1REDA

Endo-1,4-beta-xylanase ii complex with 4,5-epoxypentyl-beta-d-xyloside
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
190
structure length
190
Chain Sequence
b'ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE II
publication title Covalent binding of three epoxyalkyl xylosides to the active site of endo-1,4-xylanase II from Trichoderma reesei.
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1995-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1redA00
2JEMA 3VZJA 3VHPA 3MF9A 2C1FA 1REFA 2NQYA 1XNKA 1IGOA 1XYPA 3AKRA 3WP6A 3WT3A 3WX5A 2VG9A 2DCJA 1QH6A 3VGIA 5K9YA 4HKOA 1F5JA 3B7MA 3RI8A 3WP4A 3VZLA 4XQDA 2DCZA 1OA2A 2BVVA 3ZSEA 1C5HA 1YNAA 2D98A 2DCYA 2JENA 3AKQA 3WQ7A 1HV0A 3VL8A 4XQWA 1XYNA 1H4GA 1OLRA 2F6BA 4S2HA 1OA4A 3MF6A 3VHNA 1UU6A 2VUJA 4HK9A 1XNCA 1W2UA 2B45X 3RI9A 3WR0A 3AMMA 1OLQA 5K7PA 3WQ1A 4S2FA 1QH7A 3EXUA 1REDA 3WY6A 4IXLA 4H7MA 4HK8A 4XQ4A 1ENXA 3MFAA 2VULA 1AXKA 2DCKA 1KS5A 2QZ2A 1PVXA 1BVVA 1UU5A 3WXPA 1HV1A 3O7OA 1XYOA 1REEA 1M4WA 3AMPA 4HKLA 1XXNA 3WP3A 1H4HA 1TE1B 1HIXA 1BCXA 2NLRA 2QZ3A 1C5IA 4S2GA 3WP5A 1H8VA 1H0BA 3AKSA 1T6GC 2D97A 2BWCA 3HD8B 4HKWA 3LGRA 3M4FA 1UKRA 3VZNA 4NPRA 2DFCA 3LB9A 3AMNA 4S2DA 3B5LB 1BK1A 1NLRA 2Z79A 3WQ0A 3VHOA 2BW8A 3VZKA 1UU4A 3AMHA 2B42B 1KS4A 2VGDA 2B46X 2BWAA 3VL9A 3MFCA 1OA3A 3AKPA 5EJ3A 3VZMA 3AKTA 1XNBA 3VLBB 3VZOA 1H1AA 3AMQA 1XNDA 2JICA 5HXVA 2DFBA 4XPVA
chains in the Genus database with same CATH superfamily
1W39A 1QJFA 2DBNA 4NHYA 1FT9A 4Y1YA 2DBIA 4B29A 1IPKA 4EWDA 5F1RA 1QIQA 1YUDA 3GNEA 1NCRB 4YM2A 3VV1A 3MLLA 3PMEA 1NCQA 4Y20B 1LOGA 1NQDA 1C3HA 1CPNA 3RNSA 2CTVA 1AF9A 3H8UA 2WKKA 4WBBA 5LASA 2OKXA 5BNOC 3MZHA 2B5HA 4AFMA 1WMXA 4HPKB 1EV11 4LBMA 3ITQA 4JRAA 1ZZ9A 4YVWB 1PK6C 2VXJA 1F31A 1PM4A 4GZ9A 4YW6A 3AYAA 2VBPA 1WCUA 4ZXKA 5D8AA 4D6SA 1LU2A 2Q1FA 4AVSA 3ZM8A 4QPIB 2ZGQA 1CVNA 1HLCA 3LE0A 1GLHA 2VW1A 1L3JA 1OLRA 5E1RA 5FYCA 4LTAA 5A7NA 5F6KA 2XJVA 2VMHA 4RHV2 1V6NA 4Y4RA 4CDUA 4AVAA 2VVFA 2ZBJA 5IVCA 1D7PM 1S0GA 2HWC1 2F17A 2YDEA 3SISA 2VMGA 1PGL2 3J4UH 4RHV3 1G9DA 3KD4A 3JD72 2Q1ZB 5FZ9A 3VKLA 1UIJA 1YQCA 4W65A 1VRH1 1UY3A 2GH8A 1DU3D 2DVBA 2P17A 1G9FA 3LKJA 3JD73 4GWJA 2UYAA 5FZMA 1UYYA 4D0QA 1ENRA 1AYN2 2AGSA 2JG9C 3CMGA 4FOYA 1QQP1 2GNMA 4UOJA 2X5IC 3OGJA 4E4SA 1XXNA 3LEGA 4BA6A 5FYZA 2RV9A 1FXZA 1H4HA 3W5MA 3ZYGA 4CUBA 2EAAA 1Q43A 2YPDA 1US2A 3UESA 1XB9A 2PAKA 1F4HA 1MPXA 2D97A 3IAPA 3FHQA 1ENQA 4YVSA 2J7MA 3FJSA 2XLAA 2XQXA 1Q8PA 4G4FA 1ZM1A 4A7ZA 4OYUA 1ACCA 5FZIA 1GWKA 1HDKA 3NV3A 2XVLA 3R6SA 1H8TA 1UZ0A 2ZHKA 1Y43B 2XH6A 2N7GA 4WVMA 1RJ8A 4YWAA 2VQUA 1SLTA 1ZBE1 4AVTA 4XURA 3INAA 1BKZA 3CU7A 2EIDA 5BXXA 3GF6A 1O59A 5IFTA 1NCQC 3BYWA 1ZZCA 4P5HA 5I8YA 1B35B 1DZRA 3T09A 2W87A 2IXHA 5T5PA 1JOPA 1UOFA 2CDOA 3J26N 4KBBA 4UFHA 4KL1A 3S57A 3ROUA 2Q8EA 3AJYA 3AJZA 1V9U1 4MGQA 1BK0A 4CP1A 4E4ZA 2C6SA 2E26A 4KMQA 4YZ3A 5D8AC 1MS0A 4D7SA 1JYNA 1WW4A 1COV2 5FZ8A 1GWLA 1AR72 2WWUA 1UKGA 2JDNA 2VMIA 5DAPA 1AYM1 4AQTA 4YG6A 3USUB 1KXGA 1JYCA 2VNOA 1COV3 4LKEA 4I30A 2NQYA 5FWJA 4X8PA 2RDSA 3R4SA 1JOBA 1F8VA 2HYXA 2IWGB 2Y6GA 2VMCA 1TME3 2BFUS 2JIJA 3UJOA 2RR12 1QU0A 1ND3A 4CDUC 3S5AA 5LBCA 1PMIA 1C8M1 4JGYA 3LIGA 1G8WA 4I0AA 4Z1VA 4KWKA 1NA1A 1C1LA 5FKBA 5F2WA 2NMOA 2WT2A 4KBZA 5KXDA 3PJQA 4JGZB 5JMOA 1VLNA 4BMEA 4AF9A 5EJ1B 4M3CF 4XF3A 2DYCA 3ZXDA 4TYSA 4EE2A 3KCYA 4BCUA 5JOZA 2RS53 3OUHA 3VDBA 3J7LA 1HB2A 3ES4A 4FPYA 3RZGA 2WSVA 1WUVA 4FO9A 4MXWA 5CKMA 2E9QA 4HETA 3IB3A 2SBAA 4S2HA 5CZKA 1ZRDA 1QJU3 4LE3A 5DG1A 2WO7A 2W46A 2VZTA 3FBYA 1LGCA 4BIOA 1XNCA 1SFNA 5H9QA 3Q9OA 1OLQA 1XE0A 2W08A 5K0UA 3U0ZA 1D4M2 4MGZE 1QOSA 3J9SA 2IFWA 5ANQA 4EZHA 4Y22B 3I2KA 1TNRA 3LFIA 3OD0A 3AP9A 1GQGA 4YVSC 2WLQA 2TBVA 1POV3 2WN2A 4XFCA 2WRAA 1G86A 4I3PA 3OF1A 1AL21 2C26A 4JAAA 5T52A 4OI2A 4ZS3A 3NNFA 5LK7B 5F3EA 2JB8A 4NR1A 1BVVA 1H8TC 2EXIA 3M7AA 1W9SA 4G3YC 1VBD2 4OQ9A 3BPSA 4ASMB 4B7EA 1HV1A 5GJ6A 2BJSA 1MS9A 1PO22 5ABJB 1S1AA 2GH2A 1CAXA 2A6YA 3UK9A 3AP4A 3C7FA 1HIXA 3MUZ1 5GLZA 1PO23 2VBDA 2WQ4A 3A7QA 1I5PA 2ZGMA 2MEV2 4OI0A 4KQ7A 1FOD2 2P6CA 3KCXA 4AHYA 2ZA9A 3HNYM 1CQ9A 3LEKA 2JKBA 4BM8A 1HQWA 1YFYA 1LOFC 2MEV3 3E1F1 3VN4A 2ZGNA 3LA2A 3CBNA 4GWNA 5DZFA 4Q0PA 3HOBA 5I0DA 5EZWA 4LKFA 1LHWA 2FDHA 4Q4X3 5FDBA 2I2SA 4BIFA 4XJ8A 3TNQA 1X50A 2BW8A 2W39A 4BOWA 2VMFA 2EIEA 4XE9A 3JUUA 1RUOA 4ARYA 3AXDA 5GLWA 1R092 1V6OA 1XNTA 2B46X 5LY1A 2BWAA 1ZA7A 1GWMA 3MIGA 3MPBA 5FZDA 4E2GA 4RGGA 5JLVA 5FK7A 1ND3C 1G6NA 4OHWA 1UMZA 4JGYC 4AWDA 3FZ3A 2BPA2 1NA1C 5FY0A 1O3QA 5HCFA 5H9PA 5FZOA 3Q8AA 4NPMA 2IXKA 2X53S 3ZFGA 4FFGA 5FJKA 3ZKYA 1Y7BA 2GC2A 2WN3A 3IIAA 2QQPA 4QB1A 2E7AA 3FLPA 4CUGA 4QPGA 1AR83 2Q30A 3HT2A 2RS11 2YU1A 2OIIA 1SZBA 5JSPA 3ZYHA 2XKPA 3KLSA 4QGLA 1E5HA 1IGOA 2VOXA 2ZABA 3WF0A 1C1FA 2BYVE 3ETQA 3G6JB 4AVVA 3C7HA 4LOSA 1PVC3 4A3ZA 1R1A3 4CUCA 2XWJB 2XVKA 3FHAA 2A7AA 4KGQA 1CAUA 1TMF2 4CDWA 4UXAA 4L99A 3RG0A 3RSJA 1STMA 1TMF3 3AZVA 2QVSB 4P08A 4A6SA 3AL5A 2A71A 2LW8A 4Z2AA 3BB6A 4LIUA 1RUI2 3OB8A 5AVAA 4CEYB 4R9BA 4BQ2A 5KC5A 1OD5A 2HWF2 2BBAA 2YYOA 3AKQA 3CLPA 3PVOA 2AEYA 2BVBA 2DVFA 3EJKA 1WMEA 2WIIB 5FLIA 2WZR1 4HN0A 5FYTA 3WHTA 5BNNB 2C0ZA 3BODA 4L0PA 3QOPA 1R082 2HWF3 5F37A 2BFUL 5F5QA 2BBVA 1UL9A 2ARAA 3OD4A 1ULPA 4GKYA 1TVGA 3DYOA 1R083 2AUYA 3IWZA 1GZWA 4JKLA 4XF0A 4A7KA 4BYYA 5CFDB 1PO13 1LENA 2ZJCA 5FR3A 3BTAA 2GZWA 3K46A 4XZUG 2XPJA 1WLDA 5L9VA 2C9KA 3EXUA 1QWRA 4YYOA 5IK8A 4IEOA 5L9BA 1W2NA 2XBO1 3N9OA 1W8TA 3AZZA 3T30A 3ZN6A 3GBFA 1RUJ3 2A3WA 2XONA 1PVXA 2Y6JA 1SPPB 3OY8B 4Y26A 5FXVA 5KBFA 1KITA 1F35A 3M2MA 3WV6A 2V09A 5EWSA 1OD3A 4XXAA 1OUSA 2CYFA 5IATA 1NZCA 5JXJA 2VM9A 1W6OA 2GC0A 3ZYIB 3I3DA 2FBEA 3BTZA 3AKSA 1GICA 3WUCA 1K5MB 3PL0A 3BVCA 4NIIA 4OMCA 1US3A 3ZDVA 1YC61 1BHGA 1I1EA 4XUNA 4RYDA 3MHZA 3OEBA 1W8OA 4XFHA 3S30A 4DQAA 5FZ7A 1NXD1 2JDYA 3ASIA 2E6VA 3LPGA 1XE8A 4Y1XA 5DPNA 1EAH1 3ZFGC 2L9LA 1ENSA 1RUG1 1X8MA 2ZX3A 2H6BA 5C70A 4QPGC 4I0BA 3K3NA 1V70A 1PIV2 3NJZA 4FPGA 3UV9A 2WFF1 3DN7A 1CX4A 2HWB2 4D8MA 1OOPA 4DOUA 2WAOA 2FMYA 1WW5A 4UFJA 3GYDA 3ZFEA 1O6UA 2Q8CA 4DEQA 5HCBA 3OUIA 4CDWC 5FYBA 3SLIA 3ZX7A 2QQOA 1ULOA 2R0FA 1UY4A 1D2QA 1W3VA 1WKYA 3OCPA 4E2SA 3BU0A 4RS5A 3KB5A 4RFRB 3T3YA 5I0UA 5FZKA 1NX9A 4XUOA 5KHJA 1OF4A 1RUH3 1ZREA 2Z42A 4GWIA 2NZ9A 2SLIA 5F3IA 3MYXA 4LQRA 1XNKA 4OI1A 4NIGA 1LHOA 2D6OX 2W1QA 2XL9A 3K75B 3PU8A 5FPLA 1WZXA 5FY8A 2YU2A 4P9WA 3U4SA 1GMMA 2WSUA 3N7LA 2QBXA 2BOJA 4NAMA 4XUPA 1DFQA 3O0XA 2A6WA 5A7WB 2QQNA 2X05A 3MW2A 4D6QA 4LO7A 1RUC2 2HH9A 3VD9A 1VRBA 3BIEA 1LHUA 4GALA 5CEHA 2KD7A 1IQAA 1WCSA 2IUWA 4TTGA 1RUC3 2WAAA 4P9GA 1J83A 3OGSA 1ND2B 5EPAA 2WO1A 4GJYA 3IN9A 1KD7A 3VD7A 1EUTA 5FREA 3WG3A 2DV9A 1LRHA 3VL8A 4RHV1 3NNJA 4CUAA 1XJAA 4XFBA 3HWJA 3ZLIA 1Q5OA 4Y33A 2WWJA 4PI2A 5ERLA 4GIQA 5F5AA 3TYJA 2W2IA 3JD71 2F4PA 3ZXGA 4LULA 4XILA 4KWLA 2I45A 5FLJA 2WNVB 2W0XA 2DVAA 2D6MA 4LO6B 4Q4V2 4F83A 4RL7A 2OW4A 4UFMA 3LDBA 5D21A 5KHGA 2R1DA 1RGSA 1NYWA 3FLTA 2Y34A 4PIYA 3LF7A 2C4XA 3K3OA 4Q4V3 3X29B 3T2PA 1DGWA 2RG4A 3OG2A 4B1MA 2BV4A 2FZ2A 2VE1A 1UU5A 2R062 3WXPA 4K7JA 4AQ6A 1GZ9A 4FOWA 2WNOA 2W1SA 3CNAA 3VB9A 4OQ8A 3C7EA 4HKLA 3ZVXA 2ZGRA 3HEIA 2BDRA 5LA2A 1YWKA 4W6XA 1MQTA 2DUPA 4QXHA 1OOPC 2VW0A 1UYPA 3JU9A 3USSA 1WD3A 2VVEA 3HT1A 3ZR6A 3ZFEC 2PAEA 1RMU3 2XJQA 3PUQA 4MOAA 2VH9A 5A6YA 4YZ2A 5J37A 5DUXA 1NE4A 3ABZA 5DAWA 2GN3A 1S4CA 2HBTA 4FOVA 3RZMA 1OHFA 2WA4A 3GHNA 5FZHA 4NROA 3IM0A 3R4DB 1PX4A 4RS5C 2A70A 3MIEA 2V73A 4WVVA 2GNDA 2YROA 4IEYA 3WEZA 1HN0A 5EHDA 3KQRA 1WLCA 2XUMA 1NLRA 4NRQA 4IEXA 3ZYPA 2Y64A 2WR9A 1IPSA 2LROA 1NUKA 4AEJA 5CBLA 5CU1A 4UBGA 3H42B 3W59A 5C8CB 3S0MA 1S0BA 3E6DA 1ZBA3 3AB0A 3FLRA 1AL0G 2WNUB 4LITA 3SNMA 1FV2A 1ZRCA 1IG3A 4M0NA 4W4ZA 3WNPA 2PHWA 4JTNA 4PIXA 3T2OA 2YBPA 5ACA2 2GC1A 5FQ0A 1XNBA 3WNLA 2EALA 4XW3A 1VP6A 3Q8BA 2XKOA 4FPHA 1X36A 1COV1 2GAUA 5FLHA 5CADA 5ACA3 4CDQA 2VCAA 2RHPA 1HJFA 4M4RA 1H2LA 1TME1 1VR3A 1N1YA 4P9XA 4XETA 3VUOA 1URXA 1LESA 1LODA 1C8NA 2KM2A 2VJXA 1UCXA 3KQ4B 5T54A 5J98B 3M3QA 1C4RA 3T1LA 4AL9A 1H1IA 3EBRA 3MBWA 4IV3A 4PIZA 3IPVB 4QXBA 3ZPYA 4AEDA 4BZ4A 1XYPA 2GNBA 1ASJ3 2FZ1A 3W9AA 5C3RA 4XJ9A 2FCUA 3ZMNA 1WA4A 2BUKA 4ET7A 3HJRA 1AR92 1QH6A 3VBUB 2G9ZA 3VGIA 2RS51 2J1SA 3D8CA 3VBRB 1QXPA 1WMFA 3L2YA 4JQRA 4UI9L 4BK5A 5AFBA 3OUJA 3O1UA 4PF1A 1AR93 4IV1B 1A6CA 4LK6A 4AK3A 2YBKA 3RI8A 3DXUA 1QJU1 3KSCA 1O4ZA 2DCTA 1O4TA 1SBFA 1OF3A 2FDGA 2RJKA 5BV6A 2DCYA 1LULA 1RTVA 3MLJA 3OBTA 1H4GA 2JG8A 2QQJA 3POEA 4QU1A 5BNPA 2F6BA 3NNGA 3CL1A 3KF3A 4MGIE 3NNMA 2GMEA 1MQTC 2PELA 2ZAAA 1POV1 2WC2A 2EAKA 5EFUA 3VHNA 3WW4A 4XTMA 3V0BB 1V6LA 2DTWA 2VZVA 2JECA 2GP3A 3ACIA 3ZDSA 1LOBA 2TNFA 1PGW2 3TEZA 4XDOA 5J48A 1JW6A 5FZ0A 4LBQA 3E6BA 2QTWB 3M3CA 4M3CA 1N3QA 1N1TA 1VPHA 2OUJA 3U14A 4Q8KA 1S0IA 3ECQA 3B00A 5CIRA 4NRMA 1YFWA 3ZFFA 4XHXA 3UGHA 5T5OA 2PHDA 1LB2A 3N9PA 5HXMA 4EN6B 2RS32 2ZEYA 4OULA 1DQ6A 4XEZA 4DINB 4B3NA 2XHKA 3HQUA 1X9PA 3O1PA 2MEV1 5AC92 1Y9MA 4Q1PA 1J59A 1I5ZA 4PF5A 2JE8A 4QAWA 4OI4A 4FTBA 4H55A 4Q4X1 5FYMA 2BEOA 4N9HA 5FTTC 5JSRA 1UPIA 3F2ZA 2UURA 2DVGA 5E88A 4Q1RA 3MO4A 5FMDA 4K8FA 2TEPA 4CDQC 3RZLA 3BOPA 3OSDA 5DABA 1PGSA 1O91A 2D7FA 5JIAA 2G9GA 3WW1A 2R042 1H1MA 3VD3A 3FHIB 2GSYA 3OYWB 3IKWA 4IV3C 2ENRA 5C3QA 3O1MA 4AEDC 1X33A 5A3NA 2VTFA 3D0JA 4UW5A 1UW8A 1XRUA 4IUGA 1KJLA 2YZ4A 3IDBB 2VECA 3AKPA 5IVEA 4H3WA 2PQSA 5FBZA 2E32A 1WBFA 2Z4FA 4LO4B 1AR81 4YGEA 1NCRA 3ZSMA 1XU2A 2JICA 4BLIA 4AGGA 3MIBA 3KV9A 1ODMA 3LDRA 4LOTA 5JCTA 4UFLA 3H7JA 1PVC1 2PN5A 1R1A1 1Y4WA 4JCKA 4R4XA 4RR3A 1SACA 4N43B 4NO4A 5GALA 2VD7A 3DGTA 4HPKA 4DUVA 2FDIA 3OPTA 3C8XA 4YVWA 3WCRA 4LO5B 1FPN2 1ULEA 2JG8C 4Y5TA 5BNPC 1YQ6A 3U78A 3ZN5A 2P1BA 5LEKA 2QJVA 1TMF1 1UOGA 3FFZA 3K4AA 3LA7A 1UY1A 1JYIA 5LZ6A 1FPN3 4QPIA 1YO8A 3SQOA 3DCQA 1NOVA 4RFT0 5FP8A 4QQHA 1LTEA 4R4ZA 2PXJA 1U5YA 2XG3A 3P5BA 5CKNA 4ZKTB 1OQ1A 5FUPA 1F5JA 3KZ4C 4ORFA 3BTYA 2X10A 5F9TA 1PK6B 2HWF1 5FP4A 3M1HA 4YFWA 2WT1A 2QUOA 2BP6A 5C9AB 4X6RB 1A8MA 2JENA 4R9CA 5LY2A 3ZFFC 4AVCA 1R081 1W6NB 1G7YA 5L19A 1PO11 4TXWA 2GMPA 1W28A 4DXRA 4UW6A 2VQ0A 2XXZA 5FO9B 3MPPG 5FWEA 4H2AA 3POSA 1NT0A 4NE9A 4BQ5A 3CJIC 4YGCA 2PQQA 3Q8FA 1UU6A 3ME2A 5CYYA 4HK9A 2XVGA 4O9GA 1RUJ1 3OEAA 5EP9A 4XDPA 5A32B 4BWOA 4NHLA 1G9AA 4OUSA 2NYYA 3DUIA 2D3SA 1OPMA 1O3RA 5C3SA 2RM22 4XIKA 5C5UA 1ULDA 1IS5A 3QBQA 4EYUA 3H8XA 3VBOB 5LBEA 1VMJA 2E31A 4F3JA 5HV0A 1UZZA 1XYOA 2D6NA 4FAGA 2FD8A 5A3TA 1L7LA 3AMPA 4AEKA 2HWE2 2PLV2 2ZGOA 1E5RA 4QQ2A 4AAXA 2I74A 2JJ6A 1W6QA 2VR4A 4IEUA 1UXXX 5GZFA 1X8EA 4QU2A 1HQLA 2CAVA 2HWE3 1H8VA 4QB2A 4E27A 1O5UA 4HKWA 3POYA 2Q4SA 2NN8A 1NCRC 4KG0A 5CKQA 4Q8LA 4NWVA 4QT6A 4Q0VA 2OYZA 3N4MA 4C0BA 1G9BA 1K5JA 4LBNA 4Y5Z0 4I09A 5C4WB 4FFHA 1B35A 2W91A 4K6BA 3RDIA 2VZSA 1OMIA 2MPFA 2J1VA 3ALQA 4QGMA 4RR3C 4DUWA 3UKTA 5A7OA 5T5JA 2QNKA 3ACGA 2JDKA 3EB7A 2HJIA 4HMZA 4NRPA 5A6XA 4MGKE 3NWKA 4FOQA 1AYN3 4YVWC 1LAJA 4GQ7A 3B94A 1KDKA 4ASKA 2HKXA 3U75A 3GBWA 2A3YA 3RJRA 4XZPA 3PMSA 1TG7A 5FP3A 2VOWA 3KGLA 2NM1A 3E5UA 4NN0A 4UFIA 1TQ5A 1CZTA 4QPIC 4YPJA 1RUH1 3VLBB 3DV8A 5JMCA 1W8WA 1WBLA 3USUA 1SDDB 3WNOA 1OPOA 1XNDA 3IMMA 2ZGSA 5I0TA 1HRV2 2EF6A 4TWTA 4OCTA 3N7MA 5FZ1A 3ZYRA 5FYSA 3EYPA 1NKGA 1ST8A 2E7QA 1HB3A 3UGGA 2YC4A 2F4LA 3RQ0A 1W9YA 2C1FA 5D8AB 2Y6FA 5F3CA 3I8TA 4GMP0 4LR4A 1K12A 4JGZA 5FO8B 1H2MA 5GKAC 2P3YA 4P00B 4I3GA 4YG0A 3DEMA 4Q27A 4KI5M 3WQBA 5EYXA 1F15A 2VG9A 1RUC1 5F32A 1CR7A 4HOOA 4XC9A 5A3PA 2FDKA 3VKNA 4JV4A 3VDDB 2NP0A 3WCSA 3T0BA 4FQZA 4K21A 4IE0A 4N90A 3R4UA 1UQXA 1WMDA 1RJ7A 2ZTNA 3KT1A 4IEPA 4XJZA 3O1OA 3ORJA 1XSRA 3PUSA 2KA3A 1R64A 4GXLA 4A44A 1ULFA 3JCIA 2IFRA 2AH2A 4XFIA 5JVVA 1H6YA 3R05A 3BN6A 1PM7A 1AR73 1OH3A 4Y22A 3BPZA 3RFRA 1RUD2 2GU9A 1OA4A 2BGPA 5E89A 4Q4Y2 1RUE2 3HNBM 5L73A 4YSFA 2ZEXA 4Q4V1 4QPWA 1XU1A 2E51A 1RUD3 1JUIA 3N7JA 4Q4Y3 3WOGA 5HCAA 4GA9A 3RVHA 4BK4A 1GUIA 2J1AA 2UWCA 4YARA 5J3UA 2RR13 2Y60A 3MIFA 2VL4A 5GLUA 3J7MA 1WA6X 3UGFA 5KWRA 3WG4A 5ABJA 4XQ4A 1LGNA 1VBA2 3JQXA 5FY5A 2IC1A 2PHFA 2LUWA 4M4PA 5CAZA 5LCWL 2QQKA 5LEJA 3E6CC 5G05L 1W06A 4KG8A 2W9XA 1B35C 1SQ4A 1YI9A 1VBA3 4V1PA 5DAQA 2O8QA 1RMU1 3GJBA 5KXBA 3P1IA 1CPMA 5FMOL 4YLZA 1AX0A 4Y24A 1QMJA 3RRDA 2WZEA 3WP3A 2DUQA 4SBVA 2WNEA 4XABA 1JZ2A 1W8ZA 1DHKB 1PX3A 1BZWA 2ZZJA 1SG3A 4LORA 3NL1A 5DDJ2 2JD4A 4J25A 4ATEA 3M3OA 4C1WA 5L36A 1AJKA 4CPBA 4OHYA 3HD8B 1POQA 2MHFA 3MEPA 4D94A 3PIGA 1S2KA 2JD9A 1Z7S2 2ZACA 3PJYA 4DPNA 1V6KA 3AFKA 2A5ZA 4PQ9A 1KDMA 5I0SA 5I93A 1ZBA1 1D4M3 4LUKA 3ZYJB 1W2AX 1NY72 3M8LA 2ARXA 1Z7S3 3ZIXA 4B1LA 4FPKA 4DO0A 3WQ0A 4JVAA 1RIRA 3VHOA 3L2HA 2UY8A 2W3JA 3G7DA 1W6PB 1WCKA 3DKWA 2VGDA 3AXEA 1NG0A 4JGZC 5ACA1 1VBD3 1QDCA 3RYRA 5E8AA 2DVDA 4CVUA 2Q1MA 2QQWA 4HL0A 3BTXA 4A3XA 3ZXKA 2AYHA 1QJZA 5D2AA 1ULGA 2K9ZA 5BNQA 3PIJA 2RDQA 1H2KA 5FY1A 4LT5A 4OHZA 1XSQA 3TBDA 4Y5SA 3S7EA 4JGYB 2DFBA 4XPVA 2G19A 1AX1A 1ASJ1 1FOD3 4ZZ8A 5JR7B 3O1TA 4MG2A 1JYTA 4KU8A 5FXXA 1WD4A 2CWMA 4XFFA 1IQDC 3UYJA 4QKDA 2DTYA 2YV8A 2CGPA 4JX0A 3WSOA 1VJ2A 2D93A 2WS92 5BYNA 5GZCA 2OS2A 4LE4A 4FTEA 1YIFA 3IT8A 4XMAA 1CJDA 3SH3A 1AR91 3WP6A 2Y0IA 1DBNA 4HFSA 2ZKLA 1QOTA 2W1WA 2YB7A 3QH6A 1GQPA 2YFZA 4JHZA 3WDYA 3NJXA 2BNOA 4CCDA 1JU3A 3DXTA 3AZWA 4MHUA 1R093 4QPYA 4QX2A 2Q8OA 1V0AA 4QDQA 4X8NA 3T1MA 1SBDA 1DP0A 1OT5A 2GP5A 2Y8KA 4YW7A 5CFCB 5BNNA 1OURA 3W58A 1SDWA 1H9WA 2BRTA 4E4DX 3MUY1 3PTRB 3B01A 5ABJC 3LDKA 3GZUC 1Q8SA 2ZOEB 3OGGA 3TAYA 4CCJA 4MGTA 4HSLA 4WVWA 4AI0A 1DYOA 4CYDA 4LBOA 1VBB2 2PFWA 4LNVA 5FP7A 1HV0A 5ANNA 3T2TA 5CFDA 2W68A 5IWFA 4L92A 2V4VA 4XAAA 5B4XA 1UPSA 1ZZBA 3HN1A 2RMU2 4FCAA 1S0FA 1KFXL 4IE6A 2WINB 4EN7B 4EQVA 4TSVA 2ERFA 5FKCA 3V64A 1JZ8A 1UYZA 4IL7A 3SEEA 3I2HA 1RUNA 3PVNA 5A3OA 4CEWB 4Y4YA 4FPEA 1SPPA 2CAUA 3OY8A 4M00A 5FP9A 4C1XA 5K0UC 3J8F2 5IHRA 2RVAA 1OQEA 2WL1A 3WDUA 4AYUA 2OZJA 1AXKA 1JS9A 1GBGA 3RS6A 4NPLA 5T5LA 3H50A 3ELNA 3O12A 3FN9A 1OH4A 3IBMA 2PHLA 4IETA 1DZQA 3LFMA 4UW4A 1K5MA 2QFEA 2ZGUA 1FNYA 1RUI3 3I2DA 4Y1UA 2Q8DA 4CEYA 5IK5A 3LZZA 1TE1B 3NQHA 5FUIA 4QKNA 3SKVA 2Z69A 4FSJA 1BMV1 2HBUA 5EV7A 1T6GC 5J7MA 1M06G 1BQPA 1T6BX 1GQHA 2J42A 3O0WA 5FPZA 1QHDA 3NRUA 1DYKA 4LO8A 5A3UA 5LA1A 1VB4A 3O1VA 2RDNA 1RXGA 3TEYA 1UIKA 3H1WA 4AAPA 2DFCA 4IE4A 4LHSA 1N47A 5IT6A 4ISQA 1K42A 1GP4A 1PZ7A 1OFSA 1CX1A 4FFFA 4ASLA 1P8JA 4AZZA 4BQWA 4CDXB 1MACA 4NHKA 2AREA 1CONA 3GCXA 5JI7A 2AR6A 2VTXA 3KV6A 4QQOA 5TSWA 5LW9A 3BOWA 2XGXA 3GZAA 1XQNA 2A3XA 4SLIA 4XCAA 4NJ4A 5FXZA 5A80A 3Q8EA 1KQRA 1O3TA 3MFCA 1OA3A 4N53B 3UETA 2JDMA 3I97A 5EJ3A 3H8RA 1VAKA 2CL2A 3MICA 3RZJA 4HT1T 1ZZ7A 4Y1VA 5F5IA 2ZS6B 3K4DA 4PJYA 4CEYC 2VPVA 4L97A 1OXCA 5HXVA 4N7UA 1ALYA 1W9WA 1SCSA 1DIWA 2B39A 5SV8A 4YRDA 5FZEA 3N3HA 4CCOA 2YC2A 5BNNC 2VOTA 3AM2A 3NV4A 4KU7A 4INDA 4CDWB 1QKQA 2ET1A 4WZCA 2JIGA 3VHPA 1H6XA 1G9CA 1FPN1 1PMJX 5JSOA 3TEWA 1REFA 5A7WA 2JDAA 3ATGA 5CFDC 2ZHNA 5T3NA 1EYBA 3VHRA 1HQNA 3D6EA 1WW7A 2YC0A 1HKDA 4LKDA 3K51A 1UN1A 1PIV3 1MVEA 4IQPA 3WG1A 2XB6C 3BKZA 1ND2A 2HWB3 3D4KA 3FWEA 1DQ5A 2CGOA 1W6MB 4HKOA 3K2OA 3ZN4A 2BGCA 4EV0A 3C3VA 3N9NA 1LOAA 1V00A 1JHJA 2LM3A 1VRH2 4XCBA 3GZTB 1GZWB 5D1IA 1JH5A 1IS6A 1MS4A 3SXWA 2JDUA 4A6OA 5E16A 5APAA 4LUMA 5JI9A 4YM1A 3GGLA 2XWBB 5IJRA 2D6PA 2DDUA 2WNVA 5FV3A 3NJVA 1YXWA 2E33A 2QCSB 4JRLA 1QQP2 1IHMA 2PHXA 3OJBA 4GB32 5IUQA 1K5MC 4AXOA 1DGLA 1OKQA 1RVF2 3CIHA 1E5IA 3LIHA 4GH4B 4ZS2A 1UOBA 3WW2A 4AGVA 3HAGA 1OLME 3ZYFA 2VMDA 3BALA 2B9VA 4GB33 3PUAA 3RWKX 1RVF3 1JI6A 1ZZ6A 3WR0A 2QQMA 1JOJA 5FMBA 2X09A 5C5TA 5GM0A 1REDA 5J96B 1UY2A 1W6OB 3SCHA 4JDNA 5A6ZA 4EJRA 3LEMA 3KWVA 1YQ8A 4QXKA 1GFF2 1UAIA 1EUUA 3M3IA 4AR2A 4CP0A 1CAVA 2HWE1 4D7TA 5DG2A 3V0AA 5FZAA 2ZX1A 3HBKA 1DLLA 3ETPA 3NMBA 5KXCA 4WM7B 1W0OA 3ZO0B 3HBZA 4AQSA 1QJY2 1ZBE2 2ORZA 4K1YA 4XF9A 4BQXA 4XVHA 5A1FA 3NO8A 3ZXLA 3AYCA 3FUOA 1Z78A 1PGL1 2QZ3A 5JUVA 3OPZA 1IZ3A 5JXIA 3WLUA 1QJY3 3WP5A 2Y38A 3I4IA 5C33A 3O1RA 3OOXA 3T2QA 1OUXA 4IESA 5T50A 1S55A 2XQRA 3M4FA 1GANA 2YG0A 4UF0B 2RDRA 3CEWA 3KT7A 1AYN1 3E5XA 2YGMA 4M3CE 1V9U2 4XYXA 4BLJA 5BY5A 2WZ8A 2B7YA 5C8CA 1OI6A 4IW3A 3CZUA 4FQ4A 2WNUA 2BOIA 3A0KA 1YLLA 2JXAA 1E5SA 1BXHA 3H1MA 2QQIA 4HVRA 3LSDA 4LJHA 5C7GA 3VZKA 5IYYA 3MIDA 3POFA 1S2EA 2J1UA 1GKBA 4LA3A 1IKPA 1A8DA 2R063 5IK4A 1RB8G 2XJSA 2ILMA 3VKFC 3B3QE 2ETEA 3HR9A 1SMVA 4DFSA 5H9RA 4K9SA 2GDFA 3I7DA 4AI1A 4NUBA 3ILFA 5A1AA 1C8M2 1ND2C 2VCBA 5FOBB 1YEWA 3NV1A 4LHNA 4PBPA 3QLQA 4UBHA 3IPVA 3I59B 2A75A 5F3GA 1HXS2 5LA0A 3DPRB 2ZGKA 1EP0A 3WVJA 3VZJA 1S0EA 5KHIA 1GOHA 1IOAA 1HXS3 3VBUA 4CCCA 3O1SA 2WNVC 2XJTA 3I3BA 2VY0A 3EMRA 4UYBA 1O7FA 4OVEA 3HPNA 5IAXA 3VDCA 4AHZA 2B8MA 3RMYA 2C24A 2IXJA 5B2GB 4DRRA 4NHMA 2WFPA 2O14A 2UWBA 5LA9A 5HCHA 1VMFA 5IVFA 5ISLA 4YZ4A 3ZSKA 1AR71 1ZA4A 4JTOA 4I02A 4P9YA 2O8OA 5CNAA 3FL7A 1HB1A 3GBGA 1OFNA 2RJ2A 3V0BA 2P3IA 3VBSB 5JWPA 1L7QA 1AL22 4QB6A 1RUD1 4LBLA 3CZJA 1XYNA 4Q4Y1 4R8HA 1YQ2A 2HWD2 1JHNA 3RWNA 1IS4A 2A1XA 2RR11 1O5LA 1YIPA 3SH4A 3H7YA 4YW1A 2HWD3 4FPJA 5FOJB 4PBOA 1MZEA 5C8WA 3WUDA 2A6VA 5IFPA 4Q29A 1GYKA 2FDJA 4L8QA 1MEC2 3I3QA 3T0DA 2D3RA 1VBA1 1U12A 4QX5A 1FNZA 2D44A 3D3AA 3MLKA 5LATA 4YW4A 4CXXA 3ZR5A 4JDMA 1ENXA 1MEC3 4LBQD 3SCGA 4NIDA 1NAEA 5GZGA 1S2BA 5C8CC 1YJLA 5DUUA 4EWAA 4RA0A 5FPXA 1KS5A 2WNUC 3U07A 4XIOA 1X7NA 3CO2A 3MI8A 4ZZ5A 4WZFA 2QQVA 1TEIA 4AFDA 2Y6KA 5A3MA 1M4WA 1SEFA 1W9TA 4RQPB 3R0RA 5DZGA 4MX3A 4J1XA 1BVP1 4MO3M 3H9AA 5LB6A 4B4RA 3WDVA 2YXSA 4XBNA 2R30A 2X8KA 1GU3A 1C5IA 4JKMA 1D4M1 2AEZA 4FTSA 1Z7S1 2K2SA 3VBHB 3I3EA 4BXFA 1QDOA 4D3WA 3F95A 1V6JA 4OUMA 3OYWA 2BTVC 2AENA 2ZHMA 5LRSA 4PLMA 4D7YA 4WM8B 2WWSA 4PDWB 2XHNA 1VBD1 1JYWA 5FYUA 2WQZC 3TWIA 1PO21 3ZXFA 1U5XA 2FHRA 4CSWA 3H3LA 3VBUC 5FYYA 1AXYA 5A7QA 3VKMA 4DZGA 5A1LA 1K45A 1Y9QA 4YM3A 3PUHA 1XPWA 5JOWA 3AZXA 1FOD1 4CCKA 3FBMA 2RS33 4XJWA 3VZMA 4N43A 2LS6A 4W50A 4AFAA 3WNMA 5AC93 2WLPA 1UMHA 3OGRA 3JB4C 2ADEA 5FY9A 1BYHA 4ZPIA 4CP9A 4HVQA 1H9PA 1VB2A 5HV4A 5C3PA 5L7OB 3THCA 3VBFB 4DS0A 4LHLA 3POIA 1S0JA 3MF9A 2R32A 1A3KA 3NAPB 3QH7A 4GAZA 4NWWA 4CU8A 1R091 1L7RA 4UWDA 2WZR2 3WNNA 4MADA 2R043 3BCWA 4Q26A 4XDQA 3SH5A 2W95A 3WX5A 3KS7A 2P3JA 4AFBA 1W0PA 5BNPB 2OUHA 1T2XA 3GZEA 5C3OA 5C9AA 5A6QA 1DYPA 1W6NA 4YGDA 5LBFA 2YFUA 3LA3A 1JODA 4L9BA 4R9AA 5GLVA 3ZYBA 2OPKA 4LK7A 5F8PA 2PA7A 4Y20A 3ZOIA 1QOOA 4IEZA 3VZLA 2C5DA 2DCZA 1A34A 2R6QA 1APNA 3GDBA 3JQWA 1DLCA 4H7LA 1C5HA 4P9JA 2D98A 4XAEA 3KF5A 4QX3A 4P5YA 4RN5A 4YZ1A 1SFPA 4FP3A 5A32A 4K1ZA 3WF4A 3AP7A 5J09A 3S7IA 4LHKA 1CZSA 2C9AA 2J22A 4FFIA 3M70A 4MVTA 3W21A 1XNAA 1PNFA 2OX0A 5A7PA 5F7UA 4NMIA 1AZDA 3CKHA 4O61A 3KHBA 5A33B 3P6BA 2FCVA 1LEDA 3AMMA 3H3UA 3MDPA 3VBOA 3LEIA 3CJIB 3WQ1A 5T55A 1RC6A 1OVSA 1QH7A 3T4VA 2K46A 5BNOB 3IAQA 3TN92 3A0NA 4TLGA 1RUI1 3AL6A 2WYFA 3M3EA 3MFAA 4EN9B 5C6CA 3N9LA 1ZX5A 2DCKA 4QWNA 3U10A 3J7NA 5K8SA 4LBJA 3TN93 2QZ2A 3PUIA 3UKVA 1LGBA 3LOBA 4WVZA 4HN1A 1LCLA 2JDZA 1AX2A 3U4XA 4OUEA 3C7GA 2OXBA 5FMOS 2ZGPA 1XOYA 4X6QB 1JU4A 1U0AA 3VKOA 2KXLA 2ADDA 4XMIA 3PURA 4IGPA 5EJZB 2ZGLA 2VAUA 5IVJA 5C4WA 4HZFA 4XTPA 1DQ1A 5A70A 4AEMA 1J3PA 2CWSA 4N43C 3T4HB 5JPNB 5JZGA 1UKRA 2BQPA 2FMDA 2OQ7A 3WF3A 3AX4A 2YY1A 3B9CA 4QKBA 2Y6HA 5J36A 2XJUA 4NAOA 3MV01 1O8PA 4F7ZA 1DGWX 4EN8B 4K8RB 4DMIA 3GHMA 1VBE2 2RM23 1HW5A 2JX9A 3NV2A 2QDRA 3WDWA 1VIWB 5FYIA 1H30A 1UU4A 3APBA 2DUOA 3CHXA 3LPFA 1VBE3 5DAVA 4MYEA 1LECA 5EXOA 1O3SA 4B4QA 4RR3B 2G9FA 2W94A 2JG9B 1GP5A 4YNIA 1W2TA 2DU1A 4FAHA 2D40A 1K3IA 2DF7A 4F8AA 1KRIA 2X5IB 3ZXAC 1SLCA 2PLV3 4GD4A 2TUNA 4LMFA 1SLAA 2ET7A 1CAWB 1O8SA 3ACHA 4C91A 1LR5A 5C9AC 3IDCB 1UXZA 2E7TA 1CD3G 3AMQA 4LKSA 4D6RA 2XOMA 2JDHA 1WW6A 3DYPA 4EZ4A 3SMHA 5KXEA 1UYXA 2W5FA 3MIHA 3FC0A 2HEYF 4R52A 1UZVA 4QMAA 4H14A 2V5YA 1B09A 1PIV1 2JE7A 1PZ9A 2VBBA 2HWB1 1MS5A 2HEVF 4EWEA 4DB5A 1VBC2 3VDDA 1J58A 4AHWA 1W8UA 5FUNA 3TNPB 2D43A 1CIWA 2ZMNA 4UAPA 3THPA 1C28A 5CISA 2ES3A 2OT7A 1VBC3 5FZ3A 2DCJA 5FZLA 4NIAA 3QACA 1ZRFA 1DQ0A 4CCNA 1NCQB 2Y0OA 4O65A 5FZ6A 3VBOC 4AE2A 5K9YA 1F4AA 4OFGA 2CDPA 1WLWA 3IMNA 5FJHA 3TEXA 1W8FA 3JBG2 5JZGB 4IE7A 4OMDA 5IW0A 4DXSA 3WINE 2XMLA 2YGLA 2OPWA 4HLTA 1I6XA 4QX1A 3JBG3 3AC0A 1YNAA 3WQ7A 1HRV3 4GB31 2I07B 3K77A 1RVF1 4GMP3 3ZPOA 2IZWA 4N8MA 4UW3A 3VD4A 4KWUA 2VZ1A 4CU7A 4AFCA 3H3ZA 2HYKA 3ON7A 3MF6A 1X9TA 2XR4A 5EIYB 5CB7A 1JZ6A 1SLIA 2ID4A 5FBJA 3S5QA 1DGRA 5F39A 3RI9A 5C4WC 2BERA 4K40A 1UO9A 4QD2A 2ZGTA 1W6QB 3PNAA 2CY6A 5JZGC 4COVA 2P3KA 4CDUB 4HK8A 3IDEA 1SBEA 2VZUA 2ZX2A 1RHI2 3ST7A 1ZRIA 4XOGA 4QXCA 3FMGA 4ES8A 5FPUA 1QJY1 2ZAHA 1NXMA 5JOYA 2VQAA 4XF1A 1RHI3 4CXWA 1W03A 1IKQA 4N7IA 3RPQA 1QJX2 5IVVA 2LTNA 4IGQA 4EROA 5I91A 3IDAA 4IERA 2VOKA 2Y26A 1SLLA 4DY3A 2D3PA 4COUA 3ENRA 1QJX3 3AK0A 4PLNA 1QF3A 5FZ4A 5BPXA 4AI2A 4Q4W2 3HVDA 1AJOA 4ARXA 2A6XA 2OVUA 4ZONA 5FY4A 4PLOA 1LOFA 3WNKA 1S0CA 1RUE3 1J3RA 4YW5A 3POWA 1QJEA 2LRPA 4MUVA 4Q4W3 4CPBD 3AVRA 3GXUA 1W6PA 1RINA 4NPRA 1HRI2 3WDXA 4BXSV 2A6ZA 2R061 1XC6A 1SCRA 3LB9A 4S2DA 2R072 2H6CA 1LNSA 4HSJA 1HRI3 3B9IA 1TME2 4NHXA 2GC3A 4YVSB 4M01A 4E8DA 4A4AA 4IDZA 1PMHX 2R073 2B42B 1S0DA 4YGBA 5C71A 1H2NA 1RUF2 2IVIB 3VDDC 4MGSA 1VAVA 1H8TB 2J1EA 2J1RA 2P5BA 2Z5WA 3D5OA 4MGYE 4WVMB 5FIXA 4C90A 5LRRA 4NIHA 3OBZA 2Y33A 3DKQA 1GZCA 1RUF3 3KV4A 5FY7A 2XLFA 2VCCA 2P4EA 2XL7A 4XUTA 1HXS1 1JMUB 2FDFA 3OGVA 4DUXA 2RS52 2W52A 1AR62 5DDJ3 1R1ZA 5F6LB 1FATA 3KVAA 1JYVA 3O14A 2G1MA 3U11A 2ATFA 4W6YA 2Q0AA 2JEMA 1AR63 4JKKA 2IVJA 1QJU2 2O0OA 3MW4A 3N35A 2EIGA 1PHMA 4CP2A 1OSGA 1VALA 3PU3A 3DL3A 1Q56A 1RYYA 3V56A 2JB4A 3UKNA 1UD1A 1LJ7A 2VCMA 5CFCA 1J1TA 3KT4A 1E57A 4META 5A7SA 3E97A 3U37A 1GNYA 5A3WA 4AG4A 3KCCA 1N1SA 2IXCA 4XF4A 3I49A 2NPIA 1CZVA 3WP4A 4BPZA 1ND3B 1W8NA 1JZ4A 3QCWA 3NNLA 1POV0 4E8CA 2PAMA 4FPCA 3JB8A 1NA1B 2HWD1 2WO2A 4PHZA 1U5ZA 2W92A 4JHTA 3JXSA 5FZCA 3KMHA 1MZFA 1PZ8A 1OKOA 1WCDJ 2EICA 3D82A 4CEWA 1F2NA 2VUAA 3HQRA 5DUVA 2JKXA 4ZU7A 2PHRA 1N1VA 2OA2A 3LSEA 1ZVFA 2KR2A 2RE9A 1JZ5A 1MEC1 2WS93 3T0AA 4CZSA 5CA6A 4A2UA 1Y9GA 2H0BA 2R1BA 5DZEA 4MXWB 4R9DA 4CCLA 4KH9A 5K7PA 3UJQA 5H9SA 3DECA 1W9FA 1Y3TA 2GNTA 4HBNA 4Q4X2 2VNVA 5FMCA 5FPBA 3WY6A 4E4HA 2D5FA 1JTZX 3SITA 4MLOA 1V6IA 5HBAA 5HI0A 1CN1A 4HXCA 2WDBA 1OQDA 4QX8A 5AVPA 3UL2A 4AVBA 5K0UB 3PHMA 2VTXJ 1BBT2 2P37A 4M0HA 3NKGA 4J6GA 2IXLA 1J84A 3POBA 4JDOA 3W5NA 4G9SB 2BU9A 5F2SA 1W04A 4ONUA 1BBT3 3ZXJA 1VBB3 2IXIA 2GALA 2B4KA 3I2OA 2O1QA 2D5HA 1BCXA 2NLRA 4DRVA 4CA9A 2XUEA 4LLOA 4Z2WA 2RMU3 4S2GA 3EO6A 1SHWB 1PGW1 3WF2A 5FCCA 4LEJA 1CGPA 3ZMOA 1F9KA 3WZ1A 2BWCA 1KEXA 2CHHA 2AACA 4CDXA 1CAXB 2WABA 2P34A 2JWPA 4ATFA 1AR82 1IG0A 2G4IA 3BIWE 3ZKUA 4L2NA 1W0NA 4EN0A 4Z92B 1NQJA 3KGZA 2AZ5A 3J8F3 3P3PA 2VXRA 4N53A 1BK1A 2VUDA 2Z79A 1ULCA 2RS31 1PVC2 4IEWA 1R1A2 1OBNA 4Y3OA 5FYVA 2FCTA 1FAYA 1OVPA 2ZEZA 3LWCA 2K0GA 4FBFA 5AC91 1BEV2 1HJGA 3AMHA 3AP5A 3MGUA 3W20A 2P2KA 3TOJA 1RL3A 1CJPA 4QQPA 4IEQA 3URFA 5FRAA 5CFCC 1PNGA 1YYNA 1JUHA 2XDVA 1BEV3 3PLQA 4P9IA 1GOGA 4QX7A 2UWAA 2DURA 5FZFA 1NLSA 1FMD2 3PTYA 2JE9A 4PQQA 4QKFA 3VZOA 1H1AA 3I3MA 1GNZA 1FMD3 5CG8A 4QHZA 4CU9A 1ZRRA 1D0GA 2PYTA 2R041 4FPFA 4C0HA 4ZHNA 1YI7A 2V5DA 2ZMKA 4QHOA 1O4YA 5FZOB 3RMXA 1WGPA 3I2GA 4AI3A 3ZFGB 3B02A 4CEWC 1W6MA 1D2SA 1PO12 4RD7A 1W99A 2ZXQA 4ZU4A 4QPGB 4BQ1A 3POJA 3EHKA 1NE6A 2JDPA 3N9QA 2ARCA 4AOCA 1RUJ2 1EV12 3PVBB 3WF1A 4PI0A 3THDA 4QDSA 3B7MA 2E63A 2ZZQA 1LOEA 2WT0A 3ZSJA 5FZBA 1UMIA 4GH4A 2R49A 1EV13 1CAUB 1EPWA 2MNGA 4FVVA 3SKJE 2EXKA 4BQ3A 4NOTA 1QGLA 4CE8A 2EA7A 3C2UA 4YW3A 4JC1A 1DG6A 4XQWA 4QHBA 4BJ0A 3LCPA 4DEVA 4GULA 1DCSA 4ZY9A 3A21A 2PHTA 4RGKA 5JXGA 2YUEA 1ODNA 2VNGA 1W05A 2VUJA 4LA2A 5IAVA 4YFZA 4BQYA 4J1WA 4YG3A 2B45X 3CJXA 3TN91 1QNYA 4P02B 5F5CA 1UZYA 5L9RA 4I0WB 4AGRA 2UU8A 4NVPA 2HWC2 4CDXC 3U1XA 4A7YA 4PT6A 2PTMA 1CESA 1TZOA 2QQLA 4OZOA 5GZEA 2P6HA 4WM7A 4H7MA 4UT5A 1N3PA 2EIBA 5DAXA 3A23A 3H8OA 3A4UA 2HWC3 2VZPA 5FYHA 1QXRA 3JZVA 4CTEA 1KFUL 2J1TA 4BHPA 1NLQA 3P3NA 4C8DA 2A73B 1QEXA 4N53C 3I2IA 1LHVA 1VRH3 1FYUA 3RZHA 5KHKA 3NJYA 4XACA 3HN3A 5IK7A 4UF0A 1UY0A 1D4VB 1UX7A 2ZX0A 4FP2A 2ZX4A 3ZN6B 4B4PA 4OHVA 4BE3A 4OHXA 4TZDA 1DDLA 5I0RA 3N7KA 2XJRA 3HNMA 1SLBA 3AYEA 4MZUA 3MW3A 1UX6A 1QQP3 5E6HA 2YHJA 4TN7A 5EQUA 1UF2C 2RM21 2HLEA 3RYKA 4XUQA 3PDQA 1RUH2 3VZNA 2X29A 3IZOA 2BZDA 1VBE1 1Z0HA 3O0VA 4Q0UA 3DYMA 3GM8A 3KM5A 4RSUA 2GMMA 2CV6A 3B5LB 1YJKA 2FQPA 5KR7A 2WA3A 1VMHA 2PLV1 4Q0SA 3ILRA 4UFKA 3RZKA 1KS4A 3BI3A 1FV3A 2WUHA 4DIQA 2VZRA 3I59A 3VL9A 3K4ZA 1DQ2A 4MSVA 3TB0A 1DZTA 4URAA 3N9MA 1AXZA 3AVSA 5FXWA 4BH9A 5IVBA 1ZBE3 3DPRA 3NW4A 5EYYA 1RITA 2R0HA 4E2QA 4CXYA 3OBAA 3NKTA 5GZDA 1CWPA 1LOCA 1WWYA 4HVOA 2CGNA 5FPAA 3ILNA 1OOPB 2VZ3A 2V72A 4CU6A 3ZFEB 1LEMA 2HEWF 1W90A 4GH4C 2VW2A 4BU2A 2BNNA 1Q8OA 1VBC1 1V9U3 2DWRA 2GN7A 2OQ6A 1MR5A 4QGNA 4RS5B 1AYM2 4FT8A 4I2OA 3FUQA 3TRSB 4GWMA 1XBFA 1QXJA 4CCMA 3WT3A 4COZA 4LIVA 1AYM3 4B7KA 2ZPXA 3I2JA 1W8HA 4A45A 2EXHA 3JBG1 2ARBA 1GZTA 1WLTA 1HRV1 3RZZA 3VBSA 2VOVA 4TLFA 4GMP1 1F5FA 2VC9A 4N9IA 1GSLA 5LWBA 4WM7C 3WDTA 4XQDA 1C8M3 2ZMLA 1GR3A 4BISA 4W6WA 1W3XA 4W8JA 5JDBA 5FFOC 1MZ5A 2E53A 3NSTA 5I8SA 2B9UA 3C7OA 1IPJA 2NMNA 2BNMA 1FX5A 3VBRA 1LKNA 1RMU2 5J1XA 3BU7A 4XFAA 5CVRA 3OTFA 4IV1A 1CAVB 1HB4A 4BDVB 2ZHLA 3GCWA 3V0AB 1Q8VA 4COWA 4Q2FA 5KHHA 3HIFA 1AUYA 3SHRA 2CNAA 1RHI1 1GNHA 4YW2A 4GJZA 2QQUA 2LALA 4RQPA 1V6MA 2CSGA 4JZRA 3KV5A 1JN2P 2AC1A 2VULA 3CF6E 2Q5TA 4GKXA 5K4LA 3D0SA 3VD5A 4IE5A 2OZ6A 3I54A 1QJX1 3K48A 3B69A 4FI9A 4URTA 4AQ2A 1ZBA2 3AZYA 5DN2A 1DQ4A 1YFXA 5KC6A 4V2VA 3LQCA 1YQ5A 1NZIA 5GLTA 3VBHA 5JAXA 1HN1A 1RUE1 2CU5A 1UWWA 4OZXA 3LD8A 4MXVA 1ZYBA 4Q4W1 4U36A 2XLGA 4D69A 1AL23 1AVBA 4QM9A 2WYSA 5IVYA 3O5SA 4WM8A 2H0VA 4PDWA 1H0BA 4ISRA 4KNCA 4QM8A 1HRI1 1C57A 3DPRC 2RJLA 4YM0A 4BMBA 1MQTB 4MV2A 3SC7X 2UYBA 3OPWA 3ZSLA 1MVQA 2R071 4U2AA 1A78A 5G04L 3AMNA 4ZXEA 4KWJA 4LBKA 3BUCA 4FXKB 4Z8BA 1ASJ2 2YBSA 1RUF1 4AHXA 1UZWA 2D6LX 4IEVA 3ZIWA 3UT0A 4WV8A 3UNPA 1I3HA 2Z2SB 2R7EB 4QQLA 1OLMA 3KVBA 5DDJ1 5LBBA 4HG6B 4LPLA 3WNXA 1U5IA 3ACFA 1MS1A 1KJRA 2WBKA 5L7OA 3VBFA 1AR61 1TNFA 3NAPA 3H1YA 3VBSC 2BGOA 3EQEA 3SCFA 2W47A 4IGOA 1DF0A 5I8TA 1GP6A 5FAXA 4LXLA 1CIYA 1OC1A 1NY71 3FX3A 1J3QA 1YCIA 2W1UA 4V2WA 5FQ0B 5JPMB 1UOJA 2ORXA 2V4AA 4HONA 4K3UA 4L11A 5JIUA 1Q3EA 2YMZA 5SV5A 5FK8A 3H0OA 3ACLA 4K20A 3RYPA 2VUCA 1HX6A 4XHBA 3WG2A 4CDQB 5JOXA 2DU0A 3AKRA 2RS12 5FO7B 4XJAA 3VBRC 2VVDA 2D6KA 5M0TA 1ZNPA 1IS3A 3GALA 3SEPA 2WJSA 4IV1C 2QE3A 4XBLA 1JXNA 2RS13 4FPLA 4FPOB 4IV3B 4ZU5A 3B93A 4AEDB 2VQTA 1YFUA 4AW7A 4BB3A 4Z07A 2QDNA 4CRQA 1UNBA 2ZCWA 3RGBA 4RQPC 4E9KA 1OA2A 2PHUA 4YZ5A 1QNWA 2BVVA 3ZSEA 5B4NA 5BUVA 2WS91 2PMWB 3L9JT 5A33A 4RGAA 3T08A 5DMYA 3CQOA 1JZ7A 1DGRN 3CJIA 3BGAA 1JZ3A 3VBHC 2Y6LA 3LOIA 5BNOA 4O7XA 4DNYA 1KGYA 3HMYA 1MS8A 4LLFA 1X82A 2UY9A 5LK5A 4PCRA 3S6PA 3V65A 4AI8A 1PK6A 1W2UA 4Q5OA 1VAMA 4WM8C 2JG8B 4PDWC 1ZZ8A 2WZR3 3OBRA 4S2FA 2QKDA 3DF0A 3AYDA 3J7HA 1BMV2 3I2FA 1AHSA 5FPVA 4BQ4A 1YHFA 4IXLA 2YPJA 3E5QA 5DQ0A 1FI2A 1BBT1 2VMEA 1VBB1 4MHRA 1JBCA 1BJQA 1GOFA 2XBO2 4KGGA 1ONAA 2VO5A 5HPOA 2RMU1 2VZOA 1JYXA 4XFGA 1RXFA 4LBQB 3O7OA 1D0HA 4Y1ZA 1REEA 3MV11 1SFYA 3ZXEA 2XBO3 2VU9A 3AP6A 1LU1A 4M3CB 2WZPP 4DY5A 4I01A 1I9RA 3IIIA 5AFEA 3N36A 3NVCA 2WO3A 3RJ2X 3ZFFB 4COYA 5A3LA 3QD6A 1Q8QA 4DXTA 4O9EA 1LHNA 1YRZA 5L7OC 3J8F1 3VBFC 5JXHA 3A22A 2EXJA 3LGRA 4JQTA 1WCQA 3WHUA 4ES9A 4XXPA 3NAPC 2R16A 5DXDA 4CCEA 1GV9A 1EY2A 2ZKNA 4P14A 5FZGA 4Z82A 4MH0E 1QY4A 1MZ6A 1VE0A 3FFQA 4Q0QA 2JG9A 4QX0A 5DUWA 3ES1A 1BEV1 1N3OA 1W2OA 4DXZA 2X5IA 4FXGB 3FE5A 4OLLA 1EAH2 3VDAA 4CP9B 3POGA 1J1LA 4B8EA 1MS3A 1CAWA 1RUG2 4XBQA 3THTA 4HANA 4A41A 2VZQA 4ITCA 4P9LA 3PVEA 1FMD1 1EAH3 2EVXA 1XE7A 2ZEWA 3GJAA 4XJUA 2WFF2 5CG9A 3HQXA 1BLZA 1RUG3 2XJPA 3CDZB 5JR2A 4A42A 3WW3A 3AKTA 3WD5A 4AI9A 3Q8CA 1EPZA 2WFF3 4QDRA 2VNRA 3AFGA 3LAGA 3KHCA 2WQ8A
chains in the Genus database with same CATH topology
1W39A 1FT9A 4Y1YA 4EWDA 4B29A 1IPKA 5F1RA 1YUDA 3GNEA 1NCRB 4YM2A 3VV1A 3MLLA 3PMEA 1NCQA 4Y20B 1LOGA 1NQDA 1C3HA 1CPNA 3RNSA 2CTVA 1AF9A 3H8UA 2WKKA 4WBBA 5BNOC 3MZHA 2B5HA 4AFMA 4HPKB 1EV11 4LBMA 4JRAA 4YVWB 1ZZ9A 1PK6C 1F31A 3AYAA 4ZXKA 5D8AA 1LU2A 4AVSA 4QPIB 2ZGQA 1CVNA 1HLCA 1GLHA 2VW1A 1L3JA 1OLRA 5E1RA 4LTAA 5F6KA 2XJVA 2VMHA 4RHV2 1V6NA 4CDUA 4AVAA 2VVFA 2ZBJA 1S0GA 2HWC1 2YDEA 3SISA 2VMGA 1PGL2 3J4UH 4RHV3 1G9DA 3KD4A 3JD72 2Q1ZB 3VKLA 1UIJA 4W65A 1VRH1 2GH8A 1DU3D 2DVBA 2P17A 1G9FA 3LKJA 3JD73 2UYAA 1ENRA 1AYN2 2AGSA 2JG9C 4FOYA 1QQP1 2GNMA 2X5IC 3OGJA 4E4SA 1XXNA 4BA6A 1FXZA 1H4HA 3ZYGA 2EAAA 1Q43A 2PAKA 2D97A 1ENQA 4YVSA 3FJSA 2XLAA 4G4FA 1Q8PA 1ZM1A 4A7ZA 1HDKA 3NV3A 2XVLA 3R6SA 1H8TA 2ZHKA 1Y43B 2XH6A 2N7GA 4WVMA 1RJ8A 1SLTA 1ZBE1 4AVTA 3INAA 1BKZA 3CU7A 5BXXA 3GF6A 1NCQC 1ZZCA 4P5HA 5I8YA 1B35B 1DZRA 2IXHA 5T5PA 3J26N 4KBBA 4KL1A 3ROUA 3AJYA 3AJZA 1V9U1 4CP1A 4E4ZA 4YZ3A 5D8AC 1MS0A 4D7SA 1WW4A 1COV2 1AR72 1UKGA 2VMIA 1AYM1 4AQTA 4YG6A 3USUB 1KXGA 1JYCA 2VNOA 1COV3 4I30A 2NQYA 4X8PA 3R4SA 1F8VA 2IWGB 1TME3 2BFUS 3UJOA 2RR12 1QU0A 1ND3A 4CDUC 1PMIA 1C8M1 4JGYA 1G8WA 4I0AA 4Z1VA 4KWKA 1NA1A 1C1LA 2NMOA 2WT2A 5KXDA 3PJQA 4JGZB 1VLNA 4BMEA 4AF9A 4M3CF 4XF3A 2DYCA 3ZXDA 4TYSA 3KCYA 4BCUA 5JOZA 2RS53 3ES4A 4FPYA 2WSVA 1WUVA 4FO9A 4MXWA 2E9QA 4HETA 2SBAA 4S2HA 1ZRDA 1QJU3 4LE3A 5DG1A 3FBYA 1LGCA 4BIOA 1XNCA 1SFNA 5H9QA 3Q9OA 1OLQA 5K0UA 2W08A 3U0ZA 1D4M2 4MGZE 1QOSA 3J9SA 2IFWA 4Y22B 1TNRA 3OD0A 3AP9A 1GQGA 4YVSC 2WLQA 2TBVA 1POV3 4XFCA 4I3PA 1G86A 3OF1A 1AL21 4JAAA 5T52A 4OI2A 5LK7B 4NR1A 5BY5A 1BVVA 1H8TC 2EXIA 3M7AA 4G3YC 4ASMB 1VBD2 4B7EA 1HV1A 5GJ6A 1MS9A 1PO22 5ABJB 1S1AA 2GH2A 1CAXA 2A6YA 3UK9A 3AP4A 1HIXA 5GLZA 1PO23 2WQ4A 2ZGMA 2MEV2 4OI0A 4KQ7A 1FOD2 3KCXA 4AHYA 2ZA9A 1CQ9A 2JKBA 4BM8A 1HQWA 1YFYA 1LOFC 2MEV3 3VN4A 2ZGNA 3LA2A 4GWNA 5DZFA 4Q0PA 5EZWA 1LHWA 4Q4X3 5FDBA 2I2SA 4BIFA 4XJ8A 3TNQA 1X50A 2BW8A 2W39A 4BOWA 4XE9A 3JUUA 1RUOA 3AXDA 5GLWA 1R092 1V6OA 2B46X 2BWAA 3MIGA 3MPBA 5JLVA 4E2GA 4RGGA 1ND3C 1G6NA 4OHWA 1UMZA 4JGYC 4AWDA 3FZ3A 2BPA2 1NA1C 5HCFA 5H9PA 2IXKA 2X53S 3ZFGA 1Y7BA 2GC2A 3IIAA 2QQPA 2E7AA 3FLPA 4QPGA 1AR83 2Q30A 3HT2A 2RS11 2OIIA 5JSPA 2XKPA 3KLSA 4QGLA 1IGOA 2ZABA 2VOXA 1C1FA 2BYVE 3ETQA 3G6JB 4AVVA 1PVC3 1R1A3 2XWJB 2XVKA 2A7AA 4KGQA 1CAUA 1TMF2 4CDWA 4UXAA 4L99A 3RG0A 3RSJA 1TMF3 3AZVA 2QVSB 2A71A 3BB6A 5AVAA 1RUI2 4CEYB 4R9BA 5KC5A 1OD5A 2HWF2 2YYOA 3AKQA 3CLPA 3PVOA 2DVFA 2BVBA 3EJKA 1WMEA 2WIIB 5FLIA 2WZR1 4HN0A 3WHTA 5BNNB 2C0ZA 3BODA 3QOPA 1R082 2HWF3 2BFUL 5F5QA 2BBVA 1UL9A 3OD4A 4GKYA 1R083 2AUYA 3IWZA 1GZWA 4XF0A 4A7KA 4BYYA 5CFDB 1PO13 1LENA 2ZJCA 3BTAA 2GZWA 2XPJA 1WLDA 5IK8A 3EXUA 1QWRA 4YYOA 4IEOA 2XBO1 3AZZA 3ZN6A 3GBFA 1RUJ3 2A3WA 1PVXA 3OY8B 4Y26A 5KBFA 1KITA 3M2MA 3WV6A 2V09A 5EWSA 4XXAA 2CYFA 1NZCA 1W6OA 2GC0A 3ZYIB 2FBEA 3AKSA 1GICA 3WUCA 1K5MB 1I1EA 4XFHA 3S30A 4DQAA 1NXD1 3ASIA 3ZFGC 2E6VA 4Y1XA 1XE8A 1EAH1 1ENSA 1RUG1 1X8MA 2ZX3A 2H6BA 4QPGC 4I0BA 1V70A 1PIV2 3NJZA 4FPGA 3UV9A 2WFF1 3DN7A 1CX4A 2HWB2 1OOPA 4DOUA 2FMYA 1WW5A 3ZFEA 3GYDA 5HCBA 4CDWC 3SLIA 3ZX7A 2R0FA 1D2QA 3OCPA 4E2SA 4RS5A 3KB5A 5I0UA 1ZREA 5KHJA 1RUH3 2Z42A 2NZ9A 2SLIA 3MYXA 1XNKA 4OI1A 1LHOA 2D6OX 2XL9A 4P9WA 2WSUA 3N7LA 1DFQA 3O0XA 2A6WA 3MW2A 4LO7A 1RUC2 1LHUA 4GALA 1IQAA 1WCSA 1RUC3 4P9GA 1ND2B 3IN9A 1KD7A 5FREA 3WG3A 2DV9A 1LRHA 3VL8A 4RHV1 4XFBA 3HWJA 1Q5OA 4GIQA 3TYJA 3JD71 2F4PA 3ZXGA 4LULA 4XILA 4KWLA 2I45A 5FLJA 2WNVB 2W0XA 2DVAA 2D6MA 4LO6B 4Q4V2 4F83A 4RL7A 2OW4A 5KHGA 2R1DA 1RGSA 1NYWA 3FLTA 4PIYA 4Q4V3 3X29B 1DGWA 2FZ2A 4AQ6A 1UU5A 2R062 3WXPA 4K7JA 1GZ9A 4FOWA 3CNAA 4HKLA 3ZVXA 2ZGRA 1YWKA 4W6XA 1MQTA 2DUPA 1OOPC 2VW0A 3USSA 3JU9A 1WD3A 2VVEA 3HT1A 3ZFEC 2PAEA 1RMU3 2XJQA 5J37A 2VH9A 4YZ2A 5DUXA 1NE4A 2GN3A 4FOVA 1OHFA 2WA4A 3GHNA 3IM0A 3R4DB 4RS5C 2A70A 3MIEA 2V73A 4WVVA 2GNDA 2YROA 4IEYA 3KQRA 2XUMA 1WLCA 1NLRA 4IEXA 3ZYPA 4AEJA 5CBLA 5CU1A 4UBGA 3W59A 5C8CB 3S0MA 1S0BA 3E6DA 1ZBA3 3AB0A 3FLRA 1AL0G 2WNUB 3SNMA 1FV2A 1ZRCA 4M0NA 2PHWA 4JTNA 4PIXA 5ACA2 5FQ0A 2GC1A 1XNBA 2EALA 4XW3A 1VP6A 2XKOA 4FPHA 1X36A 1COV1 2GAUA 5FLHA 5CADA 5ACA3 4CDQA 2RHPA 1H2LA 1TME1 1VR3A 1N1YA 4P9XA 4XETA 3VUOA 1URXA 1LESA 1LODA 1C8NA 2KM2A 5T54A 1UCXA 5J98B 3M3QA 1C4RA 3T1LA 1H1IA 3EBRA 4PIZA 4IV3A 3IPVB 4AEDA 3ZPYA 4BZ4A 1XYPA 2GNBA 1ASJ3 2FZ1A 3W9AA 4XJ9A 3ZMNA 1WA4A 2BUKA 1AR92 1QH6A 3VBUB 3VGIA 2RS51 3VBRB 3D8CA 1QXPA 1WMFA 3L2YA 4JQRA 5AFBA 1AR93 4IV1B 1A6CA 4AK3A 3RI8A 1QJU1 3KSCA 1O4ZA 2DCTA 1O4TA 1SBFA 2RJKA 5BV6A 2DCYA 1LULA 1RTVA 3MLJA 3OBTA 1H4GA 2JG8A 5BNPA 2F6BA 3CL1A 4MGIE 2GMEA 1MQTC 2PELA 2ZAAA 1POV1 2WC2A 2EAKA 5EFUA 3VHNA 3WW4A 4XTMA 3V0BB 1V6LA 2DTWA 2JECA 3ZDSA 1LOBA 2TNFA 1PGW2 5J48A 1JW6A 4LBQA 3E6BA 3M3CA 4M3CA 1N3QA 1N1TA 2OUJA 4Q8KA 1S0IA 3ECQA 3B00A 5CIRA 1YFWA 3ZFFA 4XHXA 5T5OA 2PHDA 1LB2A 4EN6B 2RS32 4OULA 4XEZA 1DQ6A 4DINB 4B3NA 2XHKA 2MEV1 5AC92 4Q1PA 1J59A 1I5ZA 4PF5A 4OI4A 4FTBA 4H55A 4Q4X1 2BEOA 4N9HA 5FTTC 5JSRA 1UPIA 2UURA 2DVGA 5E88A 4Q1RA 4K8FA 2TEPA 4CDQC 3BOPA 1PGSA 1O91A 2D7FA 5JIAA 2G9GA 3WW1A 2R042 1H1MA 3FHIB 2GSYA 3OYWB 3IKWA 4IV3C 2ENRA 4AEDC 1X33A 3D0JA 4UW5A 1UW8A 1XRUA 1KJLA 2YZ4A 3IDBB 2VECA 3AKPA 4H3WA 5FBZA 1WBFA 4LO4B 1AR81 4YGEA 1NCRA 3ZSMA 1XU2A 2JICA 4BLIA 4AGGA 3MIBA 5JCTA 3H7JA 1PVC1 2PN5A 1R1A1 4JCKA 4R4XA 4RR3A 5GALA 1SACA 4N43B 4NO4A 3DGTA 4HPKA 4YVWA 3WCRA 4LO5B 1FPN2 1ULEA 2JG8C 5BNPC 5LEKA 3ZN5A 2QJVA 1TMF1 3FFZA 3LA7A 1JYIA 1FPN3 4QPIA 1YO8A 1NOVA 4RFT0 4QQHA 1LTEA 4R4ZA 1U5YA 2XG3A 4ZKTB 1OQ1A 1F5JA 3KZ4C 4ORFA 5F9TA 1PK6B 2HWF1 3M1HA 4YFWA 2WT1A 2QUOA 5C9AB 4X6RB 1A8MA 2JENA 4R9CA 3ZFFC 4AVCA 1R081 1W6NB 1G7YA 5L19A 1PO11 2GMPA 4UW6A 2VQ0A 5FO9B 3MPPG 3POSA 3CJIC 4YGCA 2PQQA 1UU6A 3ME2A 4HK9A 2XVGA 4O9GA 1RUJ1 5A32B 4BWOA 4NHLA 1G9AA 4OUSA 2NYYA 3DUIA 2D3SA 1OPMA 1O3RA 2RM22 4XIKA 1ULDA 1IS5A 3QBQA 3VBOB 4F3JA 1UZZA 1XYOA 2D6NA 4FAGA 3AMPA 4AEKA 2HWE2 2PLV2 2ZGOA 4QQ2A 2I74A 2JJ6A 1W6QA 4IEUA 5GZFA 1X8EA 4QU2A 1HQLA 2CAVA 2HWE3 1H8VA 4E27A 1O5UA 4HKWA 3POYA 2Q4SA 2NN8A 1NCRC 4KG0A 4Q8LA 4NWVA 4QT6A 4Q0VA 2OYZA 3N4MA 4C0BA 1G9BA 4LBNA 4Y5Z0 4I09A 5C4WB 1B35A 4K6BA 3RDIA 1OMIA 2MPFA 3ALQA 4QGMA 4RR3C 3UKTA 5T5JA 2QNKA 4HMZA 5JZGB 2HJIA 4MGKE 3NWKA 4FOQA 1AYN3 4YVWC 4GQ7A 3B94A 1KDKA 2HKXA 3GBWA 2A3YA 3RJRA 4XZPA 3PMSA 2VOWA 3KGLA 2NM1A 3E5UA 4NN0A 1TQ5A 4QPIC 1RUH1 3VLBB 3DV8A 5JMCA 1WBLA 3USUA 1OPOA 1XNDA 5I0TA 2ZGSA 1HRV2 2EF6A 4TWTA 3N7MA 3ZYRA 2E7QA 3RQ0A 2C1FA 5D8AB 3I8TA 4GMP0 4LR4A 4JGZA 5FO8B 1H2MA 5GKAC 4I3GA 4YG0A 4Q27A 5EYXA 2VG9A 1RUC1 1CR7A 3VKNA 4JV4A 3VDDB 2NP0A 3WCSA 4FQZA 4K21A 4N90A 3R4UA 1WMDA 1RJ7A 2ZTNA 3KT1A 4IEPA 4XJZA 2KA3A 4GXLA 1ULFA 3JCIA 2IFRA 2AH2A 4XFIA 5JVVA 3R05A 1PM7A 1AR73 4Y22A 3BPZA 1RUD2 2GU9A 1OA4A 5E89A 5L73A 4Q4Y2 1RUE2 4YSFA 4Q4V1 1XU1A 2E51A 1RUD3 1JUIA 3N7JA 4Q4Y3 3WOGA 5HCAA 4GA9A 2UWCA 4YARA 5J3UA 2RR13 3MIFA 5GLUA 5KWRA 3WG4A 5ABJA 4XQ4A 1LGNA 1VBA2 3JQXA 3E6CC 2IC1A 2PHFA 2LUWA 5CAZA 5LEJA 4KG8A 1B35C 1SQ4A 1YI9A 1VBA3 4V1PA 2O8QA 1RMU1 5KXBA 1CPMA 5FMOL 4YLZA 1AX0A 4Y24A 1QMJA 3RRDA 3WP3A 2DUQA 4SBVA 2WNEA 1DHKB 1BZWA 2ZZJA 3NL1A 5DDJ2 2JD4A 4ATEA 3M3OA 4C1WA 5L36A 1AJKA 4OHYA 3HD8B 2MHFA 3MEPA 4D94A 1S2KA 3PJYA 1Z7S2 2ZACA 4DPNA 1V6KA 3AFKA 2A5ZA 4PQ9A 1KDMA 5I0SA 5I93A 1ZBA1 1D4M3 4LUKA 3ZYJB 1NY72 3M8LA 2ARXA 1Z7S3 3ZIXA 4FPKA 3WQ0A 4JVAA 1RIRA 3VHOA 3L2HA 2UY8A 3G7DA 1W6PB 1WCKA 3DKWA 2VGDA 3AXEA 1NG0A 4JGZC 5ACA1 1VBD3 1QDCA 3RYRA 5E8AA 2DVDA 2Q1MA 4HL0A 4A3XA 3ZXKA 2AYHA 1QJZA 1ULGA 2K9ZA 5BNQA 1H2KA 4LT5A 4OHZA 3TBDA 3S7EA 4JGYB 2DFBA 4XPVA 1AX1A 1ASJ1 1FOD3 5JR7B 4KU8A 1WD4A 2CWMA 4XFFA 2DTYA 2YV8A 2CGPA 1VJ2A 2D93A 2WS92 5BYNA 5GZCA 4LE4A 4FTEA 1YIFA 3IT8A 4XMAA 1CJDA 3SH3A 1AR91 3WP6A 2Y0IA 1DBNA 4HFSA 2ZKLA 1QOTA 3QH6A 3WDYA 2BNOA 4QPYA 3AZWA 2Q8OA 1R093 4CEYA 4X8NA 3T1MA 1SBDA 5CFCB 5BNNA 3W58A 1SDWA 1H9WA 4E4DX 3B01A 5ABJC 3GZUC 1Q8SA 2ZOEB 3OGGA 3TAYA 4HSLA 4WVWA 4AI0A 4CYDA 4LBOA 1VBB2 2PFWA 4LNVA 3T2TA 1HV0A 5CFDA 2W68A 4L92A 1UPSA 1ZZBA 3HN1A 2RMU2 4FCAA 1S0FA 1KFXL 4EN7B 2WINB 4TSVA 2ERFA 3V64A 4IL7A 1RUNA 3PVNA 4CEWB 4Y4YA 4FPEA 2CAUA 3OY8A 4M00A 4C1XA 5K0UC 3J8F2 1OQEA 2WL1A 3WDUA 4AYUA 2OZJA 1AXKA 3RS6A 1GBGA 5T5LA 3H50A 3ELNA 3O12A 3IBMA 2PHLA 4IETA 1DZQA 4UW4A 4Y1UA 1K5MA 2QFEA 2ZGUA 1FNYA 1RUI3 3I2DA 5IK5A 3LZZA 1TE1B 2Z69A 4FSJA 1BMV1 5EV7A 1T6GC 5J7MA 1M06G 1BQPA 1GQHA 3O0WA 5FPZA 1QHDA 4LO8A 1DYKA 1VB4A 1UIKA 3H1WA 2DFCA 1N47A 5IT6A 4ISQA 1PZ7A 1OFSA 4ASLA 4CDXB 1MACA 4NHKA 2AREA 1CONA 5JI7A 2AR6A 4QQOA 5TSWA 3BOWA 2XGXA 3GZAA 1XQNA 2A3XA 4SLIA 1O3TA 1KQRA 3MFCA 1OA3A 4N53B 5EJ3A 1VAKA 2CL2A 3MICA 4HT1T 1ZZ7A 4Y1VA 2ZS6B 4PJYA 4CEYC 2VPVA 4L97A 5HXVA 4N7UA 1ALYA 2B39A 1SCSA 1DIWA 5SV8A 5BNNC 4YRDA 3N3HA 3AM2A 3NV4A 4KU7A 4INDA 4CDWB 1QKQA 2ET1A 4WZCA 3VHPA 1G9CA 1FPN1 5JSOA 1REFA 3ATGA 5CFDC 2ZHNA 5T3NA 1EYBA 3VHRA 1HQNA 3D6EA 1WW7A 2YC0A 1HKDA 3K51A 1UN1A 1PIV3 1MVEA 4IQPA 3WG1A 2XB6C 1ND2A 2HWB3 3D4KA 3FWEA 1DQ5A 2CGOA 1W6MB 4HKOA 3ZN4A 2BGCA 4EV0A 3C3VA 1LOAA 1V00A 2LM3A 1VRH2 3GZTB 1GZWB 5D1IA 1JH5A 1IS6A 1MS4A 3SXWA 5E16A 4LUMA 5JI9A 4YM1A 2XWBB 2D6PA 2WNVA 1YXWA 2QCSB 4JRLA 1QQP2 1IHMA 2PHXA 3OJBA 4GB32 5IUQA 1K5MC 4AXOA 1DGLA 1OKQA 1RVF2 3WW2A 4GH4B 4AGVA 3HAGA 3BALA 4GB33 1RVF3 1ZZ6A 3WR0A 1JOJA 5GM0A 1REDA 5J96B 1W6OB 3SCHA 4JDNA 4EJRA 4QXKA 1GFF2 1UAIA 3M3IA 4CP0A 1CAVA 2HWE1 4D7TA 5DG2A 3V0AA 2ZX1A 1DLLA 5KXCA 4WM7B 1W0OA 3ZO0B 3HBZA 4AQSA 1QJY2 1ZBE2 4K1YA 4XF9A 3NO8A 3ZXLA 3AYCA 3FUOA 1Z78A 1PGL1 2QZ3A 3OPZA 1IZ3A 3WLUA 1QJY3 3WP5A 2Y38A 3I4IA 5C33A 5T50A 4IESA 1S55A 3M4FA 1GANA 3CEWA 3KT7A 1AYN1 3E5XA 2YGMA 4M3CE 1V9U2 4XYXA 4BLJA 2B7YA 5C8CA 1OI6A 4FQ4A 2WNUA 3A0KA 1YLLA 2JXAA 1BXHA 3H1MA 4HVRA 3LSDA 3VZKA 3MIDA 4LA3A 1GKBA 1IKPA 1A8DA 2R063 5IK4A 1RB8G 2XJSA 2ILMA 3VKFC 3B3QE 2ETEA 3HR9A 1SMVA 4DFSA 5H9RA 4K9SA 2GDFA 3I7DA 4AI1A 3ILFA 1C8M2 1ND2C 5FOBB 3NV1A 4LHNA 4PBPA 3QLQA 4UBHA 3IPVA 3I59B 2A75A 1HXS2 3DPRB 2ZGKA 1EP0A 3WVJA 3VZJA 1S0EA 5KHIA 1IOAA 1HXS3 3VBUA 2WNVC 2XJTA 2VY0A 1O7FA 4OVEA 4AHZA 2B8MA 3RMYA 2IXJA 5B2GB 4DRRA 4NHMA 2WFPA 2UWBA 4YZ4A 3ZSKA 1AR71 1ZA4A 4JTOA 4I02A 4P9YA 2O8OA 5CNAA 3GBGA 1OFNA 3V0BA 2P3IA 3VBSB 5JWPA 1AL22 1RUD1 4LBLA 1XYNA 4Q4Y1 4R8HA 2HWD2 1JHNA 3RWNA 1IS4A 2RR11 1O5LA 1YIPA 3SH4A 3H7YA 4YW1A 2HWD3 4FPJA 5FOJB 4PBOA 1MZEA 5C8WA 3WUDA 2A6VA 4Q29A 1GYKA 4L8QA 1MEC2 2D3RA 1VBA1 1U12A 4QX5A 1FNZA 2D44A 3MLKA 4YW4A 4JDMA 1ENXA 1MEC3 4LBQD 3SCGA 5GZGA 1S2BA 5C8CC 1YJLA 5DUUA 4EWAA 4RA0A 5FPXA 1KS5A 2WNUC 3U07A 4XIOA 1X7NA 3CO2A 3MI8A 4WZFA 1TEIA 4AFDA 5A3MA 1M4WA 1SEFA 4RQPB 3R0RA 5DZGA 4MX3A 4J1XA 1BVP1 4B4RA 3H9AA 3WDVA 2YXSA 4XBNA 2R30A 2X8KA 1C5IA 1D4M1 4FTSA 1Z7S1 2K2SA 3VBHB 1QDOA 4D3WA 1V6JA 4OUMA 3OYWA 2BTVC 2AENA 2ZHMA 5LRSA 4PLMA 4D7YA 4WM8B 2WWSA 4PDWB 1VBD1 2WQZC 3TWIA 1PO21 3ZXFA 1U5XA 2FHRA 3VBUC 3VKMA 1AXYA 4DZGA 1Y9QA 4YM3A 5JOWA 3AZXA 1FOD1 3FBMA 2RS33 4XJWA 3VZMA 4N43A 4AFAA 5AC93 2WLPA 3JB4C 1BYHA 4HVQA 1H9PA 1VB2A 5L7OB 3VBFB 4DS0A 4LHLA 1S0JA 3MF9A 2R32A 1A3KA 3NAPB 3QH7A 4NWWA 1R091 2WZR2 2R043 3BCWA 4Q26A 4XDQA 3SH5A 3WX5A 3KS7A 2P3JA 4AFBA 1W0PA 5BNPB 2OUHA 5C9AA 1DYPA 1W6NA 4YGDA 4R9AA 3LA3A 4L9BA 5GLVA 2OPKA 2PA7A 4Y20A 1QOOA 4IEZA 3VZLA 2C5DA 2DCZA 2R6QA 1APNA 3JQWA 4H7LA 1C5HA 4P9JA 2D98A 4YZ1A 4FP3A 5A32A 4K1ZA 5J09A 3AP7A 3S7IA 4LHKA 2C9AA 3M70A 4MVTA 1PNFA 1AZDA 5A33B 1LEDA 3AMMA 3H3UA 3MDPA 3VBOA 3CJIB 3WQ1A 5T55A 1RC6A 1QH7A 5BNOB 3TN92 3A0NA 1RUI1 5C6CA 3M3EA 3MFAA 4EN9B 1ZX5A 2DCKA 3U10A 5K8SA 4LBJA 3TN93 2QZ2A 3UKVA 3LOBA 1LGBA 4WVZA 4HN1A 1LCLA 2JDZA 1AX2A 3U4XA 5FMOS 2ZGPA 4X6QB 1U0AA 3VKOA 2KXLA 4XMIA 2ZGLA 5C4WA 4HZFA 4XTPA 1DQ1A 4AEMA 1J3PA 2CWSA 4N43C 5JPNB 5JZGA 1UKRA 2BQPA 2FMDA 3AX4A 2YY1A 3B9CA 5J36A 2XJUA 4F7ZA 1DGWX 4EN8B 4DMIA 3GHMA 1VBE2 2RM23 1HW5A 2JX9A 3NV2A 2QDRA 3WDWA 1VIWB 1H30A 1UU4A 3APBA 2DUOA 1VBE3 5EXOA 4MYEA 1LECA 1O3SA 4B4QA 4RR3B 2G9FA 2JG9B 4YNIA 2DU1A 4FAHA 2D40A 2DF7A 4F8AA 1KRIA 2X5IB 3ZXAC 1SLCA 2PLV3 2TUNA 1SLAA 2ET7A 1CAWB 4C91A 1LR5A 5C9AC 3IDCB 2E7TA 1CD3G 3AMQA 1WW6A 3SMHA 5KXEA 3MIHA 3FC0A 2HEYF 4R52A 4QMAA 4H14A 2V5YA 1B09A 1PIV1 2JE7A 1PZ9A 2HWB1 1MS5A 2HEVF 4EWEA 4DB5A 1VBC2 3VDDA 1J58A 4AHWA 3TNPB 2D43A 1CIWA 2ZMNA 3THPA 1C28A 2ES3A 1VBC3 2DCJA 3QACA 1ZRFA 1DQ0A 1NCQB 2Y0OA 5K9YA 3VBOC 4AE2A 4OFGA 1WLWA 3IMNA 3JBG2 3WINE 2YGLA 4HLTA 1I6XA 3JBG3 1YNAA 3WQ7A 1HRV3 4GB31 2I07B 1RVF1 4GMP3 2IZWA 4UW3A 4AFCA 3H3ZA 2HYKA 3MF6A 5CB7A 1SLIA 1DGRA 3RI9A 5C4WC 4K40A 4QD2A 2ZGTA 1W6QB 3PNAA 2CY6A 5JZGC 4COVA 2P3KA 4CDUB 4HK8A 3IDEA 1SBEA 2ZX2A 1RHI2 3ST7A 4XOGA 4ES8A 3FMGA 1QJY1 2ZAHA 1NXMA 5JOYA 2VQAA 4XF1A 1RHI3 1IKQA 4N7IA 3RPQA 1QJX2 2LTNA 4EROA 5I91A 4IERA 2VOKA 2Y26A 1SLLA 4DY3A 2D3PA 4COUA 3ENRA 1QJX3 3AK0A 4PLNA 1QF3A 5BPXA 4AI2A 4Q4W2 1AJOA 2A6XA 2OVUA 4PLOA 1LOFA 1S0CA 1RUE3 1J3RA 4YW5A 3POWA 4MUVA 4Q4W3 1W6PA 1RINA 4NPRA 1HRI2 3WDX