1RE4A

Crystal structure of fragment d of bbetad398a fibrinogen
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha/alpha-E chain
publication title BbetaGlu397 and BbetaAsp398 but not BbetaAsp432 are required for "B:b" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 24
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1re4A00
1M1JB 3E1IA 1FZGA 1N73A 1LWUA 2A45H 1LT9B 1LTJC 1JY3P 1RE3C 1M1JA 2FFDC 2OYIC 1FZCB 3GHGC 1RE4C 1JY2N 1RF1B 1RF0C 3HUSC 1JY2O 1LT9A 1N73C 1FZEA 2OYIB 2Q9IA 1FZCA 2OYHB 1W2EA 1N86A 2H43A 2Z4EA 1LWUC 1RF1A 1M1JC 2OYIA 2OYHA 1FZBA 1FZAA 1LTJB 1JY2P 1T3UA 3BVHA 2A45I 1LT9C 2HODB 3H32B 2FFDB 2XNXA 3GHGB 1FZCC 3HUSB 2HPCB 2A45G 1JY3N 1FZFA 1LTJA 1RF1C 1RE3A 2FFDA 1JY3O 1N73B 3HUSA 1RE4A 2HLOA 2HODA 3H32A 1LWUB 3GHGA 2OYHC 1RF0A 2HPCA
chains in the Genus database with same CATH superfamily
2IZ1A 1KFNA 3M0DA 4DZOA 1LTIC 1NTMG 4EOTA 4L75A 3HUSC 4BWNA 1NTKJ 2PFXA 1G2CA 4W7ZA 2KZIA 2WPRA 1HGZA 2E76C 1ZW0A 1DD3A 5APWA 5APVA 1FBMA 5CBNA 2QJKC 3CXHE 1AA0A 1KTMA 2FFDC 4IOIH 1SFCC 1VQ5P 2KS1A 1NAFA 3R2PA 2QM8A 2V4HA 3BRVB 3GMAA 3IFMA 1SQVG 4C46A 3GHGC 1GU5A 4EYYQ 1JUNA 3IF4A 4BRYB 1L0LK 1DIPA 3AE2C 1GL2A 5M1BA 3TGUE 1YYCA 3PRJA 3WMM0 2OTLP 1URQB 1ZXGA 1KC8Q 1K9MQ 3USSA 3HD7A 2BEQD 1M1JC 3CXHH 4GOFA 2ITAA 4PD4H 1SQQJ 4JYBA 3II6A 2A45G 2KIKA 3LW5H 1QGKB 2WZ7A 4HB1A 3W68A 5KLIB 3G3ZA 4M3LA 3CCLP 5KLVG 5BU5A 3EWKA 1EQ7A 1LTJB 1S2EA 3VN0A 2HR3A 1RE3A 1GL2D 3RL0B 4PJ0H 1UIXA 1FDMA 1TU3F 3LIEA 1PPJG 1NJIQ 3TDKA 1N7SC 1NTMJ 2CPSA 2NPSC 2YKQA 2OYOA 2YMYA 2XNXA 1OX3A 5B5EH 1CI6B 2I8DA 1M1KQ 2E74D 4U7JA 2AEFA 1S5LX 4HH2A 2FXOA 1KN7A 2A45H 4Y99C 1L0LE 4I2LC 3PH0A 1L0LG 3F5HA 2OYHB 3M0DC 3M06A 4H0LD 3VMZA 2K88A 1ZR4A 2DW3A 2N9YB 4H44B 4BRYA 4K35A 1S5LH 1QX8A 1IFNA 4PV1C 1YBKA 2W6JH 4RJTA 3CL3D 1QVGO 1RQVA 3AEDC 3JC22 1SQVJ 4AYCA 1URQA 3QWOC 3P8CE 1SQXD 1VL2A 3G6EP 1JY3N 1HGVA 3WUUA 1NGMB 4GDOA 3HE5B 2RN0A 1U7MA 2PRRA 1NTZK 1LTJA 1L0ND 3SWYA 5APUA 1KB9D 5AW1B 4W7YA 5GTHE 1X8YA 2KYVA 2XU6A 3L70J 1RQUA 2PP6A 2IDBA 2JO1A 5KLVJ 1HWTC 3HD7C 3VP9A 1PP9G 1YJWP 1VQ4P 2ZT9B 1CI6A 1RE4C 3CXHD 3S4RA 3Q3DA 3WU2H 2OYHA 1BDCA 2M5AB 1BSHA 1WRGA 1SP4A 1SQVD 1FZCB 4WWIA 4WVZA 1LNQA 1DH3A 3H1IG 1FOSF 3S9OA 3ZDMA 1EXIA 1JY2P 4DCKA 4L73A 4H13D 1SQBK 1JTHB 1ZMEC 2B87B 3TGUD 2I1JA 1NTZG 3CWBE 1NOHA 1UIIA 3KZIE 3AE3C 3HE5A 1J1EC 1VQ7P 4EIJA 3AEAC 4DOJA 1JO5A 4KHXA 2N1TB 4YXWH 3OAKA 3D71A 1KYOE 4PD4I 2K9JB 4XA4A 3MP7B 2POHA 3RBXA 2ZYAA 5KKZC 1QEXA 3RK3B 5CHXA 3MGNA 1EDLA 2NRGA 3L72G 2YKPA 2D2CC 2QJYB 2L5GB 1LJ2A 3O8ZA 3CCQP 3A0BH 2BCCE 2BCCG 1NKNA 1NU1E 5KJ7C 2IZ0A 4MN4C 2M5AA 2K1AA 1S9KE 5CCGD 1PP9J 1GU4A 3G71P 1BE3E 3Q5PA 1L0LD 2W83C 3E7KA 1BE3G 3RK2D 1FZCA 1SQBE 2A45I 2HODB 1SQQK 5AVZB 1KILE 1NYHA 1OVRA 1NTKE 2AEMA 5AW8B 1PFIA 1JTHA 3B5NC 3CPWO 2Y9YA 2B87A 3NFQA 3V6IA 3AEBC 3H6PA 3H1IJ 1Y9BA 3PP5A 1NHLA 2N1TA 1LTTC 4H44C 1MKMA 3PJSK 2K9JA 3G9RA 4RO0A 2OYIB 3AEEC 2OTJP 2WT7A 1HJ0A 2KXPB 3JCUH 2OARA 1NTMK 5AVSB 2OGUA 1HF9A 2ZYDA 1NTZJ 4OGQD 2Q3IA 3H1LG 3V4WA 2KLUA 1XTCC 5DJTB 3VOPA 2Y9ZA 1S72P 5B66H 1QLED 3M0AA 3MUDC 4L74A 3Q1MA 1FDOA 2XKMA 4KT0J 2Q9IA 2GUVA 3C9IA 2E76D 1G1IA 2JEEA 1KILB 3S1KA 1CSBA 2R44A 2WPQA 1PP9D 4W80A 1SFCD 1IK7A 3L72J 5APTA 1L2PA 1RF0C 1SQQE 3QH9A 4B86A 1PGQA 1JOCA 1GL2B 5KAFE 3CCMP 1HVVA 1NAYA 1OFCX 3VMYA 2HODA 5GTIH 1MFTA 2JP3A 2H88C 4R4MA 3AECC 2Z5IA 1R8EA 2O1JA 4GT1A 5AW2B 1BGYG 3C1LA 3FXDA 2ZT9C 2R3SA 2E74B 3BVHA 2B9BA 1LWUB 1IC2A 1IFIA 1K05A 1NTME 4L76A 5BVZA 1CW5A 5AW7B 1HUCA 4H0LB 3MD0A 3V2PA 4IFDK 3H1HG 3CC4P 1W2BO 1S1CX 3CWBD 2OYIA 2IBZI 4UB8H 3EQ2A 1FZCC 2WITA 3H1JG 3L4FA 2FXMA 5KLVK 1T2KC 3WUVA 5KAFH 1JCCA 1LT1A 1KYOD 4PD4E 3L74G 3U59A 4C7NB 1IZNB 4DJGA 2FY8A 2E43A 3M9QA 1Q7YQ 1OWAA 1KILA 1Z56A 2AXTH 2LXCB 2M3EA 3R4YA 1SQVE 4EI2A 3LIDA 1VQKP 3H1LJ 1R5SA 5KTBA 2IYPA 4OVNF 2IFMA 3CI9A 2N1TC 3AE8C 2AEJA 2BCCD 1FZBA 3ABVC 3CX5I 4PJ0E 3L36A 1K8AQ 1IFPA 5AW4B 1YJNP 2B89A 3FGAD 1NU1D 3RK3C 3P7KA 3E1RA 1IFMA 3FXEA 1PGPA 2R32A 1P84I 3A3YB 4WY4B 1S9KD 2JKVA 2IYOA 2WTYA 1MUUA 1BE3D 5B5EE 4IFMA 2HYNA 1S3JA 3UIAA 3OW2O 2E5YA 1SQBD 3CCUP 3A0HE 2KSEA 2M8RA 1KILD 3L70E 2JJLA 3L37A 3L70G 1LWUA 1NTKD 5AW9B 1IFDA 4QMAA 2ZVNB 1RHZB 5KLVE 3MZWB 1S5LE 2FYUJ 1ZR2A 2QIWA 4K3AA 1BGYJ 2IPPA 1HBWA 1LT9B 2W8ZA 4D6TG 1PPJE 4U3FG 3I55P 1JY2O 2M3BA 4ZNCA 3TSIA 3D70A 4H13B 4C7NA 1G1JA 1BDDA 3H1HJ 3L75G 1N73B 1KQLA 1T6AA 3H1JJ 4CPGA 1EDJA 4ASWA 1L4AB 5AVUB 1AVYA 3A0HH 1Q2NA 4N6JA 1LTGC 3L74J 2QM7A 1Q86Q 3B8EB 2W6BA 1OZHA 4IL6X 1VQMP 3I5CA 1SQQD 4WY4A 1YITP 4TT3H 1YIJP 1BCCG 3H25A 2I1KA 1GZLA 3BCCE 2FYNC 3BCCG 3SWKA 4IL6H 3HRNA 1FZGA 1E5WA 1BSNA 1A02J 1AJYA 3WU2E 1RF1B 1Q90D 2IFNA 1BGYD 1VF5D 3H1KG 5APYA 1ZV8A 1J1DB 1IO4A 3RBZA 1GL2C 3RK2B 1NTMD 2IX7C 1LT9A 2H43A 4WY4D 2KUBA 2WSSH 2IBZE 2IBZG 1PP9E 3FWNA 2MJZA 3IAOA 1N73A 1D7MA 2E74C 2E75D 1U57A 1L4AA 3TNUB 4PD4D 1OW7A 1AVOA 3AE6C 3GF3A 2G3AA 4D6TJ 4U3FJ 2D2CD 5CJ4A 1MZ9A 2KB7P 3KYQA 2J59M 4N78E 1EZVI 3CCSP 1KD1Q 2B88A 3G4SP 1QL2A 2PAJA 1DEBA 2QRXA 3L75J 3U1AA 3T97A 1RE3C 5CCHA 2BASA 3H1IE 1ZP0C 4OGQB 3KXDA 3SSUA 3K5BA 5KJ7D 2K37A 3EFGA 3I56P 3CX5E 3HUSB 2ZXEB 3A0BE 3TYYA 2Q6QA 1OVUA 1FJPA 3VTPC 1P84E 2E76B 5AVYB 3CCRP 1NTZE 1L4AD 4I1LA 1RF1A 2QJKB 2LKMA 4XFJA 2YIUB 2WPVB 5AVQB 1SFCB 1FZFA 3AE1C 1MV8A 3B5ND 2FXPA 1BCCJ 5CCGA 3L70D 3FWLA 3BCCJ 1A02F 1KQGB 2WT7B 2C0XA 5CCHD 5KLVD 1RY3A 4WBAA 3OJAB 3D6YA 2ZJSE 1URQC 3L72E 3H1KJ 1E79H 4RESB 1YJ9P 3CX5H 2G8YA 2ZVOB 2P1JA 5AVWB 4D6TD 1PPJD 3L35A 3TNUA 3JSVC 1PL5A 3N7NA 1T3UA 2YXRB 5KLIC 1P84H 2WSEH 1LTAC 5APSA 3AEGC 1USDA 1X9VA 1QVFO 1M7LA 2V7QH 1M1JB 3JCUE 1LTJC 3PHLA 5APXA 1OVVA 1VQLP 1HTLC 1OIPA 1SQPJ 2P58A 1FJKA 1W2EA 1N86A 1PZQA 3RL0C 5AVTB 5APQA 1YTZT 4UB6H 5B66E 3PTZA 3HUSA 4KJMA 2NZ2A 5E79H 1JY3P 2PGDA 1SLQA 1N73C 3EFFK 1KMIZ 5EFWB 2FYUK 3AE7C 3P8MC 2WVRA 3L71G 2Q5UA 2FFDA 2OYHC 3BCCD 1SFCA 4HYTB 4OH8B 3Q5RA 3BRTB 2H89C 2ZFCA 3SFEC 1YQ3C 2GM4A 5GTIE 3H1KD 2WSEJ 4JQ0D 3H1LE 2V7QJ 3Q5SA 4YTPC 2KK7A 2QJPB 1DX7A 3AE4C 3MTUE 3P32A 2IBZD 4I7ZB 4NPDA 4LC1A 3TK1A 4BXLA 1J1DC 1M1JA 4UB8E 3MIWA 1YI2P 3BASA 5CCGC 1GW3A 1EC5A 4AQRD 2UWJE 2W6AA 4LLHA 1S4XA 2KSJA 3AE9C 1EZVE 4N78D 1EZVG 4R4LA 2P2UA 2FYUE 1GK4A 2FYUG 2YO3A 4TLFA 1FS0E 2W27A 3VYIA 1BGYE 5AW0B 1U7JA 3H1ID 2A06E 2AXTE 2A06G 3VMXA 1FE6A 1LGHB 2P67A 3CX5D 3KPEA 1DD4A 5H2FH 5AW5B 3ITKA 2YMKA 1KFMA 2L91A 3H1HE 4XE5B 1JNMA 1P84D 1NTZD 1GD2E 5KAIH 3H1JE 1L0NG 2O01J 2GA1A 2WSFH 1WT6A 3GW6A 2M0BA 4LGDE 4YPCA 4OGQC 2SPZA 3L71J 1FOSE 1OMIA 1KZUB 1YHQP 3CMAP 1AV1A 5AW6B 3L74E 1EDIA 3TF5A 3PLNA 1VQNP 3M9HA 2YO2A 3L73E 3L73G 3L72D 3IR9A 2J58A 2YIUC 3HTKB 1EXJA 2JWDA 1VF5B 1N7SD 2ZYGA 2NPSD 3CLQA 2WMMA 4DT0A 3KHUA 5AW3B 3H32B 5CJ0A 2VRSA 3A2AA 5BU8B 1J1EB 2LR2A 1VDFA 3BATA 1H88A 1KB9H 3RGUA 2QJYC 1JMMA 2WSFJ 2QA4P 3GF7A 5KKZB 2HPCB 4PV1D 2E75B 3E1IA 5TJHA 2HG5D 2R5BA 5AVRB 3TGUG 2J5UA 2Q7CA 1JY2N 2K9YA 1JB0J 2D2CB 1EDKA 4NPFX 4NPEA 1SQXJ 1QL1A 3L71D 1PIXA 1GMJA 1RE4A 1KYOI 1NWQA 3SWFA 4D6TE 4U3FE 2RH0A 2K3RA 2BEZF 4IL6E 3L75E 5L8RJ 1JM0A 1KQSO 2E42A 3V2QA 1N7LA 1LP1B 1L0NJ 3H1LD 4N3YB 4Y28J 1K73Q 1IFJA 3A5TA 3HTKA 1ZRTE 1USEA 3CCJP 1SQPK 2FBWC 1RH5B 3HD7D 1KORA 1H89A 3B5NB 5DJUB 1ZOYC 1K04A 2Y0EA 3H32A 2OYIC 3T97B 1IJDB 3L73J 3VMAA 2W90A 4GOEA 1VPCA 1OXZA 3KDPB 1BCCE 4RKUJ 1ZLLA 2QJPC 2XZRA 2MKVA 2Y0DA 3LW5J 4ZMDA 2HPCA 1EZVD 2C9NY 2CK3H 1KILC 2FYUD 2KZJA 2XNDH 4I7ZC 2RKLA 2QG4A 3H1KE 1XTGB 4C7RA 1VQ9P 5CMZA 1FZAA 1PGJA 2A06D 1M56D 1ZN5A 1PGOA 1PV3A 2YKOA 2C9LY 1T3JA 2WPSA 1W5CE 3O6QB 3H1HD 3TGUJ 5KJ7A 2JDIH 4ZKPA 3CCEP 3H1JD 1JY3O 1M90Q 1SQPE 1HJBA 1SQPG 3CMEP 2WSCH 1LP1A 3M9BA 4O9BA 2WWWA 1GK6A 1SVFA 3L74D 1LWUC 2Z5HA 1VQOP 1URQD 2ZAEB 3A7OA 4GIFA 1H0TB 3NXSA 3AEFC 2YXQB 4H0LC 4JYCA 3B5NA 2H8PD 3L73D 2R5DA 3IN6A 1X0TA 4JF7A 4WB4A 1WMKA 1GDTA 4HKZH 2OTKE 3RK3E 1GTWA 4I6MC 1N2DC 1OW8A 1R5LA 3B4SA 4AUWA 2FKWB 1NU1K 3U1CA 3RL0D 1JEKA 3Q2YA 2P7JA 1L0LJ 5GTHH 5CBOA 1N8RQ 2YNYA 1VF5C 2FFDB 1FAVA 3OA7A 1FU1A 1KB9I 1MFZA 3MUDA 3NTNA 2KNCB 1CZQA 1YQ4C 2WSCJ 2Q1KA 3CC2P 3SFDC 4UB6E 3HE4B 1NTKK 3FX0A 1AQTA 1LTSC 3CWBG 2Z4EA 1Y47A 2ZXXA 2KLVA 3O6QA 4HJGH 1VQ6P 5E79E 3GHGB 4WY4C 1NO4A 1RF0A 3CXHI 4H44D 1J2JB 4JBZA 3RL0g 3GG2A 2E75C 4U3FD 1GW4A 3AE5C 1OW6A 3CD6P 2XDJA 1H0TA 2CPBA 1H8AA 3L75D 4EDFA 2GUSA 1LTBC 2AXCA 4IFFA 2P10A 1FZEA 3N4XA 3V5BA 1JCDA 2N9BA 1ZRTD 1KQFB 2FYZA 1IK9A 1LT9C 1NU1G 1YTZI 2QE7H 4JPZB 3KZIH 3W67A 4GODA 2H7HA 4H13C 2JR8A 3V2NA 1Q81Q 1KYOH 1SQBG 2R3CA 3CC7P 1L4AC 4ZKUA 5K5GB 3L71E 2RMZA 1SQXK 1BCCD 1JMBA 2QSIA 2WQYC 3C8VA 1N7SB 3NMDA 1NTKG 2NPSB 2QEXP 2KP8A 1NVOA 2KNCA 1AQ5A 2ZT9D 4YXDC 3HE4A 5C39A 3P8CD 4Y99B 5TISE 5CCHC 4A7PA 1AFOA 2O3JA 2O1KA 3GHGA 1L0NK 2E5TA 3V2RA 1G2CB 3M91A 1Q82Q 4GKGA 1DEEG 1X79B 3F89A 1VQPP 5AVXB 2KOGA 4Z1MH 4PV1B 4ASVA 1T2KD 5H2FE 3CWBJ 2OQQA 2O01H 1RF1C 4OWFA 2HLOA 2JWAA 1SQPD 1FC2C 1NKZB 5KAIE 2KS1B 2FYNB 1SS1A 3RK2C 3KQGA 1HH0A 2KI7B 1M57D 1FDIA 5TISH 1Y8AA 1M8OB 1T8ZA 2N1TD 3CCVP 1SQQG 1SQXE 1SQXG 1SQVK 1X22A 2QVAA 2HFED 3VP8A 3RK3D 2BCCJ 3B71A 2Q3EA 3WUTA 2Y0CA 1NU1J 1N7SA 2NPSA 3HD7B 2O01N 2C0WA 3V4QA 3MHVA 1VQ8P 5AVVB 2LXBA 1BE3J 1NH4A 1L0NE 3D6ZA 3GLMA 1SQBJ 1KB9E 1KV4A 2XV5A
chains in the Genus database with same CATH topology
1KFNA 2PAJA 5AW8B 1DEBA 3U1AA 4N3YB 3T97A 3M0DA 4DZOA 1PFIA 1LTIC 4EOTA 1RE3C 1JTHA 3B5NC 1IFJA 3A5TA 3HUSC 3HTKA 2BASA 5CCHA 1G2CA 1SQPK 3HD7D 1H89A 5KJ7D 3NFQA 3B5NB 3EFGA 3H6PA 4W7ZA 3HUSB 2WPRA 1HGZA 3H32A 2ZXEB 2OYIC 5APWA 5APVA 1FBMA 3PP5A 1NHLA 1IJDB 3TYYA 2N1TA 1LTTC 2FFDC 1FJPA 3VTPC 5AVYB 1SFCC 2OYIB 1L4AD 4I1LA 2WT7A 1RF1A 2OARA 1NTMK 1VPCA 1OXZA 5AVSB 2LKMA 3KDPB 1NAFA 1ZLLA 5AVQB 2XZRA 1SFCB 1FZFA 3R2PA 2Q3IA 1MV8A 3B5ND 3V4WA 2HPCA 1XTCC 2QM8A 3BRVB 5CCGA 3VOPA 3IFMA 2C9NY 4C46A 3M0AA 1KILC 3GHGC 1GU5A 1A02F 2WT7B 2XKMA 2C0XA 2Q9IA 2GUVA 3C9IA 1JUNA 5CCHD 1RY3A 4WBAA 3OJAB 1XTGB 4C7RA 1L0LK 5CMZA 1FZAA 1G1IA 2JEEA 1KILB 1GL2A 1CSBA 1ZN5A 1URQC 2WPQA 2YKOA 4W80A 4RESB 2C9LY 1SFCD 1T3JA 2WPSA 1YYCA 5APTA 2P1JA 3WMM0 1URQB 5AVWB 1RF0C 4B86A 3L35A 3HD7A 5KJ7A 3TNUA 1M1JC 1JOCA 1GL2B 1HVVA 3N7NA 1T3UA 4JYBA 3II6A 4ZKPA 2WSEH 1LTAC 5APSA 2A45G 3VMYA 1X9VA 1M7LA 1JY3O 2HODA 3LW5H 1M1JB 2WZ7A 1HJBA 2WSCH 1LTJC 3M9BA 5APXA 2Z5IA 4O9BA 3G3ZA 2WWWA 1HTLC 1GK6A 2O1JA 4GT1A 4M3LA 5AW2B 1SVFA 1FJKA 1W2EA 1N86A 5BU5A 1LWUC 2Z5HA 3RL0C 5AVTB 1EQ7A 1URQD 3A7OA 5APQA 1LTJB 4GIFA 3NXSA 3BVHA 1YTZT 3VN0A 4JYCA 1RE3A 3B5NA 1GL2D 2H8PD 1LWUB 3HUSA 3RL0B 2R5DA 1IC2A 1IFIA 1FDMA 5BVZA 1JY3P 3LIEA 1CW5A 5AW7B 4JF7A 1HUCA 3MD0A 4WB4A 3V2PA 1SLQA 4IFDK 1N73C 1GDTA 1N7SC 2CPSA 2NPSC 2YKQA 2FYUK 2OYIA 3P8MC 3EQ2A 4I6MC 1N2DC 2YMYA 2WITA 1GTWA 2XNXA 3L4FA 1FZCC 2FXMA 5KLVK 2Q5UA 1T2KC 1CI6B 2FFDA 4AUWA 2OYHC 1SFCA 4HYTB 1JCCA 4HH2A 4OH8B 2FKWB 2A45H 1NU1K 4Y99C 3U1CA 4I2LC 3RL0D 3BRTB 2P7JA 2OYHB 3U59A 3M0DC 2ZFCA 4C7NB 3M06A 2GM4A 2E43A 3VMZA 3M9QA 1ZR4A 2YNYA 2FFDB 1FAVA 3OA7A 1OWAA 1FU1A 1MFZA 1KILA 3MUDA 1Z56A 3NTNA 1CZQA 1IFNA 3CL3D 3LIDA 5KTBA 3HE4B 1NTKK 2IFMA 1LTSC 2N1TC 3CI9A 1URQA 4AYCA 2Z4EA 3P8CE 1DX7A 1FZBA 2KLVA 3L36A 3GHGB 3MTUE 3P32A 4WY4C 1JY3N 1HGVA 5AW4B 1NO4A 4LC1A 1RF0A 3RK3C 3TK1A 3P7KA 1IFMA 1J1DC 1J2JB 1M1JA 2R32A 3A3YB 4WY4B 1S9KD 3MIWA 2WTYA 3BASA 1MUUA 5CCGC 3HE5B 1GW3A 4IFMA 1GW4A 2HYNA 3UIAA 4AQRD 2W6AA 4LLHA 1NTZK 2XDJA 2KSJA 1LTJA 2CPBA 1H8AA 3SWYA 4N78D 5APUA 2M8RA 1KILD 2JJLA 3L37A 2P2UA 2GUSA 1LWUA 5AW1B 5AW9B 4W7YA 1GK4A 1X8YA 1IFDA 2KYVA 2YO3A 2XU6A 3VYIA 2W27A 1LTBC 4IFFA 1FZEA 3N4XA 3V5BA 1JCDA 2N9BA 5AW0B 2PP6A 1ZR2A 3VMXA 2FYZA 1IK9A 1LGHB 1LT9C 1HWTC 3HD7C 2P67A 1YTZI 2IPPA 3VP9A 3KPEA 1CI6A 1HBWA 2H7HA 1LT9B 5AW5B 3V2NA 1RE4C 1KFMA 1JY2O 4XE5B 1JNMA 2M3BA 3TSIA 2R3CA 2OYHA 1L4AC 1GD2E 4C7NA 1G1JA 4ZKUA 2WSFH 1WT6A 1SQXK 1N73B 4LGDE 1KQLA 1N7SB 3NMDA 2NPSB 1WRGA 1L4AB 2KP8A 1FOSE 1SP4A 1KZUB 5AVUB 1FZCB 1AQ5A 5AW6B 1DH3A 4N6JA 1FOSF 3M9HA 3HE4A 2YO2A 1LTGC 3P8CD 1JY2P 4Y99B 5CCHC 2QM7A 1AFOA 2O1KA 3GHGA 3B8EB 1SQBK 2W6BA 1JTHB 3IR9A 2J58A 1L0NK 3HTKB 3V2RA 1G2CB 1N7SD 2NPSD 3M91A 3CLQA 3I5CA 2I1JA 4GKGA 1X79B 4WY4A 1NOHA 5AVXB 2KOGA 3HE5A 1J1EC 1T2KD 4EIJA 5AW3B 3H32B 2I1KA 4DOJA 1JO5A 2O01H 1GZLA 5CJ0A 1RF1C 2VRSA 2HLOA 4KHXA 3A2AA 2N1TB 3HRNA 5BU8B 1J1EB 3OAKA 1FZGA 1E5WA 1VDFA 1A02J 4XA4A 1NKZB 2POHA 3BATA 1H88A 1RF1B 2IFNA 3RK3B 5APYA 1ZV8A 5CHXA 1JMMA 3MGNA 3RK2C 1J1DB 3KQGA 2HPCB 1HH0A 1IO4A 2YKPA 2L5GB 3E1IA 2HG5D 1GL2C 3RK2B 2R5BA 5AVRB 1T8ZA 2N1TD 3O8ZA 2Q7CA 1JY2N 2IX7C 1LT9A 1SQVK 2H43A 4WY4D 2HFED 1NKNA 1QL1A 3VP8A 3RK3D 5KJ7C 1RE4A 1NWQA 2MJZA 1N73A 1S9KE 5CCGD 1N7SA 3SWFA 2NPSA 1GU4A 3HD7B 1L4AA 3V4QA 2C0WA 3TNUB 3RK2D 1FZCA 5AVVB 1NH4A 5CJ4A 1MZ9A 2A45I 2HODB 1SQQK 5AVZB 2KB7P 3KYQA 2J59M 4N78E 2E42A 3V2QA 1N7LA 1QL2A 2XV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1J B;  3E1I A;  1FZG A;  1N73 A;  1LWU A;  2A45 H;  1LT9 B;  1LTJ C;  1JY3 P;  1RE3 C;  1M1J A;  2FFD C;  2OYI C;  1FZC B;  3GHG C;  1RE4 C;  1JY2 N;  1RF1 B;  1RF0 C;  3HUS C;  1JY2 O;  1LT9 A;  1N73 C;  1FZE A;  2OYI B;  2Q9I A;  1FZC A;  2OYH B;  1W2E A;  1N86 A;  2H43 A;  2Z4E A;  1LWU C;  1RF1 A;  1M1J C;  2OYI A;  2OYH A;  1FZB A;  1FZA A;  1LTJ B;  1JY2 P;  1T3U A;  3BVH A;  2A45 I;  1LT9 C;  2HOD B;  3H32 B;  2FFD B;  2XNX A;  3GHG B;  1FZC C;  3HUS B;  2HPC B;  2A45 G;  1JY3 N;  1FZF A;  1LTJ A;  1RF1 C;  1RE3 A;  2FFD A;  1JY3 O;  1N73 B;  3HUS A;  1RE4 A;  2HLO A;  2HOD A;  3H32 A;  1LWU B;  3GHG A;  2OYH C;  1RF0 A;  2HPC A; 
#chains in the Genus database with same CATH topology
 2IZ1 A;  1KFN A;  3M0D A;  4DZO A;  1LTI C;  1NTM G;  4EOT A;  4L75 A;  3HUS C;  4BWN A;  1NTK J;  2PFX A;  1G2C A;  4W7Z A;  2KZI A;  2WPR A;  1HGZ A;  2E76 C;  1ZW0 A;  1DD3 A;  5APW A;  5APV A;  1FBM A;  5CBN A;  2QJK C;  3CXH E;  1AA0 A;  1KTM A;  2FFD C;  4IOI H;  1SFC C;  1VQ5 P;  2KS1 A;  1NAF A;  3R2P A;  2QM8 A;  2V4H A;  3BRV B;  3GMA A;  3IFM A;  1SQV G;  4C46 A;  3GHG C;  1GU5 A;  4EYY Q;  1JUN A;  3IF4 A;  4BRY B;  1L0L K;  1DIP A;  3AE2 C;  1GL2 A;  5M1B A;  3TGU E;  1YYC A;  3PRJ A;  3WMM 0;  2OTL P;  1URQ B;  1ZXG A;  1KC8 Q;  1K9M Q;  3USS A;  3HD7 A;  2BEQ D;  1M1J C;  3CXH H;  4GOF A;  2ITA A;  4PD4 H;  1SQQ J;  4JYB A;  3II6 A;  2A45 G;  2KIK A;  3LW5 H;  1QGK B;  2WZ7 A;  4HB1 A;  3W68 A;  5KLI B;  3G3Z A;  4M3L A;  3CCL P;  5KLV G;  5BU5 A;  3EWK A;  1EQ7 A;  1LTJ B;  1S2E A;  3VN0 A;  2HR3 A;  1RE3 A;  1GL2 D;  3RL0 B;  4PJ0 H;  1UIX A;  1FDM A;  1TU3 F;  3LIE A;  1PPJ G;  1NJI Q;  3TDK A;  1N7S C;  1NTM J;  2CPS A;  2NPS C;  2YKQ A;  2OYO A;  2YMY A;  2XNX A;  1OX3 A;  5B5E H;  1CI6 B;  2I8D A;  1M1K Q;  2E74 D;  4U7J A;  2AEF A;  1S5L X;  4HH2 A;  2FXO A;  1KN7 A;  2A45 H;  4Y99 C;  1L0L E;  4I2L C;  3PH0 A;  1L0L G;  3F5H A;  2OYH B;  3M0D C;  3M06 A;  4H0L D;  3VMZ A;  2K88 A;  1ZR4 A;  2DW3 A;  2N9Y B;  4H44 B;  4BRY A;  4K35 A;  1S5L H;  1QX8 A;  1IFN A;  4PV1 C;  1YBK A;  2W6J H;  4RJT A;  3CL3 D;  1QVG O;  1RQV A;  3AED C;  3JC2 2;  1SQV J;  4AYC A;  1URQ A;  3QWO C;  3P8C E;  1SQX D;  1VL2 A;  3G6E P;  1JY3 N;  1HGV A;  3WUU A;  1NGM B;  4GDO A;  3HE5 B;  2RN0 A;  1U7M A;  2PRR A;  1NTZ K;  1LTJ A;  1L0N D;  3SWY A;  5APU A;  1KB9 D;  5AW1 B;  4W7Y A;  5GTH E;  1X8Y A;  2KYV A;  2XU6 A;  3L70 J;  1RQU A;  2PP6 A;  2IDB A;  2JO1 A;  5KLV J;  1HWT C;  3HD7 C;  3VP9 A;  1PP9 G;  1YJW P;  1VQ4 P;  2ZT9 B;  1CI6 A;  1RE4 C;  3CXH D;  3S4R A;  3Q3D A;  3WU2 H;  2OYH A;  1BDC A;  2M5A B;  1BSH A;  1WRG A;  1SP4 A;  1SQV D;  1FZC B;  4WWI A;  4WVZ A;  1LNQ A;  1DH3 A;  3H1I G;  1FOS F;  3S9O A;  3ZDM A;  1EXI A;  1JY2 P;  4DCK A;  4L73 A;  4H13 D;  1SQB K;  1JTH B;  1ZME C;  2B87 B;  3TGU D;  2I1J A;  1NTZ G;  3CWB E;  1NOH A;  1UII A;  3KZI E;  3AE3 C;  3HE5 A;  1J1E C;  1VQ7 P;  4EIJ A;  3AEA C;  4DOJ A;  1JO5 A;  4KHX A;  2N1T B;  4YXW H;  3OAK A;  3D71 A;  1KYO E;  4PD4 I;  2K9J B;  4XA4 A;  3MP7 B;  2POH A;  3RBX A;  2ZYA A;  5KKZ C;  1QEX A;  3RK3 B;  5CHX A;  3MGN A;  1EDL A;  2NRG A;  3L72 G;  2YKP A;  2D2C C;  2QJY B;  2L5G B;  1LJ2 A;  3O8Z A;  3CCQ P;  3A0B H;  2BCC E;  2BCC G;  1NKN A;  1NU1 E;  5KJ7 C;  2IZ0 A;  4MN4 C;  2M5A A;  2K1A A;  1S9K E;  5CCG D;  1PP9 J;  1GU4 A;  3G71 P;  1BE3 E;  3Q5P A;  1L0L D;  2W83 C;  3E7K A;  1BE3 G;  3RK2 D;  1FZC A;  1SQB E;  2A45 I;  2HOD B;  1SQQ K;  5AVZ B;  1KIL E;  1NYH A;  1OVR A;  1NTK E;  2AEM A;  5AW8 B;  1PFI A;  1JTH A;  3B5N C;  3CPW O;  2Y9Y A;  2B87 A;  3NFQ A;  3V6I A;  3AEB C;  3H6P A;  3H1I J;  1Y9B A;  3PP5 A;  1NHL A;  2N1T A;  1LTT C;  4H44 C;  1MKM A;  3PJS K;  2K9J A;  3G9R A;  4RO0 A;  2OYI B;  3AEE C;  2OTJ P;  2WT7 A;  1HJ0 A;  2KXP B;  3JCU H;  2OAR A;  1NTM K;  5AVS B;  2OGU A;  1HF9 A;  2ZYD A;  1NTZ J;  4OGQ D;  2Q3I A;  3H1L G;  3V4W A;  2KLU A;  1XTC C;  5DJT B;  3VOP A;  2Y9Z A;  1S72 P;  5B66 H;  1QLE D;  3M0A A;  3MUD C;  4L74 A;  3Q1M A;  1FDO A;  2XKM A;  4KT0 J;  2Q9I A;  2GUV A;  3C9I A;  2E76 D;  1G1I A;  2JEE A;  1KIL B;  3S1K A;  1CSB A;  2R44 A;  2WPQ A;  1PP9 D;  4W80 A;  1SFC D;  1IK7 A;  3L72 J;  5APT A;  1L2P A;  1RF0 C;  1SQQ E;  3QH9 A;  4B86 A;  1PGQ A;  1JOC A;  1GL2 B;  5KAF E;  3CCM P;  1HVV A;  1NAY A;  1OFC X;  3VMY A;  2HOD A;  5GTI H;  1MFT A;  2JP3 A;  2H88 C;  4R4M A;  3AEC C;  2Z5I A;  1R8E A;  2O1J A;  4GT1 A;  5AW2 B;  1BGY G;  3C1L A;  3FXD A;  2ZT9 C;  2R3S A;  2E74 B;  3BVH A;  2B9B A;  1LWU B;  1IC2 A;  1IFI A;  1K05 A;  1NTM E;  4L76 A;  5BVZ A;  1CW5 A;  5AW7 B;  1HUC A;  4H0L B;  3MD0 A;  3V2P A;  4IFD K;  3H1H G;  3CC4 P;  1W2B O;  1S1C X;  3CWB D;  2OYI A;  2IBZ I;  4UB8 H;  3EQ2 A;  1FZC C;  2WIT A;  3H1J G;  3L4F A;  2FXM A;  5KLV K;  1T2K C;  3WUV A;  5KAF H;  1JCC A;  1LT1 A;  1KYO D;  4PD4 E;  3L74 G;  3U59 A;  4C7N B;  1IZN B;  4DJG A;  2FY8 A;  2E43 A;  3M9Q A;  1Q7Y Q;  1OWA A;  1KIL A;  1Z56 A;  2AXT H;  2LXC B;  2M3E A;  3R4Y A;  1SQV E;  4EI2 A;  3LID A;  1VQK P;  3H1L J;  1R5S A;  5KTB A;  2IYP A;  4OVN F;  2IFM A;  3CI9 A;  2N1T C;  3AE8 C;  2AEJ A;  2BCC D;  1FZB A;  3ABV C;  3CX5 I;  4PJ0 E;  3L36 A;  1K8A Q;  1IFP A;  5AW4 B;  1YJN P;  2B89 A;  3FGA D;  1NU1 D;  3RK3 C;  3P7K A;  3E1R A;  1IFM A;  3FXE A;  1PGP A;  2R32 A;  1P84 I;  3A3Y B;  4WY4 B;  1S9K D;  2JKV A;  2IYO A;  2WTY A;  1MUU A;  1BE3 D;  5B5E E;  4IFM A;  2HYN A;  1S3J A;  3UIA A;  3OW2 O;  2E5Y A;  1SQB D;  3CCU P;  3A0H E;  2KSE A;  2M8R A;  1KIL D;  3L70 E;  2JJL A;  3L37 A;  3L70 G;  1LWU A;  1NTK D;  5AW9 B;  1IFD A;  4QMA A;  2ZVN B;  1RHZ B;  5KLV E;  3MZW B;  1S5L E;  2FYU J;  1ZR2 A;  2QIW A;  4K3A A;  1BGY J;  2IPP A;  1HBW A;  1LT9 B;  2W8Z A;  4D6T G;  1PPJ E;  4U3F G;  3I55 P;  1JY2 O;  2M3B A;  4ZNC A;  3TSI A;  3D70 A;  4H13 B;  4C7N A;  1G1J A;  1BDD A;  3H1H J;  3L75 G;  1N73 B;  1KQL A;  1T6A A;  3H1J J;  4CPG A;  1EDJ A;  4ASW A;  1L4A B;  5AVU B;  1AVY A;  3A0H H;  1Q2N A;  4N6J A;  1LTG C;  3L74 J;  2QM7 A;  1Q86 Q;  3B8E B;  2W6B A;  1OZH A;  4IL6 X;  1VQM P;  3I5C A;  1SQQ D;  4WY4 A;  1YIT P;  4TT3 H;  1YIJ P;  1BCC G;  3H25 A;  2I1K A;  1GZL A;  3BCC E;  2FYN C;  3BCC G;  3SWK A;  4IL6 H;  3HRN A;  1FZG A;  1E5W A;  1BSN A;  1A02 J;  1AJY A;  3WU2 E;  1RF1 B;  1Q90 D;  2IFN A;  1BGY D;  1VF5 D;  3H1K G;  5APY A;  1ZV8 A;  1J1D B;  1IO4 A;  3RBZ A;  1GL2 C;  3RK2 B;  1NTM D;  2IX7 C;  1LT9 A;  2H43 A;  4WY4 D;  2KUB A;  2WSS H;  2IBZ E;  2IBZ G;  1PP9 E;  3FWN A;  2MJZ A;  3IAO A;  1N73 A;  1D7M A;  2E74 C;  2E75 D;  1U57 A;  1L4A A;  3TNU B;  4PD4 D;  1OW7 A;  1AVO A;  3AE6 C;  3GF3 A;  2G3A A;  4D6T J;  4U3F J;  2D2C D;  5CJ4 A;  1MZ9 A;  2KB7 P;  3KYQ A;  2J59 M;  4N78 E;  1EZV I;  3CCS P;  1KD1 Q;  2B88 A;  3G4S P;  1QL2 A;  2PAJ A;  1DEB A;  2QRX A;  3L75 J;  3U1A A;  3T97 A;  1RE3 C;  5CCH A;  2BAS A;  3H1I E;  1ZP0 C;  4OGQ B;  3KXD A;  3SSU A;  3K5B A;  5KJ7 D;  2K37 A;  3EFG A;  3I56 P;  3CX5 E;  3HUS B;  2ZXE B;  3A0B E;  3TYY A;  2Q6Q A;  1OVU A;  1FJP A;  3VTP C;  1P84 E;  2E76 B;  5AVY B;  3CCR P;  1NTZ E;  1L4A D;  4I1L A;  1RF1 A;  2QJK B;  2LKM A;  4XFJ A;  2YIU B;  2WPV B;  5AVQ B;  1SFC B;  1FZF A;  3AE1 C;  1MV8 A;  3B5N D;  2FXP A;  1BCC J;  5CCG A;  3L70 D;  3FWL A;  3BCC J;  1A02 F;  1KQG B;  2WT7 B;  2C0X A;  5CCH D;  5KLV D;  1RY3 A;  4WBA A;  3OJA B;  3D6Y A;  2ZJS E;  1URQ C;  3L72 E;  3H1K J;  1E79 H;  4RES B;  1YJ9 P;  3CX5 H;  2G8Y A;  2ZVO B;  2P1J A;  5AVW B;  4D6T D;  1PPJ D;  3L35 A;  3TNU A;  3JSV C;  1PL5 A;  3N7N A;  1T3U A;  2YXR B;  5KLI C;  1P84 H;  2WSE H;  1LTA C;  5APS A;  3AEG C;  1USD A;  1X9V A;  1QVF O;  1M7L A;  2V7Q H;  1M1J B;  3JCU E;  1LTJ C;  3PHL A;  5APX A;  1OVV A;  1VQL P;  1HTL C;  1OIP A;  1SQP J;  2P58 A;  1FJK A;  1W2E A;  1N86 A;  1PZQ A;  3RL0 C;  5AVT B;  5APQ A;  1YTZ T;  4UB6 H;  5B66 E;  3PTZ A;  3HUS A;  4KJM A;  2NZ2 A;  5E79 H;  1JY3 P;  2PGD A;  1SLQ A;  1N73 C;  3EFF K;  1KMI Z;  5EFW B;  2FYU K;  3AE7 C;  3P8M C;  2WVR A;  3L71 G;  2Q5U A;  2FFD A;  2OYH C;  3BCC D;  1SFC A;  4HYT B;  4OH8 B;  3Q5R A;  3BRT B;  2H89 C;  2ZFC A;  3SFE C;  1YQ3 C;  2GM4 A;  5GTI E;  3H1K D;  2WSE J;  4JQ0 D;  3H1L E;  2V7Q J;  3Q5S A;  4YTP C;  2KK7 A;  2QJP B;  1DX7 A;  3AE4 C;  3MTU E;  3P32 A;  2IBZ D;  4I7Z B;  4NPD A;  4LC1 A;  3TK1 A;  4BXL A;  1J1D C;  1M1J A;  4UB8 E;  3MIW A;  1YI2 P;  3BAS A;  5CCG C;  1GW3 A;  1EC5 A;  4AQR D;  2UWJ E;  2W6A A;  4LLH A;  1S4X A;  2KSJ A;  3AE9 C;  1EZV E;  4N78 D;  1EZV G;  4R4L A;  2P2U A;  2FYU E;  1GK4 A;  2FYU G;  2YO3 A;  4TLF A;  1FS0 E;  2W27 A;  3VYI A;  1BGY E;  5AW0 B;  1U7J A;  3H1I D;  2A06 E;  2AXT E;  2A06 G;  3VMX A;  1FE6 A;  1LGH B;  2P67 A;  3CX5 D;  3KPE A;  1DD4 A;  5H2F H;  5AW5 B;  3ITK A;  2YMK A;  1KFM A;  2L91 A;  3H1H E;  4XE5 B;  1JNM A;  1P84 D;  1NTZ D;  1GD2 E;  5KAI H;  3H1J E;  1L0N G;  2O01 J;  2GA1 A;  2WSF H;  1WT6 A;  3GW6 A;  2M0B A;  4LGD E;  4YPC A;  4OGQ C;  2SPZ A;  3L71 J;  1FOS E;  1OMI A;  1KZU B;  1YHQ P;  3CMA P;  1AV1 A;  5AW6 B;  3L74 E;  1EDI A;  3TF5 A;  3PLN A;  1VQN P;  3M9H A;  2YO2 A;  3L73 E;  3L73 G;  3L72 D;  3IR9 A;  2J58 A;  2YIU C;  3HTK B;  1EXJ A;  2JWD A;  1VF5 B;  1N7S D;  2ZYG A;  2NPS D;  3CLQ A;  2WMM A;  4DT0 A;  3KHU A;  5AW3 B;  3H32 B;  5CJ0 A;  2VRS A;  3A2A A;  5BU8 B;  1J1E B;  2LR2 A;  1VDF A;  3BAT A;  1H88 A;  1KB9 H;  3RGU A;  2QJY C;  1JMM A;  2WSF J;  2QA4 P;  3GF7 A;  5KKZ B;  2HPC B;  4PV1 D;  2E75 B;  3E1I A;  5TJH A;  2HG5 D;  2R5B A;  5AVR B;  3TGU G;  2J5U A;  2Q7C A;  1JY2 N;  2K9Y A;  1JB0 J;  2D2C B;  1EDK A;  4NPF X;  4NPE A;  1SQX J;  1QL1 A;  3L71 D;  1PIX A;  1GMJ A;  1RE4 A;  1KYO I;  1NWQ A;  3SWF A;  4D6T E;  4U3F E;  2RH0 A;  2K3R A;  2BEZ F;  4IL6 E;  3L75 E;  5L8R J;  1JM0 A;  1KQS O;  2E42 A;  3V2Q A;  1N7L A;  1LP1 B;  1L0N J;  3H1L D;  4N3Y B;  4Y28 J;  1K73 Q;  1IFJ A;  3A5T A;  3HTK A;  1ZRT E;  1USE A;  3CCJ P;  1SQP K;  2FBW C;  1RH5 B;  3HD7 D;  1KOR A;  1H89 A;  3B5N B;  5DJU B;  1ZOY C;  1K04 A;  2Y0E A;  3H32 A;  2OYI C;  3T97 B;  1IJD B;  3L73 J;  3VMA A;  2W90 A;  4GOE A;  1VPC A;  1OXZ A;  3KDP B;  1BCC E;  4RKU J;  1ZLL A;  2QJP C;  2XZR A;  2MKV A;  2Y0D A;  3LW5 J;  4ZMD A;  2HPC A;  1EZV D;  2C9N Y;  2CK3 H;  1KIL C;  2FYU D;  2KZJ A;  2XND H;  4I7Z C;  2RKL A;  2QG4 A;  3H1K E;  1XTG B;  4C7R A;  1VQ9 P;  5CMZ A;  1FZA A;  1PGJ A;  2A06 D;  1M56 D;  1ZN5 A;  1PGO A;  1PV3 A;  2YKO A;  2C9L Y;  1T3J A;  2WPS A;  1W5C E;  3O6Q B;  3H1H D;  3TGU J;  5KJ7 A;  2JDI H;  4ZKP A;  3CCE P;  3H1J D;  1JY3 O;  1M90 Q;  1SQP E;  1HJB A;  1SQP G;  3CME P;  2WSC H;  1LP1 A;  3M9B A;  4O9B A;  2WWW A;  1GK6 A;  1SVF A;  3L74 D;  1LWU C;  2Z5H A;  1VQO P;  1URQ D;  2ZAE B;  3A7O A;  4GIF A;  1H0T B;  3NXS A;  3AEF C;  2YXQ B;  4H0L C;  4JYC A;  3B5N A;  2H8P D;  3L73 D;  2R5D A;  3IN6 A;  1X0T A;  4JF7 A;  4WB4 A;  1WMK A;  1GDT A;  4HKZ H;  2OTK E;  3RK3 E;  1GTW A;  4I6M C;  1N2D C;  1OW8 A;  1R5L A;  3B4S A;  4AUW A;  2FKW B;  1NU1 K;  3U1C A;  3RL0 D;  1JEK A;  3Q2Y A;  2P7J A;  1L0L J;  5GTH H;  5CBO A;  1N8R Q;  2YNY A;  1VF5 C;  2FFD B;  1FAV A;  3OA7 A;  1FU1 A;  1KB9 I;  1MFZ A;  3MUD A;  3NTN A;  2KNC B;  1CZQ A;  1YQ4 C;  2WSC J;  2Q1K A;  3CC2 P;  3SFD C;  4UB6 E;  3HE4 B;  1NTK K;  3FX0 A;  1AQT A;  1LTS C;  3CWB G;  2Z4E A;  1Y47 A;  2ZXX A;  2KLV A;  3O6Q A;  4HJG H;  1VQ6 P;  5E79 E;  3GHG B;  4WY4 C;  1NO4 A;  1RF0 A;  3CXH I;  4H44 D;  1J2J B;  4JBZ A;  3RL0 g;  3GG2 A;  2E75 C;  4U3F D;  1GW4 A;  3AE5 C;  1OW6 A;  3CD6 P;  2XDJ A;  1H0T A;  2CPB A;  1H8A A;  3L75 D;  4EDF A;  2GUS A;  1LTB C;  2AXC A;  4IFF A;  2P10 A;  1FZE A;  3N4X A;  3V5B A;  1JCD A;  2N9B A;  1ZRT D;  1KQF B;  2FYZ A;  1IK9 A;  1LT9 C;  1NU1 G;  1YTZ I;  2QE7 H;  4JPZ B;  3KZI H;  3W67 A;  4GOD A;  2H7H A;  4H13 C;  2JR8 A;  3V2N A;  1Q81 Q;  1KYO H;  1SQB G;  2R3C A;  3CC7 P;  1L4A C;  4ZKU A;  5K5G B;  3L71 E;  2RMZ A;  1SQX K;  1BCC D;  1JMB A;  2QSI A;  2WQY C;  3C8V A;  1N7S B;  3NMD A;  1NTK G;  2NPS B;  2QEX P;  2KP8 A;  1NVO A;  2KNC A;  1AQ5 A;  2ZT9 D;  4YXD C;  3HE4 A;  5C39 A;  3P8C D;  4Y99 B;  5TIS E;  5CCH C;  4A7P A;  1AFO A;  2O3J A;  2O1K A;  3GHG A;  1L0N K;  2E5T A;  3V2R A;  1G2C B;  3M91 A;  1Q82 Q;  4GKG A;  1DEE G;  1X79 B;  3F89 A;  1VQP P;  5AVX B;  2KOG A;  4Z1M H;  4PV1 B;  4ASV A;  1T2K D;  5H2F E;  3CWB J;  2OQQ A;  2O01 H;  1RF1 C;  4OWF A;  2HLO A;  2JWA A;  1SQP D;  1FC2 C;  1NKZ B;  5KAI E;  2KS1 B;  2FYN B;  1SS1 A;  3RK2 C;  3KQG A;  1HH0 A;  2KI7 B;  1M57 D;  1FDI A;  5TIS H;  1Y8A A;  1M8O B;  1T8Z A;  2N1T D;  3CCV P;  1SQQ G;  1SQX E;  1SQX G;  1SQV K;  1X22 A;  2QVA A;  2HFE D;  3VP8 A;  3RK3 D;  2BCC J;  3B71 A;  2Q3E A;  3WUT A;  2Y0C A;  1NU1 J;  1N7S A;  2NPS A;  3HD7 B;  2O01 N;  2C0W A;  3V4Q A;  3MHV A;  1VQ8 P;  5AVV B;  2LXB A;  1BE3 J;  1NH4 A;  1L0N E;  3D6Z A;  3GLM A;  1SQB J;  1KB9 E;  1KV4 A;  2XV5 A; 
#chains in the Genus database with same CATH homology
 1KFN A;  2PAJ A;  5AW8 B;  1DEB A;  3U1A A;  4N3Y B;  3T97 A;  3M0D A;  4DZO A;  1PFI A;  1LTI C;  4EOT A;  1RE3 C;  1JTH A;  3B5N C;  1IFJ A;  3A5T A;  3HUS C;  3HTK A;  2BAS A;  5CCH A;  1G2C A;  1SQP K;  3HD7 D;  1H89 A;  5KJ7 D;  3NFQ A;  3B5N B;  3EFG A;  3H6P A;  4W7Z A;  3HUS B;  2WPR A;  1HGZ A;  3H32 A;  2ZXE B;  2OYI C;  5APW A;  5APV A;  1FBM A;  3PP5 A;  1NHL A;  1IJD B;  3TYY A;  2N1T A;  1LTT C;  2FFD C;  1FJP A;  3VTP C;  5AVY B;  1SFC C;  2OYI B;  1L4A D;  4I1L A;  2WT7 A;  1RF1 A;  2OAR A;  1NTM K;  1VPC A;  1OXZ A;  5AVS B;  2LKM A;  3KDP B;  1NAF A;  1ZLL A;  5AVQ B;  2XZR A;  1SFC B;  1FZF A;  3R2P A;  2Q3I A;  1MV8 A;  3B5N D;  3V4W A;  2HPC A;  1XTC C;  2QM8 A;  3BRV B;  5CCG A;  3VOP A;  3IFM A;  2C9N Y;  4C46 A;  3M0A A;  1KIL C;  3GHG C;  1GU5 A;  1A02 F;  2WT7 B;  2XKM A;  2C0X A;  2Q9I A;  2GUV A;  3C9I A;  1JUN A;  5CCH D;  1RY3 A;  4WBA A;  3OJA B;  1XTG B;  4C7R A;  1L0L K;  5CMZ A;  1FZA A;  1G1I A;  2JEE A;  1KIL B;  1GL2 A;  1CSB A;  1ZN5 A;  1URQ C;  2WPQ A;  2YKO A;  4W80 A;  4RES B;  2C9L Y;  1SFC D;  1T3J A;  2WPS A;  1YYC A;  5APT A;  2P1J A;  3WMM 0;  1URQ B;  5AVW B;  1RF0 C;  4B86 A;  3L35 A;  3HD7 A;  5KJ7 A;  3TNU A;  1M1J C;  1JOC A;  1GL2 B;  1HVV A;  3N7N A;  1T3U A;  4JYB A;  3II6 A;  4ZKP A;  2WSE H;  1LTA C;  5APS A;  2A45 G;  3VMY A;  1X9V A;  1M7L A;  1JY3 O;  2HOD A;  3LW5 H;  1M1J B;  2WZ7 A;  1HJB A;  2WSC H;  1LTJ C;  3M9B A;  5APX A;  2Z5I A;  4O9B A;  3G3Z A;  2WWW A;  1HTL C;  1GK6 A;  2O1J A;  4GT1 A;  4M3L A;  5AW2 B;  1SVF A;  1FJK A;  1W2E A;  1N86 A;  5BU5 A;  1LWU C;  2Z5H A;  3RL0 C;  5AVT B;  1EQ7 A;  1URQ D;  3A7O A;  5APQ A;  1LTJ B;  4GIF A;  3NXS A;  3BVH A;  1YTZ T;  3VN0 A;  4JYC A;  1RE3 A;  3B5N A;  1GL2 D;  2H8P D;  1LWU B;  3HUS A;  3RL0 B;  2R5D A;  1IC2 A;  1IFI A;  1FDM A;  5BVZ A;  1JY3 P;  3LIE A;  1CW5 A;  5AW7 B;  4JF7 A;  1HUC A;  3MD0 A;  4WB4 A;  3V2P A;  1SLQ A;  4IFD K;  1N73 C;  1GDT A;  1N7S C;  2CPS A;  2NPS C;  2YKQ A;  2FYU K;  2OYI A;  3P8M C;  3EQ2 A;  4I6M C;  1N2D C;  2YMY A;  2WIT A;  1GTW A;  2XNX A;  3L4F A;  1FZC C;  2FXM A;  5KLV K;  2Q5U A;  1T2K C;  1CI6 B;  2FFD A;  4AUW A;  2OYH C;  1SFC A;  4HYT B;  1JCC A;  4HH2 A;  4OH8 B;  2FKW B;  2A45 H;  1NU1 K;  4Y99 C;  3U1C A;  4I2L C;  3RL0 D;  3BRT B;  2P7J A;  2OYH B;  3U59 A;  3M0D C;  2ZFC A;  4C7N B;  3M06 A;  2GM4 A;  2E43 A;  3VMZ A;  3M9Q A;  1ZR4 A;  2YNY A;  2FFD B;  1FAV A;  3OA7 A;  1OWA A;  1FU1 A;  1MFZ A;  1KIL A;  3MUD A;  1Z56 A;  3NTN A;  1CZQ A;  1IFN A;  3CL3 D;  3LID A;  5KTB A;  3HE4 B;  1NTK K;  2IFM A;  1LTS C;  2N1T C;  3CI9 A;  1URQ A;  4AYC A;  2Z4E A;  3P8C E;  1DX7 A;  1FZB A;  2KLV A;  3L36 A;  3GHG B;  3MTU E;  3P32 A;  4WY4 C;  1JY3 N;  1HGV A;  5AW4 B;  1NO4 A;  4LC1 A;  1RF0 A;  3RK3 C;  3TK1 A;  3P7K A;  1IFM A;  1J1D C;  1J2J B;  1M1J A;  2R32 A;  3A3Y B;  4WY4 B;  1S9K D;  3MIW A;  2WTY A;  3BAS A;  1MUU A;  5CCG C;  3HE5 B;  1GW3 A;  4IFM A;  1GW4 A;  2HYN A;  3UIA A;  4AQR D;  2W6A A;  4LLH A;  1NTZ K;  2XDJ A;  2KSJ A;  1LTJ A;  2CPB A;  1H8A A;  3SWY A;  4N78 D;  5APU A;  2M8R A;  1KIL D;  2JJL A;  3L37 A;  2P2U A;  2GUS A;  1LWU A;  5AW1 B;  5AW9 B;  4W7Y A;  1GK4 A;  1X8Y A;  1IFD A;  2KYV A;  2YO3 A;  2XU6 A;  3VYI A;  2W27 A;  1LTB C;  4IFF A;  1FZE A;  3N4X A;  3V5B A;  1JCD A;  2N9B A;  5AW0 B;  2PP6 A;  1ZR2 A;  3VMX A;  2FYZ A;  1IK9 A;  1LGH B;  1LT9 C;  1HWT C;  3HD7 C;  2P67 A;  1YTZ I;  2IPP A;  3VP9 A;  3KPE A;  1CI6 A;  1HBW A;  2H7H A;  1LT9 B;  5AW5 B;  3V2N A;  1RE4 C;  1KFM A;  1JY2 O;  4XE5 B;  1JNM A;  2M3B A;  3TSI A;  2R3C A;  2OYH A;  1L4A C;  1GD2 E;  4C7N A;  1G1J A;  4ZKU A;  2WSF H;  1WT6 A;  1SQX K;  1N73 B;  4LGD E;  1KQL A;  1N7S B;  3NMD A;  2NPS B;  1WRG A;  1L4A B;  2KP8 A;  1FOS E;  1SP4 A;  1KZU B;  5AVU B;  1FZC B;  1AQ5 A;  5AW6 B;  1DH3 A;  4N6J A;  1FOS F;  3M9H A;  3HE4 A;  2YO2 A;  1LTG C;  3P8C D;  1JY2 P;  4Y99 B;  5CCH C;  2QM7 A;  1AFO A;  2O1K A;  3GHG A;  3B8E B;  1SQB K;  2W6B A;  1JTH B;  3IR9 A;  2J58 A;  1L0N K;  3HTK B;  3V2R A;  1G2C B;  1N7S D;  2NPS D;  3M91 A;  3CLQ A;  3I5C A;  2I1J A;  4GKG A;  1X79 B;  4WY4 A;  1NOH A;  5AVX B;  2KOG A;  3HE5 A;  1J1E C;  1T2K D;  4EIJ A;  5AW3 B;  3H32 B;  2I1K A;  4DOJ A;  1JO5 A;  2O01 H;  1GZL A;  5CJ0 A;  1RF1 C;  2VRS A;  2HLO A;  4KHX A;  3A2A A;  2N1T B;  3HRN A;  5BU8 B;  1J1E B;  3OAK A;  1FZG A;  1E5W A;  1VDF A;  1A02 J;  4XA4 A;  1NKZ B;  2POH A;  3BAT A;  1H88 A;  1RF1 B;  2IFN A;  3RK3 B;  5APY A;  1ZV8 A;  5CHX A;  1JMM A;  3MGN A;  3RK2 C;  1J1D B;  3KQG A;  2HPC B;  1HH0 A;  1IO4 A;  2YKP A;  2L5G B;  3E1I A;  2HG5 D;  1GL2 C;  3RK2 B;  2R5B A;  5AVR B;  1T8Z A;  2N1T D;  3O8Z A;  2Q7C A;  1JY2 N;  2IX7 C;  1LT9 A;  1SQV K;  2H43 A;  4WY4 D;  2HFE D;  1NKN A;  1QL1 A;  3VP8 A;  3RK3 D;  5KJ7 C;  1RE4 A;  1NWQ A;  2MJZ A;  1N73 A;  1S9K E;  5CCG D;  1N7S A;  3SWF A;  2NPS A;  1GU4 A;  3HD7 B;  1L4A A;  3V4Q A;  2C0W A;  3TNU B;  3RK2 D;  1FZC A;  5AVV B;  1NH4 A;  5CJ4 A;  1MZ9 A;  2A45 I;  2HOD B;  1SQQ K;  5AVZ B;  2KB7 P;  3KYQ A;  2J59 M;  4N78 E;  2E42 A;  3V2Q A;  1N7L A;  1QL2 A;  2XV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...