1RESA

Determination of the structure of the dna binding domain of gamma delta resolvase in solution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
43
structure length
43
Chain Sequence
GRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVINESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the structure of the DNA binding domain of gamma delta resolvase in solution.
pubmed rcsb
source organism Escherichia coli
molecule tags Site-specific recombinase
molecule keywords GAMMA DELTA-RESOLVASE
total genus 11
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 1994-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1resA00
1ORKA 2R5YA 4BBSJ 3I4NJ 4FE4A 4M3BA 2JK3A 2MGQA 2K9QA 4BY7J 1JTXA 1TWHJ 3Q0UA 4V2FA 1NK2P 2DMTA 2LKXA 1BL0A 1X2MA 2M8GX 1RESA 1VF9A 2MSYA 3BQZA 4CYCA 5DTDA 3SFIA 3GTKJ 4Y52J 2JA5J 4JX5A 3ZQHA 2WAQN 2CUEA 3BR6A 3GTMJ 3BG9A 1ZR2A 4IHVA 2EZLA 1VNDA 2YUSA 2QF7A 3S1QJ 3Q0WA 2R93J 2CUFA 2D5VA 5IYDJ 2IAIA 5FKKA 3FKIJ 2L7FP 3JRHA 5EF6A 2WV1A 3BG3A 3LSGA 2CJJA 1LFUP 5JLXA 2NVQJ 2E2IJ 1W0UA 2VUMJ 3A02A 1BW6A 1WH7A 1IJWC 5C3EJ 1MBJA 3LOCA 4DZJA 5FKMA 4HNVA 2NVXJ 1JJ6C 4XK4A 1MBGA 2N8GA 1MBFA 1RKTA 1WPKA 2XGEA 2X6OA 2G0EA 4EEFG 1Z77A 3A01B 1TC3C 2HXIA 3BTLA 3HM5A 1K61A 2KDZA 3HEFA 3HGGA 3OOUA 1LE8B 5J1YA 5M5WJ 3ZQFA 2Y0SN 3S2DJ 3C2BA 1XS9A 1U78A 2DTZA 2OF7A 1S7EA 4A3JJ 3IH3A 4XIDA 1AKHB 2CQQA 4A3MJ 1MBEA 4UUSB 2R0QC 2YU9J 5F08A 1ZKGA 5IYCJ 1ETQA 2XGCA 3DEWA 3FK7A 4C3HJ 2FD5A 3HBLA 1AU7A 2HYJA 3CQZJ 2K9NA 2NVYJ 4UUSA 2X48A 3M3YJ 4A93J 4FE7A 3PO2J 2XSDC 2EH3A 2XPUA 2QCOA 2I10A 1IGNA 4I76A 5F0FA 3OSFA 2AO9A 1I3QJ 1OFCX 1Y1WJ 2GBYA 2L7MP 4JP0A 4BKXA 2JA7J 3GBGA 1BW5A 3ZQIA 3IH2A 4M3EA 5F0CA 4C2MJ 4DW6A 4Y7NJ 2HOTA 2XB5A 2Y9YA 5IP6A 4GFBA 3NARA 4JX6A 5EG0A 1TWGJ 1UG2A 4B1RA 1MBKA 1IC8A 1IRZA 1ETWA 4J19A 2FX0A 3BTIA 4JYKA 5E3LA 3M4OJ 1WH5A 5J1RA 1BA5A 1IDYA 4S0HB 4M3GA 1QPIA 2MG4A 1JKRC 3O8GA 1ETXA 1U8BA 1ZTRA 3RZDJ 2O9LA 1U9OA 1ETKA 3BR5A 2LR8A 1TWAJ 2L0KA 5K7FA 1SANA 1VI0A 2LY9A 1D5YA 3L1PA 2ELKA 5DS9A 1RETA 3QQAA 2DA4A 2M34A 2GLOA 1GV5A 1X2NA 4UUTA 4BBRJ 2DA3A 4DYRA 3GTGJ 2ZB9A 1WGXA 2HI3A 1FEXA 3LSRA 4MLOA 1FTZA 5IOYA 1QRYA 2L7ZA 5FKOA 1HDDC 3BR1A 4A3LJ 1RPWA 3GTQJ 3SJMA 1MSFC 3NAUA 3GTOJ 1A6IA 4QIWN 1AKHA 5FKNA 3CDLA 3VPRA 2JN6A 4M3FA 1OCTC 1LE8A 5M3FJ 3BQYA 3HOVJ 4A69C 5M5XJ 1OJLA 3PM1A 3D1NI 2LVSA 2XPVA 3ZQGA 1ETVA 4XICA 2DA6A 3JRBA 3Q3SA 5E3NA 3GTPJ 4QTRA 1F36A 2JWTA 2X9DA 2GM4A 4X6AJ 1R9TJ 1FJLA 5C44J 2HXOA 4D5FA 4IHYA 1FIAA 3PO3J 5JLWA 5F0HA 2COBA 3S2HJ 3HGYA 1DU6A 4FISA 3HOWJ 2M9HA 5IPAA 5J1UA 3JRCA 3IV5A 4IHXA 1IDZA 1WCMJ 1DU0A 4V2GA 5C4XJ 2NS8A 3G1LA 5IP9J 1A5JA 1X58A 2WB1N 3RZOJ 2ECBA 2EQRA 2EZHA 4MO7A 5IYBJ 1T56A 1LFBA 3GTJJ 5FJ8J 3W6VA 2E19A 3S16J 1MBHA 3S15J 1YRNB 2K9SA 1RKWA 4LOCA 2MW8A 3TW7A 2H8RA 2KT0A 5IOZA 2JA6J 3B6CA 2LTPA 4C3IJ 1FIPA 3MVPA 3OSGA 2EBIA 1GDTA 1GV2A 4AC0A 5EG0B 1POGA 1ENHA 1PUFA 1JJ8C 1F43A 1Y1VJ 5M3MJ 3H0GJ 3TP3A 5GPCA 2DMUA 1HLVA 1K83J 3TP0A 2LP0A 2FQ4A 3A03A 2YS9A 3TW6A 4QSHA 1Z0XA 5FLMJ 2Y31A 3K2AA 3MKLA 1TWFJ 4RDUA 1JKQC 1H88C 1ITYA 4A3CJ 2R7ZJ 1TWCJ 1MNMC 1VFCA 2JJ7A 3S1NJ 5GP9A 1AHDP 2ID3A 2M0CA 1MSEC 2LD5A 1SFOJ 2DMQA 5K7ZA 1Q1VA 2RAEA 3HKZN 2EZKA 3I4MJ 3BTJA 4XRSA 3S17J 2NVTJ 3K7AJ 4XRSG 4W1UA 2XGDA 1O4XA 1ZQ3P 2VPRA 5EYRA 2DA1A 3WHCA 3QPLA 5FKLA 4C3JJ 2TRTA 3JRFA 1GT0C 1APLC 4RBOA 1BJZA 2CRGA 1H8AC 5EZHA 3A01A 1B8IA 1JKOC 4NDLA 4AUXA 2OPTA 5EZGA 4A3GJ 3O8HA 2B63J 1UMQA 5E3OA 2XB0X 2DMNA 2LK2A 1UHSA 5EGOB 4IEJA 4A3BJ 2ME6A 5K7HA 1GVDA 4A3EJ 2VKEA 3ZQCA 1FTTA 3UKGA 1T33A 3BR3A 1MH4A 3S14J 3BT9A 1OCPA 2HOAA 1W0TA 4I6ZA 2Y30A 1QVTA 4DYQA 3IH4A 1JUSA 5IP7J 3LSJA 1HOMA 1U9NA 3G1OA 2XPWA 1HF0A 1JGGA 1HCRA 1JUPA 2TCTA 3B6AA 4L5EA 5FLVA 4BY1J 3BG5A 4A3KJ 2VI6A 3JRIA 5F1JA 3RKQA 2O7OA 3BTCA 5BNGA 1P7IA 5EGOA 2IBDA 3OIOA 4D7MA 4MFEA 2IEKA 2K40A 1B72B 3HOXJ 1NK3P 1IV6A 3HOZJ 3HB9A 3FIWA 9ANTA 5HODA 4M6VA 3HOYJ 2ME0A 3S1MJ 1JT6A 3BR2A 2DN0A 4X1EA 4ABZA 2PMZN 2Y9ZA 2H1KA 3JRDA 3G1MA 4A3IJ 4B4CA 2ECCA 2VKVA 2E2JJ 4DZPA 4BXXJ 3JREA 2ID6A 5EDNA 1I6HJ 4XRMA 3GTLJ 1MH3A 3H3VK 2LFBA 1EF4A 1XG1A 1ZGWA 1B72A 1G2HA 1ETOA 4W97A 2NOGA 3CCYA 3JR9A 5C4JJ 1I50J 3SDGA 1HDPA 1H89C 2FJ1A 4M3DA 1CQTA 2L9RA 2P81A 1RR7A 1IUFA 3S1RJ 2DA2A 5GPAA 1JTYA 4D7NA 3FISA 3CMYA 1QVUA 2NS7A 2E1OA 1PUFB 4G12A 4MIMA 1IG7A 4A3FJ 3JRGA 1E3OC 1GUUA 1JKPC 2R92J 5EEAA 3JRAA 4FTHA 1ETYA 2CQXA 1YRNA 1WI3A 2Y2ZA 2CU7A 3E7LA 4DYCA 5J3LA 1ZR4A 2HOSA 2JA8J 2EZIA 3FK6A 2DMPA 1JUMA 4CYCB 5E3MA 4JX4A 4B3AA 5F27A 3BR0A 1B8IB 4A3DJ 2AHQA 2XRLA 5F04A 1P7JA 2HDDA 4FCYA 2R5YB 3ZOBA 1ZK8A 3LNQA 2DA7A 3WHBA 4IHWA 3QPSA 3HOUJ 2R5ZA 4AYBN 3DCFA 2O8KA 5M5YJ 3LSPA 1NTCA 1JT0A 2LLKA 4D5CA 3F0CA 2E2HJ 4MFDA 2R5ZB 3RQIA 2DJNA 2DA5A 3ZQLA 3MN2A 2W48A 3Q0VA 1XC5A 3HDDA 2JMWA 3TEDA 2M2EA 2HQ5A
chains in the Genus database with same CATH superfamily
2DQRA 4GXOA 3H9QA 4FE4A 4XSZF 4HF2A 2JQ7A 2K9QA 3Q0UA 5BQTA 4IQJA 2EFWA 3VSLA 2LKXA 2RV8A 2VQCA 2KFDA 4A0YA 5E18F 5DTDA 4C30A 2FNAA 3OYMA 4ZDLA 3WTSC 2RDPA 1QZEA 2P6SA 5HVQC 2F6CA 2YX7A 4UVAA 3BR6A 4KJZA 3MKZA 2F5VA 4IHVA 4BS9A 1ZGJA 1K79A 3SEZA 2UUZA 4F52A 4RAZA 2OTLI 2XAFA 1YS6A 2IAIA 2MH9A 4XL9A 1P2FA 3G3ZA 2AQFA 3JRHA 2DPDA 1Y6IA 5EF6A 2ACJA 3CCVI 3QPTA 2F5DA 5JLXA 4IO9F 2NVQJ 2QQ8A 4M73A 5JVGF 3OYFA 1W0UA 3A02A 2PG4A 4IOCF 1IJWC 3FMRA 3K69A 4YEJA 5C3EJ 4E7JA 3RPQA 2ZO4A 1ZG3A 2CG4A 3FXKA 1JJ6C 3E6DA 3FMQA 3MZYA 1R5GA 2ZKZA 2FA5A 3EUKL 4AWXB 1WFXA 1MBFA 4WWCA 1SMYF 2IGOA 2CW8A 2E36A 2X6OA 2ESNA 1Z6RA 1Z77A 2G0EA 3PQKA 5D6EA 3A01B 3KIOA 1O3SA 3HHHA 1BBYA 1K61A 3HEFA 3H9GA 1DGWY 2HYFA 5J1YA 3LWFA 3ZQFA 1Z1DA 1S29A 1E3HA 3WTYC 4NHJA 4PJLA 1YG2A 1LQ1A 2L4AA 1AKHB 4HX4A 2CQQA 4A3MJ 3PJRA 2OJED 1XMXA 2V9VA 2PEXA 5IYCJ 1J2XA 3DEWA 2L02A 3OOPA 1GVJA 1WSUA 2L4MA 4XKBA 1YFHA 1AU7A 2HYJA 2M4KA 2K9NA 1X4OA 2NVYJ 4UUSA 4U0YA 1VQ4I 3M3YJ 4BGDA 2XSDC 2JPCA 2VQHA 3L2VA 5CKTA 1Z3XA 2I10A 1YI2I 3WE2A 3OMYA 3OSFA 1RNLA 3RQ4A 2AO9A 3KZIC 3SHFA 1Y1WJ 3PNYA 2STTA 3QP5A 2GBYA 2L7MP 4A12A 1BW5A 3IH2A 3OL3A 1I1GA 2KIQA 2XKPA 2HOTA 3OIQA 2XB5A 3BZKA 4PUSA 2BY0A 5EG0A 2PBIA 3WU1B 1VQ7I 4LB5A 2GZWA 2L9SA 2EFOA 2GAUA 3OYNA 1YIOA 4CA0A 3GW2A 3S3OA 1MJBA 3BTIA 4BQOA 4U87A 1WH5A 3L2RA 1BA5A 1T0FC 4XN3A 3J7AO 1KQ0A 3FXJA 1QGPA 3KEQA 2MG4A 1HKQA 2B9SA 1U9OA 3CJTB 3ZMVA 2LDUA 5CVUA 1V3FA 5B1AH 3BR5A 3IWFA 3QAHA 1SANA 2ZXIA 4OWRB 4YFXF 2OC6A 3AAFA 4PZJA 4NQWB 3K4BA 2EIJH 1OCZH 3ASNH 1J5YA 2GLOA 1GV5A 1V55H 3HKZA 3V7SA 1BI3A 1RC9A 1ZN2A 3DBRB 4UUTA 3V7RA 1L3LA 2Z2SB 4D9JA 3DTKA 4DYRA 3GTGJ 2EJRA 2DQLA 1N25A 2HI3A 4YIRX 1FTZA 1K78B 2PFBA 3AL0B 3U9GA 2NS0A 3FZVA 2L7ZA 5E8GA 4A3LJ 3BR1A 3BROA 2V1NA 3DEEA 1U5TA 1MSFC 2VBZA 3CO7C 1FYKA 1A6IA 4HQMA 4XLCA 3CDLA 1GXQA 2UZKA 3K6GA 4EJWA 4AIKA 3OIPA 3A0BC 4NC7A 2ELHA 2VL8A 2IA2A 3HSEA 3RI4A 1ZH5A 4HF0A 3S3MA 1SVLA 1Q1HA 2CQKA 3D1NI 4Y17A 4XICA 1FP1D 1WJCA 2DA6A 2K86A 1SVOA 3FDYA 1YE9A 1IRFA 4Q4ZF 2ZMEB 1YYVA 3V42A 4M72A 2X9DA 3EPZA 3GYHX 2QSFX 1R9TJ 1R7JA 4EM1A 3I53A 1D1AA 3I54A 4IHYA 3HYIA 4HLYA 2OA4A 5JLWA 3C18A 2LC2A 4NNJA 2COBA 3ASOH 3MD2A 4I01A 3S2HJ 2DAOA 5DCFA 3CCEI 3F21A 5J1UA 3JRCA 3IV5A 4IHXA 1KYZA 4I98B 4LMYA 3D5RC 1S5LC 5L3DA 3G1LA 5AONA 1A5JA 4UY8I 2ECBA 4UUVA 2HGCA 1T56A 3WG9A 3K70C 3HUGB 5FO5A 2QQ9A 5LHGA 2M3AA 2I8DA 3E5XA 2K9SA 3RJPA 4LOCA 1QA6A 3E3VA 2KT0A 3ONQA 3WGGA 4XN0A 1FIPA 3LQRA 3OSGA 2MABA 3CC2I 1DP7P 4AC0A 2XHKA 4YELA 4BYYA 3M1EA 1YJ9I 3TP3A 3KP3A 4ZJZA 5GPCA 2VXZA 3TP0A 1Z7UA 2FQ4A 2LP0A 2YS9A 1M1EB 1D1BA 1QQIA 2D2WA 3TW6A 2PJPA 2VB6A 4OOIA 4RAFA 4IQ4A 1USTA 3W6JB 4BHCA 4LG0B 1ITYA 4OU0A 2R7ZJ 3K1PA 3F8FA 3ECHA 4FHTA 5LFAA 1R49A 1B6AA 4AVPA 3CC7I 2DO7A 3P5JA 5CPRB 5LHHA 1X1BA 5GP9A 1AHDP 2DPUA 2VKHA 2M0CA 1D0YA 2LD5A 2O61A 1ON1A 2DMQA 3OYIA 3SEQA 4NB5A 1V4RA 2DK8A 3GFLA 1LDJA 1MKMA 4ZZDA 5K7ZA 2D1VA 3BTJA 3QU6A 3HPGA 2GQQA 3WU0A 2XROA 2IS2A 3TKYA 2IP2A 1IN6A 3BCBA 5EYRA 3H9JA 5H6RA 4RGXA 4XBFA 3S3NA 4XMYA 4C2UA 1BJAA 2IGKA 4ESFA 4BHPA 2HDWA 3TQNA 2OCCH 5HS7A 1MMDA 4RBOA 1P4AA 1ULYA 1W1WE 3RYPA 4HDVA 3LA7A 4EJUA 3CMAI 4NDLA 5LRRA 4AUXA 4A3GJ 5CQGA 3O8HA 1OKRA 3DF8A 3VDXA 1UMQA 5E3OA 2DMNA 2LK2A 5J40A 2KLOA 5DM7F 2GIZA 3H3ZA 4M9XA 2C6YA 1UHSA 4IEJA 3BP8A 2ME6A 4B44A 5K7HA 3FXLA 4PK4A 3OYJA 5AIPA 4BQNA 1FTTA 4IOAF 3UKGA 3VOEA 3S14J 1UCRA 4IL6C 3BT9A 1XMAA 4YRVA 4P9FA 2CWEA 4I6ZA 3IWZA 4HOBA 2DCEA 3IH4A 2WY7Q 3O6BB 4L9NA 3LSJA 3WU2C 3EETA 5F64A 1BR4A 3IC7A 1F1ZA 3B6AA 3G2BA 4PSXA 3BG5A 1S7OA 4A3KJ 2VI6A 5DYMA 2M7AA 1C0WA 2O7OA 2YR2A 4WXHA 1P7IA 2A6HF 2E60A 2QYOA 4G8XA 2KHMA 3HJEA 3KPHA 1SMTA 1O3RA 2XASA 1H0MA 2CUJA 1PYVA 3I0TA 4UNOA 1MNDA 1PDNC 1JT6A 1K4SA 2JTVA 3BR2A 3CUQC 2BW3A 2QWWA 4CZZA 2TDXA 2AQEA 1R6RA 4AD9A 4ENNA 2ICWG 1Z7LA 3F23A 2H6BA 2X6YA 2Z33A 1U8RA 1BI0A 3KP5A 1XTAA 2VKVA 3BZCA 2ETHA 1I6HJ 3B73A 3V8JA 1STZA 2ZXWH 3CESA 2LFBA 3SZTA 4KISA 3H3VK 1EA3A 3FF5A 4E7LA 1J59A 3VWBA 3LAPA 1X1CA 2NOGA 1RIOH 3V8LA 1I50J 2ZXJA 5ERIA 2NNYA 4L0YB 3ZXSA 2O0YA 5D6FA 5J6XA 3MCZA 3M9AA 5ILVA 3I59A 1PP7U 2P81A 2K9MA 3BCAA 1R1TA 3S1RJ 5HLGA 2L2OA 4YIFA 4HQEA 3WODF 2H6CA 2ZNYA 2P5KA 1QVUA 2FBHA 3MEXA 1F4KA 4MIMA 1IRGA 2HTJA 3IAS2 3ESWB 1E3OC 3AKZA 1JKPC 1TQPA 2KKOA 5EEAA 3JRAA 2CQXA 2EILH 3ZQ7A 5L3BA 3G71I 4XLPF 5FB2A 1VTNC 1G3SA 2L9NA 4XRFA 1JUMA 2Q0OA 1OR7A 1U2WA 4E70A 4JX4A 4B3AA 5E3MA 5F27A 2Z3YA 2EIKH 1TLHB 2IJLA 3A4CA 1SD7A 3PIOF 1FMWA 3WTVC 3GMEA 4HLXA 4G7OF 3CO6C 3AG3H 2KZVA 4B47A 3SDBA 4F3QA 2HDDA 2Q2EB 2E71A 3CUQA 3WTTC 3QYBA 2VJ5A 1ZRFA 3L2CA 1O3TA 2RGVA 4PJNA 2PMUA 4WF2A 5KNLA 2FBKA 3QPSA 5FFXA 2HYGD 3GLLA 5CYVA 2R7UA 3KP4A 5M5YJ 2EB7A 2V6EA 3P9CA 2DYRH 4D5CA 2EK5A 3H1CA 3F0CA 2A6EF 2E2HJ 4JK1X 4KMFA 1HKTA 2R5ZB 1UELB 1XD7A 3ZMDA 1XMKA 3ZQLA 1Z91A 4EV0A 1XC5A 3HDDA 2JMWA 4G94A 2M2EA 3M8JA 1PUEE 2EWNA 2QA4I 4XSXF 4TV7A 2V9PA 4UV9A 4LLNA 4KT5C 4IRIA 1QPMA 4KICA 2LY1A 3HG9A 2CGPA 1JTXA 1BM9A 1ZRCA 3VYRB 4V2FA 1OISA 1NK2P 2DMTA 2HVQA 5E1ZB 4RB3C 4UB6C 3LSTA 2XV4S 2MSYA 4Y3OA 3OYKA 1W36C 3GTKJ 3AL0C 2L5QA 1ZAOA 4Y52J 2JUCA 1IV8A 4JX5A 3ZQHA 1WJEA 2WAQN 1N77A 1W4MA 2CUEA 2ESHA 2B7EA 3RYRA 4JBAA 2PMZA 3BG9A 1ZR2A 3DPLC 1VNDA 4BJ5C 5IYDJ 3J81Z 3F72A 3S8PA 5FKKA 2VASA 4L5IA 4A6DA 2CSOA 2P7CB 1FX7A 4RM2A 2XUBA 1R36A 1PJRA 4LFUA 1JXSA 5JR3A 2VONA 3QODA 2CJJA 1R23A 4MGRA 1LFUP 3HIFA 4EJTA 1V5GA 4RS8A 2VUMJ 4KIGA 2DOFA 1J09A 3L7WA 3HXLA 4AU7A 1E17A 4CCNA 4DZJA 4HNVA 2CQ7A 1SD4A 3RDIA 4Y15A 3PQJA 2DYSH 5JHUA 1X1DA 3R61A 5FD5A 3CC4I 3ML6A 5FD6A 3OR2C 1FMVA 3QWLA 4E7SA 4EEFG 4ZYHA 2HXIA 1WJFA 3HM5A 1I5ZA 2KDZA 1IW7F 4IHTA 1YOVB 2HKOA 4QPQA 2WTEA 2YU3A 4XLAA 3S2DJ 3C2BA 1U78A 1B4AA 2ISYA 2OF7A 4HDUA 2MD0A 2FQ3A 4XIDA 4N0BA 1JHHA 1MBEA 2MA3A 1MW7A 2YU9J 2JPBA 1CGPA 5H6QA 2ZJRF 4IX7A 2HU9A 3FK7A 3HBLA 3P9KA 2ZXHA 3FX3A 4ENKA 4QWQA 2BHZA 2CFOA 5CVVA 2X48A 2XGXA 5CVIA 2EH3A 4IRHA 4A5MA 5HDGA 1IGNA 4I76A 4N9HA 5J4YA 4E7HA 2M1BA 5K5QA 1I3QJ 2DDBA 5IY5H 3G4SI 3CCLI 3BPVA 4XOTA 2KP6A 2Y75A 3GBGA 2FU4A 2JA7J 1BI2A 4C2MJ 4Y7NJ 1S9HA 1A35A 2CH0A 4KNYA 3JTHA 5EJCA 1T0FA 2KJCA 2VKDA 4JX6A 2WADA 2X0LA 1TNTA 1U0JA 2GXAA 4BJTA 3GCMA 1D0XA 3DBHB 1MBKA 2WV0A 2WC2A 3EDPA 3A2KA 1IC8A 3HRTA 1FOYA 4JYKA 1EKEA 2KISA 3KLOA 1PVEA 2OV7A 3F8BA 2IPQX 5J1RA 1FPQA 3LSHA 3COAC 4M3GA 1ZHFA 1ETXA 5B3SH 2OCEA 3E1SA 1HXDA 3GEZA 5LGTA 5LD2C 2WB1A 1ETKA 1O57A 4P96A 3PNVA 1TWAJ 4HW0A 5KAFC 1YITI 1VQ6I 2PQ8A 5ED4A 1RETA 2M34A 2H8WA 3C3WA 3EUHC 1T6SA 1FWZA 1YW9A 1FOKA 3QP6A 2DA3A 5AIQA 1P4XA 5E1WA 5KHDA 3LSRA 1ZLJA 2L54A 3WG7H 2FSWA 4G7ZF 2WBMA 3ROUA 4L9VA 3HC7A 3ZPLA 1UFMA 3ZGKA 3PSFA 1HDDC 3OS2A 5KAIC 1IN4A 6PAXA 4M6YA 3GLXA 1OYYA 4BAYA 2IRFG 1OCTC 1I1SA 1YLFA 2P8TA 1A6QA 3LSIA 4EMSA 2VPLA 3HPHA 3RTRA 4EGZA 2QLZA 2D1HA 2XPVA 5D4RA 2DT7B 5CVJA 4EJOA 2BY1A 3JRBA 3Q3SA 3W2WA 5E3NA 3GTPJ 4QTRA 4K2EA 5GAGJ 5HOOA 1XSDA 3DP7A 3DPUA 3TOBA 2KMUA 2AXTC 1FJLA 2P4WA 2HXOA 4D5FA 1FIAA 1ZARA 3KETA 3ELKA 3GVAA 1Z3YA 3TO7A 4IHSA 1FLIA 5F0HA 1HW1A 3J80Z 2X1DA 5E8IA 2FOKA 1DU6A 4MEYF 2M9HA 3Q9VA 1Z6TA 4DJAA 5IPAA 4B09A 3GX4X 1VQMI 1DU0A 4V2GA 5C4XJ 3RZOJ 4M6XA 4KFCA 3LA3A 1T08B 1R1UA 4BXUA 1TL8A 4CUGA 5IT3A 2XAJA 3SXYA 1USSA 3S16J 1DQUA 2OQGA 2Z9OA 3TW7A 4BEHB 3B6CA 1KQ9A 3LSMA 2W24A 5H2FC 4JOMA 3Q5FA 1GV2A 2O3FA 2GA1A 4KITB 5JFRA 5EG0B 3OWTA 3ULQB 3FMSA 2H09A 1Y1VJ 3HHGA 2QGUA 3EUHA 1HLVA 3CCQI 4LK1F 2OZUA 1PP8F 1OQYA 2X6XA 1Z0XA 1X3WB 1YHQI 3QRFF 1VQNI 1MZBA 4CO8A 2Y69H 4RB0A 2QSHX 3K10A 4BU2A 2DFFA 5GTIC 3DFGA 3DV8A 1MNMC 1KGSA 1YX5A 3N4MA 2JJ7A 3K4NA 3BC8A 1NG6A 2CQNA 2ID3A 2ZCWA 2DDAA 1UHWA 1WVRA 5L3GA 2KRHA 1W36D 2K4JA 3HKZN 1Q1VA 2RAEA 2XF7A 1R58A 2EZKA 1XB4A 1IN8A 2GWRA 4XRSA 2NVTJ 2E34A 5ICEA 5D8KB 2XGDA 1O4XA 3OV8A 3F8CA 1YIJI 5DD8A 3D5LA 3ZMTA 4YIIA 2NVUB 2EV5A 3UR3C 2GIVA 1I6XA 1FBSA 3MAJA 3JRFA 4I09A 1GT0C 5DDGA 4PFPA 1H8AC 1APLC 3A01A 1OCCH 4I0AA 3M7GA 1JKOC 1JI8A 1XCBA 4O3MA 4XM3A 4BEHA 2LOOA 3OY9A 2PJRB 4H4KC 4NUBA 3HUGA 4A3BJ 2GA2A 3IP4B 2XDVA 2VE9A 1SD6A 1T33A 3BR3A 4M71A 3TDZC 4EM0B 1FT9A 4DYQA 4Y13A 3RSNA 3JAMK 4H0EA 1HOMA 1U9NA 4CICA 1XGOA 2XPWA 1HF0A 1JGGA 1HCRA 3KCCA 4KN4X 3KYDB 3FBNB 1UHMA 1RUNA 1RR8C 4DOZA 3H36A 5F1JA 1KONA 5KVRA 3BTCA 2KJBA 4LB6B 3DXJF 3LSKA 3HSRA 3OIOA 4D7MA 3FXRA 2MFZA 2K40A 3W3CA 4WX9A 3HOXJ 1NK3P 1X4PA 3PFIA 3V7CA 1IV6A 3HOZJ 1HSJA 1LEBA 5HODA 4HZFA 1G59A 2R7FA 4RB1A 3DTEA 3AG4H 3DU6A 1R71A 3AFHA 1FYMA 2VJJA 2FF4A 2ZNZA 1DGRM 4AYBA 4IZZA 3K4MA 1E2XA 1P6RA 1YW7A 2K3FA 3U1KA 2BW3B 4XKWA 2BVMA 4ABZA 2Y9ZA 4XLEA 4IRGA 2IA1A 2HFHA 3OS0A 4A3IJ 4B4CA 2ECCA 3T5XA 1QBJA 4DZPA 1T2KA 5EDNA 4XRMA 1EF4A 1QHHD 1ZGWA 4ASNA 1G2HA 2BBYA 4F7ZA 1LDKB 3JTGA 5C4JJ 2DT6A 3H0DA 3HSFA 1D0ZA 3LQQA 1HDPA 1H89C 3WGIA 2A05A 4UXNA 1LFPA 4LG0A 4DIQA 1CQTA 2VT3A 1Y0UA 4OINF 5H20A 2VLAA 1KU2A 2Q2EA 5DEQA 1IUFA 1TT0A 1SAXA 1J9IA 2DA2A 1WRJA 4ZTJA 3GO5A 2EFPA 3FISA 3CMYA 2F4MB 5CQEA 4G12A 1V5FA 3NEUA 2HEOA 3I3LA 2NNNA 1G8XA 3M8FA 2GOMA 2R7SA 1ETYA 1YRNA 1WI3A 4DYCA 4RGSA 4XKVA 2EZIA 2MD5A 2HWVA 2R3SA 4KN7X 1FBQA 3IKTA 1IXSB 4CYCB 4XOPA 2DW4A 3BR0A 3MZHA 1B8IB 1KQ8A 2DFEA 2AHQA 2XRLA 2CYYA 1LEAA 1JHFA 2R7XA 1B9MA 2VC0A 5F04A 4Y4RA 1P7JA 3PSIA 1IAWA 5DV5A 1XGMA 3TL4X 3ZOBA 1MDMB 2DFIA 1BIAA 2K02A 1DDNA 2F4OB 4IHWA 3SFZA 3O2PE 3HRSA 4P1WA 3F3XA 2VE8A 2O8KA 2DOEA 3LSPA 1OLTA 2LLKA 2KQRA 3N97A 1J75A 2X1EA 3HL2A 4HYEA 1W5TA 4M74A 3VYUB 2VQGA 3H5AA 3BOQA 1X3ZB 3ZMUA 3CJRB 2XAHA 4WCGA 3IL2A 4NBQA 3RQIA 3CD6I 4U0VA 4WXDA 2E7WA 2V4JC 3H92A 5J47A 3KYCB 4AM3A 1TZLA 3Q0VA 2V26A 1ORKA 3F8MA 4BBSJ 3I4NJ 4GRIA 3H35A 2JK3A 4IKFA 2A68F 4GO1A 1T95A 4BY7J 3S93A 2W85A 1TWHJ 3ZRGA 1ZG1A 4ESJA 4RGUA 3JAMZ 3OR1C 1K6OA 1X2MA 3DLAA 1BL0A 1RESA 2G9WA 1BR1A 1U5TB 4ITVA 2O5RA 2VC1A 4HX8A 4RM3A 2JA5J 2XC7A 3CCSI 3WGHA 2HS5A 1S7AA 1FOWA 5D5WB 1K78A 5LEJA 1U6GA 3S32A 4ZC3A 1Y39A 3DBLB 1WZ2A 3FXOA 4KMUX 1WWXA 3BDDA 2QF7A 3CF2A 4FT8A 3S1QJ 3Q0WA 2ZSHB 2E1MB 2CUFA 2D5VA 1U5TC 2R93J 2QEXI 3DQVC 1VQOI 3WTXC 4NQWA 4BXFA 2ZJQF 3FWEA 2IS6A 3KE2A 3FBIB 2CV0A 1ZREA 3LSGA 4ON0A 3ZCOA 1YS7A 1X3UA 1XDUA 1VQPI 3SZPA 3ABTA 5E79C 1DPRA 4BE1A 1JGSA 4LJZF 1WH7A 2WY8Q 2FRHA 3KZZA 3PFYA 4R79A 1LVAA 3LOCA 2BXYA 4OIOF 2O03A 3MQ0A 3C7JA 2PJRA 4HF1A 2UV1A 4I99C 1YJNI 2ZMEA 2N8GA 3KZYA 1WPKA 2LKSA 2A69F 2E7XA 4PJMA 3L2WA 1TC3C 3WTWC 4KDPA 1KU3A 2IGMA 1H9TA 3HGGA 1Z05A 2H94A 1XSVA 2FEZA 5M5WJ 1G3TA 2Y0SN 2MLKA 1L0OC 1XS9A 1WJDA 1V54H 3KEYA 2R7WA 1S7EA 3QOEA 1QU3A 4A3JJ 3IH3A 3L09A 4I02A 3VODA 4WK8F 2BZTA 4UUSB 1DPUA 1WHUA 2CFXA 3K1MA 1YX3A 1UZCA 1ZKGA 4KA4A 1ETQA 2X1CA 2XGCA 3BG6A 1D8KA 2E1CA 2I5UA 1D5VA 1TBXA 5CVRA 5HLHA 3U2RA 1BI1A 1XX5A 2M7BA 2VJIA 3CQZJ 1TTYA 2R7DA 4A93J 2JSPA 2W00A 2XPUA 3M8EA 2LF8A 5F0FA 4HA8A 4HG2A 5BOXA 3QYFA 1OFCX 5DCMB 2FOWA 1SFKA 1VQKI 4JP0A 5F0CA 2M30A 2Y9YA 5IP6A 3DTIA 4GFBA 3NARA 2H27A 2IGNA 4LITA 2VXDA 4BJ6C 4ZYEA 1UG2A 3CCUI 4B1RA 1CF7A 4YG2F 5E17F 1IRZA 3IAM2 5HS9A 4J19A 5B66C 2FX0A 3IRQA 1XGNA 4F91B 4EVIA 4HX7A 3C2HA 3WTZA 1ONVA 1GXPA 1B59A 1UB9A 4S0HB 4E7IA 1A04A 3BZ6A 1KU9A 4L9JA 3O8GA 2KL4A 4ANJA 1U8BA 1ZTRA 1QPIA 1VQ8I 5EEGA 2O9LA 2HVSA 3LFUA 5TISC 4E7KA 4KT6A 2LR8A 3P7NA 5K7FA 2VIXA 3BJ6A 2LY9A 5FLXZ 1D5YA 3L1PA 2ELKA 4MTDA 3DEUA 2RVCA 4YFKF 3QQAA 4U7BA 3OYAA 1VZ0A 1X2NA 5DUKA 3OYGA 4BBRJ 4CGZA 4L5JA 3OL4A 1T39A 2ZB9A 1WGXA 3LAJA 3T8TA 3UNGC 4MLOA 2JRTA 5CJ9A 3NWSA 5IOYA 2PI0A 1TP4A 5FKOA 2CW0F 1G6NA 1RPWA 4O5VA 5BPIA 4D0PA 1MJAA 3NAUA 4M9ZA 3IHUA 3GTOJ 4QIWN 3ZN0A 5FKNA 3I64A 5ICFA 2RC4A 4XQFA 3EQLF 2R7TA 2NYXA 3VPRA 2JN6A 1LE8A 5M3FJ 2NAZA 3LA2A 5LEKA 1P4WA 3TOAA 3HOVJ 4A69C 5M5XJ 3KP7A 4PCQA 4XLHA 1OJLA 2LVSA 3HRMA 4GCVA 3ZQGA 5L3EA 4S05A 3I56I 4G9YA 2UXNA 2LBFB 3K1NA 2EV0A 3QOPA 1VQLI 2GM4A 1W5SA 4CYDA 3ZP5A 5C44J 3PUBA 1W5CC 3T1BA 3L9FA 4HV5A 2IVMA 4U88A 1XSXA 3OYCA 2JSCA 1D1CA 1WJBA 2M87A 4LG3A 2M5WA 3HOWJ 3CJQB 4LLLA 1RI7A 2HZDA 1WCMJ 1R22A 1K4TA 3E6CC 3R0JA 2V1XA 2XAGA 1X58A 2WB1N 2W82A 3F9KA 2VOOA 1Y8RB 5HLTA 1MMNA 1ON2A 2EQRA 2EZHA 3DKXA 4XONA 4MO7A 4FX4A 1LFBA 3GTJJ 2DXIA 4FQGA 1I39A 3W6VA 3FHNA 4OAZA 2GXGA 1TQMA 2E19A 1MBHA 3OS1A 2LNBA 4AIHA 3S15J 4KUMA 1X1PA 4RLFA 1YRNB 2HTSA 1RKWA 2DLLA 1REPC 3T8RA 2H8RA 4CDGA 4C3IJ 5LGUA 3MVPA 5HDNA 2A61A 1F43A 3FXMA 1POGA 1ENHA 2DTRA 1WJAA 4KYWA 2DODA 1K83J 3A03A 1BIBA 4QSHA 4OMZA 3OYHA 3K2AA 3B02A 3RCOA 1TWFJ 4RDUA 1JKQC 3JW4A 1H88C 5E1XA 2HR3A 4G6DA 4I7HA 4A3CJ 5IT9K 1TWCJ 1VFCA 3DKYA 5KK1A 4CXFA 3S1NJ 3I5UA 3VFZA 1SFOJ 4HPQA 4RB2C 4CHUA 4BDYA 3I4MJ 3S17J 1OMIA 4XRSG 4MEXF 4W1UA 3L00A 3DU5A 2VPRA 2EPFA 2DA1A 2FUG2 3WHCA 3QPLA 3CUQB 3NWTA 2TRTA 5J8CA 1FSHA 1BC7C 3VSKA 1R4MB 1MJ9A 1BJZA 1W7PB 2CRGA 2EIMH 4RGRA 4XNFA 1X19A 5EZHA 2PLYA 2E1MC 1FNNA 3I9V2 4V19K 5EZGA 5E20A 2YSRA 3K4JA 1MIJA 2B63J 4LLGF 2XB0X 2Y0MA 1ERDA 1ZRDA 4IF4A 1S8NA 4RAGA 2O8XA 1GVDA 4A3EJ 2VKEA 2RQPA 3ZQCA 4OIQF 4F93B 1SFEA 5HS8A 1R4NB 1MH4A 2CMPA 3RPUD 2HOAA 2VBXA 2HQAA 3E6MA 3GF2A 1VQ9I 2CO5A 2UXXA 4U0WA 1RUOA 3I71A 3KLNA 3G1OA 3QPHA 1JUPA 4L5EA 5FLVA 2YPRA 1W7PD 2R7QA 4BY1J 1MNEA 5GAHJ 1WI9A 3E5QA 4HEA2 1IN5A 5BNGA 4HV6A 3CP2A 4BL0B 2HNHA 2V6CA 3CZ6A 2IBDA 5EGOA 2KZGA 2ISZA 3DLLF 2ELJA 2IEKA 1EH6A 2QVOA 4ZZLA 2YX4A 3HB9A 3FIWA 9ANTA 4Q5SF 2XF5A 2JVHA 1WKMA 4XLNF 2ME0A 3GUDA 1HC8A 4N9IA 4OAYA 3I4PA 1K6YA 5CLSA 3CMMA 2NRAC 4J01A 2EV6A 5HNFA 1GHCA 2A5YB 1KU7A 3F22A 3TGNA 4HNUA 4X1EA 2IS1A 2E5NA 1LNWA 2XAQA 5L3CA 3JRDA 1FOXA 4Y33A 5ICCA 2ADUA 2P6TA 2B0LA 2R4GA 2ID6A 3OYLA 4AIJA 2LSOA 3CLOA 4MTEA 2M8EA 1IN7A 4ZH4F 1T38A 5EEHA 4EJVA 1B72A 4GYGA 2IS4A 4HBLA 1ODDA 3P9IA 4W97A 1ZLKA 1SEUA 1I3AA 2DFHA 4CCKA 2K85A 2AXLA 1OCOH 4N4NB 2F5FA 5HLIA 4AVZA 2KRFA 3EYIA 2L9RA 4PSWA 5BPDA 4IXAA 2Z5UA 2G7HA 1MGTA 2KPMA 5GPAA 1JTYA 4A5NA 2BY2A 2A6TA 1XN7A 2ZBKA 2WWYA 4E4HA 1SC7A 5ILSA 2VJ4A 2CS3A 2E1OA 1PUFB 1G3WA 3R60A 4ZYGA 4A3FJ 1GUUA 2BOLA 3TMOA 2Z16A 2LMDA 1R5ID 2EA2A 4KIFA 2CU7A 2K5CA 3E7LA 1ZR4A 5B1BH 2HOSA 2JA8J 2R7VA 3W6KB 2DU9A 4A6EA 3FK6A 5A2QZ 4HRIA 1IXCA 2DMPA 1NH3A 2L9VA 2X51A 2XIGA 5D5XB 1P92A 4E6KG 3CTAA 3TO9A 5LRSA 4RA2A 4ENMA 3K70D 3W2VA 4II2A 4Z2YA 3ABLH 4NC8A 2HPIA 2F5CA 3R4KA 3KYLA 2MC3A 4I0BA 4FCYA 1OPCA 1TT5B 3J7AY 3V8KA 3GZ6A 1ZK8A 1O7LA 2DA7A 2DI3A 1WQ2A 2W84A 3HOUJ 5BS6A 2Q1ZB 4AYBN 1VQ5I 2A5WA 3EYYA 1B9NA 2JRMA 5F6FA 1NG7A 5GADJ 3E5UA 2LF7A 1B1BA 5DUIA 1BN5A 1UJ8A 2DJNA 3U21A 2CW7A 3BJAA 3CF5F 2QBYA 1OR7C 3TEDA 4HSRA 2ZC2A 2HQ5A 2DOAA 1AA7A 2F48A 1G3YA 1MDMA 4FETA 2Q8KA 2RNJA 2R5YA 1IF1A 1O7FA 4M3BA 2FMYA 2MYSA 2EINH 1IUYA 1NHAA 2MGQA 3GXOA 5J8FA 1Y0NA 3PL8A 4N4OB 2A07F 1LPQA 2M8GX 4Q47A 2BYVE 1KA8A 1VF9A 2IA0A 3BQZA 3I58A 4CYCA 4ESBA 1BR2A 4ETSA 5A2QK 3SFIA 4DBRA 4G6QA 1N78A 1SFXA 3GTMJ 1SVMA 2EZLA 1AWCA 4OMYA 1GLNA 2YUSA 2MBFA 1K7AA 4ZYDA 1R00A 1TNSA 2VBYA 3PUFA 4I2OA 3BY6A 3FKIJ 2L7FP 2WAFA 1XPXA 3C2GA 2QKMB 1FSEA 1LKXA 2RKHA 2WV1A 1V5EA 1OYWA 2F5EA 3BG3A 3S2WA 3HZJA 4BUPA 4DBQA 1LVKA 4KIBA 2E2IJ 1TW2A 1XGSA 3KP6A 1BW6A 1FBUA 2P5VA 1HW5A 4GDFA 1IRXA 5FGMA 4XLFA 1MBJA 3HOTA 2KIMA 5FKMA 5KCMA 2NVXJ 4PJJA 2OU2A 4XK4A 4PGGA 1MBGA 2CV2A 4BDZA 1RKTA 3IRRA 4PJ0C 3ZN1A 1YO5C 4L18B 1SFUA 2XGEA 3GFMA 2NXNB 3A0HC 3BTLA 2R7RA 1W7PA 2XRNA 3ZQQA 5HNHA 3V4GA 1MMSA 3OOUA 1LE8B 2FMLA 5LBQA 2M4GA 5ICGA 2DTZA 2QBYB 4C2TA 2P0WA 3MKWB 4LIUA 2RREA 2JT1A 2E5ZA 1E0EA 4RMNA 3D5SC 3E6BA 2R0QC 1FC3A 5F08A 1HW2A 3F6VA 3EUAA 3GWZA 3U1DA 3ERMA 2QQAA 3MMYB 2FD5A 4C3HJ 3SZGA 3JCUC 1LUJB 4FE7A 3PO2J 1HBXG 2IT0A 3PIPF 1R1VA 2QCOA 3WE3A 2QQBA 3SQNA 4BKXA 4S04A 3ZQIA 4M3EA 1Y8QB 4DW6A 2P5LC 3FM5A 3LMMA 2JZYA 2K9LA 1TWGJ 2W57A 1G4DA 2VBWA 4LGWA 1ACIA 3FM3A 4C9YA 2LYCA 4Z6YA 3KX2A 1ETWA 3GZNB 1Y56A 5E3LA 1CF7B 3M4OJ 2MC4A 4HNTA 2FE3A 1MMAA 2FXAA 2OTJI 1IDYA 4WXCA 2OD5A 2V9KA 3J80K 1A31A 1JKRC 3IUOA 3TO6A 3RZDJ 1H9GA 3E97A 5DD4A 3H5RA 2L0KA 1VI0A 3I59B 5DS9A 2DA4A 1FYLA 2EFNA 2KRCA 1OYIA 2K27A 4UHTA 1QZYA 3K4CA 5DM6F 1FEXA 4HAMA 2XKOA 2J5PA 4OIPF 3ABMH 2EA4A 2M0MA 1QRYA 3LFKA 4CZCA 5TGTA 2V1UA 3BWGA 3TDUC 1U3EM 3NRVA 3GTQJ 1HKSA 2K3PA 4P55A 3SJMA 3D0SA 3K4LA 3ERED 5GAEJ 2HPMA 1AKHA 2K7LA 2DK5A 2D45A 4EQQA 4FASD 2VT2A 4M3FA 3BQYA 2KIUA 1DP3A 2OQRA 1Z9CA 3RPUA 3FHZA 3HRUA 1DUXC 2OAZA 2UWMA 5FLXK 4BQAA 2CV1A 1HA8A 1OCRH 2ZFUA 4UB8C 3PM1A 3IKVA 3FKJA 1EV7A 1EH7A 3L2QA 1ETVA 2X85A 4QPOA 2DBBA 2V7FA 4P9UA 1SAUA 1F36A 2JWTA 2QENA 3RKYA 4LIVA 2DJIA 4X6AJ 2VOPA 4MQVA 4U7DA 3Q9SA 2Y0SA 1LDDA 2BEOA 3RKWA 4DQ2A 3PO3J 3HOSA 3QYEA 3F6OA 5FFZA 2QSGX 2EFQA 4BQQA 3HGYA 1ZGAA 3NQOA 4FISA 5TJJA 4HSTA 4ZTFA 2COMA 3VYTB 5K5OA 3DWLE 5TRDA 1S72I 1IDZA 2LY2A 4QLCU 2L01A 1YQAA 2NS8A 5IP9J 5ILUA 2XSJC 4E7ZA 4YFNF 1JE8A 2V1DA 5IYBJ 1HSTA 3LL7A 5FJ8J 1QZZA 4EATA 1IXRC 2E1NA 2HOEA 1EH8A 2MH2A 4A2UA 2KDOA 1UAAA 4XR6A 2MW8A 1YTYA 1F5TA 5IOZA 2JA6J 2LTPA 2PMHA 1J0RA 3MKYB 1A36A 1ZELA 5LGNA 1GDTA 2EBIA 2XVCA 1PUFA 1JJ8C 2HDCA 2HQRA 2LRDA 5M3MJ 3H0GJ 4UVBA 3J7ZI 2QZ8A 2AS5F 2DMUA 4PDKA 1LJ9A 2M45A 2A3SA 1XCVA 2ZSIB 3GFJA 4ZDPA 5DCMA 1QO0D 2BVLA 5FLMJ 2Y31A 1BOAA 3MKLA 2LREA 1QNTA 3ABUA 4RAYA 2NOJB 1N75A 1T8IA 1LB2A 3K0LA 1FY7A 3AG2H 3R6SA 3JSPA 4CCMA 2OZ6A 2HKXA 4CSWA 4UVCA 2W7NA 2WA0A 1MSEC 3RKXA 1FP2A 1KYWA 3CDHA 2PX9A 5FRNA 2L7KA 3CMEI 1RZ4A 2PN6A 3K7AJ 4A0ZA 1IO2A 2Z99A 2OUMA 3PNTA 1ZQ3P 2DT5A 4R1HA 3G6EI 2HZTA 2JVGA 4CCLA 2V79A 3HTUA 5FKLA 4C3JJ 1X1AA 2LG4A 2GOXB 1BOBA 1E3PA 4XORA 2RQQA 2QUFA 1B8IA 3FXUA 2FBIA 3M1CA 2OPTA 3TBIA 5IT9Z 4IJAA 1EJ9A 5LHIA 3K9TA 1SD5A 2G7UA 4ZYAA 3CCJI 3F8NA 4P5OA 2ZFWA 4BE2A 5EGOB 4AIDA 3WTUC 4G7HF 3I55I 1YW8A 3DKWA 3MWMA 3J81K 1UG0A 2BY3A 3CDIA 4R8HA 3JSOA 1TQIA 3K2ZA 4LD5A 2JUGA 5J4VA 1OCPA 1D3YA 5LLQA 1W0TA 3ISPA 2Y30A 1QVTA 3R0AA 1Z21A 1FZPB 2QM3A 5IP7J 1JUSA 3J7YJ 4EGYA 1F9NA 4XKCA 5BMZA 3ECOA 4EM2A 2TCTA 2VQLA 2P7VB 3BJOA 3CP8A 1BC8C 3VYSB 5B5EC 1MMGA 2E35A 3JRIA 2KIFA 2IW5A 1D8JA 3CCRI 3OYEA 2GXBA 4OIRF 1TW3A 3RKQA 5HDKA 4F55A 3C1DA 3O3KA 4MFEA 2H1LA 4NC6A 3OYDA 4BACA 1B72B 2XF6A 2XAUA 3G73A 4BH9A 3MFKA 3ABKH 1S3JA 3K4KA 4M6VA 1ZG5A 3HTSB 3HOYJ 1I27A 2OBPA 4MNUA 3ZMSA 3S1MJ 2O6GE 2J5OA 3CJNA 4GYIA 2DN0A 1R5HA 3ZR8X 2WAQA 3A1YA 4G6TB 4M9SA 3W2AA 2W1OA 3BLYA 2Y48A 4L0ZB 4FX0A 1MD0A 2PMZN 2RN7A 2H1KA 4L9TA 3SYTA 2IXSA 3KP2A 3G1MA 2HVRA 2VODA 1WJ5A 2FNPA 3CUOA 4BXXJ 2E2JJ 2MLGA 5D8LB 3JREA 4MQ9F 4X0GA 4D1QA 3GTLJ 3OYBA 1MH3A 1HQCA 1YJWI 5D5UB 4BNCA 1XG1A 3KEOA 1ETOA 3L2UA 3CCYA 3JR9A 5D5VB 5FROA 2WAEA 2W4SA 3SDGA 3AG1H 3ZMZA 4BHBA 2FJ1A 3MZ8A 4Q48A 5JI6A 2RNGA 2STWA 4M3DA 3T0YA 1RR7A 4CH7A 1IZ1A 4A0XA 2X6WA 4PGHA 2ZMEC 4D7NA 1J7KA 3X2QH 4MHGA 1RRJA 3QU3A 3M07A 3E0JB 2BV6A 2NS7A 1QHGA 2QKLB 4F92B 1IG7A 4PFOA 4RLQA 1S6LA 3JRGA 2LH9A 1ZYRF 2LKPA 3DPTA 4BE0A 2VN2A 2R92J 3RIRA 4FTHA 2Y2ZA 2F2EA 4JQFA 4CCOA 5J3LA 4J00A 4DGWB 4GGGA 2CUZA 3H5NA 4LK0F 4CCJA 5F1RA 2BHYA 3H3UA 2L3DA 4O6JA 5D4SA 4A3DJ 2BXZA 5L3FA 4B3XA 3CLQA 2ZJPF 1P9QC 3VB2A 2R5YB 3CCMI 4ZDOA 5GTHC 2BE5F 3LNQA 1KZHA 1Z67A 3WHBA 5FRMA 1O3QA 3VEPA 4IVNA 2R5ZA 1XDSA 3DCFA 2R7OA 4UV8A 2X4HA 2BGCA 1NTCA 5JHFA 2ZJ2A 4B43A 1JT0A 4DNCA 5JVTA 3BG7A 4B8XA 2K4BA 3GFIA 3KFWX 2HQNA 4II3A 3N05A 4MFDA 2Z1DA 1T98A 2JA2A 5K1YA 4B48A 2LBFA 2DA5A 4IPAA 3REOA 5K5RA 3BPXA 3FXQA 3MN2A 2W48A 1AOYA 2W25A 2F4IA 3GZ5A 4ENJA
chains in the Genus database with same CATH topology
1ORKA 2R5YA 4BBSJ 3I4NJ 4FE4A 4M3BA 2JK3A 2MGQA 2K9QA 4BY7J 1JTXA 1TWHJ 3Q0UA 4V2FA 1NK2P 2DMTA 2LKXA 1BL0A 1X2MA 2M8GX 1RESA 1VF9A 2MSYA 3BQZA 4CYCA 5DTDA 3SFIA 3GTKJ 4Y52J 2JA5J 4JX5A 3ZQHA 2WAQN 2CUEA 3BR6A 3GTMJ 3BG9A 1ZR2A 4IHVA 2EZLA 1VNDA 2YUSA 2QF7A 3S1QJ 3Q0WA 2R93J 2CUFA 2D5VA 5IYDJ 2IAIA 5FKKA 3FKIJ 2L7FP 3JRHA 5EF6A 2WV1A 3BG3A 3LSGA 2CJJA 1LFUP 5JLXA 2NVQJ 2E2IJ 1W0UA 2VUMJ 3A02A 1BW6A 1WH7A 1IJWC 5C3EJ 1MBJA 3LOCA 4DZJA 5FKMA 4HNVA 2NVXJ 1JJ6C 4XK4A 1MBGA 2N8GA 1MBFA 1RKTA 1WPKA 2XGEA 2X6OA 2G0EA 4EEFG 1Z77A 3A01B 1TC3C 2HXIA 3BTLA 3HM5A 1K61A 2KDZA 3HEFA 3HGGA 3OOUA 1LE8B 5J1YA 5M5WJ 3ZQFA 2Y0SN 3S2DJ 3C2BA 1XS9A 1U78A 2DTZA 2OF7A 1S7EA 4A3JJ 3IH3A 4XIDA 1AKHB 2CQQA 4A3MJ 1MBEA 4UUSB 2R0QC 2YU9J 5F08A 1ZKGA 5IYCJ 1ETQA 2XGCA 3DEWA 3FK7A 4C3HJ 2FD5A 3HBLA 1AU7A 2HYJA 3CQZJ 2K9NA 2NVYJ 4UUSA 2X48A 3M3YJ 4A93J 4FE7A 3PO2J 2XSDC 2EH3A 2XPUA 2QCOA 2I10A 1IGNA 4I76A 5F0FA 3OSFA 2AO9A 1I3QJ 1OFCX 1Y1WJ 2GBYA 2L7MP 4JP0A 4BKXA 2JA7J 3GBGA 1BW5A 3ZQIA 3IH2A 4M3EA 5F0CA 4C2MJ 4DW6A 4Y7NJ 2HOTA 2XB5A 2Y9YA 5IP6A 4GFBA 3NARA 4JX6A 5EG0A 1TWGJ 1UG2A 4B1RA 1MBKA 1IC8A 1IRZA 1ETWA 4J19A 2FX0A 3BTIA 4JYKA 5E3LA 3M4OJ 1WH5A 5J1RA 1BA5A 1IDYA 4S0HB 4M3GA 1QPIA 2MG4A 1JKRC 3O8GA 1ETXA 1U8BA 1ZTRA 3RZDJ 2O9LA 1U9OA 1ETKA 3BR5A 2LR8A 1TWAJ 2L0KA 5K7FA 1SANA 1VI0A 2LY9A 1D5YA 3L1PA 2ELKA 5DS9A 1RETA 3QQAA 2DA4A 2M34A 2GLOA 1GV5A 1X2NA 4UUTA 4BBRJ 2DA3A 4DYRA 3GTGJ 2ZB9A 1WGXA 2HI3A 1FEXA 3LSRA 4MLOA 1FTZA 5IOYA 1QRYA 2L7ZA 5FKOA 1HDDC 3BR1A 4A3LJ 1RPWA 3GTQJ 3SJMA 1MSFC 3NAUA 3GTOJ 1A6IA 4QIWN 1AKHA 5FKNA 3CDLA 3VPRA 2JN6A 4M3FA 1OCTC 1LE8A 5M3FJ 3BQYA 3HOVJ 4A69C 5M5XJ 1OJLA 3PM1A 3D1NI 2LVSA 2XPVA 3ZQGA 1ETVA 4XICA 2DA6A 3JRBA 3Q3SA 5E3NA 3GTPJ 4QTRA 1F36A 2JWTA 2X9DA 2GM4A 4X6AJ 1R9TJ 1FJLA 5C44J 2HXOA 4D5FA 4IHYA 1FIAA 3PO3J 5JLWA 5F0HA 2COBA 3S2HJ 3HGYA 1DU6A 4FISA 3HOWJ 2M9HA 5IPAA 5J1UA 3JRCA 3IV5A 4IHXA 1IDZA 1WCMJ 1DU0A 4V2GA 5C4XJ 2NS8A 3G1LA 5IP9J 1A5JA 1X58A 2WB1N 3RZOJ 2ECBA 2EQRA 2EZHA 4MO7A 5IYBJ 1T56A 1LFBA 3GTJJ 5FJ8J 3W6VA 2E19A 3S16J 1MBHA 3S15J 1YRNB 2K9SA 1RKWA 4LOCA 2MW8A 3TW7A 2H8RA 2KT0A 5IOZA 2JA6J 3B6CA 2LTPA 4C3IJ 1FIPA 3MVPA 3OSGA 2EBIA 1GDTA 1GV2A 4AC0A 5EG0B 1POGA 1ENHA 1PUFA 1JJ8C 1F43A 1Y1VJ 5M3MJ 3H0GJ 3TP3A 5GPCA 2DMUA 1HLVA 1K83J 3TP0A 2LP0A 2FQ4A 3A03A 2YS9A 3TW6A 4QSHA 1Z0XA 5FLMJ 2Y31A 3K2AA 3MKLA 1TWFJ 4RDUA 1JKQC 1H88C 1ITYA 4A3CJ 2R7ZJ 1TWCJ 1MNMC 1VFCA 2JJ7A 3S1NJ 5GP9A 1AHDP 2ID3A 2M0CA 1MSEC 2LD5A 1SFOJ 2DMQA 5K7ZA 1Q1VA 2RAEA 3HKZN 2EZKA 3I4MJ 3BTJA 4XRSA 3S17J 2NVTJ 3K7AJ 4XRSG 4W1UA 2XGDA 1O4XA 1ZQ3P 2VPRA 5EYRA 2DA1A 3WHCA 3QPLA 5FKLA 4C3JJ 2TRTA 3JRFA 1GT0C 1APLC 4RBOA 1BJZA 2CRGA 1H8AC 5EZHA 3A01A 1B8IA 1JKOC 4NDLA 4AUXA 2OPTA 5EZGA 4A3GJ 3O8HA 2B63J 1UMQA 5E3OA 2XB0X 2DMNA 2LK2A 1UHSA 5EGOB 4IEJA 4A3BJ 2ME6A 5K7HA 1GVDA 4A3EJ 2VKEA 3ZQCA 1FTTA 3UKGA 1T33A 3BR3A 1MH4A 3S14J 3BT9A 1OCPA 2HOAA 1W0TA 4I6ZA 2Y30A 1QVTA 4DYQA 3IH4A 1JUSA 5IP7J 3LSJA 1HOMA 1U9NA 3G1OA 2XPWA 1HF0A 1JGGA 1HCRA 1JUPA 2TCTA 3B6AA 4L5EA 5FLVA 4BY1J 3BG5A 4A3KJ 2VI6A 3JRIA 5F1JA 3RKQA 2O7OA 3BTCA 5BNGA 1P7IA 5EGOA 2IBDA 3OIOA 4D7MA 4MFEA 2IEKA 2K40A 1B72B 3HOXJ 1NK3P 1IV6A 3HOZJ 3HB9A 3FIWA 9ANTA 5HODA 4M6VA 3HOYJ 2ME0A 3S1MJ 1JT6A 3BR2A 2DN0A 4X1EA 4ABZA 2PMZN 2Y9ZA 2H1KA 3JRDA 3G1MA 4A3IJ 4B4CA 2ECCA 2VKVA 2E2JJ 4DZPA 4BXXJ 3JREA 2ID6A 5EDNA 1I6HJ 4XRMA 3GTLJ 1MH3A 3H3VK 2LFBA 1EF4A 1XG1A 1ZGWA 1B72A 1G2HA 1ETOA 4W97A 2NOGA 3CCYA 3JR9A 5C4JJ 1I50J 3SDGA 1HDPA 1H89C 2FJ1A 4M3DA 1CQTA 2L9RA 2P81A 1RR7A 1IUFA 3S1RJ 2DA2A 5GPAA 1JTYA 4D7NA 3FISA 3CMYA 1QVUA 2NS7A 2E1OA 1PUFB 4G12A 4MIMA 1IG7A 4A3FJ 3JRGA 1E3OC 1GUUA 1JKPC 2R92J 5EEAA 3JRAA 4FTHA 1ETYA 2CQXA 1YRNA 1WI3A 2Y2ZA 2CU7A 3E7LA 4DYCA 5J3LA 1ZR4A 2HOSA 2JA8J 2EZIA 3FK6A 2DMPA 1JUMA 4CYCB 5E3MA 4JX4A 4B3AA 5F27A 3BR0A 1B8IB 4A3DJ 2AHQA 2XRLA 5F04A 1P7JA 2HDDA 4FCYA 2R5YB 3ZOBA 1ZK8A 3LNQA 2DA7A 3WHBA 4IHWA 3QPSA 3HOUJ 2R5ZA 4AYBN 3DCFA 2O8KA 5M5YJ 3LSPA 1NTCA 1JT0A 2LLKA 4D5CA 3F0CA 2E2HJ 4MFDA 2R5ZB 3RQIA 2DJNA 2DA5A 3ZQLA 3MN2A 2W48A 3Q0VA 1XC5A 3HDDA 2JMWA 3TEDA 2M2EA 2HQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORK A;  2R5Y A;  4BBS J;  3I4N J;  4FE4 A;  4M3B A;  2JK3 A;  2MGQ A;  2K9Q A;  4BY7 J;  1JTX A;  1TWH J;  3Q0U A;  4V2F A;  1NK2 P;  2DMT A;  2LKX A;  1BL0 A;  1X2M A;  2M8G X;  1RES A;  1VF9 A;  2MSY A;  3BQZ A;  4CYC A;  5DTD A;  3SFI A;  3GTK J;  4Y52 J;  2JA5 J;  4JX5 A;  3ZQH A;  2WAQ N;  2CUE A;  3BR6 A;  3GTM J;  3BG9 A;  1ZR2 A;  4IHV A;  2EZL A;  1VND A;  2YUS A;  2QF7 A;  3S1Q J;  3Q0W A;  2R93 J;  2CUF A;  2D5V A;  5IYD J;  2IAI A;  5FKK A;  3FKI J;  2L7F P;  3JRH A;  5EF6 A;  2WV1 A;  3BG3 A;  3LSG A;  2CJJ A;  1LFU P;  5JLX A;  2NVQ J;  2E2I J;  1W0U A;  2VUM J;  3A02 A;  1BW6 A;  1WH7 A;  1IJW C;  5C3E J;  1MBJ A;  3LOC A;  4DZJ A;  5FKM A;  4HNV A;  2NVX J;  1JJ6 C;  4XK4 A;  1MBG A;  2N8G A;  1MBF A;  1RKT A;  1WPK A;  2XGE A;  2X6O A;  2G0E A;  4EEF G;  1Z77 A;  3A01 B;  1TC3 C;  2HXI A;  3BTL A;  3HM5 A;  1K61 A;  2KDZ A;  3HEF A;  3HGG A;  3OOU A;  1LE8 B;  5J1Y A;  5M5W J;  3ZQF A;  2Y0S N;  3S2D J;  3C2B A;  1XS9 A;  1U78 A;  2DTZ A;  2OF7 A;  1S7E A;  4A3J J;  3IH3 A;  4XID A;  1AKH B;  2CQQ A;  4A3M J;  1MBE A;  4UUS B;  2R0Q C;  2YU9 J;  5F08 A;  1ZKG A;  5IYC J;  1ETQ A;  2XGC A;  3DEW A;  3FK7 A;  4C3H J;  2FD5 A;  3HBL A;  1AU7 A;  2HYJ A;  3CQZ J;  2K9N A;  2NVY J;  4UUS A;  2X48 A;  3M3Y J;  4A93 J;  4FE7 A;  3PO2 J;  2XSD C;  2EH3 A;  2XPU A;  2QCO A;  2I10 A;  1IGN A;  4I76 A;  5F0F A;  3OSF A;  2AO9 A;  1I3Q J;  1OFC X;  1Y1W J;  2GBY A;  2L7M P;  4JP0 A;  4BKX A;  2JA7 J;  3GBG A;  1BW5 A;  3ZQI A;  3IH2 A;  4M3E A;  5F0C A;  4C2M J;  4DW6 A;  4Y7N J;  2HOT A;  2XB5 A;  2Y9Y A;  5IP6 A;  4GFB A;  3NAR A;  4JX6 A;  5EG0 A;  1TWG J;  1UG2 A;  4B1R A;  1MBK A;  1IC8 A;  1IRZ A;  1ETW A;  4J19 A;  2FX0 A;  3BTI A;  4JYK A;  5E3L A;  3M4O J;  1WH5 A;  5J1R A;  1BA5 A;  1IDY A;  4S0H B;  4M3G A;  1QPI A;  2MG4 A;  1JKR C;  3O8G A;  1ETX A;  1U8B A;  1ZTR A;  3RZD J;  2O9L A;  1U9O A;  1ETK A;  3BR5 A;  2LR8 A;  1TWA J;  2L0K A;  5K7F A;  1SAN A;  1VI0 A;  2LY9 A;  1D5Y A;  3L1P A;  2ELK A;  5DS9 A;  1RET A;  3QQA A;  2DA4 A;  2M34 A;  2GLO A;  1GV5 A;  1X2N A;  4UUT A;  4BBR J;  2DA3 A;  4DYR A;  3GTG J;  2ZB9 A;  1WGX A;  2HI3 A;  1FEX A;  3LSR A;  4MLO A;  1FTZ A;  5IOY A;  1QRY A;  2L7Z A;  5FKO A;  1HDD C;  3BR1 A;  4A3L J;  1RPW A;  3GTQ J;  3SJM A;  1MSF C;  3NAU A;  3GTO J;  1A6I A;  4QIW N;  1AKH A;  5FKN A;  3CDL A;  3VPR A;  2JN6 A;  4M3F A;  1OCT C;  1LE8 A;  5M3F J;  3BQY A;  3HOV J;  4A69 C;  5M5X J;  1OJL A;  3PM1 A;  3D1N I;  2LVS A;  2XPV A;  3ZQG A;  1ETV A;  4XIC A;  2DA6 A;  3JRB A;  3Q3S A;  5E3N A;  3GTP J;  4QTR A;  1F36 A;  2JWT A;  2X9D A;  2GM4 A;  4X6A J;  1R9T J;  1FJL A;  5C44 J;  2HXO A;  4D5F A;  4IHY A;  1FIA A;  3PO3 J;  5JLW A;  5F0H A;  2COB A;  3S2H J;  3HGY A;  1DU6 A;  4FIS A;  3HOW J;  2M9H A;  5IPA A;  5J1U A;  3JRC A;  3IV5 A;  4IHX A;  1IDZ A;  1WCM J;  1DU0 A;  4V2G A;  5C4X J;  2NS8 A;  3G1L A;  5IP9 J;  1A5J A;  1X58 A;  2WB1 N;  3RZO J;  2ECB A;  2EQR A;  2EZH A;  4MO7 A;  5IYB J;  1T56 A;  1LFB A;  3GTJ J;  5FJ8 J;  3W6V A;  2E19 A;  3S16 J;  1MBH A;  3S15 J;  1YRN B;  2K9S A;  1RKW A;  4LOC A;  2MW8 A;  3TW7 A;  2H8R A;  2KT0 A;  5IOZ A;  2JA6 J;  3B6C A;  2LTP A;  4C3I J;  1FIP A;  3MVP A;  3OSG A;  2EBI A;  1GDT A;  1GV2 A;  4AC0 A;  5EG0 B;  1POG A;  1ENH A;  1PUF A;  1JJ8 C;  1F43 A;  1Y1V J;  5M3M J;  3H0G J;  3TP3 A;  5GPC A;  2DMU A;  1HLV A;  1K83 J;  3TP0 A;  2LP0 A;  2FQ4 A;  3A03 A;  2YS9 A;  3TW6 A;  4QSH A;  1Z0X A;  5FLM J;  2Y31 A;  3K2A A;  3MKL A;  1TWF J;  4RDU A;  1JKQ C;  1H88 C;  1ITY A;  4A3C J;  2R7Z J;  1TWC J;  1MNM C;  1VFC A;  2JJ7 A;  3S1N J;  5GP9 A;  1AHD P;  2ID3 A;  2M0C A;  1MSE C;  2LD5 A;  1SFO J;  2DMQ A;  5K7Z A;  1Q1V A;  2RAE A;  3HKZ N;  2EZK A;  3I4M J;  3BTJ A;  4XRS A;  3S17 J;  2NVT J;  3K7A J;  4XRS G;  4W1U A;  2XGD A;  1O4X A;  1ZQ3 P;  2VPR A;  5EYR A;  2DA1 A;  3WHC A;  3QPL A;  5FKL A;  4C3J J;  2TRT A;  3JRF A;  1GT0 C;  1APL C;  4RBO A;  1BJZ A;  2CRG A;  1H8A C;  5EZH A;  3A01 A;  1B8I A;  1JKO C;  4NDL A;  4AUX A;  2OPT A;  5EZG A;  4A3G J;  3O8H A;  2B63 J;  1UMQ A;  5E3O A;  2XB0 X;  2DMN A;  2LK2 A;  1UHS A;  5EGO B;  4IEJ A;  4A3B J;  2ME6 A;  5K7H A;  1GVD A;  4A3E J;  2VKE A;  3ZQC A;  1FTT A;  3UKG A;  1T33 A;  3BR3 A;  1MH4 A;  3S14 J;  3BT9 A;  1OCP A;  2HOA A;  1W0T A;  4I6Z A;  2Y30 A;  1QVT A;  4DYQ A;  3IH4 A;  1JUS A;  5IP7 J;  3LSJ A;  1HOM A;  1U9N A;  3G1O A;  2XPW A;  1HF0 A;  1JGG A;  1HCR A;  1JUP A;  2TCT A;  3B6A A;  4L5E A;  5FLV A;  4BY1 J;  3BG5 A;  4A3K J;  2VI6 A;  3JRI A;  5F1J A;  3RKQ A;  2O7O A;  3BTC A;  5BNG A;  1P7I A;  5EGO A;  2IBD A;  3OIO A;  4D7M A;  4MFE A;  2IEK A;  2K40 A;  1B72 B;  3HOX J;  1NK3 P;  1IV6 A;  3HOZ J;  3HB9 A;  3FIW A;  9ANT A;  5HOD A;  4M6V A;  3HOY J;  2ME0 A;  3S1M J;  1JT6 A;  3BR2 A;  2DN0 A;  4X1E A;  4ABZ A;  2PMZ N;  2Y9Z A;  2H1K A;  3JRD A;  3G1M A;  4A3I J;  4B4C A;  2ECC A;  2VKV A;  2E2J J;  4DZP A;  4BXX J;  3JRE A;  2ID6 A;  5EDN A;  1I6H J;  4XRM A;  3GTL J;  1MH3 A;  3H3V K;  2LFB A;  1EF4 A;  1XG1 A;  1ZGW A;  1B72 A;  1G2H A;  1ETO A;  4W97 A;  2NOG A;  3CCY A;  3JR9 A;  5C4J J;  1I50 J;  3SDG A;  1HDP A;  1H89 C;  2FJ1 A;  4M3D A;  1CQT A;  2L9R A;  2P81 A;  1RR7 A;  1IUF A;  3S1R J;  2DA2 A;  5GPA A;  1JTY A;  4D7N A;  3FIS A;  3CMY A;  1QVU A;  2NS7 A;  2E1O A;  1PUF B;  4G12 A;  4MIM A;  1IG7 A;  4A3F J;  3JRG A;  1E3O C;  1GUU A;  1JKP C;  2R92 J;  5EEA A;  3JRA A;  4FTH A;  1ETY A;  2CQX A;  1YRN A;  1WI3 A;  2Y2Z A;  2CU7 A;  3E7L A;  4DYC A;  5J3L A;  1ZR4 A;  2HOS A;  2JA8 J;  2EZI A;  3FK6 A;  2DMP A;  1JUM A;  4CYC B;  5E3M A;  4JX4 A;  4B3A A;  5F27 A;  3BR0 A;  1B8I B;  4A3D J;  2AHQ A;  2XRL A;  5F04 A;  1P7J A;  2HDD A;  4FCY A;  2R5Y B;  3ZOB A;  1ZK8 A;  3LNQ A;  2DA7 A;  3WHB A;  4IHW A;  3QPS A;  3HOU J;  2R5Z A;  4AYB N;  3DCF A;  2O8K A;  5M5Y J;  3LSP A;  1NTC A;  1JT0 A;  2LLK A;  4D5C A;  3F0C A;  2E2H J;  4MFD A;  2R5Z B;  3RQI A;  2DJN A;  2DA5 A;  3ZQL A;  3MN2 A;  2W48 A;  3Q0V A;  1XC5 A;  3HDD A;  2JMW A;  3TED A;  2M2E A;  2HQ5 A; 
#chains in the Genus database with same CATH topology
 2DQR A;  4GXO A;  3H9Q A;  4FE4 A;  4XSZ F;  4HF2 A;  2JQ7 A;  2K9Q A;  3Q0U A;  5BQT A;  4IQJ A;  2EFW A;  3VSL A;  2LKX A;  2RV8 A;  2VQC A;  2KFD A;  4A0Y A;  5E18 F;  5DTD A;  4C30 A;  2FNA A;  3OYM A;  4ZDL A;  3WTS C;  2RDP A;  1QZE A;  2P6S A;  5HVQ C;  2F6C A;  2YX7 A;  4UVA A;  3BR6 A;  4KJZ A;  3MKZ A;  2F5V A;  4IHV A;  4BS9 A;  1ZGJ A;  1K79 A;  3SEZ A;  2UUZ A;  4F52 A;  4RAZ A;  2OTL I;  2XAF A;  1YS6 A;  2IAI A;  2MH9 A;  4XL9 A;  1P2F A;  3G3Z A;  2AQF A;  3JRH A;  2DPD A;  1Y6I A;  5EF6 A;  2ACJ A;  3CCV I;  3QPT A;  2F5D A;  5JLX A;  4IO9 F;  2NVQ J;  2QQ8 A;  4M73 A;  5JVG F;  3OYF A;  1W0U A;  3A02 A;  2PG4 A;  4IOC F;  1IJW C;  3FMR A;  3K69 A;  4YEJ A;  5C3E J;  4E7J A;  3RPQ A;  2ZO4 A;  1ZG3 A;  2CG4 A;  3FXK A;  1JJ6 C;  3E6D A;  3FMQ A;  3MZY A;  1R5G A;  2ZKZ A;  2FA5 A;  3EUK L;  4AWX B;  1WFX A;  1MBF A;  4WWC A;  1SMY F;  2IGO A;  2CW8 A;  2E36 A;  2X6O A;  2ESN A;  1Z6R A;  1Z77 A;  2G0E A;  3PQK A;  5D6E A;  3A01 B;  3KIO A;  1O3S A;  3HHH A;  1BBY A;  1K61 A;  3HEF A;  3H9G A;  1DGW Y;  2HYF A;  5J1Y A;  3LWF A;  3ZQF A;  1Z1D A;  1S29 A;  1E3H A;  3WTY C;  4NHJ A;  4PJL A;  1YG2 A;  1LQ1 A;  2L4A A;  1AKH B;  4HX4 A;  2CQQ A;  4A3M J;  3PJR A;  2OJE D;  1XMX A;  2V9V A;  2PEX A;  5IYC J;  1J2X A;  3DEW A;  2L02 A;  3OOP A;  1GVJ A;  1WSU A;  2L4M A;  4XKB A;  1YFH A;  1AU7 A;  2HYJ A;  2M4K A;  2K9N A;  1X4O A;  2NVY J;  4UUS A;  4U0Y A;  1VQ4 I;  3M3Y J;  4BGD A;  2XSD C;  2JPC A;  2VQH A;  3L2V A;  5CKT A;  1Z3X A;  2I10 A;  1YI2 I;  3WE2 A;  3OMY A;  3OSF A;  1RNL A;  3RQ4 A;  2AO9 A;  3KZI C;  3SHF A;  1Y1W J;  3PNY A;  2STT A;  3QP5 A;  2GBY A;  2L7M P;  4A12 A;  1BW5 A;  3IH2 A;  3OL3 A;  1I1G A;  2KIQ A;  2XKP A;  2HOT A;  3OIQ A;  2XB5 A;  3BZK A;  4PUS A;  2BY0 A;  5EG0 A;  2PBI A;  3WU1 B;  1VQ7 I;  4LB5 A;  2GZW A;  2L9S A;  2EFO A;  2GAU A;  3OYN A;  1YIO A;  4CA0 A;  3GW2 A;  3S3O A;  1MJB A;  3BTI A;  4BQO A;  4U87 A;  1WH5 A;  3L2R A;  1BA5 A;  1T0F C;  4XN3 A;  3J7A O;  1KQ0 A;  3FXJ A;  1QGP A;  3KEQ A;  2MG4 A;  1HKQ A;  2B9S A;  1U9O A;  3CJT B;  3ZMV A;  2LDU A;  5CVU A;  1V3F A;  5B1A H;  3BR5 A;  3IWF A;  3QAH A;  1SAN A;  2ZXI A;  4OWR B;  4YFX F;  2OC6 A;  3AAF A;  4PZJ A;  4NQW B;  3K4B A;  2EIJ H;  1OCZ H;  3ASN H;  1J5Y A;  2GLO A;  1GV5 A;  1V55 H;  3HKZ A;  3V7S A;  1BI3 A;  1RC9 A;  1ZN2 A;  3DBR B;  4UUT A;  3V7R A;  1L3L A;  2Z2S B;  4D9J A;  3DTK A;  4DYR A;  3GTG J;  2EJR A;  2DQL A;  1N25 A;  2HI3 A;  4YIR X;  1FTZ A;  1K78 B;  2PFB A;  3AL0 B;  3U9G A;  2NS0 A;  3FZV A;  2L7Z A;  5E8G A;  4A3L J;  3BR1 A;  3BRO A;  2V1N A;  3DEE A;  1U5T A;  1MSF C;  2VBZ A;  3CO7 C;  1FYK A;  1A6I A;  4HQM A;  4XLC A;  3CDL A;  1GXQ A;  2UZK A;  3K6G A;  4EJW A;  4AIK A;  3OIP A;  3A0B C;  4NC7 A;  2ELH A;  2VL8 A;  2IA2 A;  3HSE A;  3RI4 A;  1ZH5 A;  4HF0 A;  3S3M A;  1SVL A;  1Q1H A;  2CQK A;  3D1N I;  4Y17 A;  4XIC A;  1FP1 D;  1WJC A;  2DA6 A;  2K86 A;  1SVO A;  3FDY A;  1YE9 A;  1IRF A;  4Q4Z F;  2ZME B;  1YYV A;  3V42 A;  4M72 A;  2X9D A;  3EPZ A;  3GYH X;  2QSF X;  1R9T J;  1R7J A;  4EM1 A;  3I53 A;  1D1A A;  3I54 A;  4IHY A;  3HYI A;  4HLY A;  2OA4 A;  5JLW A;  3C18 A;  2LC2 A;  4NNJ A;  2COB A;  3ASO H;  3MD2 A;  4I01 A;  3S2H J;  2DAO A;  5DCF A;  3CCE I;  3F21 A;  5J1U A;  3JRC A;  3IV5 A;  4IHX A;  1KYZ A;  4I98 B;  4LMY A;  3D5R C;  1S5L C;  5L3D A;  3G1L A;  5AON A;  1A5J A;  4UY8 I;  2ECB A;  4UUV A;  2HGC A;  1T56 A;  3WG9 A;  3K70 C;  3HUG B;  5FO5 A;  2QQ9 A;  5LHG A;  2M3A A;  2I8D A;  3E5X A;  2K9S A;  3RJP A;  4LOC A;  1QA6 A;  3E3V A;  2KT0 A;  3ONQ A;  3WGG A;  4XN0 A;  1FIP A;  3LQR A;  3OSG A;  2MAB A;  3CC2 I;  1DP7 P;  4AC0 A;  2XHK A;  4YEL A;  4BYY A;  3M1E A;  1YJ9 I;  3TP3 A;  3KP3 A;  4ZJZ A;  5GPC A;  2VXZ A;  3TP0 A;  1Z7U A;  2FQ4 A;  2LP0 A;  2YS9 A;  1M1E B;  1D1B A;  1QQI A;  2D2W A;  3TW6 A;  2PJP A;  2VB6 A;  4OOI A;  4RAF A;  4IQ4 A;  1UST A;  3W6J B;  4BHC A;  4LG0 B;  1ITY A;  4OU0 A;  2R7Z J;  3K1P A;  3F8F A;  3ECH A;  4FHT A;  5LFA A;  1R49 A;  1B6A A;  4AVP A;  3CC7 I;  2DO7 A;  3P5J A;  5CPR B;  5LHH A;  1X1B A;  5GP9 A;  1AHD P;  2DPU A;  2VKH A;  2M0C A;  1D0Y A;  2LD5 A;  2O61 A;  1ON1 A;  2DMQ A;  3OYI A;  3SEQ A;  4NB5 A;  1V4R A;  2DK8 A;  3GFL A;  1LDJ A;  1MKM A;  4ZZD A;  5K7Z A;  2D1V A;  3BTJ A;  3QU6 A;  3HPG A;  2GQQ A;  3WU0 A;  2XRO A;  2IS2 A;  3TKY A;  2IP2 A;  1IN6 A;  3BCB A;  5EYR A;  3H9J A;  5H6R A;  4RGX A;  4XBF A;  3S3N A;  4XMY A;  4C2U A;  1BJA A;  2IGK A;  4ESF A;  4BHP A;  2HDW A;  3TQN A;  2OCC H;  5HS7 A;  1MMD A;  4RBO A;  1P4A A;  1ULY A;  1W1W E;  3RYP A;  4HDV A;  3LA7 A;  4EJU A;  3CMA I;  4NDL A;  5LRR A;  4AUX A;  4A3G J;  5CQG A;  3O8H A;  1OKR A;  3DF8 A;  3VDX A;  1UMQ A;  5E3O A;  2DMN A;  2LK2 A;  5J40 A;  2KLO A;  5DM7 F;  2GIZ A;  3H3Z A;  4M9X A;  2C6Y A;  1UHS A;  4IEJ A;  3BP8 A;  2ME6 A;  4B44 A;  5K7H A;  3FXL A;  4PK4 A;  3OYJ A;  5AIP A;  4BQN A;  1FTT A;  4IOA F;  3UKG A;  3VOE A;  3S14 J;  1UCR A;  4IL6 C;  3BT9 A;  1XMA A;  4YRV A;  4P9F A;  2CWE A;  4I6Z A;  3IWZ A;  4HOB A;  2DCE A;  3IH4 A;  2WY7 Q;  3O6B B;  4L9N A;  3LSJ A;  3WU2 C;  3EET A;  5F64 A;  1BR4 A;  3IC7 A;  1F1Z A;  3B6A A;  3G2B A;  4PSX A;  3BG5 A;  1S7O A;  4A3K J;  2VI6 A;  5DYM A;  2M7A A;  1C0W A;  2O7O A;  2YR2 A;  4WXH A;  1P7I A;  2A6H F;  2E60 A;  2QYO A;  4G8X A;  2KHM A;  3HJE A;  3KPH A;  1SMT A;  1O3R A;  2XAS A;  1H0M A;  2CUJ A;  1PYV A;  3I0T A;  4UNO A;  1MND A;  1PDN C;  1JT6 A;  1K4S A;  2JTV A;  3BR2 A;  3CUQ C;  2BW3 A;  2QWW A;  4CZZ A;  2TDX A;  2AQE A;  1R6R A;  4AD9 A;  4ENN A;  2ICW G;  1Z7L A;  3F23 A;  2H6B A;  2X6Y A;  2Z33 A;  1U8R A;  1BI0 A;  3KP5 A;  1XTA A;  2VKV A;  3BZC A;  2ETH A;  1I6H J;  3B73 A;  3V8J A;  1STZ A;  2ZXW H;  3CES A;  2LFB A;  3SZT A;  4KIS A;  3H3V K;  1EA3 A;  3FF5 A;  4E7L A;  1J59 A;  3VWB A;  3LAP A;  1X1C A;  2NOG A;  1RIO H;  3V8L A;  1I50 J;  2ZXJ A;  5ERI A;  2NNY A;  4L0Y B;  3ZXS A;  2O0Y A;  5D6F A;  5J6X A;  3MCZ A;  3M9A A;  5ILV A;  3I59 A;  1PP7 U;  2P81 A;  2K9M A;  3BCA A;  1R1T A;  3S1R J;  5HLG A;  2L2O A;  4YIF A;  4HQE A;  3WOD F;  2H6C A;  2ZNY A;  2P5K A;  1QVU A;  2FBH A;  3MEX A;  1F4K A;  4MIM A;  1IRG A;  2HTJ A;  3IAS 2;  3ESW B;  1E3O C;  3AKZ A;  1JKP C;  1TQP A;  2KKO A;  5EEA A;  3JRA A;  2CQX A;  2EIL H;  3ZQ7 A;  5L3B A;  3G71 I;  4XLP F;  5FB2 A;  1VTN C;  1G3S A;  2L9N A;  4XRF A;  1JUM A;  2Q0O A;  1OR7 A;  1U2W A;  4E70 A;  4JX4 A;  4B3A A;  5E3M A;  5F27 A;  2Z3Y A;  2EIK H;  1TLH B;  2IJL A;  3A4C A;  1SD7 A;  3PIO F;  1FMW A;  3WTV C;  3GME A;  4HLX A;  4G7O F;  3CO6 C;  3AG3 H;  2KZV A;  4B47 A;  3SDB A;  4F3Q A;  2HDD A;  2Q2E B;  2E71 A;  3CUQ A;  3WTT C;  3QYB A;  2VJ5 A;  1ZRF A;  3L2C A;  1O3T A;  2RGV A;  4PJN A;  2PMU A;  4WF2 A;  5KNL A;  2FBK A;  3QPS A;  5FFX A;  2HYG D;  3GLL A;  5CYV A;  2R7U A;  3KP4 A;  5M5Y J;  2EB7 A;  2V6E A;  3P9C A;  2DYR H;  4D5C A;  2EK5 A;  3H1C A;  3F0C A;  2A6E F;  2E2H J;  4JK1 X;  4KMF A;  1HKT A;  2R5Z B;  1UEL B;  1XD7 A;  3ZMD A;  1XMK A;  3ZQL A;  1Z91 A;  4EV0 A;  1XC5 A;  3HDD A;  2JMW A;  4G94 A;  2M2E A;  3M8J A;  1PUE E;  2EWN A;  2QA4 I;  4XSX F;  4TV7 A;  2V9P A;  4UV9 A;  4LLN A;  4KT5 C;  4IRI A;  1QPM A;  4KIC A;  2LY1 A;  3HG9 A;  2CGP A;  1JTX A;  1BM9 A;  1ZRC A;  3VYR B;  4V2F A;  1OIS A;  1NK2 P;  2DMT A;  2HVQ A;  5E1Z B;  4RB3 C;  4UB6 C;  3LST A;  2XV4 S;  2MSY A;  4Y3O A;  3OYK A;  1W36 C;  3GTK J;  3AL0 C;  2L5Q A;  1ZAO A;  4Y52 J;  2JUC A;  1IV8 A;  4JX5 A;  3ZQH A;  1WJE A;  2WAQ N;  1N77 A;  1W4M A;  2CUE A;  2ESH A;  2B7E A;  3RYR A;  4JBA A;  2PMZ A;  3BG9 A;  1ZR2 A;  3DPL C;  1VND A;  4BJ5 C;  5IYD J;  3J81 Z;  3F72 A;  3S8P A;  5FKK A;  2VAS A;  4L5I A;  4A6D A;  2CSO A;  2P7C B;  1FX7 A;  4RM2 A;  2XUB A;  1R36 A;  1PJR A;  4LFU A;  1JXS A;  5JR3 A;  2VON A;  3QOD A;  2CJJ A;  1R23 A;  4MGR A;  1LFU P;  3HIF A;  4EJT A;  1V5G A;  4RS8 A;  2VUM J;  4KIG A;  2DOF A;  1J09 A;  3L7W A;  3HXL A;  4AU7 A;  1E17 A;  4CCN A;  4DZJ A;  4HNV A;  2CQ7 A;  1SD4 A;  3RDI A;  4Y15 A;  3PQJ A;  2DYS H;  5JHU A;  1X1D A;  3R61 A;  5FD5 A;  3CC4 I;  3ML6 A;  5FD6 A;  3OR2 C;  1FMV A;  3QWL A;  4E7S A;  4EEF G;  4ZYH A;  2HXI A;  1WJF A;  3HM5 A;  1I5Z A;  2KDZ A;  1IW7 F;  4IHT A;  1YOV B;  2HKO A;  4QPQ A;  2WTE A;  2YU3 A;  4XLA A;  3S2D J;  3C2B A;  1U78 A;  1B4A A;  2ISY A;  2OF7 A;  4HDU A;  2MD0 A;  2FQ3 A;  4XID A;  4N0B A;  1JHH A;  1MBE A;  2MA3 A;  1MW7 A;  2YU9 J;  2JPB A;  1CGP A;  5H6Q A;  2ZJR F;  4IX7 A;  2HU9 A;  3FK7 A;  3HBL A;  3P9K A;  2ZXH A;  3FX3 A;  4ENK A;  4QWQ A;  2BHZ A;  2CFO A;  5CVV A;  2X48 A;  2XGX A;  5CVI A;  2EH3 A;  4IRH A;  4A5M A;  5HDG A;  1IGN A;  4I76 A;  4N9H A;  5J4Y A;  4E7H A;  2M1B A;  5K5Q A;  1I3Q J;  2DDB A;  5IY5 H;  3G4S I;  3CCL I;  3BPV A;  4XOT A;  2KP6 A;  2Y75 A;  3GBG A;  2FU4 A;  2JA7 J;  1BI2 A;  4C2M J;  4Y7N J;  1S9H A;  1A35 A;  2CH0 A;  4KNY A;  3JTH A;  5EJC A;  1T0F A;  2KJC A;  2VKD A;  4JX6 A;  2WAD A;  2X0L A;  1TNT A;  1U0J A;  2GXA A;  4BJT A;  3GCM A;  1D0X A;  3DBH B;  1MBK A;  2WV0 A;  2WC2 A;  3EDP A;  3A2K A;  1IC8 A;  3HRT A;  1FOY A;  4JYK A;  1EKE A;  2KIS A;  3KLO A;  1PVE A;  2OV7 A;  3F8B A;  2IPQ X;  5J1R A;  1FPQ A;  3LSH A;  3COA C;  4M3G A;  1ZHF A;  1ETX A;  5B3S H;  2OCE A;  3E1S A;  1HXD A;  3GEZ A;  5LGT A;  5LD2 C;  2WB1 A;  1ETK A;  1O57 A;  4P96 A;  3PNV A;  1TWA J;  4HW0 A;  5KAF C;  1YIT I;  1VQ6 I;  2PQ8 A;  5ED4 A;  1RET A;  2M34 A;  2H8W A;  3C3W A;  3EUH C;  1T6S A;  1FWZ A;  1YW9 A;  1FOK A;  3QP6 A;  2DA3 A;  5AIQ A;  1P4X A;  5E1W A;  5KHD A;  3LSR A;  1ZLJ A;  2L54 A;  3WG7 H;  2FSW A;  4G7Z F;  2WBM A;  3ROU A;  4L9V A;  3HC7 A;  3ZPL A;  1UFM A;  3ZGK A;  3PSF A;  1HDD C;  3OS2 A;  5KAI C;  1IN4 A;  6PAX A;  4M6Y A;  3GLX A;  1OYY A;  4BAY A;  2IRF G;  1OCT C;  1I1S A;  1YLF A;  2P8T A;  1A6Q A;  3LSI A;  4EMS A;  2VPL A;  3HPH A;  3RTR A;  4EGZ A;  2QLZ A;  2D1H A;  2XPV A;  5D4R A;  2DT7 B;  5CVJ A;  4EJO A;  2BY1 A;  3JRB A;  3Q3S A;  3W2W A;  5E3N A;  3GTP J;  4QTR A;  4K2E A;  5GAG J;  5HOO A;  1XSD A;  3DP7 A;  3DPU A;  3TOB A;  2KMU A;  2AXT C;  1FJL A;  2P4W A;  2HXO A;  4D5F A;  1FIA A;  1ZAR A;  3KET A;  3ELK A;  3GVA A;  1Z3Y A;  3TO7 A;  4IHS A;  1FLI A;  5F0H A;  1HW1 A;  3J80 Z;  2X1D A;  5E8I A;  2FOK A;  1DU6 A;  4MEY F;  2M9H A;  3Q9V A;  1Z6T A;  4DJA A;  5IPA A;  4B09 A;  3GX4 X;  1VQM I;  1DU0 A;  4V2G A;  5C4X J;  3RZO J;  4M6X A;  4KFC A;  3LA3 A;  1T08 B;  1R1U A;  4BXU A;  1TL8 A;  4CUG A;  5IT3 A;  2XAJ A;  3SXY A;  1USS A;  3S16 J;  1DQU A;  2OQG A;  2Z9O A;  3TW7 A;  4BEH B;  3B6C A;  1KQ9 A;  3LSM A;  2W24 A;  5H2F C;  4JOM A;  3Q5F A;  1GV2 A;  2O3F A;  2GA1 A;  4KIT B;  5JFR A;  5EG0 B;  3OWT A;  3ULQ B;  3FMS A;  2H09 A;  1Y1V J;  3HHG A;  2QGU A;  3EUH A;  1HLV A;  3CCQ I;  4LK1 F;  2OZU A;  1PP8 F;  1OQY A;  2X6X A;  1Z0X A;  1X3W B;  1YHQ I;  3QRF F;  1VQN I;  1MZB A;  4CO8 A;  2Y69 H;  4RB0 A;  2QSH X;  3K10 A;  4BU2 A;  2DFF A;  5GTI C;  3DFG A;  3DV8 A;  1MNM C;  1KGS A;  1YX5 A;  3N4M A;  2JJ7 A;  3K4N A;  3BC8 A;  1NG6 A;  2CQN A;  2ID3 A;  2ZCW A;  2DDA A;  1UHW A;  1WVR A;  5L3G A;  2KRH A;  1W36 D;  2K4J A;  3HKZ N;  1Q1V A;  2RAE A;  2XF7 A;  1R58 A;  2EZK A;  1XB4 A;  1IN8 A;  2GWR A;  4XRS A;  2NVT J;  2E34 A;  5ICE A;  5D8K B;  2XGD A;  1O4X A;  3OV8 A;  3F8C A;  1YIJ I;  5DD8 A;  3D5L A;  3ZMT A;  4YII A;  2NVU B;  2EV5 A;  3UR3 C;  2GIV A;  1I6X A;  1FBS A;  3MAJ A;  3JRF A;  4I09 A;  1GT0 C;  5DDG A;  4PFP A;  1H8A C;  1APL C;  3A01 A;  1OCC H;  4I0A A;  3M7G A;  1JKO C;  1JI8 A;  1XCB A;  4O3M A;  4XM3 A;  4BEH A;  2LOO A;  3OY9 A;  2PJR B;  4H4K C;  4NUB A;  3HUG A;  4A3B J;  2GA2 A;  3IP4 B;  2XDV A;  2VE9 A;  1SD6 A;  1T33 A;  3BR3 A;  4M71 A;  3TDZ C;  4EM0 B;  1FT9 A;  4DYQ A;  4Y13 A;  3RSN A;  3JAM K;  4H0E A;  1HOM A;  1U9N A;  4CIC A;  1XGO A;  2XPW A;  1HF0 A;  1JGG A;  1HCR A;  3KCC A;  4KN4 X;  3KYD B;  3FBN B;  1UHM A;  1RUN A;  1RR8 C;  4DOZ A;  3H36 A;  5F1J A;  1KON A;  5KVR A;  3BTC A;  2KJB A;  4LB6 B;  3DXJ F;  3LSK A;  3HSR A;  3OIO A;  4D7M A;  3FXR A;  2MFZ A;  2K40 A;  3W3C A;  4WX9 A;  3HOX J;  1NK3 P;  1X4P A;  3PFI A;  3V7C A;  1IV6 A;  3HOZ J;  1HSJ A;  1LEB A;  5HOD A;  4HZF A;  1G59 A;  2R7F A;  4RB1 A;  3DTE A;  3AG4 H;  3DU6 A;  1R71 A;  3AFH A;  1FYM A;  2VJJ A;  2FF4 A;  2ZNZ A;  1DGR M;  4AYB A;  4IZZ A;  3K4M A;  1E2X A;  1P6R A;  1YW7 A;  2K3F A;  3U1K A;  2BW3 B;  4XKW A;  2BVM A;  4ABZ A;  2Y9Z A;  4XLE A;  4IRG A;  2IA1 A;  2HFH A;  3OS0 A;  4A3I J;  4B4C A;  2ECC A;  3T5X A;  1QBJ A;  4DZP A;  1T2K A;  5EDN A;  4XRM A;  1EF4 A;  1QHH D;  1ZGW A;  4ASN A;  1G2H A;  2BBY A;  4F7Z A;  1LDK B;  3JTG A;  5C4J J;  2DT6 A;  3H0D A;  3HSF A;  1D0Z A;  3LQQ A;  1HDP A;  1H89 C;  3WGI A;  2A05 A;  4UXN A;  1LFP A;  4LG0 A;  4DIQ A;  1CQT A;  2VT3 A;  1Y0U A;  4OIN F;  5H20 A;  2VLA A;  1KU2 A;  2Q2E A;  5DEQ A;  1IUF A;  1TT0 A;  1SAX A;  1J9I A;  2DA2 A;  1WRJ A;  4ZTJ A;  3GO5 A;  2EFP A;  3FIS A;  3CMY A;  2F4M B;  5CQE A;  4G12 A;  1V5F A;  3NEU A;  2HEO A;  3I3L A;  2NNN A;  1G8X A;  3M8F A;  2GOM A;  2R7S A;  1ETY A;  1YRN A;  1WI3 A;  4DYC A;  4RGS A;  4XKV A;  2EZI A;  2MD5 A;  2HWV A;  2R3S A;  4KN7 X;  1FBQ A;  3IKT A;  1IXS B;  4CYC B;  4XOP A;  2DW4 A;  3BR0 A;  3MZH A;  1B8I B;  1KQ8 A;  2DFE A;  2AHQ A;  2XRL A;  2CYY A;  1LEA A;  1JHF A;  2R7X A;  1B9M A;  2VC0 A;  5F04 A;  4Y4R A;  1P7J A;  3PSI A;  1IAW A;  5DV5 A;  1XGM A;  3TL4 X;  3ZOB A;  1MDM B;  2DFI A;  1BIA A;  2K02 A;  1DDN A;  2F4O B;  4IHW A;  3SFZ A;  3O2P E;  3HRS A;  4P1W A;  3F3X A;  2VE8 A;  2O8K A;  2DOE A;  3LSP A;  1OLT A;  2LLK A;  2KQR A;  3N97 A;  1J75 A;  2X1E A;  3HL2 A;  4HYE A;  1W5T A;  4M74 A;  3VYU B;  2VQG A;  3H5A A;  3BOQ A;  1X3Z B;  3ZMU A;  3CJR B;  2XAH A;  4WCG A;  3IL2 A;  4NBQ A;  3RQI A;  3CD6 I;  4U0V A;  4WXD A;  2E7W A;  2V4J C;  3H92 A;  5J47 A;  3KYC B;  4AM3 A;  1TZL A;  3Q0V A;  2V26 A;  1ORK A;  3F8M A;  4BBS J;  3I4N J;  4GRI A;  3H35 A;  2JK3 A;  4IKF A;  2A68 F;  4GO1 A;  1T95 A;  4BY7 J;  3S93 A;  2W85 A;  1TWH J;  3ZRG A;  1ZG1 A;  4ESJ A;  4RGU A;  3JAM Z;  3OR1 C;  1K6O A;  1X2M A;  3DLA A;  1BL0 A;  1RES A;  2G9W A;  1BR1 A;  1U5T B;  4ITV A;  2O5R A;  2VC1 A;  4HX8 A;  4RM3 A;  2JA5 J;  2XC7 A;  3CCS I;  3WGH A;  2HS5 A;  1S7A A;  1FOW A;  5D5W B;  1K78 A;  5LEJ A;  1U6G A;  3S32 A;  4ZC3 A;  1Y39 A;  3DBL B;  1WZ2 A;  3FXO A;  4KMU X;  1WWX A;  3BDD A;  2QF7 A;  3CF2 A;  4FT8 A;  3S1Q J;  3Q0W A;  2ZSH B;  2E1M B;  2CUF A;  2D5V A;  1U5T C;  2R93 J;  2QEX I;  3DQV C;  1VQO I;  3WTX C;  4NQW A;  4BXF A;  2ZJQ F;  3FWE A;  2IS6 A;  3KE2 A;  3FBI B;  2CV0 A;  1ZRE A;  3LSG A;  4ON0 A;  3ZCO A;  1YS7 A;  1X3U A;  1XDU A;  1VQP I;  3SZP A;  3ABT A;  5E79 C;  1DPR A;  4BE1 A;  1JGS A;  4LJZ F;  1WH7 A;  2WY8 Q;  2FRH A;  3KZZ A;  3PFY A;  4R79 A;  1LVA A;  3LOC A;  2BXY A;  4OIO F;  2O03 A;  3MQ0 A;  3C7J A;  2PJR A;  4HF1 A;  2UV1 A;  4I99 C;  1YJN I;  2ZME A;  2N8G A;  3KZY A;  1WPK A;  2LKS A;  2A69 F;  2E7X A;  4PJM A;  3L2W A;  1TC3 C;  3WTW C;  4KDP A;  1KU3 A;  2IGM A;  1H9T A;  3HGG A;  1Z05 A;  2H94 A;  1XSV A;  2FEZ A;  5M5W J;  1G3T A;  2Y0S N;  2MLK A;  1L0O C;  1XS9 A;  1WJD A;  1V54 H;  3KEY A;  2R7W A;  1S7E A;  3QOE A;  1QU3 A;  4A3J J;  3IH3 A;  3L09 A;  4I02 A;  3VOD A;  4WK8 F;  2BZT A;  4UUS B;  1DPU A;  1WHU A;  2CFX A;  3K1M A;  1YX3 A;  1UZC A;  1ZKG A;  4KA4 A;  1ETQ A;  2X1C A;  2XGC A;  3BG6 A;  1D8K A;  2E1C A;  2I5U A;  1D5V A;  1TBX A;  5CVR A;  5HLH A;  3U2R A;  1BI1 A;  1XX5 A;  2M7B A;  2VJI A;  3CQZ J;  1TTY A;  2R7D A;  4A93 J;  2JSP A;  2W00 A;  2XPU A;  3M8E A;  2LF8 A;  5F0F A;  4HA8 A;  4HG2 A;  5BOX A;  3QYF A;  1OFC X;  5DCM B;  2FOW A;  1SFK A;  1VQK I;  4JP0 A;  5F0C A;  2M30 A;  2Y9Y A;  5IP6 A;  3DTI A;  4GFB A;  3NAR A;  2H27 A;  2IGN A;  4LIT A;  2VXD A;  4BJ6 C;  4ZYE A;  1UG2 A;  3CCU I;  4B1R A;  1CF7 A;  4YG2 F;  5E17 F;  1IRZ A;  3IAM 2;  5HS9 A;  4J19 A;  5B66 C;  2FX0 A;  3IRQ A;  1XGN A;  4F91 B;  4EVI A;  4HX7 A;  3C2H A;  3WTZ A;  1ONV A;  1GXP A;  1B59 A;  1UB9 A;  4S0H B;  4E7I A;  1A04 A;  3BZ6 A;  1KU9 A;  4L9J A;  3O8G A;  2KL4 A;  4ANJ A;  1U8B A;  1ZTR A;  1QPI A;  1VQ8 I;  5EEG A;  2O9L A;  2HVS A;  3LFU A;  5TIS C;  4E7K A;  4KT6 A;  2LR8 A;  3P7N A;  5K7F A;  2VIX A;  3BJ6 A;  2LY9 A;  5FLX Z;  1D5Y A;  3L1P A;  2ELK A;  4MTD A;  3DEU A;  2RVC A;  4YFK F;  3QQA A;  4U7B A;  3OYA A;  1VZ0 A;  1X2N A;  5DUK A;  3OYG A;  4BBR J;  4CGZ A;  4L5J A;  3OL4 A;  1T39 A;  2ZB9 A;  1WGX A;  3LAJ A;  3T8T A;  3UNG C;  4MLO A;  2JRT A;  5CJ9 A;  3NWS A;  5IOY A;  2PI0 A;  1TP4 A;  5FKO A;  2CW0 F;  1G6N A;  1RPW A;  4O5V A;  5BPI A;  4D0P A;  1MJA A;  3NAU A;  4M9Z A;  3IHU A;  3GTO J;  4QIW N;  3ZN0 A;  5FKN A;  3I64 A;  5ICF A;  2RC4 A;  4XQF A;  3EQL F;  2R7T A;  2NYX A;  3VPR A;  2JN6 A;  1LE8 A;  5M3F J;  2NAZ A;  3LA2 A;  5LEK A;  1P4W A;  3TOA A;  3HOV J;  4A69 C;  5M5X J;  3KP7 A;  4PCQ A;  4XLH A;  1OJL A;  2LVS A;  3HRM A;  4GCV A;  3ZQG A;  5L3E A;  4S05 A;  3I56 I;  4G9Y A;  2UXN A;  2LBF B;  3K1N A;  2EV0 A;  3QOP A;  1VQL I;  2GM4 A;  1W5S A;  4CYD A;  3ZP5 A;  5C44 J;  3PUB A;  1W5C C;  3T1B A;  3L9F A;  4HV5 A;  2IVM A;  4U88 A;  1XSX A;  3OYC A;  2JSC A;  1D1C A;  1WJB A;  2M87 A;  4LG3 A;  2M5W A;  3HOW J;  3CJQ B;  4LLL A;  1RI7 A;  2HZD A;  1WCM J;  1R22 A;  1K4T A;  3E6C C;  3R0J A;  2V1X A;  2XAG A;  1X58 A;  2WB1 N;  2W82 A;  3F9K A;  2VOO A;  1Y8R B;  5HLT A;  1MMN A;  1ON2 A;  2EQR A;  2EZH A;  3DKX A;  4XON A;  4MO7 A;  4FX4 A;  1LFB A;  3GTJ J;  2DXI A;  4FQG A;  1I39 A;  3W6V A;  3FHN A;  4OAZ A;  2GXG A;  1TQM A;  2E19 A;  1MBH A;  3OS1 A;  2LNB A;  4AIH A;  3S15 J;  4KUM A;  1X1P A;  4RLF A;  1YRN B;  2HTS A;  1RKW A;  2DLL A;  1REP C;  3T8R A;  2H8R A;  4CDG A;  4C3I J;  5LGU A;  3MVP A;  5HDN A;  2A61 A;  1F43 A;  3FXM A;  1POG A;  1ENH A;  2DTR A;  1WJA A;  4KYW A;  2DOD A;  1K83 J;  3A03 A;  1BIB A;  4QSH A;  4OMZ A;  3OYH A;  3K2A A;  3B02 A;  3RCO A;  1TWF J;  4RDU A;  1JKQ C;  3JW4 A;  1H88 C;  5E1X A;  2HR3 A;  4G6D A;  4I7H A;  4A3C J;  5IT9 K;  1TWC J;  1VFC A;  3DKY A;  5KK1 A;  4CXF A;  3S1N J;  3I5U A;  3VFZ A;  1SFO J;  4HPQ A;  4RB2 C;  4CHU A;  4BDY A;  3I4M J;  3S17 J;  1OMI A;  4XRS G;  4MEX F;  4W1U A;  3L00 A;  3DU5 A;  2VPR A;  2EPF A;  2DA1 A;  2FUG 2;  3WHC A;  3QPL A;  3CUQ B;  3NWT A;  2TRT A;  5J8C A;  1FSH A;  1BC7 C;  3VSK A;  1R4M B;  1MJ9 A;  1BJZ A;  1W7P B;  2CRG A;  2EIM H;  4RGR A;  4XNF A;  1X19 A;  5EZH A;  2PLY A;  2E1M C;  1FNN A;  3I9V 2;  4V19 K;  5EZG A;  5E20 A;  2YSR A;  3K4J A;  1MIJ A;  2B63 J;  4LLG F;  2XB0 X;  2Y0M A;  1ERD A;  1ZRD A;  4IF4 A;  1S8N A;  4RAG A;  2O8X A;  1GVD A;  4A3E J;  2VKE A;  2RQP A;  3ZQC A;  4OIQ F;  4F93 B;  1SFE A;  5HS8 A;  1R4N B;  1MH4 A;  2CMP A;  3RPU D;  2HOA A;  2VBX A;  2HQA A;  3E6M A;  3GF2 A;  1VQ9 I;  2CO5 A;  2UXX A;  4U0W A;  1RUO A;  3I71 A;  3KLN A;  3G1O A;  3QPH A;  1JUP A;  4L5E A;  5FLV A;  2YPR A;  1W7P D;  2R7Q A;  4BY1 J;  1MNE A;  5GAH J;  1WI9 A;  3E5Q A;  4HEA 2;  1IN5 A;  5BNG A;  4HV6 A;  3CP2 A;  4BL0 B;  2HNH A;  2V6C A;  3CZ6 A;  2IBD A;  5EGO A;  2KZG A;  2ISZ A;  3DLL F;  2ELJ A;  2IEK A;  1EH6 A;  2QVO A;  4ZZL A;  2YX4 A;  3HB9 A;  3FIW A;  9ANT A;  4Q5S F;  2XF5 A;  2JVH A;  1WKM A;  4XLN F;  2ME0 A;  3GUD A;  1HC8 A;  4N9I A;  4OAY A;  3I4P A;  1K6Y A;  5CLS A;  3CMM A;  2NRA C;  4J01 A;  2EV6 A;  5HNF A;  1GHC A;  2A5Y B;  1KU7 A;  3F22 A;  3TGN A;  4HNU A;  4X1E A;  2IS1 A;  2E5N A;  1LNW A;  2XAQ A;  5L3C A;  3JRD A;  1FOX A;  4Y33 A;  5ICC A;  2ADU A;  2P6T A;  2B0L A;  2R4G A;  2ID6 A;  3OYL A;  4AIJ A;  2LSO A;  3CLO A;  4MTE A;  2M8E A;  1IN7 A;  4ZH4 F;  1T38 A;  5EEH A;  4EJV A;  1B72 A;  4GYG A;  2IS4 A;  4HBL A;  1ODD A;  3P9I A;  4W97 A;  1ZLK A;  1SEU A;  1I3A A;  2DFH A;  4CCK A;  2K85 A;  2AXL A;  1OCO H;  4N4N B;  2F5F A;  5HLI A;  4AVZ A;  2KRF A;  3EYI A;  2L9R A;  4PSW A;  5BPD A;  4IXA A;  2Z5U A;  2G7H A;  1MGT A;  2KPM A;  5GPA A;  1JTY A;  4A5N A;  2BY2 A;  2A6T A;  1XN7 A;  2ZBK A;  2WWY A;  4E4H A;  1SC7 A;  5ILS A;  2VJ4 A;  2CS3 A;  2E1O A;  1PUF B;  1G3W A;  3R60 A;  4ZYG A;  4A3F J;  1GUU A;  2BOL A;  3TMO A;  2Z16 A;  2LMD A;  1R5I D;  2EA2 A;  4KIF A;  2CU7 A;  2K5C A;  3E7L A;  1ZR4 A;  5B1B H;  2HOS A;  2JA8 J;  2R7V A;  3W6K B;  2DU9 A;  4A6E A;  3FK6 A;  5A2Q Z;  4HRI A;  1IXC A;  2DMP A;  1NH3 A;  2L9V A;  2X51 A;  2XIG A;  5D5X B;  1P92 A;  4E6K G;  3CTA A;  3TO9 A;  5LRS A;  4RA2 A;  4ENM A;  3K70 D;  3W2V A;  4II2 A;  4Z2Y A;  3ABL H;  4NC8 A;  2HPI A;  2F5C A;  3R4K A;  3KYL A;  2MC3 A;  4I0B A;  4FCY A;  1OPC A;  1TT5 B;  3J7A Y;  3V8K A;  3GZ6 A;  1ZK8 A;  1O7L A;  2DA7 A;  2DI3 A;  1WQ2 A;  2W84 A;  3HOU J;  5BS6 A;  2Q1Z B;  4AYB N;  1VQ5 I;  2A5W A;  3EYY A;  1B9N A;  2JRM A;  5F6F A;  1NG7 A;  5GAD J;  3E5U A;  2LF7 A;  1B1B A;  5DUI A;  1BN5 A;  1UJ8 A;  2DJN A;  3U21 A;  2CW7 A;  3BJA A;  3CF5 F;  2QBY A;  1OR7 C;  3TED A;  4HSR A;  2ZC2 A;  2HQ5 A;  2DOA A;  1AA7 A;  2F48 A;  1G3Y A;  1MDM A;  4FET A;  2Q8K A;  2RNJ A;  2R5Y A;  1IF1 A;  1O7F A;  4M3B A;  2FMY A;  2MYS A;  2EIN H;  1IUY A;  1NHA A;  2MGQ A;  3GXO A;  5J8F A;  1Y0N A;  3PL8 A;  4N4O B;  2A07 F;  1LPQ A;  2M8G X;  4Q47 A;  2BYV E;  1KA8 A;  1VF9 A;  2IA0 A;  3BQZ A;  3I58 A;  4CYC A;  4ESB A;  1BR2 A;  4ETS A;  5A2Q K;  3SFI A;  4DBR A;  4G6Q A;  1N78 A;  1SFX A;  3GTM J;  1SVM A;  2EZL A;  1AWC A;  4OMY A;  1GLN A;  2YUS A;  2MBF A;  1K7A A;  4ZYD A;  1R00 A;  1TNS A;  2VBY A;  3PUF A;  4I2O A;  3BY6 A;  3FKI J;  2L7F P;  2WAF A;  1XPX A;  3C2G A;  2QKM B;  1FSE A;  1LKX A;  2RKH A;  2WV1 A;  1V5E A;  1OYW A;  2F5E A;  3BG3 A;  3S2W A;  3HZJ A;  4BUP A;  4DBQ A;  1LVK A;  4KIB A;  2E2I J;  1TW2 A;  1XGS A;  3KP6 A;  1BW6 A;  1FBU A;  2P5V A;  1HW5 A;  4GDF A;  1IRX A;  5FGM A;  4XLF A;  1MBJ A;  3HOT A;  2KIM A;  5FKM A;  5KCM A;  2NVX J;  4PJJ A;  2OU2 A;  4XK4 A;  4PGG A;  1MBG A;  2CV2 A;  4BDZ A;  1RKT A;  3IRR A;  4PJ0 C;  3ZN1 A;  1YO5 C;  4L18 B;  1SFU A;  2XGE A;  3GFM A;  2NXN B;  3A0H C;  3BTL A;  2R7R A;  1W7P A;  2XRN A;  3ZQQ A;  5HNH A;  3V4G A;  1MMS A;  3OOU A;  1LE8 B;  2FML A;  5LBQ A;  2M4G A;  5ICG A;  2DTZ A;  2QBY B;  4C2T A;  2P0W A;  3MKW B;  4LIU A;  2RRE A;  2JT1 A;  2E5Z A;  1E0E A;  4RMN A;  3D5S C;  3E6B A;  2R0Q C;  1FC3 A;  5F08 A;  1HW2 A;  3F6V A;  3EUA A;  3GWZ A;  3U1D A;  3ERM A;  2QQA A;  3MMY B;  2FD5 A;  4C3H J;  3SZG A;  3JCU C;  1LUJ B;  4FE7 A;  3PO2 J;  1HBX G;  2IT0 A;  3PIP F;  1R1V A;  2QCO A;  3WE3 A;  2QQB A;  3SQN A;  4BKX A;  4S04 A;  3ZQI A;  4M3E A;  1Y8Q B;  4DW6 A;  2P5L C;  3FM5 A;  3LMM A;  2JZY A;  2K9L A;  1TWG J;  2W57 A;  1G4D A;  2VBW A;  4LGW A;  1ACI A;  3FM3 A;  4C9Y A;  2LYC A;  4Z6Y A;  3KX2 A;  1ETW A;  3GZN B;  1Y56 A;  5E3L A;  1CF7 B;  3M4O J;  2MC4 A;  4HNT A;  2FE3 A;  1MMA A;  2FXA A;  2OTJ I;  1IDY A;  4WXC A;  2OD5 A;  2V9K A;  3J80 K;  1A31 A;  1JKR C;  3IUO A;  3TO6 A;  3RZD J;  1H9G A;  3E97 A;  5DD4 A;  3H5R A;  2L0K A;  1VI0 A;  3I59 B;  5DS9 A;  2DA4 A;  1FYL A;  2EFN A;  2KRC A;  1OYI A;  2K27 A;  4UHT A;  1QZY A;  3K4C A;  5DM6 F;  1FEX A;  4HAM A;  2XKO A;  2J5P A;  4OIP F;  3ABM H;  2EA4 A;  2M0M A;  1QRY A;  3LFK A;  4CZC A;  5TGT A;  2V1U A;  3BWG A;  3TDU C;  1U3E M;  3NRV A;  3GTQ J;  1HKS A;  2K3P A;  4P55 A;  3SJM A;  3D0S A;  3K4L A;  3ERE D;  5GAE J;  2HPM A;  1AKH A;  2K7L A;  2DK5 A;  2D45 A;  4EQQ A;  4FAS D;  2VT2 A;  4M3F A;  3BQY A;  2KIU A;  1DP3 A;  2OQR A;  1Z9C A;  3RPU A;  3FHZ A;  3HRU A;  1DUX C;  2OAZ A;  2UWM A;  5FLX K;  4BQA A;  2CV1 A;  1HA8 A;  1OCR H;  2ZFU A;  4UB8 C;  3PM1 A;  3IKV A;  3FKJ A;  1EV7 A;  1EH7 A;  3L2Q A;  1ETV A;  2X85 A;  4QPO A;  2DBB A;  2V7F A;  4P9U A;  1SAU A;  1F36 A;  2JWT A;  2QEN A;  3RKY A;  4LIV A;  2DJI A;  4X6A J;  2VOP A;  4MQV A;  4U7D A;  3Q9S A;  2Y0S A;  1LDD A;  2BEO A;  3RKW A;  4DQ2 A;  3PO3 J;  3HOS A;  3QYE A;  3F6O A;  5FFZ A;  2QSG X;  2EFQ A;  4BQQ A;  3HGY A;  1ZGA A;  3NQO A;  4FIS A;  5TJJ A;  4HST A;  4ZTF A;  2COM A;  3VYT B;  5K5O A;  3DWL E;  5TRD A;  1S72 I;  1IDZ A;  2LY2 A;  4QLC U;  2L01 A;  1YQA A;  2NS8 A;  5IP9 J;  5ILU A;  2XSJ C;  4E7Z A;  4YFN F;  1JE8 A;  2V1D A;  5IYB J;  1HST A;  3LL7 A;  5FJ8 J;  1QZZ A;  4EAT A;  1IXR C;  2E1N A;  2HOE A;  1EH8 A;  2MH2 A;  4A2U A;  2KDO A;  1UAA A;  4XR6 A;  2MW8 A;  1YTY A;  1F5T A;  5IOZ A;  2JA6 J;  2LTP A;  2PMH A;  1J0R A;  3MKY B;  1A36 A;  1ZEL A;  5LGN A;  1GDT A;  2EBI A;  2XVC A;  1PUF A;  1JJ8 C;  2HDC A;  2HQR A;  2LRD A;  5M3M J;  3H0G J;  4UVB A;  3J7Z I;  2QZ8 A;  2AS5 F;  2DMU A;  4PDK A;  1LJ9 A;  2M45 A;  2A3S A;  1XCV A;  2ZSI B;  3GFJ A;  4ZDP A;  5DCM A;  1QO0 D;  2BVL A;  5FLM J;  2Y31 A;  1BOA A;  3MKL A;  2LRE A;  1QNT A;  3ABU A;  4RAY A;  2NOJ B;  1N75 A;  1T8I A;  1LB2 A;  3K0L A;  1FY7 A;  3AG2 H;  3R6S A;  3JSP A;  4CCM A;  2OZ6 A;  2HKX A;  4CSW A;  4UVC A;  2W7N A;  2WA0 A;  1MSE C;  3RKX A;  1FP2 A;  1KYW A;  3CDH A;  2PX9 A;  5FRN A;  2L7K A;  3CME I;  1RZ4 A;  2PN6 A;  3K7A J;  4A0Z A;  1IO2 A;  2Z99 A;  2OUM A;  3PNT A;  1ZQ3 P;  2DT5 A;  4R1H A;  3G6E I;  2HZT A;  2JVG A;  4CCL A;  2V79 A;  3HTU A;  5FKL A;  4C3J J;  1X1A A;  2LG4 A;  2GOX B;  1BOB A;  1E3P A;  4XOR A;  2RQQ A;  2QUF A;  1B8I A;  3FXU A;  2FBI A;  3M1C A;  2OPT A;  3TBI A;  5IT9 Z;  4IJA A;  1EJ9 A;  5LHI A;  3K9T A;  1SD5 A;  2G7U A;  4ZYA A;  3CCJ I;  3F8N A;  4P5O A;  2ZFW A;  4BE2 A;  5EGO B;  4AID A;  3WTU C;  4G7H F;  3I55 I;  1YW8 A;  3DKW A;  3MWM A;  3J81 K;  1UG0 A;  2BY3 A;  3CDI A;  4R8H A;  3JSO A;  1TQI A;  3K2Z A;  4LD5 A;  2JUG A;  5J4V A;  1OCP A;  1D3Y A;  5LLQ A;  1W0T A;  3ISP A;  2Y30 A;  1QVT A;  3R0A A;  1Z21 A;  1FZP B;  2QM3 A;  5IP7 J;  1JUS A;  3J7Y J;  4EGY A;  1F9N A;  4XKC A;  5BMZ A;  3ECO A;  4EM2 A;  2TCT A;  2VQL A;  2P7V B;  3BJO A;  3CP8 A;  1BC8 C;  3VYS B;  5B5E C;  1MMG A;  2E35 A;  3JRI A;  2KIF A;  2IW5 A;  1D8J A;  3CCR I;  3OYE A;  2GXB A;  4OIR F;  1TW3 A;  3RKQ A;  5HDK A;  4F55 A;  3C1D A;  3O3K A;  4MFE A;  2H1L A;  4NC6 A;  3OYD A;  4BAC A;  1B72 B;  2XF6 A;  2XAU A;  3G73 A;  4BH9 A;  3MFK A;  3ABK H;  1S3J A;  3K4K A;  4M6V A;  1ZG5 A;  3HTS B;  3HOY J;  1I27 A;  2OBP A;  4MNU A;  3ZMS A;  3S1M J;  2O6G E;  2J5O A;  3CJN A;  4GYI A;  2DN0 A;  1R5H A;  3ZR8 X;  2WAQ A;  3A1Y A;  4G6T B;  4M9S A;  3W2A A;  2W1O A;  3BLY A;  2Y48 A;  4L0Z B;  4FX0 A;  1MD0 A;  2PMZ N;  2RN7 A;  2H1K A;  4L9T A;  3SYT A;  2IXS A;  3KP2 A;  3G1M A;  2HVR A;  2VOD A;  1WJ5 A;  2FNP A;  3CUO A;  4BXX J;  2E2J J;  2MLG A;  5D8L B;  3JRE A;  4MQ9 F;  4X0G A;  4D1Q A;  3GTL J;  3OYB A;  1MH3 A;  1HQC A;  1YJW I;  5D5U B;  4BNC A;  1XG1 A;  3KEO A;  1ETO A;  3L2U A;  3CCY A;  3JR9 A;  5D5V B;  5FRO A;  2WAE A;  2W4S A;  3SDG A;  3AG1 H;  3ZMZ A;  4BHB A;  2FJ1 A;  3MZ8 A;  4Q48 A;  5JI6 A;  2RNG A;  2STW A;  4M3D A;  3T0Y A;  1RR7 A;  4CH7 A;  1IZ1 A;  4A0X A;  2X6W A;  4PGH A;  2ZME C;  4D7N A;  1J7K A;  3X2Q H;  4MHG A;  1RRJ A;  3QU3 A;  3M07 A;  3E0J B;  2BV6 A;  2NS7 A;  1QHG A;  2QKL B;  4F92 B;  1IG7 A;  4PFO A;  4RLQ A;  1S6L A;  3JRG A;  2LH9 A;  1ZYR F;  2LKP A;  3DPT A;  4BE0 A;  2VN2 A;  2R92 J;  3RIR A;  4FTH A;  2Y2Z A;  2F2E A;  4JQF A;  4CCO A;  5J3L A;  4J00 A;  4DGW B;  4GGG A;  2CUZ A;  3H5N A;  4LK0 F;  4CCJ A;  5F1R A;  2BHY A;  3H3U A;  2L3D A;  4O6J A;  5D4S A;  4A3D J;  2BXZ A;  5L3F A;  4B3X A;  3CLQ A;  2ZJP F;  1P9Q C;  3VB2 A;  2R5Y B;  3CCM I;  4ZDO A;  5GTH C;  2BE5 F;  3LNQ A;  1KZH A;  1Z67 A;  3WHB A;  5FRM A;  1O3Q A;  3VEP A;  4IVN A;  2R5Z A;  1XDS A;  3DCF A;  2R7O A;  4UV8 A;  2X4H A;  2BGC A;  1NTC A;  5JHF A;  2ZJ2 A;  4B43 A;  1JT0 A;  4DNC A;  5JVT A;  3BG7 A;  4B8X A;  2K4B A;  3GFI A;  3KFW X;  2HQN A;  4II3 A;  3N05 A;  4MFD A;  2Z1D A;  1T98 A;  2JA2 A;  5K1Y A;  4B48 A;  2LBF A;  2DA5 A;  4IPA A;  3REO A;  5K5R A;  3BPX A;  3FXQ A;  3MN2 A;  2W48 A;  1AOY A;  2W25 A;  2F4I A;  3GZ5 A;  4ENJ A; 
#chains in the Genus database with same CATH homology
 1ORK A;  2R5Y A;  4BBS J;  3I4N J;  4FE4 A;  4M3B A;  2JK3 A;  2MGQ A;  2K9Q A;  4BY7 J;  1JTX A;  1TWH J;  3Q0U A;  4V2F A;  1NK2 P;  2DMT A;  2LKX A;  1BL0 A;  1X2M A;  2M8G X;  1RES A;  1VF9 A;  2MSY A;  3BQZ A;  4CYC A;  5DTD A;  3SFI A;  3GTK J;  4Y52 J;  2JA5 J;  4JX5 A;  3ZQH A;  2WAQ N;  2CUE A;  3BR6 A;  3GTM J;  3BG9 A;  1ZR2 A;  4IHV A;  2EZL A;  1VND A;  2YUS A;  2QF7 A;  3S1Q J;  3Q0W A;  2R93 J;  2CUF A;  2D5V A;  5IYD J;  2IAI A;  5FKK A;  3FKI J;  2L7F P;  3JRH A;  5EF6 A;  2WV1 A;  3BG3 A;  3LSG A;  2CJJ A;  1LFU P;  5JLX A;  2NVQ J;  2E2I J;  1W0U A;  2VUM J;  3A02 A;  1BW6 A;  1WH7 A;  1IJW C;  5C3E J;  1MBJ A;  3LOC A;  4DZJ A;  5FKM A;  4HNV A;  2NVX J;  1JJ6 C;  4XK4 A;  1MBG A;  2N8G A;  1MBF A;  1RKT A;  1WPK A;  2XGE A;  2X6O A;  2G0E A;  4EEF G;  1Z77 A;  3A01 B;  1TC3 C;  2HXI A;  3BTL A;  3HM5 A;  1K61 A;  2KDZ A;  3HEF A;  3HGG A;  3OOU A;  1LE8 B;  5J1Y A;  5M5W J;  3ZQF A;  2Y0S N;  3S2D J;  3C2B A;  1XS9 A;  1U78 A;  2DTZ A;  2OF7 A;  1S7E A;  4A3J J;  3IH3 A;  4XID A;  1AKH B;  2CQQ A;  4A3M J;  1MBE A;  4UUS B;  2R0Q C;  2YU9 J;  5F08 A;  1ZKG A;  5IYC J;  1ETQ A;  2XGC A;  3DEW A;  3FK7 A;  4C3H J;  2FD5 A;  3HBL A;  1AU7 A;  2HYJ A;  3CQZ J;  2K9N A;  2NVY J;  4UUS A;  2X48 A;  3M3Y J;  4A93 J;  4FE7 A;  3PO2 J;  2XSD C;  2EH3 A;  2XPU A;  2QCO A;  2I10 A;  1IGN A;  4I76 A;  5F0F A;  3OSF A;  2AO9 A;  1I3Q J;  1OFC X;  1Y1W J;  2GBY A;  2L7M P;  4JP0 A;  4BKX A;  2JA7 J;  3GBG A;  1BW5 A;  3ZQI A;  3IH2 A;  4M3E A;  5F0C A;  4C2M J;  4DW6 A;  4Y7N J;  2HOT A;  2XB5 A;  2Y9Y A;  5IP6 A;  4GFB A;  3NAR A;  4JX6 A;  5EG0 A;  1TWG J;  1UG2 A;  4B1R A;  1MBK A;  1IC8 A;  1IRZ A;  1ETW A;  4J19 A;  2FX0 A;  3BTI A;  4JYK A;  5E3L A;  3M4O J;  1WH5 A;  5J1R A;  1BA5 A;  1IDY A;  4S0H B;  4M3G A;  1QPI A;  2MG4 A;  1JKR C;  3O8G A;  1ETX A;  1U8B A;  1ZTR A;  3RZD J;  2O9L A;  1U9O A;  1ETK A;  3BR5 A;  2LR8 A;  1TWA J;  2L0K A;  5K7F A;  1SAN A;  1VI0 A;  2LY9 A;  1D5Y A;  3L1P A;  2ELK A;  5DS9 A;  1RET A;  3QQA A;  2DA4 A;  2M34 A;  2GLO A;  1GV5 A;  1X2N A;  4UUT A;  4BBR J;  2DA3 A;  4DYR A;  3GTG J;  2ZB9 A;  1WGX A;  2HI3 A;  1FEX A;  3LSR A;  4MLO A;  1FTZ A;  5IOY A;  1QRY A;  2L7Z A;  5FKO A;  1HDD C;  3BR1 A;  4A3L J;  1RPW A;  3GTQ J;  3SJM A;  1MSF C;  3NAU A;  3GTO J;  1A6I A;  4QIW N;  1AKH A;  5FKN A;  3CDL A;  3VPR A;  2JN6 A;  4M3F A;  1OCT C;  1LE8 A;  5M3F J;  3BQY A;  3HOV J;  4A69 C;  5M5X J;  1OJL A;  3PM1 A;  3D1N I;  2LVS A;  2XPV A;  3ZQG A;  1ETV A;  4XIC A;  2DA6 A;  3JRB A;  3Q3S A;  5E3N A;  3GTP J;  4QTR A;  1F36 A;  2JWT A;  2X9D A;  2GM4 A;  4X6A J;  1R9T J;  1FJL A;  5C44 J;  2HXO A;  4D5F A;  4IHY A;  1FIA A;  3PO3 J;  5JLW A;  5F0H A;  2COB A;  3S2H J;  3HGY A;  1DU6 A;  4FIS A;  3HOW J;  2M9H A;  5IPA A;  5J1U A;  3JRC A;  3IV5 A;  4IHX A;  1IDZ A;  1WCM J;  1DU0 A;  4V2G A;  5C4X J;  2NS8 A;  3G1L A;  5IP9 J;  1A5J A;  1X58 A;  2WB1 N;  3RZO J;  2ECB A;  2EQR A;  2EZH A;  4MO7 A;  5IYB J;  1T56 A;  1LFB A;  3GTJ J;  5FJ8 J;  3W6V A;  2E19 A;  3S16 J;  1MBH A;  3S15 J;  1YRN B;  2K9S A;  1RKW A;  4LOC A;  2MW8 A;  3TW7 A;  2H8R A;  2KT0 A;  5IOZ A;  2JA6 J;  3B6C A;  2LTP A;  4C3I J;  1FIP A;  3MVP A;  3OSG A;  2EBI A;  1GDT A;  1GV2 A;  4AC0 A;  5EG0 B;  1POG A;  1ENH A;  1PUF A;  1JJ8 C;  1F43 A;  1Y1V J;  5M3M J;  3H0G J;  3TP3 A;  5GPC A;  2DMU A;  1HLV A;  1K83 J;  3TP0 A;  2LP0 A;  2FQ4 A;  3A03 A;  2YS9 A;  3TW6 A;  4QSH A;  1Z0X A;  5FLM J;  2Y31 A;  3K2A A;  3MKL A;  1TWF J;  4RDU A;  1JKQ C;  1H88 C;  1ITY A;  4A3C J;  2R7Z J;  1TWC J;  1MNM C;  1VFC A;  2JJ7 A;  3S1N J;  5GP9 A;  1AHD P;  2ID3 A;  2M0C A;  1MSE C;  2LD5 A;  1SFO J;  2DMQ A;  5K7Z A;  1Q1V A;  2RAE A;  3HKZ N;  2EZK A;  3I4M J;  3BTJ A;  4XRS A;  3S17 J;  2NVT J;  3K7A J;  4XRS G;  4W1U A;  2XGD A;  1O4X A;  1ZQ3 P;  2VPR A;  5EYR A;  2DA1 A;  3WHC A;  3QPL A;  5FKL A;  4C3J J;  2TRT A;  3JRF A;  1GT0 C;  1APL C;  4RBO A;  1BJZ A;  2CRG A;  1H8A C;  5EZH A;  3A01 A;  1B8I A;  1JKO C;  4NDL A;  4AUX A;  2OPT A;  5EZG A;  4A3G J;  3O8H A;  2B63 J;  1UMQ A;  5E3O A;  2XB0 X;  2DMN A;  2LK2 A;  1UHS A;  5EGO B;  4IEJ A;  4A3B J;  2ME6 A;  5K7H A;  1GVD A;  4A3E J;  2VKE A;  3ZQC A;  1FTT A;  3UKG A;  1T33 A;  3BR3 A;  1MH4 A;  3S14 J;  3BT9 A;  1OCP A;  2HOA A;  1W0T A;  4I6Z A;  2Y30 A;  1QVT A;  4DYQ A;  3IH4 A;  1JUS A;  5IP7 J;  3LSJ A;  1HOM A;  1U9N A;  3G1O A;  2XPW A;  1HF0 A;  1JGG A;  1HCR A;  1JUP A;  2TCT A;  3B6A A;  4L5E A;  5FLV A;  4BY1 J;  3BG5 A;  4A3K J;  2VI6 A;  3JRI A;  5F1J A;  3RKQ A;  2O7O A;  3BTC A;  5BNG A;  1P7I A;  5EGO A;  2IBD A;  3OIO A;  4D7M A;  4MFE A;  2IEK A;  2K40 A;  1B72 B;  3HOX J;  1NK3 P;  1IV6 A;  3HOZ J;  3HB9 A;  3FIW A;  9ANT A;  5HOD A;  4M6V A;  3HOY J;  2ME0 A;  3S1M J;  1JT6 A;  3BR2 A;  2DN0 A;  4X1E A;  4ABZ A;  2PMZ N;  2Y9Z A;  2H1K A;  3JRD A;  3G1M A;  4A3I J;  4B4C A;  2ECC A;  2VKV A;  2E2J J;  4DZP A;  4BXX J;  3JRE A;  2ID6 A;  5EDN A;  1I6H J;  4XRM A;  3GTL J;  1MH3 A;  3H3V K;  2LFB A;  1EF4 A;  1XG1 A;  1ZGW A;  1B72 A;  1G2H A;  1ETO A;  4W97 A;  2NOG A;  3CCY A;  3JR9 A;  5C4J J;  1I50 J;  3SDG A;  1HDP A;  1H89 C;  2FJ1 A;  4M3D A;  1CQT A;  2L9R A;  2P81 A;  1RR7 A;  1IUF A;  3S1R J;  2DA2 A;  5GPA A;  1JTY A;  4D7N A;  3FIS A;  3CMY A;  1QVU A;  2NS7 A;  2E1O A;  1PUF B;  4G12 A;  4MIM A;  1IG7 A;  4A3F J;  3JRG A;  1E3O C;  1GUU A;  1JKP C;  2R92 J;  5EEA A;  3JRA A;  4FTH A;  1ETY A;  2CQX A;  1YRN A;  1WI3 A;  2Y2Z A;  2CU7 A;  3E7L A;  4DYC A;  5J3L A;  1ZR4 A;  2HOS A;  2JA8 J;  2EZI A;  3FK6 A;  2DMP A;  1JUM A;  4CYC B;  5E3M A;  4JX4 A;  4B3A A;  5F27 A;  3BR0 A;  1B8I B;  4A3D J;  2AHQ A;  2XRL A;  5F04 A;  1P7J A;  2HDD A;  4FCY A;  2R5Y B;  3ZOB A;  1ZK8 A;  3LNQ A;  2DA7 A;  3WHB A;  4IHW A;  3QPS A;  3HOU J;  2R5Z A;  4AYB N;  3DCF A;  2O8K A;  5M5Y J;  3LSP A;  1NTC A;  1JT0 A;  2LLK A;  4D5C A;  3F0C A;  2E2H J;  4MFD A;  2R5Z B;  3RQI A;  2DJN A;  2DA5 A;  3ZQL A;  3MN2 A;  2W48 A;  3Q0V A;  1XC5 A;  3HDD A;  2JMW A;  3TED A;  2M2E A;  2HQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...