLQA 1LTJB 5BVZA 1T2KC 3MIWA 4WB4A 2ZFCA 2BASA 2N1TD 4GT1A 3U1AA 1LWUC 1GU4A 1L0NK 1HH0A 4M3LA 1IFDA 5AVUB 3TYYA 2WSEH 1RF1A 2H7HA 1FZEA 2YKPA 2HYNA 1FJPA 1N86A 5CHXA 1FZCA 1GZLA 1GL2C 1RE3A 2XNXA 1N73A 5CCHA 5AW7B 3RK3C 3I5CA 2I1JA 2IPPA 1KILC 1URQB 2PP6A 4XA4A 3P32A 3U1CA 5AW2B 4XE5B 1A02F 1KFMA 3N7NA 4W7ZA 2H43A 2HFED 3VTPC 2KOGA 1JTHA 5CCGA 1NOHA 2WPSA 3OA7A 4LGDE 1NU1K 1EQ7A 5AVVB 4JF7A 3TSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUS A;  2XNX A;  1N73 A;  2HPC B;  1M1J A;  1LT9 A;  1RF0 C;  2FFD C;  1RF1 C;  3GHG C;  1JY2 N;  3HUS B;  2HPC A;  2Q9I A;  2OYH B;  2A45 H;  1FZF A;  1LT9 B;  1JY2 P;  1FZC B;  1LTJ B;  1RE3 C;  2FFD A;  3GHG B;  1FZA A;  1JY3 O;  1JY3 P;  3H32 A;  1LWU B;  1RF1 B;  1FZC C;  2H43 A;  2HOD A;  1M1J B;  2OYH C;  3E1I A;  1LWU C;  1LT9 C;  1M1J C;  1RF0 A;  1JY2 O;  2Z4E A;  1LTJ C;  3BVH A;  2OYI A;  2OYI B;  3GHG A;  1LTJ A;  2OYI C;  2HLO A;  1FZG A;  1RE4 A;  3HUS C;  2A45 G;  2OYH A;  2A45 I;  1RF1 A;  1N73 C;  2HOD B;  1FZE A;  1LWU A;  1FZB A;  3H32 B;  1N86 A;  1JY3 N;  1N73 B;  1FZC A;  1RE4 C;  1W2E A;  1RE3 A;  2FFD B;  1T3U A; 
#chains in the Genus database with same CATH topology
 2IDB A;  1AJY A;  3EFG A;  3UIA A;  3HUS B;  3L75 D;  5KTB A;  2L91 A;  2OTJ P;  3PP5 A;  3WU2 E;  1VPC A;  1H8A A;  3MD0 A;  3D70 A;  2QSI A;  1ZRT E;  2FYN B;  3AEB C;  4WBA A;  1JO5 A;  1SQQ J;  3Q2Y A;  1N7S D;  2FKW B;  1SQV J;  2ZVN B;  2N1T A;  1FC2 C;  3C9I A;  5KLI C;  2R5D A;  1KQG B;  2I1K A;  1QLE D;  2JO1 A;  2M3B A;  3E1I A;  3FWN A;  4LC1 A;  5AW6 B;  3CPW O;  1OFC X;  2WIT A;  4U3F J;  3CMA P;  1LTJ C;  1L0N D;  5APU A;  1S9K E;  3MUD A;  4K35 A;  3IN6 A;  4H44 B;  1PL5 A;  1L4A B;  1RHZ B;  2FXO A;  1G1I A;  2XV5 A;  1MZ9 A;  3H6P A;  4UB8 E;  2BCC D;  3H1J G;  2P10 A;  3H1H J;  3MGN A;  5KLV E;  5M1B A;  3M0A A;  1LTA C;  3BRV B;  1NU1 D;  1W2E A;  2KK7 A;  4HH2 A;  1M8O B;  3V4Q A;  2FYU K;  3C1L A;  5B5E H;  4L75 A;  3SFD C;  1M1J A;  1LT9 A;  2KZJ A;  1JCC A;  4I7Z C;  1IFI A;  2FYU J;  2W6A A;  1FZF A;  2V4H A;  3CX5 E;  1T8Z A;  3H1I J;  3CME P;  1FS0 E;  2O01 H;  1JY3 P;  1TU3 F;  2WSE J;  2R32 A;  1YI2 P;  3L71 G;  2WT7 A;  1HBW A;  1U57 A;  1S5L X;  1T6A A;  5AW0 B;  2AXC A;  3GF3 A;  2FFD A;  2Z5I A;  2E43 A;  1SQP K;  3B5N A;  1IFP A;  1OX3 A;  3KQG A;  3MZW B;  3AE3 C;  1S4X A;  1E5W A;  1KFN A;  2A06 G;  2WWW A;  3L74 E;  4OGQ D;  1ZRT D;  4N6J A;  1FAV A;  1HJ0 A;  1NH4 A;  1NTZ K;  5CJ0 A;  4YXD C;  1N7L A;  1CW5 A;  4JYC A;  3I55 P;  1VQ9 P;  1PPJ E;  5CBN A;  1DD4 A;  1EDK A;  1UII A;  1M56 D;  2PRR A;  2QM7 A;  4HKZ H;  1USE A;  4YPC A;  1OW8 A;  4PV1 C;  2FY8 A;  4H13 C;  1RF1 C;  1ZP0 C;  2N9B A;  2QIW A;  1NO4 A;  3CXH I;  3HTK A;  3H1I G;  1RQU A;  3KYQ A;  2W90 A;  4OVN F;  4C46 A;  5BU5 A;  2MKV A;  2HPC A;  4CPG A;  2W27 A;  3H1L G;  1NAF A;  1URQ A;  2OYO A;  2KSE A;  2WPR A;  3NMD A;  2YMY A;  2JDI H;  4JQ0 D;  1U7J A;  3O6Q B;  1CI6 B;  1YJ9 P;  2R44 A;  3H1K E;  2M5A A;  3AE7 C;  1URQ D;  1EDI A;  4WWI A;  1M1J B;  5AW3 B;  2OYH C;  1DX7 A;  3AE5 C;  5K5G B;  3L73 G;  1LJ2 A;  4HB1 A;  4WY4 A;  1MFZ A;  1LGH B;  3RBX A;  1NTM D;  2V7Q H;  2IBZ G;  3HUS C;  3L72 D;  3A0B H;  2AEF A;  1KB9 D;  1YTZ I;  2Y0E A;  5KLV J;  3G71 P;  3SWF A;  2HOD B;  1VQ8 P;  4Y28 J;  4B86 A;  5KJ7 C;  3M9H A;  4IL6 E;  1H0T A;  1RE4 C;  1ZR4 A;  2W6J H;  3AEA C;  1NTK G;  2H8P D;  5AVQ B;  5AW1 B;  1L4A D;  1T3U A;  2Q1K A;  3HE5 A;  3KDP B;  3PH0 A;  2Q6Q A;  5CJ4 A;  2Q7C A;  1QVG O;  1N8R Q;  2J58 A;  4WY4 C;  2V7Q J;  1JMB A;  1SQP D;  5AVX B;  2LXB A;  3BCC G;  2KIK A;  2IZ1 A;  1Q82 Q;  3VMA A;  1KIL B;  1KYO E;  2NZ2 A;  1ZLL A;  3BRT B;  3A2A A;  1PPJ D;  3G3Z A;  3HD7 D;  3P8M C;  4R4M A;  3I56 P;  3AEF C;  3A5T A;  1FDO A;  1KV4 A;  1VQP P;  1NU1 G;  1BDC A;  1RF0 A;  4ZMD A;  4H13 D;  4Y99 C;  4WVZ A;  3GHG A;  1LTT C;  5CCH D;  1LTJ A;  2C9N Y;  3CWB J;  3HE4 B;  3KXD A;  1MKM A;  3RK3 B;  4D6T J;  3A7O A;  1PGO A;  1PP9 E;  2R5B A;  1LTG C;  1NTK J;  1OVR A;  1PV3 A;  3HD7 B;  5E79 H;  3U59 A;  1FU1 A;  1KD1 Q;  5H2F E;  1KIL D;  2DW3 A;  2M8R A;  1M1K Q;  3CCE P;  1U7M A;  1BGY J;  4OGQ B;  1BGY E;  3RBZ A;  1PGP A;  1PP9 J;  1QEX A;  1RF0 C;  3WUV A;  1JCD A;  2KXP B;  3LID A;  1KOR A;  1SQQ K;  1SQQ G;  1WMK A;  5KJ7 D;  1S5L E;  1JY2 P;  2JP3 A;  4TT3 H;  3Q5S A;  4C7R A;  2P7J A;  1VL2 A;  2OTL P;  2KLU A;  2FYU E;  1FZC C;  1M57 D;  2KSJ A;  4U3F G;  2JR8 A;  1HGV A;  2AXT H;  1K05 A;  2HG5 D;  1JNM A;  3A0H E;  3B5N C;  3AEE C;  3HRN A;  3L75 G;  2B9B A;  1MV8 A;  3USS A;  1R8E A;  3F89 A;  2B87 B;  2KS1 B;  5APY A;  3R2P A;  3CC7 P;  5KAF H;  3CXH H;  4H0L B;  4DJG A;  2A06 E;  1R5S A;  1ZW0 A;  3A3Y B;  3AEG C;  1WRG A;  3ZDM A;  2XND H;  4IL6 H;  3MP7 B;  1SQX J;  1ZXG A;  2LKM A;  1EXJ A;  3SFE C;  4L76 A;  3T97 B;  1T2K D;  2JJL A;  3B5N D;  4IFD K;  1P84 I;  3N4X A;  3P8C E;  1DEE G;  3H1K D;  3HTK B;  4H44 D;  4PD4 H;  1NTK D;  1RQV A;  1SQB G;  2Q5U A;  4O9B A;  4XFJ A;  5APQ A;  1K04 A;  2O1K A;  3IAO A;  3RK3 E;  5CCG C;  3AED C;  3CWB D;  2IFN A;  3HD7 A;  1VQM P;  4IOI H;  3VP8 A;  1HTL C;  3II6 A;  1SFC B;  1YIT P;  2AEJ A;  5KLV K;  4DT0 A;  3H25 A;  2L5G B;  2WSC H;  3CC2 P;  1URQ C;  1ZME C;  3D6Y A;  1SQP G;  1NYH A;  2BEZ F;  1JY2 O;  4ASV A;  3TGU E;  2Z4E A;  1M90 Q;  4BXL A;  3H1J J;  3D6Z A;  3AEC C;  1SQX G;  2WTY A;  2OYH A;  1LT1 A;  5KAI H;  2W83 C;  1LTB C;  2JWA A;  2ZYD A;  3VOP A;  4GIF A;  4EDF A;  2K9J B;  1N73 C;  2WSC J;  1UIX A;  3QWO C;  1AA0 A;  1SQB J;  1FDI A;  3L37 A;  2FFD B;  2WT7 B;  2UWJ E;  2BEQ D;  1OZH A;  1L2P A;  3V5B A;  5AVW B;  1OIP A;  2E75 C;  1K9M Q;  2RMZ A;  1VQK P;  4AUW A;  2O01 N;  1NTM J;  1RY3 A;  3L72 J;  5KAI E;  4BRY A;  1ZN5 A;  1JTH B;  2ZT9 C;  2XZR A;  3CCV P;  1PPJ G;  2ZXE B;  2Z5H A;  3TNU B;  1GW3 A;  1N7S A;  3C8V A;  5AVZ B;  1VF5 D;  1X0T A;  2VRS A;  4RKU J;  1PFI A;  3CC4 P;  1YJN P;  5B5E E;  1M1J C;  1SQB D;  1IK9 A;  2FYZ A;  1KB9 I;  3H1I E;  2OTK E;  4ZKU A;  1CSB A;  2OYI C;  1Q2N A;  4GOF A;  3RL0 D;  1DIP A;  2A45 G;  2ZT9 B;  2RKL A;  4PJ0 H;  2RH0 A;  3M9B A;  1Z56 A;  5TIS H;  2Y9Z A;  5EFW B;  1VQL P;  2BCC G;  3H1J D;  1N73 B;  3V2R A;  3FXD A;  1YJW P;  2E75 B;  4Z1M H;  1BE3 E;  1CZQ A;  1W5C E;  2E76 C;  1IFM A;  4RO0 A;  4NPF X;  4UB6 H;  3HUS A;  4Y99 B;  5APS A;  5AW5 B;  3CCR P;  1YYC A;  2FFD C;  2YIU C;  1NKN A;  1JY2 N;  2JKV A;  1EZV E;  2ZJS E;  4PJ0 E;  3V2P A;  2P1J A;  2IBZ I;  3OW2 O;  1AFO A;  2QJK C;  3BAS A;  1SFC C;  1NKZ B;  1HGZ A;  1P84 D;  2FBW C;  1XTG B;  2M0B A;  4HJG H;  2K88 A;  4JBZ A;  1NGM B;  3RK2 D;  3H1K J;  2YIU B;  3NTN A;  1SQX K;  1DEB A;  2CPB A;  2JEE A;  3CWB G;  1L4A A;  1FOS E;  3CI9 A;  1BCC G;  2AEM A;  1SQX D;  1L0N E;  1ZOY C;  3M91 A;  4L73 A;  3VN0 A;  1FZG A;  2R3C A;  2FYU D;  3MTU E;  3H32 B;  1N7S B;  1VQ6 P;  1IC2 A;  5AW4 B;  4KJM A;  1YIJ P;  1N2D C;  4I7Z B;  2D2C B;  4WY4 D;  1P84 H;  1NU1 E;  2IYO A;  2YNY A;  3E7K A;  1FJK A;  3PLN A;  5AVR B;  1SQB E;  2I8D A;  3KZI H;  3L35 A;  1YQ4 C;  2KNC A;  1EZV I;  4GOE A;  2E74 D;  1GL2 A;  1L0L E;  4HYT B;  2WQY C;  3EWK A;  4NPD A;  3VMY A;  5CCG D;  1SQV G;  3SWK A;  3B71 A;  2QEX P;  1OW6 A;  1FZC B;  5CCH C;  1S5L H;  1FZA A;  2E76 D;  1NAY A;  3R4Y A;  1LWU B;  4QMA A;  2IZ0 A;  4H44 C;  3GW6 A;  4U3F D;  3JCU H;  5APX A;  5KJ7 A;  2PGD A;  3KPE A;  1HWT C;  1S2E A;  2KP8 A;  2WMM A;  1Y8A A;  1J1D B;  1PP9 D;  1SQP E;  1VQ7 P;  1BGY D;  2KLV A;  3HD7 C;  1KQF B;  1SQQ D;  1EDL A;  1YHQ P;  1XTC C;  1MUU A;  3EQ2 A;  3LIE A;  4D6T G;  3G6E P;  1X79 B;  3H1H G;  1SQX E;  4U7J A;  4D6T D;  2A45 I;  2N1T B;  1H89 A;  3S4R A;  2YXR B;  1LWU A;  4IL6 X;  4RJT A;  2Y0D A;  3L70 E;  1FOS F;  3CCQ P;  1KMI Z;  2SPZ A;  3L75 E;  2HPC B;  2E5T A;  2WPQ A;  1ZR2 A;  3TGU D;  1BCC D;  1FE6 A;  3CXH E;  3LW5 H;  2IX7 C;  3M9Q A;  4C7N B;  2O1J A;  2WSF J;  2E74 C;  3O6Q A;  2NPS B;  1LT9 B;  1KIL E;  2QM8 A;  1OVV A;  3L4F A;  1AQ5 A;  1BDD A;  1RE3 C;  4WY4 B;  5C39 A;  1QL2 A;  1YBK A;  1AV1 A;  1JM0 A;  1SQP J;  1L0L K;  2GUV A;  3NFQ A;  2HR3 A;  3VMX A;  2YMK A;  3BAT A;  2P67 A;  2HOD A;  3L71 J;  2ZYA A;  3AE1 C;  2J59 M;  3PJS K;  3CCM P;  2Q3I A;  1S1C X;  1NTK E;  2H88 C;  3BCC D;  5GTH H;  1H88 A;  2OYI A;  1EXI A;  2NPS C;  3Q5R A;  1RE4 A;  1Y9B A;  3EFF K;  3TK1 A;  1GDT A;  1IO4 A;  5KLV D;  2D2C D;  1DH3 A;  3RK2 B;  1NTM E;  2BCC E;  2K37 A;  1KYO I;  1OWA A;  1GK4 A;  2GA1 A;  2QRX A;  2ZYG A;  3L72 E;  3P7K A;  5AW9 B;  1CI6 A;  4KHX A;  1LP1 A;  1GW4 A;  2N9Y B;  2FXM A;  2E74 B;  1NTM K;  2WPV B;  2YO3 A;  3OAK A;  1WT6 A;  3S1K A;  5CBO A;  4GOD A;  5AW8 B;  1NTK K;  3M06 A;  3F5H A;  3M0D C;  3TDK A;  1S9K D;  2OYH B;  1LNQ A;  2A45 H;  3H1J E;  4OGQ C;  5APT A;  2NRG A;  2D2C C;  1LTI C;  3GHG B;  4EI2 A;  1G2C B;  1JY3 O;  3VYI A;  1SFC D;  3JCU E;  4TLF A;  4EOT A;  4PV1 B;  1RF1 B;  4ZNC A;  1VQN P;  1S72 P;  3RK3 D;  1OVU A;  4NPE A;  3A0H H;  2G3A A;  2XKM A;  4ASW A;  1J1E B;  1A02 J;  1L4A C;  1SFC A;  2B87 A;  2KS1 A;  3H1L D;  3ITK A;  1QX8 A;  1SP4 A;  3WU2 H;  1EC5 A;  2IFM A;  2WSS H;  3FXE A;  3B4S A;  3L73 E;  3B5N B;  3L73 J;  2YKO A;  1KN7 A;  5GTI E;  3VP9 A;  3IFM A;  1RH5 B;  1FZB A;  1R5L A;  2CPS A;  4LLH A;  1KQL A;  3GG2 A;  4YXW H;  3V2Q A;  2J5U A;  2XDJ A;  1KIL A;  1LTS C;  2KZI A;  2K3R A;  2NPS D;  3MUD C;  5AVY B;  3D71 A;  1SQV K;  4U3F E;  3RL0 B;  3CCL P;  1SS1 A;  2IBZ D;  4UB6 E;  2Q3E A;  3JC2 2;  1G1J A;  2MJZ A;  4C7N A;  4EIJ A;  1OW7 A;  4IFF A;  5GTI H;  2QA4 P;  1SQV E;  4UB8 H;  5APV A;  3Q5P A;  2E75 D;  1NTZ G;  3H1I D;  3CX5 H;  4ZKP A;  1M7L A;  1AVO A;  2QJK B;  3H32 A;  1D7M A;  1IK7 A;  3KHU A;  1W2B O;  3WMM 0;  5TJH A;  2GUS A;  1VDF A;  1SVF A;  2M5A B;  1HUC A;  3IF4 A;  3P8C D;  1LT9 C;  4I1L A;  1Q81 Q;  1IFN A;  2OYI B;  1GL2 D;  1NU1 J;  4R4L A;  4D6T E;  5APW A;  4BRY B;  4DZO A;  2A06 D;  1X9V A;  3H1H D;  1Q86 Q;  1USD A;  3JSV C;  2BCC J;  1VQ4 P;  5E79 E;  5AVS B;  1GK6 A;  3G9R A;  4I6M C;  1PZQ A;  4DOJ A;  3HE4 A;  3WUU A;  2E42 A;  1FDM A;  2E76 B;  2QJP B;  1L0N J;  1PP9 G;  3ABV C;  3CX5 D;  2Q9I A;  2G8Y A;  1KQS O;  1P84 E;  2OQQ A;  3B8E B;  4YTP C;  5AVT B;  5KKZ C;  1BGY G;  3HE5 B;  1FBM A;  4N3Y B;  1SQV D;  4PD4 D;  2POH A;  3MHV A;  3OJA B;  1KYO D;  4L74 A;  3SWY A;  3W67 A;  2FYU G;  4GKG A;  4BWN A;  3AE9 C;  4GDO A;  1IFJ A;  3PRJ A;  4IFM A;  5KLI B;  3L75 J;  3L70 D;  2WZ7 A;  1QL1 A;  2E5Y A;  5DJU B;  1X22 A;  3RK2 C;  3CCU P;  3VMZ A;  3TF5 A;  1VQO P;  2QVA A;  2IYP A;  1SLQ A;  1T3J A;  3AE2 C;  2AXT E;  3L70 J;  4K3A A;  1J1D C;  3L36 A;  3CCJ P;  2C0W A;  2WSF H;  3IR9 A;  4JYB A;  3SSU A;  3CL3 D;  5DJT B;  2NPS A;  1NJI Q;  2P58 A;  3CCS P;  5KAF E;  3TNU A;  3NXS A;  2B88 A;  1PGJ A;  4N78 D;  1L0L D;  1HF9 A;  4PV1 D;  4OH8 B;  1GD2 E;  2JWD A;  4MN4 C;  5KKZ B;  1X8Y A;  2ZT9 D;  3AE6 C;  3PTZ A;  1Q90 D;  3RL0 g;  4A7P A;  1H0T B;  4I2L C;  3WUT A;  1JMM A;  2CK3 H;  2KYV A;  4AYC A;  2ZXX A;  2P2U A;  2XU6 A;  1NVO A;  2C0X A;  1N7S C;  1KB9 H;  2LXC B;  3H1H E;  1YTZ T;  3M0D A;  1G2C A;  1VF5 B;  2PFX A;  1ZV8 A;  3L74 G;  5TIS E;  1QGK B;  3T97 A;  3FWL A;  1OXZ A;  3RL0 C;  3L70 G;  1NTZ D;  1NWQ A;  1J2J B;  2YO2 A;  2N1T C;  4W80 A;  2KI7 B;  1K8A Q;  1PIX A;  2ITA A;  1BE3 G;  1KZU B;  3BVH A;  4W7Y A;  1BSH A;  4AQR D;  1KB9 E;  3KZI E;  2W6B A;  2HLO A;  2QE7 H;  2K9J A;  3V2N A;  2ZVO B;  3O8Z A;  5BU8 B;  4RES B;  3GLM A;  2OAR A;  2QJY B;  4N78 E;  5B66 E;  3FGA D;  1NHL A;  3S9O A;  3V4W A;  1JB0 J;  1JY3 N;  1MFT A;  5KLV G;  3Q3D A;  2C9L Y;  1J1E C;  2GM4 A;  1AVY A;  1KC8 Q;  1IJD B;  2FYN C;  5CMZ A;  1GTW A;  1HJB A;  1JUN A;  1JOC A;  1JEK A;  5GTH E;  2KB7 P;  1BE3 D;  1GL2 B;  2Y0C A;  1EZV D;  2LR2 A;  2R3S A;  3GHG C;  1HVV A;  2PAJ A;  2ZAE B;  1SQB K;  3CWB E;  3L74 J;  2YKQ A;  3L73 D;  3V6I A;  5B66 H;  3Q1M A;  1NTZ E;  1BCC E;  1LTJ B;  3CLQ A;  3CX5 I;  3CXH D;  5BVZ A;  1T2K C;  1EDJ A;  1NTM G;  3L72 G;  3H1L J;  1KTM A;  3L71 E;  3MIW A;  2ZFC A;  4WB4 A;  2BAS A;  1Y47 A;  3GF7 A;  3L74 D;  1BE3 J;  4DCK A;  3LW5 J;  2N1T D;  4GT1 A;  3U1A A;  1LWU C;  1VQ5 P;  4H0L C;  1GU4 A;  1QVF O;  1L0N K;  1HH0 A;  2QJY C;  4H13 B;  4M3L A;  1IFD A;  2Y9Y A;  3PHL A;  3A0B E;  2M3E A;  5AVU B;  3AE4 C;  2O01 J;  2WSE H;  3BCC E;  3TYY A;  3QH9 A;  1L0L G;  1RF1 A;  2H7H A;  1FZE A;  2YKP A;  2HYN A;  4OWF A;  1FJP A;  1N86 A;  2K1A A;  1GMJ A;  1OMI A;  5CHX A;  1FZC A;  1GZL A;  1DD3 A;  1GL2 C;  2H89 C;  3TGU G;  1RE3 A;  1BSN A;  4H0L D;  3W68 A;  4JPZ B;  2XNX A;  1N73 A;  5CCH A;  1K73 Q;  5AW7 B;  1S3J A;  2K9Y A;  3RK3 C;  2OGU A;  1NTZ J;  1LP1 B;  2I1J A;  2QG4 A;  3I5C A;  2YXQ B;  4LGD E;  3G4S P;  2IPP A;  3H1L E;  1KIL C;  2O3J A;  3CD6 P;  1KYO H;  1EZV G;  3GMA A;  1URQ B;  2PP6 A;  4XA4 A;  2QJP C;  3BCC J;  3P32 A;  4KT0 J;  5AW2 B;  3U1C A;  3H1K G;  2KUB A;  4XE5 B;  2RN0 A;  1KFM A;  1A02 F;  3FX0 A;  1PGQ A;  3L71 D;  3N7N A;  4W7Z A;  5H2F H;  2H43 A;  4PD4 E;  2HFE D;  3VTP C;  2W8Z A;  2KOG A;  2FXP A;  1YQ3 C;  1JTH A;  3RGU A;  2B89 A;  1L0L J;  1IZN B;  5CCG A;  1SQQ E;  3AE8 C;  3E1R A;  1NOH A;  2IBZ E;  2WPS A;  2KNC B;  3OA7 A;  1BCC J;  1L0N G;  1E79 H;  1NU1 K;  1VF5 C;  3K5B A;  1AQT A;  3TGU J;  2WVR A;  5L8R J;  1EQ7 A;  5AVV B;  1Q7Y Q;  4JF7 A;  1GU5 A;  4EYY Q;  3TSI A;  4PD4 I; 
#chains in the Genus database with same CATH homology
 3EFG A;  3UIA A;  3HUS B;  5KTB A;  3PP5 A;  1VPC A;  1H8A A;  3MD0 A;  4WBA A;  1JO5 A;  1N7S D;  2FKW B;  2N1T A;  3C9I A;  2R5D A;  2I1K A;  5AW6 B;  4LC1 A;  2M3B A;  3E1I A;  1GU5 A;  2WIT A;  1LTJ C;  5APU A;  1S9K E;  3MUD A;  1L4A B;  1G1I A;  2XV5 A;  1MZ9 A;  3H6P A;  3MGN A;  3M0A A;  1LTA C;  3BRV B;  4HH2 A;  1W2E A;  3V4Q A;  2WT7 B;  2FYU K;  1M1J A;  1LT9 A;  1JCC A;  1IFI A;  2W6A A;  1FZF A;  1T8Z A;  2O01 H;  1JY3 P;  2R32 A;  2WT7 A;  1HBW A;  5AW0 B;  2FFD A;  2Z5I A;  1SQP K;  3B5N A;  3KQG A;  1E5W A;  1KFN A;  2WWW A;  4N6J A;  1FAV A;  1NH4 A;  1NTZ K;  5CJ0 A;  1CW5 A;  1N7L A;  4JYC A;  2QM7 A;  1RF1 C;  2N9B A;  4C46 A;  1NO4 A;  5BU5 A;  3HTK A;  3KYQ A;  2HPC A;  2W27 A;  1NAF A;  1URQ A;  3NMD A;  2WPR A;  2YMY A;  1CI6 B;  1URQ D;  1M1J B;  5AW3 B;  2OYH C;  1DX7 A;  4WY4 A;  1MFZ A;  1LGH B;  3HUS C;  1YTZ I;  3SWF A;  2HOD B;  4B86 A;  5KJ7 C;  3M9H A;  1RE4 C;  1ZR4 A;  2H8P D;  5AVQ B;  5AW1 B;  1L4A D;  1T3U A;  3KDP B;  3HE5 A;  5CJ4 A;  2Q7C A;  2J58 A;  4WY4 C;  5AVX B;  1KIL B;  1ZLL A;  3BRT B;  3A2A A;  3HD7 D;  3G3Z A;  3P8M C;  3A5T A;  1RF0 A;  4Y99 C;  3GHG A;  1LTT C;  5CCH D;  1LTJ A;  2C9N Y;  3HE4 B;  3RK3 B;  3A7O A;  2R5B A;  1LTG C;  3HD7 B;  3U59 A;  1FU1 A;  1KIL D;  2M8R A;  1RF0 C;  1JCD A;  3LID A;  1SQQ K;  5KJ7 D;  1JY2 P;  4C7R A;  2P7J A;  1FZC C;  2KSJ A;  1HGV A;  2HG5 D;  1JNM A;  3HRN A;  3B5N C;  1MV8 A;  5APY A;  3R2P A;  3A3Y B;  1WRG A;  2LKM A;  1T2K D;  2JJL A;  3B5N D;  4IFD K;  3N4X A;  3P8C E;  3HTK B;  2Q5U A;  4O9B A;  5APQ A;  2O1K A;  5CCG C;  2IFN A;  3HD7 A;  3VP8 A;  1HTL C;  3II6 A;  1SFC B;  5KLV K;  2L5G B;  2WSC H;  1URQ C;  1JY2 O;  2Z4E A;  2OYH A;  2WTY A;  2E43 A;  1N73 C;  1LTB C;  3VOP A;  4GIF A;  3L37 A;  2FFD B;  3V5B A;  5AVW B;  4AUW A;  1RY3 A;  1ZN5 A;  1JTH B;  2XZR A;  2ZXE B;  2Z5H A;  3TNU B;  1GW3 A;  1N7S A;  5AVZ B;  2VRS A;  1PFI A;  1M1J C;  1IK9 A;  2FYZ A;  4ZKU A;  1CSB A;  2OYI C;  3RL0 D;  2A45 G;  3M9B A;  1Z56 A;  1N73 B;  3V2R A;  1CZQ A;  5APS A;  1IFM A;  5AW5 B;  4Y99 B;  3HUS A;  1YYC A;  2FFD C;  1NKN A;  1JY2 N;  3V2P A;  2P1J A;  1AFO A;  3BAS A;  1SFC C;  1NKZ B;  1HGZ A;  1XTG B;  3RK2 D;  3NTN A;  1SQX K;  1DEB A;  2CPB A;  2JEE A;  1L4A A;  1FOS E;  3CI9 A;  3M91 A;  1FZG A;  3VN0 A;  2R3C A;  3MTU E;  3H32 B;  1N7S B;  1IC2 A;  5AW4 B;  1N2D C;  4WY4 D;  2YNY A;  1FJK A;  5AVR B;  3L35 A;  1GL2 A;  4HYT B;  3VMY A;  5CCG D;  1FZC B;  5CCH C;  1FZA A;  1LWU B;  5APX A;  5KJ7 A;  3KPE A;  1HWT C;  2KP8 A;  1J1D B;  2KLV A;  3HD7 C;  1XTC C;  1MUU A;  3EQ2 A;  3LIE A;  1X79 B;  1H89 A;  2A45 I;  2N1T B;  1LWU A;  1FOS F;  2HPC B;  2WPQ A;  1ZR2 A;  3LW5 H;  4C7N B;  2IX7 C;  3M9Q A;  2O1J A;  2NPS B;  1LT9 B;  1AQ5 A;  2QM8 A;  3L4F A;  1RE3 C;  4WY4 B;  1QL2 A;  3VMX A;  1L0L K;  2GUV A;  3NFQ A;  3BAT A;  2P67 A;  2HOD A;  2J59 M;  2Q3I A;  1H88 A;  2OYI A;  2NPS C;  1RE4 A;  1GDT A;  3TK1 A;  1IO4 A;  1DH3 A;  3RK2 B;  1OWA A;  3P7K A;  1GK4 A;  5AW9 B;  1CI6 A;  4KHX A;  1GW4 A;  2FXM A;  2YO3 A;  1NTM K;  3OAK A;  1WT6 A;  5AW8 B;  1NTK K;  3M06 A;  3M0D C;  1S9K D;  2OYH B;  2A45 H;  5APT A;  1LTI C;  3GHG B;  1G2C B;  1JY3 O;  3VYI A;  1SFC D;  4EOT A;  1RF1 B;  3RK3 D;  2XKM A;  1A02 J;  1J1E B;  1L4A C;  1SFC A;  1SP4 A;  2IFM A;  3B5N B;  2YKO A;  3VP9 A;  3IFM A;  1FZB A;  4LLH A;  2CPS A;  1KQL A;  3V2Q A;  2XDJ A;  5AVY B;  1KIL A;  1LTS C;  2NPS D;  1SQV K;  3RL0 B;  1G1J A;  2MJZ A;  4C7N A;  4EIJ A;  4IFF A;  5APV A;  4ZKP A;  1M7L A;  3H32 A;  3WMM 0;  2GUS A;  1VDF A;  1SVF A;  1HUC A;  3P8C D;  1LT9 C;  4I1L A;  2OYI B;  1IFN A;  1GL2 D;  5APW A;  4DZO A;  1X9V A;  5AVS B;  1GK6 A;  4I6M C;  4DOJ A;  3HE4 A;  2E42 A;  1FDM A;  2Q9I A;  3B8E B;  5AVT B;  3HE5 B;  1FBM A;  4N3Y B;  2POH A;  3SWY A;  3OJA B;  4GKG A;  4IFM A;  1IFJ A;  3RK2 C;  2WZ7 A;  1QL1 A;  3VMZ A;  1SLQ A;  1T3J A;  1J1D C;  3L36 A;  2C0W A;  2WSF H;  3IR9 A;  4JYB A;  3CL3 D;  2NPS A;  3TNU A;  3NXS A;  4N78 D;  4OH8 B;  1GD2 E;  1X8Y A;  4I2L C;  1JMM A;  2KYV A;  4AYC A;  2P2U A;  2XU6 A;  2C0X A;  1N7S C;  3M0D A;  1YTZ T;  1G2C A;  1ZV8 A;  3T97 A;  1OXZ A;  3RL0 C;  1NWQ A;  1J2J B;  2YO2 A;  2N1T C;  4W80 A;  1KZU B;  3BVH A;  4W7Y A;  4AQR D;  2W6B A;  2HLO A;  3V2N A;  5BU8 B;  3O8Z A;  4RES B;  2OAR A;  4N78 E;  1NHL A;  3V4W A;  1JY3 N;  2C9L Y;  2GM4 A;  1J1E C;  1IJD B;  5CMZ A;  1GTW A;  1JUN A;  1HJB A;  1JOC A;  2KB7 P;  1GL2 B;  3GHG C;  1HVV A;  2PAJ A;  1SQB K;  2YKQ A;  3CLQ A;  1LTJ B;  5BVZ A;  1T2K C;  3MIW A;  4WB4 A;  2ZFC A;  2BAS A;  2N1T D;  4GT1 A;  3U1A A;  1LWU C;  1GU4 A;  1L0N K;  1HH0 A;  4M3L A;  1IFD A;  5AVU B;  3TYY A;  2WSE H;  1RF1 A;  2H7H A;  1FZE A;  2YKP A;  2HYN A;  1FJP A;  1N86 A;  5CHX A;  1FZC A;  1GZL A;  1GL2 C;  1RE3 A;  2XNX A;  1N73 A;  5CCH A;  5AW7 B;  3RK3 C;  3I5C A;  2I1J A;  2IPP A;  1KIL C;  1URQ B;  2PP6 A;  4XA4 A;  3P32 A;  3U1C A;  5AW2 B;  4XE5 B;  1A02 F;  1KFM A;  3N7N A;  4W7Z A;  2H43 A;  2HFE D;  3VTP C;  2KOG A;  1JTH A;  5CCG A;  1NOH A;  2WPS A;  3OA7 A;  4LGD E;  1NU1 K;  1EQ7 A;  5AVV B;  4JF7 A;  3TSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...