1RF1A

Crystal structure of fragment d of gammae132a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
64
structure length
64
Chain Sequence
IEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha/alpha-E chain
publication title Calcium-Binding Site beta2, Adjacent to the "b" Polymerization Site, Modulates Lateral Aggregation of Protofibrils during Fibrin Polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 23
structure length 64
sequence length 64
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-11-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1rf1A00
2A45I 2OYIA 3GHGB 2FFDC 2HODB 2OYIC 1JY2O 1RE3A 1JY2N 1RE3C 2HPCA 1LT9B 1N73A 1T3UA 2A45G 1LTJA 1RF1A 2OYHA 1N73C 2OYHC 3H32A 1LTJC 1LWUB 1RF1C 1RE4A 2FFDA 3BVHA 2FFDB 1RE4C 1FZBA 1W2EA 2HLOA 2XNXA 3E1IA 1M1JA 2OYIB 1M1JC 3HUSA 1FZCA 1FZEA 2HPCB 3GHGA 3HUSC 1FZCC 2A45H 1N73B 1RF0A 2HODA 3GHGC 1JY3P 1RF1B 2OYHB 1RF0C 1LT9A 1LTJB 3H32B 1LT9C 1FZGA 1FZAA 1FZFA 2Z4EA 1N86A 1JY2P 1LWUA 1JY3N 1M1JB 1JY3O 2H43A 3HUSB 1FZCB 1LWUC 2Q9IA
chains in the Genus database with same CATH superfamily
4GOEA 3L72J 3L74J 1RQVA 3RK2B 3M9HA 1FDOA 3I56P 5TISH 4GIFA 1OW7A 2R5DA 1VQ9P 3L73D 3R4YA 4DJGA 1MV8A 1EZVD 3G4SP 3II6A 2FYUD 5AVSB 1AV1A 4YXWH 3H1LD 3CC2P 2R3SA 4PV1B 2A45G 2PGDA 1T2KC 3RK3D 1SQXG 4JYCA 1S1CX 1KC8Q 1SQXE 1ZW0A 2D2CC 3JSVC 1GW4A 2OYIA 4N78E 4BRYB 4EDFA 3OJAB 5AW4B 1HWTC 1WMKA 2O1JA 1G1JA 1MZ9A 2JP3A 1RF0A 3T97B 4PV1C 4GDOA 1KYOI 3CD6P 1ZV8A 3H1KJ 4Y28J 4IFFA 1U7JA 1HBWA 4JBZA 2ZJSE 1LT1A 3QWOC 4OGQB 1SQVG 1M1JB 2J5UA 1SQVE 3ABVC 1SFCB 1EZVI 1NO4A 3H6PA 1YHQP 1EXJA 2WQYC 1RE4C 3CI9A 1GD2E 2NPSC 1NVOA 3H1ID 2PAJA 1N2DC 3AE3C 2E76D 4BWNA 1L0NG 4KHXA 1L0NE 4IFDK 5AW3B 5TJHA 3L73J 3PP5A 5APVA 3L71G 4OGQC 4A7PA 2FYUJ 3L71E 5KJ7C 2IYOA 2FBWC 3H1LJ 1SFCC 2H89C 2WWWA 4YPCA 1BGYG 4TT3H 4IFMA 1OXZA 2CK3H 1BGYE 2YXRB 3VOPA 1QVFO 2KS1A 1Y47A 2L91A 5CCHA 2YMKA 1M57D 2H88C 1IK7A 1AFOA 2XZRA 3L72G 4I1LA 3P7KA 1KQSO 3L72E 3B5NA 1ZN5A 3L74E 5AVUB 1KZUB 1DH3A 1N8RQ 3CC4P 3MD0A 1S9KD 5APTA 3FXEA 1T3JA 1M8OB 1FU1A 3QH9A 2YIUB 4RESB 2HYNA 2A06G 2O01J 2KUBA 1UIIA 3L75G 1YITP 5GTHE 4MN4C 1IK9A 2A06E 2M3EA 1NTZD 1M1KQ 1LP1A 2FYNB 2H8PD 1UIXA 1ZMEC 1KORA 1FJKA 1R5SA 5CJ0A 3CL3D 1KILE 2OYIB 5KLVG 2WT7A 2GA1A 2KYVA 5KLVE 1GL2D 1FZFA 3VYIA 1NU1D 1JY2O 1CI6A 1AA0A 3CXHI 1FE6A 1RHZB 2W83C 2KSJA 4TLFA 3IF4A 3TYYA 4XE5B 1M90Q 2J58A 1HUCA 2HLOA 1RF0C 5CCGA 1URQC 2MKVA 2H43A 4GT1A 2Q6QA 2ZVOB 1LTSC 2YKOA 1KYOE 1JNMA 2QRXA 1X79B 5CMZA 2KI7B 2KIKA 1L0LK 1JMMA 4HB1A 1KFNA 3EWKA 3EFFK 1NOHA 4H44D 1XTCC 3L73G 1M56D 5GTHH 3CCSP 5BU5A 1EZVG 3L73E 3RBXA 2L5GB 1EZVE 2WPQA 3H1LG 3CMAP 3VMYA 1FZCA 3HE4A 1PZQA 1NTZJ 2E74D 1LTAC 4JQ0D 2KP8A 3H1LE 2NRGA 3GMAA 1Y8AA 3SFDC 2YO3A 2FXPA 3VTPC 1DIPA 3H1JJ 3LIEA 2K9JA 3RK3E 1K8AQ 2AXTE 2QG4A 3CCUP 2QA4P 1GK4A 1N7SD 2BEQD 3A0BE 3FWNA 2N1TD 3LW5H 1OZHA 1NU1J 3B5NB 1FZAA 2ZXEB 1BCCG 2K3RA 4H0LC 3Q5SA 1BCCE 1RH5B 2JEEA 2QJYC 4WY4A 1AJYA 3MZWB 1SQPK 1L0ND 1LP1B 5CCHC 3PJSK 1VDFA 1YYCA 1U7MA 2QJPB 2B88A 2WT7B 5AW6B 2IX7C 1T3UA 1QGKB 1ZR4A 1QEXA 4HYTB 2UWJE 1KYOH 1CI6B 1IFMA 1QX8A 3VMZA 5AVRB 1SQXJ 1SVFA 3H1IG 2Q9IA 5C39A 5M1BA 3JC22 2Q3EA 3H1IE 3SFEC 3U59A 2K37A 3CX5D 3WUVA 2QJPC 3G3ZA 3GG2A 4UB6H 4M3LA 1ZR2A 1YIJP 2WSFH 1OWAA 1Q81Q 1MFZA 4I2LC 5AW5B 2DW3A 5TISE 3RBZA 3M0AA 4ZMDA 3A0BH 3L75D 1NTMD 1PGJA 4BXLA 3MUDA 1ZLLA 1VQNP 1SQVJ 3CLQA 1MUUA 2P67A 4EYYQ 2WTYA 4K3AA 2E75D 2ZT9B 1SQBK 1NTMK 5AVYB 1BSHA 3GHGA 1T6AA 2WPVB 3EFGA 1JUNA 1HF9A 2N9YB 5APYA 5CCGC 4Y99B 5BU8B 3HE4B 1FZCB 1L0NJ 5BVZA 2KZJA 1U57A 1S4XA 1NTZG 2K9JB 1IFIA 3L71J 5EFWB 1NTZE 2XKMA 3CX5I 1JTHA 3CCMP 1GDTA 2ZT9C 3BRTB 3KDPB 1T2KD 4OVNF 2V4HA 5AW8B 1LTJA 4GKGA 1BGYJ 2OGUA 1YTZT 1NU1G 1NU1E 4Y99C 1FZCC 4WY4B 2LKMA 1P84H 1LTGC 3Q3DA 3I55P 4PD4D 2OTKE 1D7MA 1JY2N 1NTKD 2D2CB 3D71A 4PV1D 2Y9ZA 1FC2C 1ZXGA 3CXHH 3PLNA 1LT9C 4EIJA 4WWIA 1NTKK 3L75J 1NTMJ 2FXMA 3WUTA 2IZ0A 1KTMA 3P32A 3B71A 4WY4C 3O6QA 1L0LG 1L4AA 3OA7A 1IFDA 3FX0A 1LNQA 3U1CA 2BEZF 3A0HE 5AVQB 5KLVJ 1S5LH 2WSEH 3C9IA 3TDKA 1KQGB 1FDMA 2NPSD 2YO2A 5APUA 3LW5J 1LTBC 1AQTA 5KLIB 1BCCD 3FGAD 4NPDA 3Q5RA 1URQA 4LLHA 4OGQD 2NPSB 1OIPA 5KJ7D 1RE3C 1H88A 4PD4I 1SFCD 2LXBA 2ZYGA 2XDJA 2K88A 5CJ4A 2WZ7A 2HR3A 1E79H 1YQ3C 3D6YA 4IOIH 3HE5A 2YKQA 1YBKA 2FY8A 1PP9D 3CCRP 1KD1Q 5KLIC 2OYHC 2XNDH 1HGVA 3WMM0 5KTBA 1GTWA 4U3FG 3M06A 4OH8B 3ZDMA 3AEEC 1EC5A 4U3FE 2I1JA 3V2NA 1S3JA 3SWFA 2OTJP 4HKZH 1Y9BA 3MUDC 3IN6A 1JTHB 4YTPC 1P84D 2P7JA 3BASA 2YNYA 2M0BA 4ZNCA 4ASWA 2RMZA 1W2EA 3HRNA 3PRJA 1EXIA 1HH0A 3GHGC 2WSFJ 3IR9A 1VQPP 3A0HH 5L8RJ 3CXHD 2B9BA 2B87A 2ZVNB 4ASVA 4U7JA 1HJ0A 1IFNA 3JCUH 1S5LX 3AE4C 4ZKUA 2M5AA 2HODA 3M0DA 4AQRD 2JJLA 3WUUA 3RGUA 1G1IA 4UB8H 2JO1A 2N9BA 5E79E 3CX5E 2PFXA 1BCCJ 2PP6A 1NGMB 5DJUB 1A02J 1GZLA 5B5EE 1LTJC 2YKPA 2Z5IA 3KYQA 1IZNB 5CBNA 1KB9I 1HJBA 1KFMA 2AXCA 3CCQP 3O6QB 2IBZI 4WBAA 1SQBG 1L4AB 1NTMG 2FYZA 3V6IA 3KQGA 2QSIA 3L75E 1NTME 2G3AA 1P84I 1DEBA 2GUVA 1PP9J 4JYBA 1NKNA 2CPBA 3H1IJ 2HPCA 3CPWO 3A2AA 1URQB 1RF1A 2KZIA 4Z1MH 3E1IA 3HUSA 1L4AC 3RL0B 2E5TA 5KKZC 1VQ6P 3Q2YA 1LJ2A 1SQQK 4NPFX 3AE1C 3HE5B 3VP8A 1RY3A 3UIAA 3V2RA 3AE2C 3B4SA 3H25A 2O01N 1GU4A 3N4XA 2C0WA 4JPZB 1JY2P 1JY3N 1NWQA 1L0LD 2NZ2A 3V4QA 1X0TA 3AEDC 5E79H 3CX5H 3RL0g 3R2PA 3RL0C 2WSSH 5AVXB 5B5EH 1OW8A 4PD4E 1H89A 1JM0A 1NTKG 3NTNA 3TNUA 2WSEJ 1FJPA 2FKWB 1NTKE 1OVUA 1S2EA 4H13B 2I1KA 2OQQA 3MHVA 5CCHD 3H32A 4H0LB 3SWYA 4L74A 2Q3IA 2B87B 2QE7H 1OVRA 4UB6E 2QJYB 4D6TD 2XU6A 2O3JA 3B5ND 2M5AB 4GOFA 2KS1B 2HODB 3USSA 1KILA 3AE7C 2HFED 1H0TA 3S1KA 1QVGO 1SQPD 4H13C 4LGDE 1LT9A 3AEFC 2KB7P 5B66E 1NH4A 5APQA 2ZYDA 4U3FD 2SPZA 3TGUD 3HD7A 2P2UA 1Q90D 4C7NA 2W6AA 3OAKA 3EQ2A 1PGOA 3W68A 1NHLA 3M0DC 4HH2A 2KOGA 3AE5C 2A45I 3BCCD 2AEFA 1N73A 3V2QA 1PP9G 3GLMA 3ITKA 1L0LJ 1PP9E 2HPCB 3P8CD 1RF1B 3F89A 4PD4H 2IBZG 3HUSB 2QVAA 4DZOA 1IJDB 1VF5B 1RE3A 4AUWA 4K35A 1E5WA 5CCGD 2QJKB 4N6JA 1AVYA 5AW0B 1P84E 2BASA 1N7SC 1NYHA 1L2PA 1BSNA 1BDDA 2E43A 4W7ZA 1CW5A 2KSEA 1NAYA 2OYHA 1RF1C 1VQ7P 3L4FA 2ZT9D 1J2JB 3CXHE 1SQBD 3HUSC 4WB4A 2ZAEB 1GMJA 1VF5C 3FWLA 3B8EB 3V4WA 4I6MC 5B66H 3TNUB 3H1HG 1SQPJ 2QJKC 1IFPA 4WVZA 3H1HE 1PIXA 2POHA 2KK7A 4I7ZB 4O9BA 1S5LE 4U3FJ 3H32B 3TGUJ 3V5BA 1VQ8P 1M7LA 3V2PA 1W2BO 1K9MQ 1VQ4P 3VP9A 1KILB 3MGNA 4EOTA 1H0TB 2JWAA 4WY4D 4GODA 3MIWA 2ZXXA 1JY3O 5GTIE 1KB9H 1LT9B 2Z5HA 4I7ZC 2Q5UA 2D2CD 5CBOA 3H1KD 1PFIA 5H2FE 2Q7CA 3HD7B 4C7NB 2BCCD 2P1JA 3FXDA 3W67A 5AVVB 4R4MA 1YI2P 1KILC 2C0XA 2WPRA 3BRVB 1N73B 1VQKP 1MFTA 3D6ZA 1KMIZ 5CHXA 1SQBJ 1BE3D 2GM4A 2VRSA 3TK1A 1J1EC 3HD7C 1YTZI 3BVHA 1HGZA 1K05A 1VPCA 1L0LE 3PTZA 1PGQA 1ZRTE 2P10A 3CCLP 2W90A 3D70A 2LXCB 2K1AA 3S4RA 2QM7A 3JCUE 2KNCA 4RKUJ 1FAVA 2Q1KA 1N73C 3PHLA 3CCEP 2XNXA 3AE8C 2FYUK 5AW1B 2OYHB 1CSBA 4NPEA 4UB8E 4KJMA 3RK2C 4D6TG 3VMXA 4D6TE 3CCVP 5GTIH 5K5GB 3KZIE 1FBMA 1KQFB 3RK3B 4XA4A 1FZBA 5KAIH 1HTLC 2O1KA 3Q1MA 1OFCX 2W8ZA 4L75A 2H7HA 2KXPB 5H2FH 2C9NY 2IYPA 3C1LA 1SQPG 3GHGB 1GL2A 3TSIA 3L70D 1SQPE 3VN0A 1KB9D 1NJIQ 2BCCJ 2YMYA 3TGUG 2IBZD 1VQOP 1CZQA 2AEJA 1NAFA 3TGUE 1EQ7A 1DD4A 1QLED 1NTKJ 2R3CA 3RK3C 3IFMA 2QEXP 1PGPA 1R5LA 5APSA 3MP7B 4C7RA 2V7QH 3BCCG 1DD3A 2WSCJ 1BE3J 1DX7A 2ZFCA 3E1RA 3BCCE 1PV3A 1LTJB 1G2CA 3NFQA 5AW7B 3CWBD 3N7NA 1HVVA 4JF7A 3P8CE 1FS0E 2Y0EA 2JWDA 2E76B 1M1JC 3NXSA 3GW6A 2RH0A 2A45H 1X22A 1FZGA 3WU2E 1YJNP 3H1HD 1JMBA 4QMAA 3M91A 2WPSA 2FFDA 2E42A 1L4AD 2Y9YA 2HG5D 1PPJD 3AECC 1AVOA 1EDKA 3KZIH 3CC7P 3A5TA 3VMAA 4B86A 3C8VA 3L74G 1SQBE 2E76C 4LC1A 5KKZB 2ITAA 2P58A 5AW2B 1EDLA 2K9YA 3CMEP 1Q86Q 1URQD 4C46A 1FOSE 2KLVA 2KNCB 3L70J 1N7SA 2B89A 3L36A 2N1TA 4W7YA 3RL0D 3A7OA 1OX3A 5APXA 4W80A 1YJ9P 1QL1A 4N3YB 3H1JD 1SQQD 4KT0J 4DT0A 1NTZK 2JDIH 1LWUA 2R5BA 3G71P 1VL2A 4OWFA 2YIUC 4L73A 1YQ4C 2R32A 3AEAC 1USEA 3CWBJ 4AYCA 4EI2A 1GL2B 1NU1K 2FYNC 1S72P 3A3YB 1FOSF 4IL6E 3SWKA 3H1KG 3WU2H 3MTUE 3O8ZA 1Q7YQ 2I8DA 2FXOA 2OYIC 3H1KE 4H13D 1DEEG 1ZRTD 2BCCG 2W6JH 3AEBC 3H1HJ 2R44A 3Q5PA 2BCCE 4H0LD 3GF7A 1GW3A 4HJGH 3S9OA 1IC2A 1N86A 4CPGA 1LTTC 4XFJA 4R4LA 1GL2C 1SQXD 5AVWB 1G2CB 5AVZB 1RQUA 2KLUA 1BE3G 1K04A 1KV4A 3F5HA 4N78D 1FZEA 1OVVA 1WRGA 1BE3E 3M9QA 1PL5A 1WT6A 1AQ5A 4PJ0E 2C9LY 1SQXK 4L76A 1R8EA 2PRRA 2FYUG 3E7KA 2FYUE 2FFDB 2M8RA 1JCCA 1GU5A 4H44B 3IAOA 1JB0J 3PH0A 3KXDA 1QL2A 1SQQJ 3TF5A 2IDBA 1IO4A 3OW2O 2E74B 1K73Q 1SQVD 2Y0CA 1VQMP 5AVTB 1LGHB 2GUSA 2YXQB 1W5CE 2Z4EA 1MKMA 1EDIA 3G6EP 2FFDC 4IL6H 1JO5A 3KHUA 1N7SB 1SQVK 2N1TB 2AEMA 2V7QJ 5AW9B 1VF5D 4ZKPA 4H44C 3HTKA 3AE6C 2IFMA 3L70G 1XTGB 3L70E 2IZ1A 1X9VA 2W6BA 4RO0A 2QIWA 1JOCA 1KB9E 3L71D 1N7LA 2E74C 2WMMA 1BDCA 1SS1A 1L0NK 2IBZE 3B5NC 2XV5A 1LWUB 3NMDA 3L35A 3I5CA 1BGYD 3M9BA 1SP4A 2WSCH 2J59M 2N1TC 3P8MC 4DCKA 3U1AA 4YXDC 4DOJA 4PJ0H 2CPSA 1T8ZA 4D6TJ 3CWBG 1X8YA 5KAFE 2WVRA 3CWBE 3AEGC 1A02F 1FDIA 4BRYA 3L72D 3SSUA 3L74D 1ZP0C 2MJZA 2WITA 1J1DB 1LWUC 3GF3A 4RJTA 2LR2A 1TU3F 1Q82Q 5APWA 3T97A 2AXTH 1USDA 1RE4A 2JKVA 1VQLP 2M3BA 2NPSA 2A06D 2G8YA 3CCJP 1PPJG 2IFNA 1PPJE 1KQLA 1OW6A 2JR8A 1KILD 2RN0A 5KLVD 1GK6A 1Z56A 2IPPA 1Q2NA 1M1JA 5KJ7A 1OMIA 4IL6X 1J1DC 1SFCA 2OYOA 3AE9C 3BCCJ 3KPEA 5KLVK 2E75B 3HD7D 1S9KE 2O01H 1NKZB 1JEKA 2ZYAA 5KAIE 1SLQA 1ZOYC 3LIDA 2RKLA 2QM8A 3K5BA 3H1JG 1J1EB 1SQQG 2E5YA 2W27A 1VQ5P 2Y0DA 1IFJA 3H1JE 1SQQE 1KN7A 5DJTB 1EDJA 1H8AA 2OTLP 3RK2D 1JCDA 5KAFH 2OARA 2E75C 3L37A 1LTIC 1JY3P 1YJWP 1KYOD 3HTKB 3BATA 3G9RA
chains in the Genus database with same CATH topology
3N7NA 3V4QA 1HVVA 4JF7A 3P8CE 3R2PA 3RK2B 3RL0C 5AVXB 3U59A 3M9HA 1M1JC 3NXSA 4GIFA 2A45H 1H89A 2R5DA 3NTNA 3TNUA 3G3ZA 1FJPA 1FZGA 4M3LA 1ZR2A 2FKWB 1MV8A 3II6A 3M91A 5AVSB 2WPSA 2FFDA 2WSFH 2I1KA 2E42A 1L4AD 1OWAA 2HG5D 1MFZA 2A45G 5CCHD 4I2LC 5AW5B 3H32A 3SWYA 1T2KC 2Q3IA 3M0AA 3RK3D 4JYCA 3A5TA 2XU6A 4B86A 3B5ND 3MUDA 1ZLLA 1GW4A 2OYIA 4N78E 3CLQA 1MUUA 2P67A 2HODB 2WTYA 4LC1A 1SQBK 3OJAB 1KILA 5AW4B 1HWTC 5AW2B 1NTMK 2HFED 2O1JA 1URQD 5AVYB 4C46A 1FOSE 1G1JA 2KLVA 3GHGA 1MZ9A 1RF0A 1JUNA 3EFGA 1N7SA 1LT9A 4LGDE 5APYA 3L36A 2N1TA 2KB7P 5CCGC 4W7YA 1NH4A 4Y99B 3RL0D 5BU8B 3HE4B 3A7OA 1FZCB 5APXA 1ZV8A 4W80A 5APQA 5BVZA 1QL1A 4IFFA 1HBWA 3HD7A 4N3YB 2P2UA 1IFIA 4C7NA 2W6AA 3OAKA 2XKMA 1JTHA 3EQ2A 1NTZK 1NHLA 3M0DC 1GDTA 1LWUA 2R5BA 1M1JB 4HH2A 3BRTB 3KDPB 1T2KD 2KOGA 1SFCB 2A45I 5AW8B 1NO4A 1N73A 1LTJA 4GKGA 3H6PA 1YTZT 3V2QA 2R32A 1RE4C 3CI9A 4AYCA 1GD2E 1GL2B 2NPSC 4Y99C 2HPCB 3P8CD 1FZCC 2PAJA 4WY4B 1N2DC 1RF1B 1NU1K 4KHXA 2LKMA 1FOSF 3A3YB 1LTGC 3HUSB 3MTUE 3O8ZA 4DZOA 4IFDK 1IJDB 5AW3B 2OYIC 1RE3A 1JY2N 4AUWA 3PP5A 5APVA 1E5WA 5CCGD 4N6JA 5KJ7C 5AW0B 1SFCC 1GW3A 2BASA 1N7SC 1LT9C 4EIJA 1IC2A 1N86A 2E43A 2WWWA 1LTTC 1NTKK 4W7ZA 1CW5A 2FXMA 1GL2C 5AVWB 1G2CB 3P32A 1OXZA 4IFMA 2OYHA 4WY4C 5AVZB 3VOPA 1RF1C 3L4FA 1L4AA 1J2JB 3OA7A 4N78D 1FZEA 1IFDA 1WRGA 3HUSC 4WB4A 5CCHA 3M9QA 3U1CA 5AVQB 3B8EB 1WT6A 1AQ5A 3V4WA 2C9LY 1AFOA 2XZRA 2WSEH 3C9IA 1SQXK 4I6MC 1FDMA 4I1LA 3P7KA 3TNUB 2NPSD 2YO2A 5APUA 3B5NA 1ZN5A 5AVUB 1KZUB 1DH3A 1LTBC 2FFDB 3MD0A 2M8RA 1S9KD 5APTA 2POHA 1T3JA 1FU1A 1JCCA 4O9BA 1GU5A 3H32B 4RESB 2HYNA 1URQA 3V5BA 4LLHA 2NPSB 1QL2A 1IK9A 5KJ7D 1RE3C 1IO4A 1M7LA 2H8PD 1H88A 3V2PA 1SFCD 1FJKA 5CJ0A 3CL3D 2OYIB 2XDJA 5CJ4A 3VP9A 5AVTB 2WZ7A 1LGHB 2WT7A 2GUSA 2KYVA 1KILB 1GL2D 3MGNA 4EOTA 1FZFA 2Z4EA 4WY4D 3HE5A 3MIWA 1JY3O 2YKQA 3VYIA 2FFDC 1JO5A 1JY2O 1CI6A 1N7SB 1LT9B 1SQVK 2Z5HA 2N1TB 5AW9B 2OYHC 1HGVA 3WMM0 4ZKPA 3HTKA 2KSJA 5KTBA 2IFMA 1GTWA 2Q5UA 1XTGB 3M06A 4OH8B 1PFIA 2Q7CA 3HD7B 2I1JA 1X9VA 2W6BA 3V2NA 3SWFA 1JOCA 3TYYA 4C7NB 2P1JA 1N7LA 1JTHB 4XE5B 1L0NK 2J58A 2P7JA 5AVVB 3B5NC 3BASA 2XV5A 2YNYA 1LWUB 1KILC 3NMDA 2C0XA 1HUCA 2WPRA 3L35A 1W2EA 2HLOA 3HRNA 1HH0A 3BRVB 1N73B 3GHGC 3I5CA 1RF0C 5CCGA 3M9BA 1SP4A 2WSCH 1URQC 2J59M 2N1TC 3P8MC 3IR9A 3U1AA 2H43A 4GT1A 5CHXA 4DOJA 2CPSA 2GM4A 1LTSC 1T8ZA 2YKOA 2VRSA 3TK1A 1IFNA 1X8YA 1JNMA 1J1EC 3HD7C 1YTZI 3BVHA 1HGZA 4ZKUA 1X79B 1A02F 5CMZA 1VPCA 2HODA 1L0LK 2MJZA 1JMMA 3M0DA 4AQRD 2JJLA 1KFNA 1G1IA 2WITA 1J1DB 1NOHA 2N9BA 1LWUC 1XTCC 2QM7A 2PP6A 1FAVA 5BU5A 1A02J 5APWA 3T97A 1N73C 1GZLA 1LTJC 2L5GB 1RE4A 2YKPA 2Z5IA 3KYQA 2M3BA 2XNXA 2NPSA 2WPQA 3VMYA 1FZCA 3HE4A 1HJBA 1KFMA 1LTAC 2FYUK 5AW1B 2KP8A 2IFNA 2OYHB 1CSBA 1KQLA 4WBAA 2YO3A 1L4AB 1KILD 3VTPC 3RK2C 3LIEA 2FYZA 3KQGA 3VMXA 1GK6A 1Z56A 3RK3B 1FBMA 4XA4A 1GK4A 1DEBA 1N7SD 2GUVA 2IPPA 2N1TD 3LW5H 1FZBA 1M1JA 5KJ7A 1J1DC 1HTLC 1SFCA 2O1KA 3B5NB 3KPEA 1FZAA 2ZXEB 4JYBA 2H7HA 5KLVK 2C9NY 3HD7D 1S9KE 1NKNA 2O01H 1NKZB 3GHGB 1GL2A 3TSIA 2CPBA 2HPCA 2JEEA 4WY4A 3A2AA 1URQB 1RF1A 1SLQA 3VN0A 1SQPK 3LIDA 3E1IA 3HUSA 2YMYA 1L4AC 2QM8A 5CCHC 1CZQA 3RL0B 1VDFA 1NAFA 1J1EB 1EQ7A 1YYCA 2W27A 2R3CA 3RK3C 1IFJA 3IFMA 2WT7B 5AW6B 2IX7C 1SQQK 1T3UA 5APSA 3HE5B 4C7RA 1ZR4A 1H8AA 3VP8A 1RY3A 4HYTB 3RK2D 1CI6B 1JCDA 3UIAA 1IFMA 3V2RA 2OARA 1DX7A 2ZFCA 3L37A 1LTIC 3VMZA 5AVRB 1JY3P 1GU4A 1LTJB 3N4XA 2C0WA 1G2CA 3HTKB 1JY2P 1SVFA 3NFQA 1JY3N 5AW7B 3BATA 2Q9IA 1NWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A45 I;  2OYI A;  3GHG B;  2FFD C;  2HOD B;  2OYI C;  1JY2 O;  1RE3 A;  1JY2 N;  1RE3 C;  2HPC A;  1LT9 B;  1N73 A;  1T3U A;  2A45 G;  1LTJ A;  1RF1 A;  2OYH A;  1N73 C;  2OYH C;  3H32 A;  1LTJ C;  1LWU B;  1RF1 C;  1RE4 A;  2FFD A;  3BVH A;  2FFD B;  1RE4 C;  1FZB A;  1W2E A;  2HLO A;  2XNX A;  3E1I A;  1M1J A;  2OYI B;  1M1J C;  3HUS A;  1FZC A;  1FZE A;  2HPC B;  3GHG A;  3HUS C;  1FZC C;  2A45 H;  1N73 B;  1RF0 A;  2HOD A;  3GHG C;  1JY3 P;  1RF1 B;  2OYH B;  1RF0 C;  1LT9 A;  1LTJ B;  3H32 B;  1LT9 C;  1FZG A;  1FZA A;  1FZF A;  2Z4E A;  1N86 A;  1JY2 P;  1LWU A;  1JY3 N;  1M1J B;  1JY3 O;  2H43 A;  3HUS B;  1FZC B;  1LWU C;  2Q9I A; 
#chains in the Genus database with same CATH topology
 4GOE A;  3L72 J;  3L74 J;  1RQV A;  3RK2 B;  3M9H A;  1FDO A;  3I56 P;  5TIS H;  4GIF A;  1OW7 A;  2R5D A;  1VQ9 P;  3L73 D;  3R4Y A;  4DJG A;  1MV8 A;  1EZV D;  3G4S P;  3II6 A;  2FYU D;  5AVS B;  1AV1 A;  4YXW H;  3H1L D;  3CC2 P;  2R3S A;  4PV1 B;  2A45 G;  2PGD A;  1T2K C;  3RK3 D;  1SQX G;  4JYC A;  1S1C X;  1KC8 Q;  1SQX E;  1ZW0 A;  2D2C C;  3JSV C;  1GW4 A;  2OYI A;  4N78 E;  4BRY B;  4EDF A;  3OJA B;  5AW4 B;  1HWT C;  1WMK A;  2O1J A;  1G1J A;  1MZ9 A;  2JP3 A;  1RF0 A;  3T97 B;  4PV1 C;  4GDO A;  1KYO I;  3CD6 P;  1ZV8 A;  3H1K J;  4Y28 J;  4IFF A;  1U7J A;  1HBW A;  4JBZ A;  2ZJS E;  1LT1 A;  3QWO C;  4OGQ B;  1SQV G;  1M1J B;  2J5U A;  1SQV E;  3ABV C;  1SFC B;  1EZV I;  1NO4 A;  3H6P A;  1YHQ P;  1EXJ A;  2WQY C;  1RE4 C;  3CI9 A;  1GD2 E;  2NPS C;  1NVO A;  3H1I D;  2PAJ A;  1N2D C;  3AE3 C;  2E76 D;  4BWN A;  1L0N G;  4KHX A;  1L0N E;  4IFD K;  5AW3 B;  5TJH A;  3L73 J;  3PP5 A;  5APV A;  3L71 G;  4OGQ C;  4A7P A;  2FYU J;  3L71 E;  5KJ7 C;  2IYO A;  2FBW C;  3H1L J;  1SFC C;  2H89 C;  2WWW A;  4YPC A;  1BGY G;  4TT3 H;  4IFM A;  1OXZ A;  2CK3 H;  1BGY E;  2YXR B;  3VOP A;  1QVF O;  2KS1 A;  1Y47 A;  2L91 A;  5CCH A;  2YMK A;  1M57 D;  2H88 C;  1IK7 A;  1AFO A;  2XZR A;  3L72 G;  4I1L A;  3P7K A;  1KQS O;  3L72 E;  3B5N A;  1ZN5 A;  3L74 E;  5AVU B;  1KZU B;  1DH3 A;  1N8R Q;  3CC4 P;  3MD0 A;  1S9K D;  5APT A;  3FXE A;  1T3J A;  1M8O B;  1FU1 A;  3QH9 A;  2YIU B;  4RES B;  2HYN A;  2A06 G;  2O01 J;  2KUB A;  1UII A;  3L75 G;  1YIT P;  5GTH E;  4MN4 C;  1IK9 A;  2A06 E;  2M3E A;  1NTZ D;  1M1K Q;  1LP1 A;  2FYN B;  2H8P D;  1UIX A;  1ZME C;  1KOR A;  1FJK A;  1R5S A;  5CJ0 A;  3CL3 D;  1KIL E;  2OYI B;  5KLV G;  2WT7 A;  2GA1 A;  2KYV A;  5KLV E;  1GL2 D;  1FZF A;  3VYI A;  1NU1 D;  1JY2 O;  1CI6 A;  1AA0 A;  3CXH I;  1FE6 A;  1RHZ B;  2W83 C;  2KSJ A;  4TLF A;  3IF4 A;  3TYY A;  4XE5 B;  1M90 Q;  2J58 A;  1HUC A;  2HLO A;  1RF0 C;  5CCG A;  1URQ C;  2MKV A;  2H43 A;  4GT1 A;  2Q6Q A;  2ZVO B;  1LTS C;  2YKO A;  1KYO E;  1JNM A;  2QRX A;  1X79 B;  5CMZ A;  2KI7 B;  2KIK A;  1L0L K;  1JMM A;  4HB1 A;  1KFN A;  3EWK A;  3EFF K;  1NOH A;  4H44 D;  1XTC C;  3L73 G;  1M56 D;  5GTH H;  3CCS P;  5BU5 A;  1EZV G;  3L73 E;  3RBX A;  2L5G B;  1EZV E;  2WPQ A;  3H1L G;  3CMA P;  3VMY A;  1FZC A;  3HE4 A;  1PZQ A;  1NTZ J;  2E74 D;  1LTA C;  4JQ0 D;  2KP8 A;  3H1L E;  2NRG A;  3GMA A;  1Y8A A;  3SFD C;  2YO3 A;  2FXP A;  3VTP C;  1DIP A;  3H1J J;  3LIE A;  2K9J A;  3RK3 E;  1K8A Q;  2AXT E;  2QG4 A;  3CCU P;  2QA4 P;  1GK4 A;  1N7S D;  2BEQ D;  3A0B E;  3FWN A;  2N1T D;  3LW5 H;  1OZH A;  1NU1 J;  3B5N B;  1FZA A;  2ZXE B;  1BCC G;  2K3R A;  4H0L C;  3Q5S A;  1BCC E;  1RH5 B;  2JEE A;  2QJY C;  4WY4 A;  1AJY A;  3MZW B;  1SQP K;  1L0N D;  1LP1 B;  5CCH C;  3PJS K;  1VDF A;  1YYC A;  1U7M A;  2QJP B;  2B88 A;  2WT7 B;  5AW6 B;  2IX7 C;  1T3U A;  1QGK B;  1ZR4 A;  1QEX A;  4HYT B;  2UWJ E;  1KYO H;  1CI6 B;  1IFM A;  1QX8 A;  3VMZ A;  5AVR B;  1SQX J;  1SVF A;  3H1I G;  2Q9I A;  5C39 A;  5M1B A;  3JC2 2;  2Q3E A;  3H1I E;  3SFE C;  3U59 A;  2K37 A;  3CX5 D;  3WUV A;  2QJP C;  3G3Z A;  3GG2 A;  4UB6 H;  4M3L A;  1ZR2 A;  1YIJ P;  2WSF H;  1OWA A;  1Q81 Q;  1MFZ A;  4I2L C;  5AW5 B;  2DW3 A;  5TIS E;  3RBZ A;  3M0A A;  4ZMD A;  3A0B H;  3L75 D;  1NTM D;  1PGJ A;  4BXL A;  3MUD A;  1ZLL A;  1VQN P;  1SQV J;  3CLQ A;  1MUU A;  2P67 A;  4EYY Q;  2WTY A;  4K3A A;  2E75 D;  2ZT9 B;  1SQB K;  1NTM K;  5AVY B;  1BSH A;  3GHG A;  1T6A A;  2WPV B;  3EFG A;  1JUN A;  1HF9 A;  2N9Y B;  5APY A;  5CCG C;  4Y99 B;  5BU8 B;  3HE4 B;  1FZC B;  1L0N J;  5BVZ A;  2KZJ A;  1U57 A;  1S4X A;  1NTZ G;  2K9J B;  1IFI A;  3L71 J;  5EFW B;  1NTZ E;  2XKM A;  3CX5 I;  1JTH A;  3CCM P;  1GDT A;  2ZT9 C;  3BRT B;  3KDP B;  1T2K D;  4OVN F;  2V4H A;  5AW8 B;  1LTJ A;  4GKG A;  1BGY J;  2OGU A;  1YTZ T;  1NU1 G;  1NU1 E;  4Y99 C;  1FZC C;  4WY4 B;  2LKM A;  1P84 H;  1LTG C;  3Q3D A;  3I55 P;  4PD4 D;  2OTK E;  1D7M A;  1JY2 N;  1NTK D;  2D2C B;  3D71 A;  4PV1 D;  2Y9Z A;  1FC2 C;  1ZXG A;  3CXH H;  3PLN A;  1LT9 C;  4EIJ A;  4WWI A;  1NTK K;  3L75 J;  1NTM J;  2FXM A;  3WUT A;  2IZ0 A;  1KTM A;  3P32 A;  3B71 A;  4WY4 C;  3O6Q A;  1L0L G;  1L4A A;  3OA7 A;  1IFD A;  3FX0 A;  1LNQ A;  3U1C A;  2BEZ F;  3A0H E;  5AVQ B;  5KLV J;  1S5L H;  2WSE H;  3C9I A;  3TDK A;  1KQG B;  1FDM A;  2NPS D;  2YO2 A;  5APU A;  3LW5 J;  1LTB C;  1AQT A;  5KLI B;  1BCC D;  3FGA D;  4NPD A;  3Q5R A;  1URQ A;  4LLH A;  4OGQ D;  2NPS B;  1OIP A;  5KJ7 D;  1RE3 C;  1H88 A;  4PD4 I;  1SFC D;  2LXB A;  2ZYG A;  2XDJ A;  2K88 A;  5CJ4 A;  2WZ7 A;  2HR3 A;  1E79 H;  1YQ3 C;  3D6Y A;  4IOI H;  3HE5 A;  2YKQ A;  1YBK A;  2FY8 A;  1PP9 D;  3CCR P;  1KD1 Q;  5KLI C;  2OYH C;  2XND H;  1HGV A;  3WMM 0;  5KTB A;  1GTW A;  4U3F G;  3M06 A;  4OH8 B;  3ZDM A;  3AEE C;  1EC5 A;  4U3F E;  2I1J A;  3V2N A;  1S3J A;  3SWF A;  2OTJ P;  4HKZ H;  1Y9B A;  3MUD C;  3IN6 A;  1JTH B;  4YTP C;  1P84 D;  2P7J A;  3BAS A;  2YNY A;  2M0B A;  4ZNC A;  4ASW A;  2RMZ A;  1W2E A;  3HRN A;  3PRJ A;  1EXI A;  1HH0 A;  3GHG C;  2WSF J;  3IR9 A;  1VQP P;  3A0H H;  5L8R J;  3CXH D;  2B9B A;  2B87 A;  2ZVN B;  4ASV A;  4U7J A;  1HJ0 A;  1IFN A;  3JCU H;  1S5L X;  3AE4 C;  4ZKU A;  2M5A A;  2HOD A;  3M0D A;  4AQR D;  2JJL A;  3WUU A;  3RGU A;  1G1I A;  4UB8 H;  2JO1 A;  2N9B A;  5E79 E;  3CX5 E;  2PFX A;  1BCC J;  2PP6 A;  1NGM B;  5DJU B;  1A02 J;  1GZL A;  5B5E E;  1LTJ C;  2YKP A;  2Z5I A;  3KYQ A;  1IZN B;  5CBN A;  1KB9 I;  1HJB A;  1KFM A;  2AXC A;  3CCQ P;  3O6Q B;  2IBZ I;  4WBA A;  1SQB G;  1L4A B;  1NTM G;  2FYZ A;  3V6I A;  3KQG A;  2QSI A;  3L75 E;  1NTM E;  2G3A A;  1P84 I;  1DEB A;  2GUV A;  1PP9 J;  4JYB A;  1NKN A;  2CPB A;  3H1I J;  2HPC A;  3CPW O;  3A2A A;  1URQ B;  1RF1 A;  2KZI A;  4Z1M H;  3E1I A;  3HUS A;  1L4A C;  3RL0 B;  2E5T A;  5KKZ C;  1VQ6 P;  3Q2Y A;  1LJ2 A;  1SQQ K;  4NPF X;  3AE1 C;  3HE5 B;  3VP8 A;  1RY3 A;  3UIA A;  3V2R A;  3AE2 C;  3B4S A;  3H25 A;  2O01 N;  1GU4 A;  3N4X A;  2C0W A;  4JPZ B;  1JY2 P;  1JY3 N;  1NWQ A;  1L0L D;  2NZ2 A;  3V4Q A;  1X0T A;  3AED C;  5E79 H;  3CX5 H;  3RL0 g;  3R2P A;  3RL0 C;  2WSS H;  5AVX B;  5B5E H;  1OW8 A;  4PD4 E;  1H89 A;  1JM0 A;  1NTK G;  3NTN A;  3TNU A;  2WSE J;  1FJP A;  2FKW B;  1NTK E;  1OVU A;  1S2E A;  4H13 B;  2I1K A;  2OQQ A;  3MHV A;  5CCH D;  3H32 A;  4H0L B;  3SWY A;  4L74 A;  2Q3I A;  2B87 B;  2QE7 H;  1OVR A;  4UB6 E;  2QJY B;  4D6T D;  2XU6 A;  2O3J A;  3B5N D;  2M5A B;  4GOF A;  2KS1 B;  2HOD B;  3USS A;  1KIL A;  3AE7 C;  2HFE D;  1H0T A;  3S1K A;  1QVG O;  1SQP D;  4H13 C;  4LGD E;  1LT9 A;  3AEF C;  2KB7 P;  5B66 E;  1NH4 A;  5APQ A;  2ZYD A;  4U3F D;  2SPZ A;  3TGU D;  3HD7 A;  2P2U A;  1Q90 D;  4C7N A;  2W6A A;  3OAK A;  3EQ2 A;  1PGO A;  3W68 A;  1NHL A;  3M0D C;  4HH2 A;  2KOG A;  3AE5 C;  2A45 I;  3BCC D;  2AEF A;  1N73 A;  3V2Q A;  1PP9 G;  3GLM A;  3ITK A;  1L0L J;  1PP9 E;  2HPC B;  3P8C D;  1RF1 B;  3F89 A;  4PD4 H;  2IBZ G;  3HUS B;  2QVA A;  4DZO A;  1IJD B;  1VF5 B;  1RE3 A;  4AUW A;  4K35 A;  1E5W A;  5CCG D;  2QJK B;  4N6J A;  1AVY A;  5AW0 B;  1P84 E;  2BAS A;  1N7S C;  1NYH A;  1L2P A;  1BSN A;  1BDD A;  2E43 A;  4W7Z A;  1CW5 A;  2KSE A;  1NAY A;  2OYH A;  1RF1 C;  1VQ7 P;  3L4F A;  2ZT9 D;  1J2J B;  3CXH E;  1SQB D;  3HUS C;  4WB4 A;  2ZAE B;  1GMJ A;  1VF5 C;  3FWL A;  3B8E B;  3V4W A;  4I6M C;  5B66 H;  3TNU B;  3H1H G;  1SQP J;  2QJK C;  1IFP A;  4WVZ A;  3H1H E;  1PIX A;  2POH A;  2KK7 A;  4I7Z B;  4O9B A;  1S5L E;  4U3F J;  3H32 B;  3TGU J;  3V5B A;  1VQ8 P;  1M7L A;  3V2P A;  1W2B O;  1K9M Q;  1VQ4 P;  3VP9 A;  1KIL B;  3MGN A;  4EOT A;  1H0T B;  2JWA A;  4WY4 D;  4GOD A;  3MIW A;  2ZXX A;  1JY3 O;  5GTI E;  1KB9 H;  1LT9 B;  2Z5H A;  4I7Z C;  2Q5U A;  2D2C D;  5CBO A;  3H1K D;  1PFI A;  5H2F E;  2Q7C A;  3HD7 B;  4C7N B;  2BCC D;  2P1J A;  3FXD A;  3W67 A;  5AVV B;  4R4M A;  1YI2 P;  1KIL C;  2C0X A;  2WPR A;  3BRV B;  1N73 B;  1VQK P;  1MFT A;  3D6Z A;  1KMI Z;  5CHX A;  1SQB J;  1BE3 D;  2GM4 A;  2VRS A;  3TK1 A;  1J1E C;  3HD7 C;  1YTZ I;  3BVH A;  1HGZ A;  1K05 A;  1VPC A;  1L0L E;  3PTZ A;  1PGQ A;  1ZRT E;  2P10 A;  3CCL P;  2W90 A;  3D70 A;  2LXC B;  2K1A A;  3S4R A;  2QM7 A;  3JCU E;  2KNC A;  4RKU J;  1FAV A;  2Q1K A;  1N73 C;  3PHL A;  3CCE P;  2XNX A;  3AE8 C;  2FYU K;  5AW1 B;  2OYH B;  1CSB A;  4NPE A;  4UB8 E;  4KJM A;  3RK2 C;  4D6T G;  3VMX A;  4D6T E;  3CCV P;  5GTI H;  5K5G B;  3KZI E;  1FBM A;  1KQF B;  3RK3 B;  4XA4 A;  1FZB A;  5KAI H;  1HTL C;  2O1K A;  3Q1M A;  1OFC X;  2W8Z A;  4L75 A;  2H7H A;  2KXP B;  5H2F H;  2C9N Y;  2IYP A;  3C1L A;  1SQP G;  3GHG B;  1GL2 A;  3TSI A;  3L70 D;  1SQP E;  3VN0 A;  1KB9 D;  1NJI Q;  2BCC J;  2YMY A;  3TGU G;  2IBZ D;  1VQO P;  1CZQ A;  2AEJ A;  1NAF A;  3TGU E;  1EQ7 A;  1DD4 A;  1QLE D;  1NTK J;  2R3C A;  3RK3 C;  3IFM A;  2QEX P;  1PGP A;  1R5L A;  5APS A;  3MP7 B;  4C7R A;  2V7Q H;  3BCC G;  1DD3 A;  2WSC J;  1BE3 J;  1DX7 A;  2ZFC A;  3E1R A;  3BCC E;  1PV3 A;  1LTJ B;  1G2C A;  3NFQ A;  5AW7 B;  3CWB D;  3N7N A;  1HVV A;  4JF7 A;  3P8C E;  1FS0 E;  2Y0E A;  2JWD A;  2E76 B;  1M1J C;  3NXS A;  3GW6 A;  2RH0 A;  2A45 H;  1X22 A;  1FZG A;  3WU2 E;  1YJN P;  3H1H D;  1JMB A;  4QMA A;  3M91 A;  2WPS A;  2FFD A;  2E42 A;  1L4A D;  2Y9Y A;  2HG5 D;  1PPJ D;  3AEC C;  1AVO A;  1EDK A;  3KZI H;  3CC7 P;  3A5T A;  3VMA A;  4B86 A;  3C8V A;  3L74 G;  1SQB E;  2E76 C;  4LC1 A;  5KKZ B;  2ITA A;  2P58 A;  5AW2 B;  1EDL A;  2K9Y A;  3CME P;  1Q86 Q;  1URQ D;  4C46 A;  1FOS E;  2KLV A;  2KNC B;  3L70 J;  1N7S A;  2B89 A;  3L36 A;  2N1T A;  4W7Y A;  3RL0 D;  3A7O A;  1OX3 A;  5APX A;  4W80 A;  1YJ9 P;  1QL1 A;  4N3Y B;  3H1J D;  1SQQ D;  4KT0 J;  4DT0 A;  1NTZ K;  2JDI H;  1LWU A;  2R5B A;  3G71 P;  1VL2 A;  4OWF A;  2YIU C;  4L73 A;  1YQ4 C;  2R32 A;  3AEA C;  1USE A;  3CWB J;  4AYC A;  4EI2 A;  1GL2 B;  1NU1 K;  2FYN C;  1S72 P;  3A3Y B;  1FOS F;  4IL6 E;  3SWK A;  3H1K G;  3WU2 H;  3MTU E;  3O8Z A;  1Q7Y Q;  2I8D A;  2FXO A;  2OYI C;  3H1K E;  4H13 D;  1DEE G;  1ZRT D;  2BCC G;  2W6J H;  3AEB C;  3H1H J;  2R44 A;  3Q5P A;  2BCC E;  4H0L D;  3GF7 A;  1GW3 A;  4HJG H;  3S9O A;  1IC2 A;  1N86 A;  4CPG A;  1LTT C;  4XFJ A;  4R4L A;  1GL2 C;  1SQX D;  5AVW B;  1G2C B;  5AVZ B;  1RQU A;  2KLU A;  1BE3 G;  1K04 A;  1KV4 A;  3F5H A;  4N78 D;  1FZE A;  1OVV A;  1WRG A;  1BE3 E;  3M9Q A;  1PL5 A;  1WT6 A;  1AQ5 A;  4PJ0 E;  2C9L Y;  1SQX K;  4L76 A;  1R8E A;  2PRR A;  2FYU G;  3E7K A;  2FYU E;  2FFD B;  2M8R A;  1JCC A;  1GU5 A;  4H44 B;  3IAO A;  1JB0 J;  3PH0 A;  3KXD A;  1QL2 A;  1SQQ J;  3TF5 A;  2IDB A;  1IO4 A;  3OW2 O;  2E74 B;  1K73 Q;  1SQV D;  2Y0C A;  1VQM P;  5AVT B;  1LGH B;  2GUS A;  2YXQ B;  1W5C E;  2Z4E A;  1MKM A;  1EDI A;  3G6E P;  2FFD C;  4IL6 H;  1JO5 A;  3KHU A;  1N7S B;  1SQV K;  2N1T B;  2AEM A;  2V7Q J;  5AW9 B;  1VF5 D;  4ZKP A;  4H44 C;  3HTK A;  3AE6 C;  2IFM A;  3L70 G;  1XTG B;  3L70 E;  2IZ1 A;  1X9V A;  2W6B A;  4RO0 A;  2QIW A;  1JOC A;  1KB9 E;  3L71 D;  1N7L A;  2E74 C;  2WMM A;  1BDC A;  1SS1 A;  1L0N K;  2IBZ E;  3B5N C;  2XV5 A;  1LWU B;  3NMD A;  3L35 A;  3I5C A;  1BGY D;  3M9B A;  1SP4 A;  2WSC H;  2J59 M;  2N1T C;  3P8M C;  4DCK A;  3U1A A;  4YXD C;  4DOJ A;  4PJ0 H;  2CPS A;  1T8Z A;  4D6T J;  3CWB G;  1X8Y A;  5KAF E;  2WVR A;  3CWB E;  3AEG C;  1A02 F;  1FDI A;  4BRY A;  3L72 D;  3SSU A;  3L74 D;  1ZP0 C;  2MJZ A;  2WIT A;  1J1D B;  1LWU C;  3GF3 A;  4RJT A;  2LR2 A;  1TU3 F;  1Q82 Q;  5APW A;  3T97 A;  2AXT H;  1USD A;  1RE4 A;  2JKV A;  1VQL P;  2M3B A;  2NPS A;  2A06 D;  2G8Y A;  3CCJ P;  1PPJ G;  2IFN A;  1PPJ E;  1KQL A;  1OW6 A;  2JR8 A;  1KIL D;  2RN0 A;  5KLV D;  1GK6 A;  1Z56 A;  2IPP A;  1Q2N A;  1M1J A;  5KJ7 A;  1OMI A;  4IL6 X;  1J1D C;  1SFC A;  2OYO A;  3AE9 C;  3BCC J;  3KPE A;  5KLV K;  2E75 B;  3HD7 D;  1S9K E;  2O01 H;  1NKZ B;  1JEK A;  2ZYA A;  5KAI E;  1SLQ A;  1ZOY C;  3LID A;  2RKL A;  2QM8 A;  3K5B A;  3H1J G;  1J1E B;  1SQQ G;  2E5Y A;  2W27 A;  1VQ5 P;  2Y0D A;  1IFJ A;  3H1J E;  1SQQ E;  1KN7 A;  5DJT B;  1EDJ A;  1H8A A;  2OTL P;  3RK2 D;  1JCD A;  5KAF H;  2OAR A;  2E75 C;  3L37 A;  1LTI C;  1JY3 P;  1YJW P;  1KYO D;  3HTK B;  3BAT A;  3G9R A; 
#chains in the Genus database with same CATH homology
 3N7N A;  3V4Q A;  1HVV A;  4JF7 A;  3P8C E;  3R2P A;  3RK2 B;  3RL0 C;  5AVX B;  3U59 A;  3M9H A;  1M1J C;  3NXS A;  4GIF A;  2A45 H;  1H89 A;  2R5D A;  3NTN A;  3TNU A;  3G3Z A;  1FJP A;  1FZG A;  4M3L A;  1ZR2 A;  2FKW B;  1MV8 A;  3II6 A;  3M91 A;  5AVS B;  2WPS A;  2FFD A;  2WSF H;  2I1K A;  2E42 A;  1L4A D;  1OWA A;  2HG5 D;  1MFZ A;  2A45 G;  5CCH D;  4I2L C;  5AW5 B;  3H32 A;  3SWY A;  1T2K C;  2Q3I A;  3M0A A;  3RK3 D;  4JYC A;  3A5T A;  2XU6 A;  4B86 A;  3B5N D;  3MUD A;  1ZLL A;  1GW4 A;  2OYI A;  4N78 E;  3CLQ A;  1MUU A;  2P67 A;  2HOD B;  2WTY A;  4LC1 A;  1SQB K;  3OJA B;  1KIL A;  5AW4 B;  1HWT C;  5AW2 B;  1NTM K;  2HFE D;  2O1J A;  1URQ D;  5AVY B;  4C46 A;  1FOS E;  1G1J A;  2KLV A;  3GHG A;  1MZ9 A;  1RF0 A;  1JUN A;  3EFG A;  1N7S A;  1LT9 A;  4LGD E;  5APY A;  3L36 A;  2N1T A;  2KB7 P;  5CCG C;  4W7Y A;  1NH4 A;  4Y99 B;  3RL0 D;  5BU8 B;  3HE4 B;  3A7O A;  1FZC B;  5APX A;  1ZV8 A;  4W80 A;  5APQ A;  5BVZ A;  1QL1 A;  4IFF A;  1HBW A;  3HD7 A;  4N3Y B;  2P2U A;  1IFI A;  4C7N A;  2W6A A;  3OAK A;  2XKM A;  1JTH A;  3EQ2 A;  1NTZ K;  1NHL A;  3M0D C;  1GDT A;  1LWU A;  2R5B A;  1M1J B;  4HH2 A;  3BRT B;  3KDP B;  1T2K D;  2KOG A;  1SFC B;  2A45 I;  5AW8 B;  1NO4 A;  1N73 A;  1LTJ A;  4GKG A;  3H6P A;  1YTZ T;  3V2Q A;  2R32 A;  1RE4 C;  3CI9 A;  4AYC A;  1GD2 E;  1GL2 B;  2NPS C;  4Y99 C;  2HPC B;  3P8C D;  1FZC C;  2PAJ A;  4WY4 B;  1N2D C;  1RF1 B;  1NU1 K;  4KHX A;  2LKM A;  1FOS F;  3A3Y B;  1LTG C;  3HUS B;  3MTU E;  3O8Z A;  4DZO A;  4IFD K;  1IJD B;  5AW3 B;  2OYI C;  1RE3 A;  1JY2 N;  4AUW A;  3PP5 A;  5APV A;  1E5W A;  5CCG D;  4N6J A;  5KJ7 C;  5AW0 B;  1SFC C;  1GW3 A;  2BAS A;  1N7S C;  1LT9 C;  4EIJ A;  1IC2 A;  1N86 A;  2E43 A;  2WWW A;  1LTT C;  1NTK K;  4W7Z A;  1CW5 A;  2FXM A;  1GL2 C;  5AVW B;  1G2C B;  3P32 A;  1OXZ A;  4IFM A;  2OYH A;  4WY4 C;  5AVZ B;  3VOP A;  1RF1 C;  3L4F A;  1L4A A;  1J2J B;  3OA7 A;  4N78 D;  1FZE A;  1IFD A;  1WRG A;  3HUS C;  4WB4 A;  5CCH A;  3M9Q A;  3U1C A;  5AVQ B;  3B8E B;  1WT6 A;  1AQ5 A;  3V4W A;  2C9L Y;  1AFO A;  2XZR A;  2WSE H;  3C9I A;  1SQX K;  4I6M C;  1FDM A;  4I1L A;  3P7K A;  3TNU B;  2NPS D;  2YO2 A;  5APU A;  3B5N A;  1ZN5 A;  5AVU B;  1KZU B;  1DH3 A;  1LTB C;  2FFD B;  3MD0 A;  2M8R A;  1S9K D;  5APT A;  2POH A;  1T3J A;  1FU1 A;  1JCC A;  4O9B A;  1GU5 A;  3H32 B;  4RES B;  2HYN A;  1URQ A;  3V5B A;  4LLH A;  2NPS B;  1QL2 A;  1IK9 A;  5KJ7 D;  1RE3 C;  1IO4 A;  1M7L A;  2H8P D;  1H88 A;  3V2P A;  1SFC D;  1FJK A;  5CJ0 A;  3CL3 D;  2OYI B;  2XDJ A;  5CJ4 A;  3VP9 A;  5AVT B;  2WZ7 A;  1LGH B;  2WT7 A;  2GUS A;  2KYV A;  1KIL B;  1GL2 D;  3MGN A;  4EOT A;  1FZF A;  2Z4E A;  4WY4 D;  3HE5 A;  3MIW A;  1JY3 O;  2YKQ A;  3VYI A;  2FFD C;  1JO5 A;  1JY2 O;  1CI6 A;  1N7S B;  1LT9 B;  1SQV K;  2Z5H A;  2N1T B;  5AW9 B;  2OYH C;  1HGV A;  3WMM 0;  4ZKP A;  3HTK A;  2KSJ A;  5KTB A;  2IFM A;  1GTW A;  2Q5U A;  1XTG B;  3M06 A;  4OH8 B;  1PFI A;  2Q7C A;  3HD7 B;  2I1J A;  1X9V A;  2W6B A;  3V2N A;  3SWF A;  1JOC A;  3TYY A;  4C7N B;  2P1J A;  1N7L A;  1JTH B;  4XE5 B;  1L0N K;  2J58 A;  2P7J A;  5AVV B;  3B5N C;  3BAS A;  2XV5 A;  2YNY A;  1LWU B;  1KIL C;  3NMD A;  2C0X A;  1HUC A;  2WPR A;  3L35 A;  1W2E A;  2HLO A;  3HRN A;  1HH0 A;  3BRV B;  1N73 B;  3GHG C;  3I5C A;  1RF0 C;  5CCG A;  3M9B A;  1SP4 A;  2WSC H;  1URQ C;  2J59 M;  2N1T C;  3P8M C;  3IR9 A;  3U1A A;  2H43 A;  4GT1 A;  5CHX A;  4DOJ A;  2CPS A;  2GM4 A;  1LTS C;  1T8Z A;  2YKO A;  2VRS A;  3TK1 A;  1IFN A;  1X8Y A;  1JNM A;  1J1E C;  3HD7 C;  1YTZ I;  3BVH A;  1HGZ A;  4ZKU A;  1X79 B;  1A02 F;  5CMZ A;  1VPC A;  2HOD A;  1L0L K;  2MJZ A;  1JMM A;  3M0D A;  4AQR D;  2JJL A;  1KFN A;  1G1I A;  2WIT A;  1J1D B;  1NOH A;  2N9B A;  1LWU C;  1XTC C;  2QM7 A;  2PP6 A;  1FAV A;  5BU5 A;  1A02 J;  5APW A;  3T97 A;  1N73 C;  1GZL A;  1LTJ C;  2L5G B;  1RE4 A;  2YKP A;  2Z5I A;  3KYQ A;  2M3B A;  2XNX A;  2NPS A;  2WPQ A;  3VMY A;  1FZC A;  3HE4 A;  1HJB A;  1KFM A;  1LTA C;  2FYU K;  5AW1 B;  2KP8 A;  2IFN A;  2OYH B;  1CSB A;  1KQL A;  4WBA A;  2YO3 A;  1L4A B;  1KIL D;  3VTP C;  3RK2 C;  3LIE A;  2FYZ A;  3KQG A;  3VMX A;  1GK6 A;  1Z56 A;  3RK3 B;  1FBM A;  4XA4 A;  1GK4 A;  1DEB A;  1N7S D;  2GUV A;  2IPP A;  2N1T D;  3LW5 H;  1FZB A;  1M1J A;  5KJ7 A;  1J1D C;  1HTL C;  1SFC A;  2O1K A;  3B5N B;  3KPE A;  1FZA A;  2ZXE B;  4JYB A;  2H7H A;  5KLV K;  2C9N Y;  3HD7 D;  1S9K E;  1NKN A;  2O01 H;  1NKZ B;  3GHG B;  1GL2 A;  3TSI A;  2CPB A;  2HPC A;  2JEE A;  4WY4 A;  3A2A A;  1URQ B;  1RF1 A;  1SLQ A;  3VN0 A;  1SQP K;  3LID A;  3E1I A;  3HUS A;  2YMY A;  1L4A C;  2QM8 A;  5CCH C;  1CZQ A;  3RL0 B;  1VDF A;  1NAF A;  1J1E B;  1EQ7 A;  1YYC A;  2W27 A;  2R3C A;  3RK3 C;  1IFJ A;  3IFM A;  2WT7 B;  5AW6 B;  2IX7 C;  1SQQ K;  1T3U A;  5APS A;  3HE5 B;  4C7R A;  1ZR4 A;  1H8A A;  3VP8 A;  1RY3 A;  4HYT B;  3RK2 D;  1CI6 B;  1JCD A;  3UIA A;  1IFM A;  3V2R A;  2OAR A;  1DX7 A;  2ZFC A;  3L37 A;  1LTI C;  3VMZ A;  5AVR B;  1JY3 P;  1GU4 A;  1LTJ B;  3N4X A;  2C0W A;  1G2C A;  3HTK B;  1JY2 P;  1SVF A;  3NFQ A;  1JY3 N;  5AW7 B;  3BAT A;  2Q9I A;  1NWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...