1RF2D

Cholera toxin b-pentamer complexed with bivalent nitrophenol-galactoside ligand bv4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cholera toxin B protein (CTB)
publication title Nonspanning bivalent ligands as improved surface receptor binding inhibitors of the cholera toxin B pentamer.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 25
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rf2D00
1SJED 1CK1A 1TY2A 4C56C 1I4RA 1B44D 2Z8LA 1BCPF 3R8BA 3W2DA 1SXTA 2NTSA 4RGOS 1LT6D 1LTTD 2AQ3B 2J4XA 1SJHD 1RD9D 1UUPA 5FKAC 2SEBD 1HQRD 1QILA 1ESFA 2AQ2B 1BCPB 1D6EC 1FNWA 4RFBA 1XTCD 5ELCA 1DYQA 1I4XA 3DWQA 1KLUD 1AN8A 1TS4A 4L6TB 1HXYD 1EU4A 1PRTD 1JWMD 1TS3A 1UNSA 1XXGA 1LTBD 1AW7A 3O13A 1S5FD 1TS2A 1V1OA 1STEA 3GP7A 1JCKB 1PZID 1LT4D 1GOZA 1G8ZD 5ELDA 1PRTC 1EFID 1FNUA 1LTID 2ICIA 4O1NA 1ENFA 1EEFD 1LLRD 1S5CD 4RHRA 1HA5A 1LT5D 1D5ZC 2XN9C 3CHBD 1EEID 1I4QA 2RDGA 2XNAC 1PZJD 3KLSX 1ET6A 1B1ZA 1JR0D 1KLGD 1PTOH 1TY0A 2CHBD 4K6LA 1L0YB 1V1PB 1S5DD 4UDUC 1FD7D 1S5ED 4RGNA 1JWSD 1JWUD 1PTOD 1CQVA 1RF2D 1I4GA 1I4HA 1PYWD 1FGBD 1SEBD 2RDHA 5I4DA 1FNVA 1LTSD 1ET9A 1PTOC 3BVZA 1SBBB 1RCVD 1S5BD 1D5MC 1MD2D 1SE2A 4DXGA 1M4VA 1CT1D 1SE4A 1LTGD 4Z9CB 3URYA 1RDPD 3R2IA 1L0XB 2G9HD 4OHJA 4RCOA 3R2TA 4RHSA 2IPKD 1T5XD 1I4PA 1JQYD 3MFGA 5ELBA 1KTKA 2WV6D 3TSSA 1PRTF 3BVGA 1PTOF 5TSSA 2NTTA 5D3DA 2XRSD 2XRQD 2O2LD 4BWGB 3EA6A 1F77A 1HTLD 2AQ1B 4RGMA 4RGTA 3EFXD 3DWAA 3V05A 1BCPD 4TSSA 3SEBA 4RH6A 3DWPA 1PRTB 1PTOB 2IJ0A 2QILA 3OWEB 1TS5A 5D3IB 1LO5D 3BYYB 2R61A 1BCPC 3BZDB 2QEJC 1EU3A 1CHQD 1CHPD 1EWCA 2TSSA 4DXFA 1LTAD 1PZKD 1LTRD 1V1PA 3MC0B 5ELEA 3BYTB 5ELFA 4ZYSA 1LT3D 1DJRD 3BVMA 5FK9C 1BXTA 4L63B 1SE3A 1D5XC
chains in the Genus database with same CATH superfamily
1NY4A 1KDAA 1TY2A 4ME3A 4YIJA 3HKZE 2J0TD 1SXTA 5H1SE 4DR4L 1LT6D 4KMUC 1PXUA 1Z9FA 2KHSA 2SOBA 1CI3M 4FP5D 4JI4L 3PF4A 3NBHB 4JYAL 5LHY1 4CKBA 4OWTB 1L2FA 4L6TB 4HIMA 1TS3A 3BZCA 1IYJB 3X3MA 4IUUA 1Q90A 4DK0A 1I3QB 2NUCA 1G91A 1TS2A 1V1OA 1SSOA 3NUCA 4WFN3 1YHAA 3DEPA 1G8ZD 5C4JB 4LFAL 5ELDA 2ATWA 3RMHA 4JK1C 4LF6Q 4O1NA 2ZJPA 1F2MA 2A73B 4Q0FA 1GUWA 3H3VH 1IKLA 1S40A 4O0AA 1IYVA 4LK1C 3T4AC 2HUGA 1S5ED 1TVXA 1PH1A 4HEDA 2UU9L 1PTOD 1N36Q 1IXRA 2FXQA 4TRDA 3GD7A 4XIGS 3C1FA 1MIUA 4CDEC 3TS2A 1YNJC 4WJ4A 4OIJA 4TKOB 1RCVD 4BBRG 1H9SA 3STBC 1HFGA 3T56B 3R2IA 3S24A 4A3JH 4LFBQ 4QCLA 1WVLA 3A7AB 2HDMA 2A68C 1HNZQ 2MPMA 4LF9Q 4I65A 4A3JG 1STBA 1I94L 4KY7A 1T5XD 3F2UA 3HOVH 4IZ8A 3HOVG 2K33A 5KEEA 4DU9A 4P73A 2KBNA 1E1OA 2EJMA 3GTJH 1STGA 3GTQB 5IT9c 2NZ1D 1NJIC 4ZUIA 4AH6A 2MJ8A 3PO3H 3IRBA 5EBCA 4GOPB 5IYDH 1EWHA 4Q5VA 4J1MA 4DR3L 4DXFA 1CHPD 3PO3G 5IYDG 4G4KA 3M7NA 2VUMH 1FGUA 3NE5B 2AHOB 4CDCC 1OTCA 2VUMG 3T1HL 4A3GH 3BYTB 2EJFC 1VQ5A 4A3GG 1QNKA 5LMUL 1KNAA 2YU9H 3KFUA 3FMCA 2D9UA 1NNXA 4A3JB 4FXGC 3W2DA 3DLLA 2PW7A 1LTTD 4LMQD 3P75A 4JOIA 4DNTB 3HOVB 2B29A 4L5SA 1MGSA 4FXKC 2EY5A 3CCUA 3GTJB 2GVBA 1AN8A 1PFNA 4JV5L 1DXMA 2ZXRA 4MNOA 3T1YQ 3NPPA 1B70B 3PGZA 3PO3B 2EXZA 1WTHA 1EWIA 2F4VQ 1GUGA 3SHLA 2VUMB 1JICA 2B8GA 4DV6Q 4R4IA 2XNAC 1VDZA 3SK4A 4NP5A 4UP7A 1EY6A 4XT3B 1B1ZA 3TZDA 1UE7A 1SYEA 2KENA 4KJNA 2JA7H 1YHQA 4AYBE 3MFYA 4RGNA 1PV4A 3K5LA 2JA7G 3LWEA 2VQFQ 5I2YA 3SK5A 2EYFA 2IX0A 1YJWA 1LABA 1SMYD 3GTMH 3FPUB 1SYDA 2FFKB 3DHQA 4DFAA 3OW7A 4YHHQ 1MSGA 2K03A 3G48A 1G2TA 3CMEA 3S1RH 1HR0W 1B53A 2PNRC 2F0UA 2UUAQ 1R4QB 1VMCA 5FJ8H 5IGFA 4EQNA 3G6EA 2IWHA 2ZJRA 5FJ8G 3NQIA 2WIIB 2A69D 2WV6D 2ZM6L 2BDOA 3TS0A 2K1BA 1X3FA 2XRSD 2LY7A 3QB3A 4OGQC 1HTLD 3C2PA 1DOKA 3DWAA 4NPSA 4ZCKA 3WWVA 1PYSB 4ALPA 4BY1H 1HZCA 2K05A 3OWEB 1CUKA 4BY1G 3CPWA 2K4KA 4FXDA 4CGYB 5JAVA 4OO1H 2JA7B 3C3LA 4OO1G 3M85A 4A75A 3VYUA 1V1PA 2Q2UA 1XYIA 2PQAA 1CKMA 2Z1CA 2B3GA 1UWVA 1X56A 2UXCQ 1EY5A 1EIHA 1VF7A 4DR6Q 4DV2Q 4H02A 4DR2L 1HNWL 4QJFA 3S1RB 4DN4M 1VQPA 3BDCA 2SNMA 2ICEC 3MEHA 2J4XA 3AFPA 3KF8A 4YCUA 2RCFA 4IJHA 2NWGA 1BCPB 5E4WC 4KKTA 3VR4A 2ZXOA 2ZJQA 3TMEA 1E2VA 1KXLA 4P72A 1B50A 5J22A 3HOXH 3V2TA 2L12A 2UXDQ 1KNEA 4BY1B 1STEA 1JCKB 3HOXG 1KAAA 4B3TQ 1Q8IA 3F2DA 4EGVA 3RN5A 2ICIA 2IY5B 3CD6A 5C3WA 5GAGC 3MXPA 1W6KA 1SN8A 2PPBC 1I4QA 3KK7A 2X6LA 3U4VA 2O4XA 2RBMA 3RZOH 5M3MH 1E2ZA 4NMZA 2UXBQ 4K8IA 4B3RL 5M3MG 4A3FH 2PI2E 1J6QA 1ASZA 5FLMH 1JJ2A 2M00A 4A3FG 3F2CA 5FLMG 1SE8A 2TMPA 1XMOL 4F8MA 5KNCA 4KY5A 5FO7B 1JE4A 1KRSA 3H3VC 4OX9Q 5D65A 5IT9L 5AJ3Q 4EQOA 4A3LH 2QGQA 4A3LG 3GO5A 2R3ZA 3J80c 4MHEA 5IY0A 1SE2A 1RHPA 1ILPA 3WOFA 3URYA 1IL8A 3SR1A 1XJVA 4PMCA 2JK8A 4LF8Q 3HOXB 5FOBB 3TZUA 2V1CC 4L8JA 1AP0A 3OHXC 1ASYA 4FO2A 1SYCA 1JB3A 1XWEA 2NTTA 2A6HD 1SAPA 5D3DA 2K04A 2IHEA 4FNFA 1VQJA 5M3MB 4B3MQ 3ND8A 5BN3A 4A3FB 1XPUA 5JVG3 1WI5A 3NSWA 4JI0L 1KDBA 3EJIA 2K28A 1LTRD 5F2DA 4DGZA 2IHFA 2KCCA 1KHIA 1A3TA 5KGUA 5NUCA 1K3BC 4NXML 4DV3Q 1VQGA 1FJGL 5I9OA 1G51A 5A35A 1YHBA 2DUDA 5IGCA 5J1ZA 3R8BA 1QNUA 3OIPA 4IO9A 3GV6A 3AFQA 4ZRZA 1EZ6A 2K7VA 5IWAL 1IYUA 3I4MH 3CXCA 1ESFA 4DAVA 1DYQA 3I4MG 1G6ZA 2VW9A 1EYCA 1MKHA 1UNSA 2R93H 4LFCQ 1AW7A 4KHVA 2R93G 1STAA 1LT4D 4DV0Q 1PRTC 1JOQA 2R7ZG 3BZKA 2K01A 1HTPA 3K59A 1IHZA 3UDIA 2A19A 1OXXK 4B3SL 3M4PA 3E3XA 3D31A 1DD2A 1YNND 4HJ9A 3VYSA 4L5QA 1K8MA 5AFWA 4A3BH 2B2YC 2CW0C 4R8NA 4KLKA 4A3BG 2EYLA 2EYHA 5CV6A 4BBSH 5CYUA 3D4DA 4EVOA 3NENA 4JI2L 3NK9A 3KLSA 4A93H 4O42A 5HGQA 3GTOH 4A93G 5EGTA 3A55A 3PMFA 4POGA 3PUVA 3I4MB 1MD2D 2IL8A 2R93B 1VQ8A 1L0XB 2F3VA 2D0OA 4BA1I 5EJWA 3E6ZX 3DXJC 1K83H 2L5TA 1P8LA 1M90C 1NUCA 1S4ZA 1CZGA 2DY7A 5DAUA 2N49A 4F7XA 4LF5Q 4DKAC 2B8FA 2VB2X 3A8IE 4IURA 1Z6HA 1WJJA 4A3BB 1SRUA 4I7ZC 4RH6A 2LMCB 2F4IA 2JYOA 1YVCA 4LF4Q 2A6ED 1TXYA 1BCPC 1SLJA 4TVAB 5CC4A 4BBSB 2I0QA 1WTWA 3K5NA 1CKOA 3D4WA 5KRUA 2BE5C 1CA6A 4A93B 4AQYQ 5E3FA 3GTOB 3VA5A 3FRPB 3CP0A 4C1NI 4FF1A 1OXUA 4LW1A 1C9OA 1D7QA 2F0EA 4CDDC 1SE3A 1XNRQ 1QCBD 4X62L 3CQZH 3E9HA 4HMIA 3TP7A 4DR7Q 1C48A 1HZAA 1K83B 3AYHB 3WOEA 3KJPA 2BH8A 5GQOA 5CBAE 4DUZQ 1HQRD 3MHBA 3OW2A 4RFBA 4OWWB 4G57A 1AEXA 1T5EA 4A4IA 3CU7A 2F3IA 1X3PA 1BNZA 3J7AF 1FL0A 2DJFC 3I56A 4ULLA 4NW2A 3J80L 4DV7L 1ONLA 1PA6A 4BY7H 4BY7G 2HQLA 3I8ZA 3GTLH 3MXUA 2RDGA 4OIKA 1QZGA 3N6RA 4K5XA 3I7FA 2D62A 1PTOH 4NXNQ 5HGTA 1DOMA 1FD7D 1FR3A 2ZTCA 2E5LL 1I4GA 1HNXQ 4OEMB 4GKJL 3S2HH 4LFBL 4X64L 3UE0A 3T13A 1X9NA 3OSOA 3S14H 2LXJA 3KBXA 2MQHA 3HFZB 4N9TA 3VR3A 4UPAA 4BY7B 1VQBA 1EQRA 4KHPL 4X65L 4QL5A 3HKSA 4BWGB 3GTLB 2AQ1B 1E1TA 1ML0D 3EFXD 3VR6A 2K5HA 5D14A 2E2DC 2AUKA 4NB3A 3TQYA 4QY7A 1PTOB 2F0HA 1A2UA 1TS5A 2N3SA 3MXNA 2JXMB 2WAQG 1CKNB 5FO9B 3NQTA 2HDLA 4JI1L 1MI2A 2C5CA 3S2HB 1IBLQ 5ELEA 3LNNA 2DJGC 1NMFA 2I5MX 2RSNA 5A2QE 1LT3D 1DJRD 2YV5A 4C56C 1N32Q 4JCVE 1T9HA 2Z6KA 1A62A 3S14B 4JBJA 1BCPF 4GN5A 3NWSA 4QUCA 1QVFA 5JEAJ 1VMPA 4DAYB 1SJHD 1FYCA 4ZKBB 2RKSA 2PCFB 5C4XH 4JI6L 1CSQA 3T1YL 2A1AA 5C4XG 3P20A 5ELCA 4K6DA 5I2XA 2JP1A 3AQQA 2Q8IB 3BDOA 1XXGA 1LTBD 2NBFA 3H94A 2F52A 4KN4C 1WCMH 4H7BA 3M9BA 1Y1VH 4JI7Q 4S3SA 1NSNS 2WAQB 3GQBA 1Y1VG 2EDGA 2RQXA 1WTOA 2UUCQ 1R4PB 5M5XH 4C1NK 2CQAA 2ASBA 4ABNA 2RHQB 1ZXTA 4DAPA 1KDCA 2VQFL 5LMNQ 3NP8A 3PIP3 2B2UA 2OT2A 3J7YW 1X3EA 4XDXA 5EAYA 3OYYA 2X69A 3QOJA 4KD4A 1HR0Q 4XQNA 1STNA 3U4ZA 5C3EG 4LAAA 1JJGA 1ESRA 3OMCA 5BR8Q 1YBYA 5C4XB 3TN2A 2AMCB 1D5MC 2R7FA 2UUAL 1XX8A 1XMQL 2JEAI 3TP8A 3A8JE 2FINB 1UE6A 2KHIA 1ICFB 5C0XJ 5I6WA 4R9WA 4OHJA 4WRDA 4GS3A 3R2TA 1Y8NB 1Q81C 1WCMB 1LACA 1Y1VB 1YITA 5ELOA 3L7ZC 1CSPA 2CWAA 3KF6A 4AIMA 3HZXA 4GLAC 2KVMA 2UUBL 2MO1A 5M5XB 3ERQA 1EIYB 3E5SA 3RLNA 3TP6A 4BBRH 4X66L 1A8VA 1P16A 1O7IA 3I72A 2JA5H 3A54A 5IYCG 2UXCL 2B63G 4YWKA 1N33L 2JA5G 1K8AC 5EKKA 3MZ5A 2BDNA 1N34Q 1RL2A 5IGDA 4V0BA 2F0OA 3HOWH 4P74A 3I3CA 1YJNA 3HOWG 5C5LA 1ZEQX 3UI2A 1CZWA 2PZTA 4JOIC 1AE3A 1JOOA 1VQDA 2LKVA 4BXXH 1RTOA 1ZYRD 4BXXG 1TU2B 4JPBW 3G4SA 2AQ2B 2AKWB 2K5WA 5KYIA 4YCVA 4I7AA 1KLUD 3CCJA 2RSOA 2OQKA 4BBRB 4U68A 1VQCA 1G6PA 3MEFA 3K7AH 3A0JA 1V8QA 5IOCA 4E6IA 2I46A 4RHRA 2JA5B 5M5WH 1EEID 3PIPA 3EROA 1GKHA 5AJ3L 1HZBA 3HOWB 3Q6SA 3UDFA 1I5FA 2EY6A 1XPOA 3FPPA 4M1UB 4GKKL 1QWYA 1NTGA 2N8NA 1R9TH 2I5HA 1EQQA 1PTOC 3MVVA 3CC2A 3CCEA 2F0VA 1YIJA 4OWXB 3ITPA 4A3GB 4BA2I 4DV5Q 1UE5A 5FLXL 3J81j 1KL9A 2K32A 3K7AB 5C3XA 2YU9B 2CWPA 1H9JA 4ZK9B 3S1NH 1XNQQ 2CFMA 3BDLA 4JVZA 1HRJA 2NVYH 1JC7A 3R93A 4DNRB 5M5WB 2NB0A 1EIGA 3K7UC 2K5QA 3MAQA 3K0XA 5CV9A 5LMNW 1PRTB 1SYFA 1Y8PB 3ND9A 3H6MA 4LF7L 1J5EL 3LX0A 2PO4A 1EU3A 4DV3L 1PZKD 3S16H 2E2IH 1SR3A 3DM1A 4DR4Q 3H91A 1R9TB 4IFDH 2XIWA 4JI4Q 4JI8L 4IFDG 5JVH3 3NWTA 5IE8A 3SVMA 3NTIA 4CKCA 1B8AA 2JEBI 3JAMc 2HHHL 3EN2A 1PDQA 2RCNA 1LUZA 2AQ3B 2EIFA 2R92H 3A8KE 4LFCL 4CDFC 3S1NB 4N9PA 2R92G 1V43A 1JB7A 2NVYB 4LUVA 2HIVA 1YZ6A 3ULPA 1C7YA 1L1OB 5ISRA 1EU4A 2QDLA 1JWMD 5BN4A 3CMAA 3KDFA 3J7AV 4DR1L 3GTMB 1SNCA 1PZID 4HIDA 1JT8A 1F2LA 1HH2P 2L0CA 3N52A 4IPHA 1BKBA 3BS1A 4IUTA 2HCCA 2UU9Q 3S16B 2E2IB 3DUZA 2OCEA 3HRZC 1K28A 1PH7A 2MNAA 1M1KC 2PI2A 1X32A 5L37A 1JR0D 2PMZE 4LJZC 1QVGA 1HUNA 2PYKA 4G7ZC 1HZ9A 4CJ2C 3JC66 5GAHC 1PYWD 2OTJA 1I94Q 4DK1A 4HSVA 2R92B 2X6GA 3IAYA 1WOCA 3H3VI 2N55A 1TQOA 2H5XA 1K3RA 1U5KA 3SGIA 5C44H 4K0KQ 5IYBH 1SMYC 2F0WA 3V96A 3NBHA 5C44G 5IYBG 1H9KA 3VYRA 3UE1A 1I4PA 4DR3Q 1TR5A 3K5OA 3OWFA 3L3OC 1UEAB 3BVGA 1PTOF 2YTXA 4LF4L 2JJQA 2CH4A 2QW7A 5KYLA 3T1HQ 1HA6A 1BBWA 2A69C 5EPKA 3J7ZC 2WAQE 3V05A 2IW3A 4X3TA 4JI5L 5LMUQ 4R4TA 1PHJA 3PSIA 1OXVA 4GLVB 1BBUA 2QEJC 1DM0B 2B2TA 2RA4A 4QF4A 1EQTA 1IBML 1S72A 3C46A 3ZYYX 2I07B 5T1IA 3GTKH 2F0NA 1VQLA 3BVMA 1K0RA 5IIFA 1AE2A 3G7LA 5C44B 5EPJA 5G3LF 3RZOB 2EPBA 3TRZA 4N8X1 2NTSA 4RGOS 2SNSA 3HOZH 3VR2A 1BOSA 3HOZG 3M4YA 5K5PA 3A5ZB 1I4XA 4J15A 2Q2TA 1QUQB 4TQUS 3O13A 5DM73 2N78A 4DF7A 3S15H 4GN4B 1HFNA 3KJOA 4DR5L 3AU7A 4JI3L 1EFID 3I70A 1EEFD 1LLRD 2K52A 2KJXA 4PV1C 1KAWA 1B9NA 2KEEA 2Q8RE 1BQQT 5GROA 4DK6C 2AUJD 2JQOA 4GOPA 2K75A 3GTKB 3GTPH 2NZOA 2DGYA 4KN7C 1PMRA 1TWGH 4UHVA 3A74A 3CC4A 1IW7D 1PH5A 3C1EA 3D6CA 5C4ZA 1RF2D 4XYOA 1FGBD 3QG1A 4IQZA 4EQ5A 2G5DA 3HOZB 1Z7TA 1O7ZA 4KK7A 5I9PA 2R7ZH 5JJIA 2F0QA 2L11A 3QO2A 5BN5A 4KKSA 3UDXA 4DV4L 2ZM6Q 1S5BD 1TWCH 3CF5A 1CT1D 2EJGC 3A5UA 1LTGD 3PCOB 3ICEA 1HJPA 3RZDH 1IBKL 4G7HC 1O78A 3TEHB 1PFBA 3S15B 4GLXA 4P2CB 2YTYA 3Q22A 1WTRA 3CCVA 3JAML 5FO8B 3J80i 2VQEL 2Z9HA 3PQIA 5TSSA 5KNDA 1E2WA 1GHKA 4KV6A 1MJCA 2XRQD 3HS0C 2F03A 3M7GA 3RD4A 3GTPB 4IUQA 5ELNA 2A6HC 2F0FA 5M5YH 5CGKA 4R4QA 1TWGB 1LO5D 1HQMC 2F3WA 4DR2Q 4YY3L 4NKLA 1CHQD 1KQSA 3VR5A 1L1OC 1O80A 3CRKC 3J81L 4UP9A 1PH9A 3PUZA 1PH4A 1F9SA 1QVCA 2R7ZB 3MC0B 1O7LA 1AH9A 2Y0SG 1EYAA 2GA4B 4ZYSA 1NMGA 1B9MA 3EVQA 1TWCB 2EY1A 3OPOA 2B2WA 4RGTA 4DV1L 1PH3A 3RZDB 1A63A 3W5OA 4K2KA 4RG1A 4JBKA 2IT1A 1Y14B 1H9SB 5E7NA 4P75A 4K2LA 3EQLC 4LUZA 5FKAC 2HD3A 2GN5A 2O5IC 4JC0A 2E76C 1VQ7A 2B2YA 4ODGA 2NN6I 4IJLA 5M5YB 4B3RQ 3GP7A 1S3OA 1GOZA 4K14A 1XMOQ 1QB5D 2KA7A 1D1KA 3IFDA 1HA5A 2ENBA 3GV3A 2F0PA 4PZ8A 2KEDA 2Z4HA 2Y0SB 5IT9E 2ALYB 4IUNA 3A56A 1JJCB 3SE0A 1NAPA 1DZ1A 3S17H 1EOVA 1ET6A 5GAEC 1YNNC 1A6XA 2XGTA 1VQEA 4UDUC 3U58A 4LF6L 4OONA 3R3OA 3FDTA 1B2TA 2RDHA 5CV8A 4M8AA 1FNVA 1STHA 3Q0AA 1LV9A 1RODA 1A2TA 3FVQA 1TWHH 1WTVA 4A3CH 4RKBA 4DK3C 3S9WA 3D8GA 4A3CG 3PO2H 1VQFA 2G9HD 1Q8KA 1N36L 3PO2G 3RN2A 4JBMA 4PZ6A 4NDXA 4JI0Q 4PNYA 3EBEA 1U4RA 2OWOA 2JA8H 1WD1A 4WJ3M 3I4OA 1PRTF 3RLOA 2CKZB 3M3YH 3CQZB 1B3QA 4IUVA 1Y1WG 2JA8G 2LS01 3BU2A 3I55A 4HCEA 5JJLA 1XTDA 4NXMQ 4ME5A 3S17B 1FJGQ 1HNZL 2CCZA 3I2ZA 2E2JH 1N9WA 4LF9L 2L15A 3ULLA 1BVSA 3BYYB 2A74C 3BZDB 2KECA 2YTVA 2A6EC 3H15A 4PG3A 4B08A 1K73C 4HJ8A 1EUJA 4HR7B 4F88A 5IWAQ 1H95A 5C0XI 1DGSA 2Z6KC 4BS9A 1TWHB 4QGUA 1NBWA 1D5XC 5I6YA 1CK1A 3K57A 3ERSX 3PO2B 1I4RA 2XWJB 2MP1A 1F2ZA 5JOBA 3FKIG 1MJEA 3NTKA 4U673 2F1MA 2JA8B 4GZYC 1H9MA 1Q12A 1QG7A 3F1ZA 3M3YB 2PMZB 1D6EC 2ID0A 3CCSA 1BR9A 1HCZA 5K36H 4GNXA 1W3SA 5CV7A 5K36G 1LM0A 4C3HH 1S5FD 2Z0SA 5FLXc 2E2JB 1GUSA 4C3HG 4HCSA 3OMGA 3HOYH 2LSSA 1LTID 4A3IH 3HOYG 1GVPA 5C5MA 4XQQA 2XVSA 3GTGH 1GHJA 4A3IG 3M4OH 1LTLA 3K8AA 2DNCA 4IOCA 2F0LA 2FMCA 1PZJD 3ULJA 4EX5A 4H0LC 1SMXA 2B2UC 2MFIA 2PNHA 4HN7A 3K0YA 1V1PB 2PQAB 4DUYQ 1OO9B 2K5VA 2F4VL 2L4NA 1YNJD 3SXHA 1PYBA 4IOAA 4DV6L 1VQNA 2AWOA 1K0SA 3L9AX 3STBD 1EY9A 3HP3A 3Q23A 1SBBB 1IZ6A 4UAIA 3UDGA 2C9OA 1M4VA 2F0IA 1NE3A 3NTHA 3SDZA 4Z9CB 3KF8B 1RDPD 1TIID 4C3HB 4RHSA 2EOTA 4QIWB 3RNUA 3HOYB 1W2BA 1F9QA 1U0LA 2B2VA 3WDNA 2FMMA 4A3IB 3MFGA 3GTGB 2N88A 5IP7H 1O7YA 3M4OB 4C3IH 5IP7G 2EYMA 2BA1A 3DEOA 5C3EH 3Q8DA 4C3IG 1F77A 4RGMA 1SNOA 3TBIB 4XQJA 1BF4A 4YHHL 1MBYA 5DNFA 4Y52H 2NZHA 2MGSA 4A76A 1PVOA 3DWPA 5D3IB 4WORA 1VQOA 4QQBX 2JA9A 4X62Q 3CAMA 3K58A 4XXEA 3FHWA 3QWNA 2CVRA 4H13C 3OTOQ 5ELFA 2E75C 1SNQA 3ONAB 4YWMA 1EFWA 2IJ0A 3LGJA 2LXKA 1GXDC 1B44D 2QEXA 1Q3LA 1YI2A 4DV7Q 2JA6H 2RVLA 1RD9D 3J80E 3GTQH 5IYCH 1Q82C 2JA6G 2B63H 2SEBD 2WFWA 1ZKOA 4C3IB 3CC7A 5C3EB 4DR6L 4DV2L 1NR4A 4B9WA 2E2HH 4XTCS 3VYTA 4C3JH 5CMDA 4C3JG 5IGBA 2E5LQ 1S5CD 3QJYA 2DY8A 4RMFA 4GKJQ 4DA2A 5LL6S 4X64Q 4R8IA 2HCIA 1VQKA 2Q2HA 2UXDL 1DOLA 2NYZD 4B3TL 2C35B 1VQ6A 1RJTA 4C2MH 1J9OA 1F9PA 1JWUD 1GO3E 3FP9A 2PW5A 2JA6B 4K0KL 5G3LD 2SDFA 1RIPA 2WB1G 1PH8A 1EL0A 3K80C 2B63B 5DM63 3BVZA 3D0FA 4KHPQ 2UXBL 4X65Q 2K50A 1X55A 3F2BA 2R7DA 3S1MH 4HJ7A 2EVBA 1SROA 2G9DA 1STYA 2E2HB 4OX9L 1EYDA 4L5RC 1Y69U 4C3JB 2Q2IA 2KCMA 4DNIA 3TSSA 4CKEA 4PMWA 1WTXA 1W6JA 4A3MH 3G71A 4JI1Q 4JBWA 4RCNA 1CM9A 1II3A 4MZ9A 4OXPA 4A3MG 1HUMA 4LF8L 3PUWA 2QILA 2AWNA 4OL7A 2Y0SE 4C2MB 2WKCA 1ENAA 3S2DH 1JE5A 1YJ9A 1LTAD 4ID6A 2EE1A 4LUOA 2JE6I 2WB1B 3NXWA 3RUZA 1AZPA 4JI6Q 4B3ML 3OIQA 1BDOA 1LYLA 3CCQA 3ZJYC 2NVQH 3S1QH 1A15A 1CQFA 5JJKA 3E9IA 3S1MB 2D0PA 2Z8LA 3HEJA 1HHVA 1A0IA 3EIVA 2RHSB 3L0OA 1TWFH 3FEWX 5DLQE 2VY3A 3D4RA 1Q1EA 4O2DA 3KLWA 1WFQA 1M8AA 1IL2A 4A3MB 2J7ZA 1XTCD 1KRTA 1SNDA 1ZYRC 4PZ7A 2NVXH 1BUVT 4ZKCB 4JYAQ 4GN3B 4IPDA 4RKLA 1ENFA 3S2DB 1LT5D 1VQAA 2Q8TA 1U4MA 3TREA 2XN9C 2PQEA 3SK6A 4LFAQ 4RAUC 1CKNA 3U9OA 1XMQQ 3G6JB 2NVQB 4HIKA 2VB3X 3S1QB 4DV0L 1CTMA 2IX3A 1SNMA 2BOSA 3IL8A 1AZQA 1I4HA 3J81c 1PFSA 2WINB 1TWFB 5J3BA 3TDQA 2OEOA 1K9MC 1ET9A 3MXGA 2MUYA 2UUBQ 5JJZA 4DAYA 2KOLA 4POFA 1X54A 2DNEA 4QB4A 2QDBA 1GM5A 2NVXB 2OQ0A 4FF4A 4X66Q 4J6HA 5M9OA 1WD0A 2K14A 4PMBA 4ZAIA 1Q1BA 1EY4A 4YWLA 5KNBA 4FF2A 1N33Q 4G7OC 1D2BA 3L2PA 1X3GA 2EZVA 2NN6H 4IPGA 2NN6G 1UE1A 4IALA 1QE6A 4TSSA 1EZ8A 1EIFA 2F0MA 1CA5A 4KI0A 2L55A 2B2TC 1VCIA 4X3KA 5IODA 2KCTA 1PFMA 1X3QA 3K6OA 3HOUH 2LFNA 3H09A 3HOUG 1F2YA 4LF5L 2EQSA 2KHJA 3CPFA 5JEAH 5JEAG 1GUTA 1EY7A 2FHTA 4DAMA 3QOLA 1VQMA 4CHTB 2P5ZX 3NELA 1BBXC 5EBDA 3E0EA 1Q46A 2L1BA 1VS0A 4HTHA 4AQYL 3J7A5 1C0AA 1UUPA 4XT1B 1EY0A 3U9SA 3PV0A 1QILA 1WYDA 1QZHA 3HKZG 3T51B 3JAMi 4YCWA 3LWUA 4QIWE 1XNRL 1PRTD 2BCOA 3KUPA 2K5NA 4HJ5A 5J39A 5IGEA 1DCZA 4DR7L 1B3AA 3IFTA 4HAEA 5JPMC 1PH2A 1FNUA 3CCRA 2HQEA 4IPCA 1EY8A 3BG3A 4GOPC 3HOUB 4DUZL 4GKKQ 4JV5Q 2CW0D 2OTLA 1U4PA 1TKWB 2K6AA 2B39A 2WP8J 3MXNB 3NHHA 3J81i 1Q7YC 2PZWA 4JG2A 5CV4A 5EKLA 3AEVA 1VQHA 3QIAA 3D6WA 1K8GA 1KLGD 4PQXA 2CHBD 4GNXB 1L0YB 3I4NH 4MN3A 1C8CA 2CQOA 3I4NG 4DPGA 3A7LA 5C6AA 2QF7A 4K5WA 1SEBD 5E1FA 5C0XH 2EYPA 1G291 5FLXE 3K5MA 4A3KH 1K8OA 5C0XG 3I91A 4A3KG 2M2LA 3TP5A 3HKZB 3W3AA 3SK8A 4NXNL 1F9RA 1SNPA 1A3VA 2OF1A 1QJOA 1EYGA 1OXTA 1HNXL 1BO0A 2DN8A 4LF7Q 1J5EQ 4A3DH 4P71A 3I73A 1Q86C 5COYA 1OXSC 3DM3A 4A3DG 2EYOA 2RF4A 2Z4IA 4RA8A 1V9PA 3QR8A 4ZQ3A 3KBGA 2O2LD 5EPLA 1DONA 3EA6A 4FYDA 2L9HA 2Z6BA 2XWBB 4JI8Q 1BCPD 5JPNC 5CORA 4IN3A 2JSOA 3PUXA 1NCVA 3SEBA 2O5JC 2HT1A 2BE5D 3I4NB 1B7YB 1U9RA 2HHHQ 2R61A 5CR3A 2XSCA 1EWCA 1B4OA 1ILQA 5HY6A 2D5DA 1XPRA 2YYZA 4B9XA 4A3KB 2F0SA 5IGGA 2B2WC 1V1QA 1GD7A 1UEBA 3KLRA 4UP8A 4APVA 4FDBA 2IX1A 3BJUA 3CKIB 2WACA 4DR1Q 2ZTDA 4CBVA 3D3RA 5IP9H 4A3DB 5A2QL 1IBLL 5IP9G 2FJ2A 4KJOA 1HNWQ 2HIXA 4IFDI 1TT2A 2E74C 1I50H 1AFPA 5LL6X 3I4LA 1HXYD 3PUYA 3CCMA 1N32L 3T16A 4BBSG 1G2SA 2VS1A 3KF6B 5EQ0A 1KABA 2WKDA 5DEHA 4KY6A 2XTIA 2KQ3A 1Y8OB 2VZAA 1JORA 3GDEA 3AMUA 4KD3A 4CJ1B 4HJAA 1E0BA 5M3FH 1GUNA 4OO1I 4DUYL 2R6GA 5M3FG 1YNXA 4MTNA 4L5TA 3KLSX 2F0TA 5GADC 1QOHA 4JI7L 2MO0A 2QA4A 2WB1E 4R1JA 4FF3A 1PLFA 1CQVA 4H44C 1N8RC 2UUCL 3MWYW 3W1GA 2VNUD 4V190 2KUMA 3CW2C 1GUOA 5I4DA 4HSPA 1IW7C 3IKJA 3PF5A 3AB9A 4AYBG 4J8QA 1NR2A 4HMJA 4N8FA 5LMNL 1WTPA 2MHVA 2EXDA 1I50B 1SE4A 1EQVA 3CRLC 3DMUA 1H9RA 3MTSA 4JI5Q 3HG9A 4RCOA 1FVIA 2IPKD 1HR0L 3PIO3 1E3PA 1L1OA 1E22A 2QKIC 1KTKA 2EY2A 5BR8L 2ES2A 1U4LA 4A3EH 4X3SA 1L0WA 5M3FB 4A3EG 3P7JA 3RLFA 1IBMQ 2VXWA 4X3UA 5E4XA 4R4OA 3KOJA 4ILWA 3F8TA 1D8LA 3Q24A 2VL6A 2A8VA 3OTOL 2TSSA 2CH4W 4K8JA 1YEZA 4ZLTF 2A5HA 4LNQA 1WTQA 4XYQA 2F0JA 4QUFA 4AYBB 2D2CC 4CJ0B 1Y1WH 2PZUA 2F0GA 3NEMA 2BH2A 4L63B 1SJED 5HURA 3T53B 2ZTEA 4IFDJ 3P1HA 1C4QA 5CBEE 1J8IA 1I6HH 4DR5Q 4JI3Q 3VDYA 3NBIA 3MA2B 1N34L 4GNXC 4LWCA 4KTAA 4A3EB 1Z47A 5T1GA 1FNWA 4IUPA 3B6YA 3ER0A 3OOCA 3DWQA 3X3NA 1E24A 1TS4A 1A3UA 2JN4A 4Y7NH 2K5DA 1I6VC 1JMCA 4R4CA 1SYGA 1UAPA 5C4HA 4KKUA 3FKIH 1D5ZC 3CHBD 4FVMA 1RKNA 3E0JA 2H4OA 1CFMA 5CV5A 3H0GH 2H1EA 4F87A 4DV4Q 3H0GG 2F0KA 4OELB 1Y1WB 1TY0A 4B3SQ 4K6LA 1SFOH 4X6AH 1S5DD 4EQPA 2E8GA 1IBKQ 1JWSD 3CCLA 4JW0A 3W1BA 2I5LX 2F0DA 1I6HB 1X6OA 1JOKA 2ZXPA 3U50C 5EKIA 1KD1C 1LTSD 1TWAH 5KIXA 2VQEQ 4WJWA 2GVAA 2NVTH 1VF5C 4JI2Q 3JAME 2BA0A 4DXGA 3PIOA 1VQ9A 2M9VA 1KIXA 4Y7NB 2V4DA 2B2VC 2QCPX 4MTKA 1MHWC 2ZT9C 1SYBA 1QUQA 4YY3Q 3HGBA 1JQYD 2RDFA 5ELBA 3KDFB 1RTNA 3FKIB 1SDFA 3VA7A 4HIOA 3I90A 3J81E 3H0GB 1I3QH 4QMGA 4DV5L 4K5VA 1HPCA 2OXPA 2EYJA 5C4JH 3M4QA 2A68D 1SFOB 3K81C 4DV1Q 1D1IA 1PH6A 4MIUA 1KC8C 1XNQL 1GJXA 1IKMA 1ENCA 1VQIA 1ICWA 2KCNA 3KYHC 3RR5A 1VQ4A 4RWSC 1EOTA 1TWAB 4UY8C 2NVTB 1E7ZA 4ZUJA 1X65A 5FK9C 4KHZA 1BXTA 1MSHA 1WCMG
chains in the Genus database with same CATH topology
1KDAA 1TY2A 4YIJA 2J0TD 1SXTA 1LT6D 4KMUC 1PXUA 2KHSA 2SOBA 1CI3M 4FP5D 5LHY1 4CKBA 4L6TB 1TS3A 3X3MA 4IUUA 1Q90A 4DK0A 1I3QB 2NUCA 1G91A 1TS2A 1V1OA 1SSOA 3NUCA 4WFN3 3DEPA 1G8ZD 5C4JB 5ELDA 3RMHA 4JK1C 4O1NA 1F2MA 2A73B 4Q0FA 1GUWA 1IKLA 1IYVA 4LK1C 3T4AC 2HUGA 1S5ED 1TVXA 4HEDA 1PTOD 4TRDA 3GD7A 4XIGS 3C1FA 1YNJC 4OIJA 4TKOB 1RCVD 1H9SA 1HFGA 3T56B 3R2IA 4QCLA 1WVLA 3A7AB 2HDMA 2A68C 2MPMA 4I65A 1STBA 4KY7A 1T5XD 3F2UA 4IZ8A 2K33A 5KEEA 4DU9A 2EJMA 1STGA 3GTQB 2NZ1D 4ZUIA 2MJ8A 5EBCA 1EWHA 4Q5VA 4J1MA 4DXFA 1CHPD 4G4KA 3M7NA 3NE5B 3BYTB 2EJFC 1QNKA 1KNAA 3FMCA 2D9UA 4A3JB 4FXGC 3W2DA 2PW7A 1LTTD 4LMQD 3P75A 4DNTB 3HOVB 1MGSA 4FXKC 2EY5A 3GTJB 1AN8A 1PFNA 1DXMA 2ZXRA 3NPPA 3PO3B 2EXZA 1GUGA 3SHLA 2VUMB 1JICA 2B8GA 2XNAC 1VDZA 3SK4A 4NP5A 1EY6A 4XT3B 1B1ZA 3TZDA 1SYEA 4KJNA 3MFYA 4RGNA 3K5LA 3LWEA 5I2YA 3SK5A 2EYFA 2IX0A 1LABA 1SMYD 3FPUB 1SYDA 2FFKB 3DHQA 4DFAA 3OW7A 1MSGA 2K03A 1G2TA 1B53A 2PNRC 2F0UA 1R4QB 1VMCA 5IGFA 4EQNA 2IWHA 3NQIA 2WIIB 2A69D 2WV6D 2BDOA 2K1BA 2XRSD 2LY7A 3QB3A 4OGQC 1HTLD 3C2PA 1DOKA 3DWAA 2K05A 3OWEB 4FXDA 4CGYB 5JAVA 4OO1H 2JA7B 3C3LA 4OO1G 3M85A 3VYUA 1V1PA 1XYIA 2Z1CA 1EY5A 1EIHA 1VF7A 3S1RB 4DN4M 3BDCA 2SNMA 2ICEC 3MEHA 2J4XA 3KF8A 2NWGA 1BCPB 5E4WC 4KKTA 3VR4A 2ZXOA 3TMEA 1E2VA 1B50A 5J22A 3V2TA 2L12A 1KNEA 4BY1B 1STEA 1JCKB 1KAAA 1Q8IA 4EGVA 2ICIA 5C3WA 3MXPA 1W6KA 2PPBC 1I4QA 3KK7A 2X6LA 2O4XA 2RBMA 1E2ZA 4NMZA 4K8IA 2M00A 2TMPA 4F8MA 5KNCA 4KY5A 5FO7B 1JE4A 3H3VC 5D65A 5IT9L 4EQOA 3GO5A 2R3ZA 4MHEA 1SE2A 1RHPA 1ILPA 3WOFA 3URYA 1IL8A 3SR1A 4PMCA 3HOXB 5FOBB 3TZUA 4L8JA 1AP0A 3OHXC 4FO2A 1SYCA 1JB3A 1XWEA 2NTTA 2A6HD 1SAPA 5D3DA 2K04A 4FNFA 5M3MB 3ND8A 5BN3A 4A3FB 5JVG3 3NSWA 1KDBA 3EJIA 2K28A 1LTRD 5F2DA 4DGZA 2KCCA 1A3TA 5KGUA 5NUCA 5I9OA 5A35A 5IGCA 5J1ZA 3R8BA 1QNUA 3OIPA 3GV6A 4ZRZA 1EZ6A 2K7VA 1IYUA 1ESFA 4DAVA 1DYQA 1G6ZA 1EYCA 1UNSA 1AW7A 4KHVA 1STAA 1LT4D 1PRTC 1JOQA 2K01A 1HTPA 3K59A 1IHZA 1OXXK 3D31A 1DD2A 1YNND 3VYSA 1K8MA 5AFWA 2B2YC 2CW0C 4R8NA 2EYLA 2EYHA 5CV6A 5CYUA 3D4DA 4EVOA 3NK9A 3KLSA 4O42A 5EGTA 3A55A 3PMFA 3PUVA 3I4MB 1MD2D 2IL8A 2R93B 1L0XB 2F3VA 4BA1I 5EJWA 3E6ZX 3DXJC 2L5TA 1NUCA 1S4ZA 1CZGA 2DY7A 5DAUA 4F7XA 2B8FA 2VB2X 3A8IE 4IURA 1Z6HA 4A3BB 4I7ZC 4RH6A 2LMCB 2F4IA 2JYOA 2A6ED 1BCPC 5CC4A 4BBSB 1WTWA 3K5NA 3D4WA 5KRUA 2BE5C 1CA6A 4A93B 5E3FA 3GTOB 3VA5A 3FRPB 4C1NI 4FF1A 1OXUA 2F0EA 1SE3A 1QCBD 4HMIA 3TP7A 1C48A 1K83B 3WOEA 5CBAE 1HQRD 3MHBA 4RFBA 4G57A 1AEXA 1T5EA 3CU7A 1X3PA 1BNZA 3J7AF 4ULLA 4NW2A 3J80L 1ONLA 3I8ZA 3MXUA 2RDGA 4OIKA 3N6RA 4K5XA 2D62A 1PTOH 5HGTA 1DOMA 1FD7D 1FR3A 1I4GA 3T13A 3OSOA 3KBXA 4N9TA 3VR3A 4BY7B 4BWGB 3GTLB 2AQ1B 1ML0D 3EFXD 3VR6A 5D14A 2E2DC 2AUKA 1PTOB 2F0HA 1A2UA 1TS5A 3MXNA 2JXMB 5FO9B 3NQTA 2HDLA 1MI2A 2C5CA 3S2HB 5ELEA 3LNNA 2RSNA 5A2QE 1LT3D 1DJRD 4C56C 3S14B 1BCPF 3NWSA 4QUCA 5JEAJ 1VMPA 1SJHD 1FYCA 4ZKBB 2RKSA 2PCFB 3P20A 5ELCA 4K6DA 5I2XA 2JP1A 2Q8IB 3BDOA 1XXGA 1LTBD 2NBFA 3H94A 4KN4C 4H7BA 4S3SA 1NSNS 2WAQB 3GQBA 2EDGA 2RQXA 1WTOA 1R4PB 4C1NK 2CQAA 4ABNA 1ZXTA 4DAPA 1KDCA 3NP8A 3PIP3 2B2UA 2OT2A 3J7YW 4XDXA 2X69A 3QOJA 4KD4A 4XQNA 1STNA 4LAAA 1ESRA 3OMCA 5C4XB 3TN2A 1D5MC 1XX8A 2JEAI 3TP8A 3A8JE 2FINB 5C0XJ 5I6WA 4R9WA 4OHJA 4WRDA 3R2TA 1Y8NB 1WCMB 1LACA 1Y1VB 3L7ZC 3HZXA 2KVMA 5M5XB 3ERQA 3E5SA 3TP6A 3I72A 3A54A 5EKKA 3MZ5A 2BDNA 5IGDA 4V0BA 2F0OA 3I3CA 5C5LA 1ZEQX 3UI2A 1CZWA 2PZTA 1JOOA 2LKVA 1RTOA 1ZYRD 1TU2B 2AQ2B 2K5WA 5KYIA 1KLUD 2RSOA 4BBRB 4U68A 1V8QA 5IOCA 4E6IA 2I46A 4RHRA 2JA5B 1EEID 3EROA 3HOWB 3Q6SA 2EY6A 3FPPA 4M1UB 1QWYA 1PTOC 3MVVA 2F0VA 3ITPA 4A3GB 4BA2I 5FLXL 2K32A 3K7AB 5C3XA 2YU9B 1H9JA 4ZK9B 3BDLA 1HRJA 1JC7A 3R93A 4DNRB 5M5WB 2NB0A 1EIGA 2K5QA 3MAQA 5CV9A 1PRTB 1SYFA 1Y8PB 3ND9A 3H6MA 3LX0A 2PO4A 1EU3A 1PZKD 3DM1A 3H91A 1R9TB 4IFDH 2XIWA 4IFDG 5JVH3 3NWTA 3SVMA 3NTIA 4CKCA 2JEBI 1PDQA 2AQ3B 3A8KE 3S1NB 4N9PA 1V43A 2NVYB 5ISRA 1EU4A 1JWMD 5BN4A 3J7AV 3GTMB 1SNCA 1PZID 1F2LA 2L0CA 3N52A 3BS1A 4IUTA 2HCCA 3S16B 2E2IB 3DUZA 3HRZC 1X32A 1JR0D 4LJZC 1HUNA 2PYKA 4G7ZC 4CJ2C 1PYWD 4DK1A 4HSVA 2R92B 2X6GA 3IAYA 2N55A 1TQOA 1SMYC 2F0WA 3V96A 3NBHA 1H9KA 3VYRA 1I4PA 1TR5A 3K5OA 3OWFA 3L3OC 1UEAB 3BVGA 1PTOF 5KYLA 1HA6A 2A69C 5EPKA 3V05A 2IW3A 4X3TA 1OXVA 2QEJC 1DM0B 2B2TA 2RA4A 4QF4A 1EQTA 3C46A 3ZYYX 2I07B 5T1IA 2F0NA 3BVMA 5IIFA 3G7LA 5C44B 5EPJA 5G3LF 3RZOB 2EPBA 2NTSA 4RGOS 2SNSA 3VR2A 1BOSA 3M4YA 5K5PA 1I4XA 4TQUS 3O13A 5DM73 4DF7A 1HFNA 3AU7A 1EFID 3I70A 1EEFD 1LLRD 2KJXA 4PV1C 1B9NA 2KEEA 2Q8RE 1BQQT 2AUJD 3GTKB 4KN7C 1PMRA 1IW7D 3C1EA 3D6CA 5C4ZA 1RF2D 4XYOA 1FGBD 3QG1A 4IQZA 3HOZB 1Z7TA 1O7ZA 4KK7A 5I9PA 2F0QA 2L11A 3QO2A 5BN5A 4KKSA 1S5BD 1CT1D 2EJGC 1LTGD 4G7HC 1O78A 1PFBA 3S15B 4P2CB 3Q22A 1WTRA 3JAML 5FO8B 5KNDA 5TSSA 1GHKA 1E2WA 4KV6A 2XRQD 3HS0C 2F03A 3M7GA 3RD4A 3GTPB 4IUQA 2A6HC 2F0FA 5CGKA 1TWGB 1LO5D 1HQMC 2F3WA 4NKLA 1CHQD 3VR5A 1O80A 3CRKC 3J81L 3PUZA 1F9SA 2R7ZB 3MC0B 1O7LA 1EYAA 2GA4B 4ZYSA 1B9MA 3EVQA 1TWCB 2EY1A 3OPOA 2B2WA 4RGTA 3RZDB 4K2KA 2IT1A 1H9SB 4K2LA 3EQLC 5FKAC 2O5IC 2E76C 2B2YA 4ODGA 2NN6I 5M5YB 3GP7A 1GOZA 4K14A 1QB5D 2KA7A 1D1KA 3IFDA 1HA5A 2ENBA 3GV3A 2F0PA 2KEDA 2Z4HA 2Y0SB 5IT9E 4IUNA 3A56A 3SE0A 1NAPA 1DZ1A 1ET6A 1YNNC 1A6XA 4UDUC 3R3OA 3FDTA 1B2TA 2RDHA 5CV8A 4M8AA 1FNVA 1STHA 3Q0AA 1LV9A 1RODA 1A2TA 3FVQA 1WTVA 4RKBA 3S9WA 3D8GA 2G9HD 4NDXA 4PNYA 1U4RA 1WD1A 1PRTF 3CQZB 4IUVA 2LS01 4HCEA 4ME5A 3S17B 3BYYB 2A74C 3BZDB 2KECA 2A6EC 4B08A 4HR7B 4F88A 5C0XI 4BS9A 1TWHB 1D5XC 5I6YA 1CK1A 3K57A 3PO2B 1I4RA 2XWJB 2MP1A 1F2ZA 5JOBA 3NTKA 4U673 2F1MA 2JA8B 4GZYC 1H9MA 1Q12A 1QG7A 3M3YB 2PMZB 1D6EC 2ID0A 1BR9A 1HCZA 5K36H 5CV7A 5K36G 1S5FD 2E2JB 1GUSA 4C3HG 4HCSA 3OMGA 1LTID 4XQQA 5C5MA 2XVSA 1GHJA 2DNCA 2F0LA 2FMCA 1PZJD 4H0LC 2B2UC 4HN7A 3K0YA 1V1PB 1OO9B 2L4NA 1YNJD 3SXHA 2AWOA 3L9AX 1EY9A 3HP3A 3Q23A 1SBBB 4UAIA 2C9OA 1M4VA 2F0IA 3NTHA 3SDZA 4Z9CB 1RDPD 1TIID 4C3HB 4RHSA 2EOTA 4QIWB 3HOYB 1F9QA 2B2VA 4A3IB 3WDNA 2FMMA 3MFGA 3GTGB 2N88A 1O7YA 3M4OB 2EYMA 2BA1A 3DEOA 4C3IG 1BF4A 1F77A 4RGMA 1SNOA 3TBIB 4XQJA 1MBYA 5DNFA 2MGSA 3DWPA 5D3IB 4WORA 3K58A 4XXEA 3QWNA 2CVRA 4H13C 5ELFA 2E75C 1SNQA 3ONAB 2IJ0A 1GXDC 1B44D 1Q3LA 2RVLA 1RD9D 3J80E 2SEBD 1ZKOA 4C3IB 5C3EB 1NR4A 4B9WA 4XTCS 3VYTA 5CMDA 4C3JG 5IGBA 1S5CD 3QJYA 2DY8A 4DA2A 5LL6S 4R8IA 2HCIA 1DOLA 2NYZD 1RJTA 1J9OA 1F9PA 1JWUD 2PW5A 2JA6B 5G3LD 2SDFA 1EL0A 2B63B 5DM63 3BVZA 2EVBA 2G9DA 1STYA 2E2HB 1EYDA 1Y69U 4C3JB 4CKEA 3TSSA 4PMWA 1WTXA 1W6JA 4JBWA 4RCNA 1CM9A 1II3A 1HUMA 3PUWA 2QILA 2AWNA 4OL7A 4C2MB 2WKCA 1ENAA 1LTAD 4ID6A 2EE1A 2JE6I 2WB1B 3NXWA 3RUZA 1AZPA 3OIQA 1BDOA 1A15A 1CQFA 3S1MB 2Z8LA 3HEJA 1HHVA 3FEWX 3D4RA 1Q1EA 1M8AA 4A3MB 2J7ZA 1XTCD 1SNDA 1ZYRC 1BUVT 4ZKCB 4RKLA 1ENFA 3S2DB 1LT5D 2Q8TA 1U4MA 2XN9C 2PQEA 3SK6A 4RAUC 3U9OA 2NVQB 3G6JB 2VB3X 3S1QB 1CTMA 2IX3A 1SNMA 2BOSA 3IL8A 1AZQA 1I4HA 2WINB 1TWFB 3TDQA 2OEOA 1ET9A 3MXGA 2MUYA 5JJZA 4DAYA 2KOLA 2DNEA 4QB4A 2QDBA 2NVXB 4FF4A 4J6HA 5M9OA 1WD0A 4PMBA 4ZAIA 1Q1BA 1EY4A 5KNBA 4FF2A 4G7OC 1D2BA 2EZVA 2NN6H 2NN6G 4IALA 1QE6A 4TSSA 1EZ8A 2F0MA 1CA5A 4KI0A 2L55A 2B2TC 1VCIA 4X3KA 5IODA 1PFMA 1X3QA 3K6OA 2LFNA 3H09A 1F2YA 5JEAH 5JEAG 1GUTA 1EY7A 2FHTA 3QOLA 4CHTB 1BBXC 5EBDA 2L1BA 4HTHA 1UUPA 4XT1B 1EY0A 3U9SA 3PV0A 1QILA 3T51B 3LWUA 1PRTD 2BCOA 3KUPA 5J39A 5IGEA 1DCZA 1B3AA 3IFTA 4HAEA 5JPMC 1FNUA 2HQEA 3HOUB 1EY8A 3BG3A 2CW0D 1U4PA 1TKWB 2K6AA 2B39A 2WP8J 3NHHA 2PZWA 5CV4A 5EKLA 3QIAA 3D6WA 1KLGD 4PQXA 2CHBD 1L0YB 4MN3A 1C8CA 3A7LA 5C6AA 2QF7A 4K5WA 1SEBD 5E1FA 5C0XH 2EYPA 1G291 5FLXE 3K5MA 1K8OA 5C0XG 3I91A 2M2LA 3TP5A 3HKZB 3W3AA 3SK8A 1F9RA 1SNPA 1A3VA 2OF1A 1QJOA 1OXTA 1BO0A 2DN8A 3I73A 5COYA 1OXSC 2EYOA 2Z4IA 4RA8A 4ZQ3A 3KBGA 2O2LD 5EPLA 1DONA 3EA6A 4FYDA 2L9HA 2XWBB 1BCPD 5JPNC 5CORA 4IN3A 2JSOA 3PUXA 1NCVA 3SEBA 2O5JC 2BE5D 3I4NB 1U9RA 2R61A 5CR3A 2XSCA 1EWCA 1B4OA 1ILQA 2D5DA 2YYZA 4B9XA 4A3KB 2F0SA 5IGGA 2B2WC 3KLRA 2IX1A 3CKIB 2WACA 4CBVA 3D3RA 4A3DB 5A2QL 2FJ2A 4KJOA 4IFDI 1TT2A 2E74C 1AFPA 5LL6X 3I4LA 1HXYD 3PUYA 3T16A 1G2SA 5EQ0A 1KABA 2WKDA 5DEHA 4KY6A 2KQ3A 1Y8OB 1JORA 3AMUA 4KD3A 4CJ1B 1E0BA 4OO1I 1GUNA 2R6GA 3KLSX 2F0TA 1QOHA 4FF3A 1PLFA 1CQVA 4H44C 3MWYW 2VNUD 4V190 2KUMA 1GUOA 5I4DA 4HSPA 1IW7C 3IKJA 3AB9A 4J8QA 1NR2A 4HMJA 1WTPA 2MHVA 1I50B 1SE4A 1EQVA 3CRLC 3DMUA 1H9RA 3MTSA 3HG9A 4RCOA 2IPKD 3PIO3 2QKIC 1KTKA 2EY2A 1U4LA 4X3SA 5M3FB 3P7JA 3RLFA 2VXWA 4X3UA 5E4XA 4ILWA 3Q24A 2TSSA 4K8JA 4ZLTF 2A5HA 1WTQA 4XYQA 2F0JA 4QUFA 4AYBB 2D2CC 4CJ0B 2PZUA 2F0GA 4L63B 1SJED 5HURA 3T53B 4IFDJ 3P1HA 1C4QA 5CBEE 1J8IA 3NBIA 3MA2B 4KTAA 4A3EB 1Z47A 5T1GA 1FNWA 4IUPA 3OOCA 3DWQA 3X3NA 1TS4A 1A3UA 2K5DA 1I6VC 1SYGA 1UAPA 5C4HA 4KKUA 1D5ZC 3CHBD 4FVMA 1RKNA 3E0JA 2H4OA 1CFMA 5CV5A 2H1EA 4F87A 2F0KA 1Y1WB 1TY0A 4K6LA 1S5DD 4EQPA 1JWSD 2F0DA 1I6HB 1JOKA 2ZXPA 5EKIA 1LTSD 5KIXA 4WJWA 1VF5C 3JAME 2BA0A 4DXGA 2M9VA 4Y7NB 2V4DA 2B2VC 2QCPX 2ZT9C 1SYBA 3HGBA 1JQYD 2RDFA 5ELBA 1RTNA 3FKIB 1SDFA 3VA7A 3I90A 3J81E 3H0GB 4QMGA 4K5VA 1HPCA 2OXPA 2EYJA 2A68D 1SFOB 1D1IA 4MIUA 1GJXA 1IKMA 1ENCA 2KCNA 1ICWA 4RWSC 1EOTA 1TWAB 2NVTB 4ZUJA 5FK9C 4KHZA 1BXTA 1MSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SJE D;  1CK1 A;  1TY2 A;  4C56 C;  1I4R A;  1B44 D;  2Z8L A;  1BCP F;  3R8B A;  3W2D A;  1SXT A;  2NTS A;  4RGO S;  1LT6 D;  1LTT D;  2AQ3 B;  2J4X A;  1SJH D;  1RD9 D;  1UUP A;  5FKA C;  2SEB D;  1HQR D;  1QIL A;  1ESF A;  2AQ2 B;  1BCP B;  1D6E C;  1FNW A;  4RFB A;  1XTC D;  5ELC A;  1DYQ A;  1I4X A;  3DWQ A;  1KLU D;  1AN8 A;  1TS4 A;  4L6T B;  1HXY D;  1EU4 A;  1PRT D;  1JWM D;  1TS3 A;  1UNS A;  1XXG A;  1LTB D;  1AW7 A;  3O13 A;  1S5F D;  1TS2 A;  1V1O A;  1STE A;  3GP7 A;  1JCK B;  1PZI D;  1LT4 D;  1GOZ A;  1G8Z D;  5ELD A;  1PRT C;  1EFI D;  1FNU A;  1LTI D;  2ICI A;  4O1N A;  1ENF A;  1EEF D;  1LLR D;  1S5C D;  4RHR A;  1HA5 A;  1LT5 D;  1D5Z C;  2XN9 C;  3CHB D;  1EEI D;  1I4Q A;  2RDG A;  2XNA C;  1PZJ D;  3KLS X;  1ET6 A;  1B1Z A;  1JR0 D;  1KLG D;  1PTO H;  1TY0 A;  2CHB D;  4K6L A;  1L0Y B;  1V1P B;  1S5D D;  4UDU C;  1FD7 D;  1S5E D;  4RGN A;  1JWS D;  1JWU D;  1PTO D;  1CQV A;  1RF2 D;  1I4G A;  1I4H A;  1PYW D;  1FGB D;  1SEB D;  2RDH A;  5I4D A;  1FNV A;  1LTS D;  1ET9 A;  1PTO C;  3BVZ A;  1SBB B;  1RCV D;  1S5B D;  1D5M C;  1MD2 D;  1SE2 A;  4DXG A;  1M4V A;  1CT1 D;  1SE4 A;  1LTG D;  4Z9C B;  3URY A;  1RDP D;  3R2I A;  1L0X B;  2G9H D;  4OHJ A;  4RCO A;  3R2T A;  4RHS A;  2IPK D;  1T5X D;  1I4P A;  1JQY D;  3MFG A;  5ELB A;  1KTK A;  2WV6 D;  3TSS A;  1PRT F;  3BVG A;  1PTO F;  5TSS A;  2NTT A;  5D3D A;  2XRS D;  2XRQ D;  2O2L D;  4BWG B;  3EA6 A;  1F77 A;  1HTL D;  2AQ1 B;  4RGM A;  4RGT A;  3EFX D;  3DWA A;  3V05 A;  1BCP D;  4TSS A;  3SEB A;  4RH6 A;  3DWP A;  1PRT B;  1PTO B;  2IJ0 A;  2QIL A;  3OWE B;  1TS5 A;  5D3I B;  1LO5 D;  3BYY B;  2R61 A;  1BCP C;  3BZD B;  2QEJ C;  1EU3 A;  1CHQ D;  1CHP D;  1EWC A;  2TSS A;  4DXF A;  1LTA D;  1PZK D;  1LTR D;  1V1P A;  3MC0 B;  5ELE A;  3BYT B;  5ELF A;  4ZYS A;  1LT3 D;  1DJR D;  3BVM A;  5FK9 C;  1BXT A;  4L63 B;  1SE3 A;  1D5X C; 
#chains in the Genus database with same CATH topology
 1NY4 A;  1KDA A;  1TY2 A;  4ME3 A;  4YIJ A;  3HKZ E;  2J0T D;  1SXT A;  5H1S E;  4DR4 L;  1LT6 D;  4KMU C;  1PXU A;  1Z9F A;  2KHS A;  2SOB A;  1CI3 M;  4FP5 D;  4JI4 L;  3PF4 A;  3NBH B;  4JYA L;  5LHY 1;  4CKB A;  4OWT B;  1L2F A;  4L6T B;  4HIM A;  1TS3 A;  3BZC A;  1IYJ B;  3X3M A;  4IUU A;  1Q90 A;  4DK0 A;  1I3Q B;  2NUC A;  1G91 A;  1TS2 A;  1V1O A;  1SSO A;  3NUC A;  4WFN 3;  1YHA A;  3DEP A;  1G8Z D;  5C4J B;  4LFA L;  5ELD A;  2ATW A;  3RMH A;  4JK1 C;  4LF6 Q;  4O1N A;  2ZJP A;  1F2M A;  2A73 B;  4Q0F A;  1GUW A;  3H3V H;  1IKL A;  1S40 A;  4O0A A;  1IYV A;  4LK1 C;  3T4A C;  2HUG A;  1S5E D;  1TVX A;  1PH1 A;  4HED A;  2UU9 L;  1PTO D;  1N36 Q;  1IXR A;  2FXQ A;  4TRD A;  3GD7 A;  4XIG S;  3C1F A;  1MIU A;  4CDE C;  3TS2 A;  1YNJ C;  4WJ4 A;  4OIJ A;  4TKO B;  1RCV D;  4BBR G;  1H9S A;  3STB C;  1HFG A;  3T56 B;  3R2I A;  3S24 A;  4A3J H;  4LFB Q;  4QCL A;  1WVL A;  3A7A B;  2HDM A;  2A68 C;  1HNZ Q;  2MPM A;  4LF9 Q;  4I65 A;  4A3J G;  1STB A;  1I94 L;  4KY7 A;  1T5X D;  3F2U A;  3HOV H;  4IZ8 A;  3HOV G;  2K33 A;  5KEE A;  4DU9 A;  4P73 A;  2KBN A;  1E1O A;  2EJM A;  3GTJ H;  1STG A;  3GTQ B;  5IT9 c;  2NZ1 D;  1NJI C;  4ZUI A;  4AH6 A;  2MJ8 A;  3PO3 H;  3IRB A;  5EBC A;  4GOP B;  5IYD H;  1EWH A;  4Q5V A;  4J1M A;  4DR3 L;  4DXF A;  1CHP D;  3PO3 G;  5IYD G;  4G4K A;  3M7N A;  2VUM H;  1FGU A;  3NE5 B;  2AHO B;  4CDC C;  1OTC A;  2VUM G;  3T1H L;  4A3G H;  3BYT B;  2EJF C;  1VQ5 A;  4A3G G;  1QNK A;  5LMU L;  1KNA A;  2YU9 H;  3KFU A;  3FMC A;  2D9U A;  1NNX A;  4A3J B;  4FXG C;  3W2D A;  3DLL A;  2PW7 A;  1LTT D;  4LMQ D;  3P75 A;  4JOI A;  4DNT B;  3HOV B;  2B29 A;  4L5S A;  1MGS A;  4FXK C;  2EY5 A;  3CCU A;  3GTJ B;  2GVB A;  1AN8 A;  1PFN A;  4JV5 L;  1DXM A;  2ZXR A;  4MNO A;  3T1Y Q;  3NPP A;  1B70 B;  3PGZ A;  3PO3 B;  2EXZ A;  1WTH A;  1EWI A;  2F4V Q;  1GUG A;  3SHL A;  2VUM B;  1JIC A;  2B8G A;  4DV6 Q;  4R4I A;  2XNA C;  1VDZ A;  3SK4 A;  4NP5 A;  4UP7 A;  1EY6 A;  4XT3 B;  1B1Z A;  3TZD A;  1UE7 A;  1SYE A;  2KEN A;  4KJN A;  2JA7 H;  1YHQ A;  4AYB E;  3MFY A;  4RGN A;  1PV4 A;  3K5L A;  2JA7 G;  3LWE A;  2VQF Q;  5I2Y A;  3SK5 A;  2EYF A;  2IX0 A;  1YJW A;  1LAB A;  1SMY D;  3GTM H;  3FPU B;  1SYD A;  2FFK B;  3DHQ A;  4DFA A;  3OW7 A;  4YHH Q;  1MSG A;  2K03 A;  3G48 A;  1G2T A;  3CME A;  3S1R H;  1HR0 W;  1B53 A;  2PNR C;  2F0U A;  2UUA Q;  1R4Q B;  1VMC A;  5FJ8 H;  5IGF A;  4EQN A;  3G6E A;  2IWH A;  2ZJR A;  5FJ8 G;  3NQI A;  2WII B;  2A69 D;  2WV6 D;  2ZM6 L;  2BDO A;  3TS0 A;  2K1B A;  1X3F A;  2XRS D;  2LY7 A;  3QB3 A;  4OGQ C;  1HTL D;  3C2P A;  1DOK A;  3DWA A;  4NPS A;  4ZCK A;  3WWV A;  1PYS B;  4ALP A;  4BY1 H;  1HZC A;  2K05 A;  3OWE B;  1CUK A;  4BY1 G;  3CPW A;  2K4K A;  4FXD A;  4CGY B;  5JAV A;  4OO1 H;  2JA7 B;  3C3L A;  4OO1 G;  3M85 A;  4A75 A;  3VYU A;  1V1P A;  2Q2U A;  1XYI A;  2PQA A;  1CKM A;  2Z1C A;  2B3G A;  1UWV A;  1X56 A;  2UXC Q;  1EY5 A;  1EIH A;  1VF7 A;  4DR6 Q;  4DV2 Q;  4H02 A;  4DR2 L;  1HNW L;  4QJF A;  3S1R B;  4DN4 M;  1VQP A;  3BDC A;  2SNM A;  2ICE C;  3MEH A;  2J4X A;  3AFP A;  3KF8 A;  4YCU A;  2RCF A;  4IJH A;  2NWG A;  1BCP B;  5E4W C;  4KKT A;  3VR4 A;  2ZXO A;  2ZJQ A;  3TME A;  1E2V A;  1KXL A;  4P72 A;  1B50 A;  5J22 A;  3HOX H;  3V2T A;  2L12 A;  2UXD Q;  1KNE A;  4BY1 B;  1STE A;  1JCK B;  3HOX G;  1KAA A;  4B3T Q;  1Q8I A;  3F2D A;  4EGV A;  3RN5 A;  2ICI A;  2IY5 B;  3CD6 A;  5C3W A;  5GAG C;  3MXP A;  1W6K A;  1SN8 A;  2PPB C;  1I4Q A;  3KK7 A;  2X6L A;  3U4V A;  2O4X A;  2RBM A;  3RZO H;  5M3M H;  1E2Z A;  4NMZ A;  2UXB Q;  4K8I A;  4B3R L;  5M3M G;  4A3F H;  2PI2 E;  1J6Q A;  1ASZ A;  5FLM H;  1JJ2 A;  2M00 A;  4A3F G;  3F2C A;  5FLM G;  1SE8 A;  2TMP A;  1XMO L;  4F8M A;  5KNC A;  4KY5 A;  5FO7 B;  1JE4 A;  1KRS A;  3H3V C;  4OX9 Q;  5D65 A;  5IT9 L;  5AJ3 Q;  4EQO A;  4A3L H;  2QGQ A;  4A3L G;  3GO5 A;  2R3Z A;  3J80 c;  4MHE A;  5IY0 A;  1SE2 A;  1RHP A;  1ILP A;  3WOF A;  3URY A;  1IL8 A;  3SR1 A;  1XJV A;  4PMC A;  2JK8 A;  4LF8 Q;  3HOX B;  5FOB B;  3TZU A;  2V1C C;  4L8J A;  1AP0 A;  3OHX C;  1ASY A;  4FO2 A;  1SYC A;  1JB3 A;  1XWE A;  2NTT A;  2A6H D;  1SAP A;  5D3D A;  2K04 A;  2IHE A;  4FNF A;  1VQJ A;  5M3M B;  4B3M Q;  3ND8 A;  5BN3 A;  4A3F B;  1XPU A;  5JVG 3;  1WI5 A;  3NSW A;  4JI0 L;  1KDB A;  3EJI A;  2K28 A;  1LTR D;  5F2D A;  4DGZ A;  2IHF A;  2KCC A;  1KHI A;  1A3T A;  5KGU A;  5NUC A;  1K3B C;  4NXM L;  4DV3 Q;  1VQG A;  1FJG L;  5I9O A;  1G51 A;  5A35 A;  1YHB A;  2DUD A;  5IGC A;  5J1Z A;  3R8B A;  1QNU A;  3OIP A;  4IO9 A;  3GV6 A;  3AFQ A;  4ZRZ A;  1EZ6 A;  2K7V A;  5IWA L;  1IYU A;  3I4M H;  3CXC A;  1ESF A;  4DAV A;  1DYQ A;  3I4M G;  1G6Z A;  2VW9 A;  1EYC A;  1MKH A;  1UNS A;  2R93 H;  4LFC Q;  1AW7 A;  4KHV A;  2R93 G;  1STA A;  1LT4 D;  4DV0 Q;  1PRT C;  1JOQ A;  2R7Z G;  3BZK A;  2K01 A;  1HTP A;  3K59 A;  1IHZ A;  3UDI A;  2A19 A;  1OXX K;  4B3S L;  3M4P A;  3E3X A;  3D31 A;  1DD2 A;  1YNN D;  4HJ9 A;  3VYS A;  4L5Q A;  1K8M A;  5AFW A;  4A3B H;  2B2Y C;  2CW0 C;  4R8N A;  4KLK A;  4A3B G;  2EYL A;  2EYH A;  5CV6 A;  4BBS H;  5CYU A;  3D4D A;  4EVO A;  3NEN A;  4JI2 L;  3NK9 A;  3KLS A;  4A93 H;  4O42 A;  5HGQ A;  3GTO H;  4A93 G;  5EGT A;  3A55 A;  3PMF A;  4POG A;  3PUV A;  3I4M B;  1MD2 D;  2IL8 A;  2R93 B;  1VQ8 A;  1L0X B;  2F3V A;  2D0O A;  4BA1 I;  5EJW A;  3E6Z X;  3DXJ C;  1K83 H;  2L5T A;  1P8L A;  1M90 C;  1NUC A;  1S4Z A;  1CZG A;  2DY7 A;  5DAU A;  2N49 A;  4F7X A;  4LF5 Q;  4DKA C;  2B8F A;  2VB2 X;  3A8I E;  4IUR A;  1Z6H A;  1WJJ A;  4A3B B;  1SRU A;  4I7Z C;  4RH6 A;  2LMC B;  2F4I A;  2JYO A;  1YVC A;  4LF4 Q;  2A6E D;  1TXY A;  1BCP C;  1SLJ A;  4TVA B;  5CC4 A;  4BBS B;  2I0Q A;  1WTW A;  3K5N A;  1CKO A;  3D4W A;  5KRU A;  2BE5 C;  1CA6 A;  4A93 B;  4AQY Q;  5E3F A;  3GTO B;  3VA5 A;  3FRP B;  3CP0 A;  4C1N I;  4FF1 A;  1OXU A;  4LW1 A;  1C9O A;  1D7Q A;  2F0E A;  4CDD C;  1SE3 A;  1XNR Q;  1QCB D;  4X62 L;  3CQZ H;  3E9H A;  4HMI A;  3TP7 A;  4DR7 Q;  1C48 A;  1HZA A;  1K83 B;  3AYH B;  3WOE A;  3KJP A;  2BH8 A;  5GQO A;  5CBA E;  4DUZ Q;  1HQR D;  3MHB A;  3OW2 A;  4RFB A;  4OWW B;  4G57 A;  1AEX A;  1T5E A;  4A4I A;  3CU7 A;  2F3I A;  1X3P A;  1BNZ A;  3J7A F;  1FL0 A;  2DJF C;  3I56 A;  4ULL A;  4NW2 A;  3J80 L;  4DV7 L;  1ONL A;  1PA6 A;  4BY7 H;  4BY7 G;  2HQL A;  3I8Z A;  3GTL H;  3MXU A;  2RDG A;  4OIK A;  1QZG A;  3N6R A;  4K5X A;  3I7F A;  2D62 A;  1PTO H;  4NXN Q;  5HGT A;  1DOM A;  1FD7 D;  1FR3 A;  2ZTC A;  2E5L L;  1I4G A;  1HNX Q;  4OEM B;  4GKJ L;  3S2H H;  4LFB L;  4X64 L;  3UE0 A;  3T13 A;  1X9N A;  3OSO A;  3S14 H;  2LXJ A;  3KBX A;  2MQH A;  3HFZ B;  4N9T A;  3VR3 A;  4UPA A;  4BY7 B;  1VQB A;  1EQR A;  4KHP L;  4X65 L;  4QL5 A;  3HKS A;  4BWG B;  3GTL B;  2AQ1 B;  1E1T A;  1ML0 D;  3EFX D;  3VR6 A;  2K5H A;  5D14 A;  2E2D C;  2AUK A;  4NB3 A;  3TQY A;  4QY7 A;  1PTO B;  2F0H A;  1A2U A;  1TS5 A;  2N3S A;  3MXN A;  2JXM B;  2WAQ G;  1CKN B;  5FO9 B;  3NQT A;  2HDL A;  4JI1 L;  1MI2 A;  2C5C A;  3S2H B;  1IBL Q;  5ELE A;  3LNN A;  2DJG C;  1NMF A;  2I5M X;  2RSN A;  5A2Q E;  1LT3 D;  1DJR D;  2YV5 A;  4C56 C;  1N32 Q;  4JCV E;  1T9H A;  2Z6K A;  1A62 A;  3S14 B;  4JBJ A;  1BCP F;  4GN5 A;  3NWS A;  4QUC A;  1QVF A;  5JEA J;  1VMP A;  4DAY B;  1SJH D;  1FYC A;  4ZKB B;  2RKS A;  2PCF B;  5C4X H;  4JI6 L;  1CSQ A;  3T1Y L;  2A1A A;  5C4X G;  3P20 A;  5ELC A;  4K6D A;  5I2X A;  2JP1 A;  3AQQ A;  2Q8I B;  3BDO A;  1XXG A;  1LTB D;  2NBF A;  3H94 A;  2F52 A;  4KN4 C;  1WCM H;  4H7B A;  3M9B A;  1Y1V H;  4JI7 Q;  4S3S A;  1NSN S;  2WAQ B;  3GQB A;  1Y1V G;  2EDG A;  2RQX A;  1WTO A;  2UUC Q;  1R4P B;  5M5X H;  4C1N K;  2CQA A;  2ASB A;  4ABN A;  2RHQ B;  1ZXT A;  4DAP A;  1KDC A;  2VQF L;  5LMN Q;  3NP8 A;  3PIP 3;  2B2U A;  2OT2 A;  3J7Y W;  1X3E A;  4XDX A;  5EAY A;  3OYY A;  2X69 A;  3QOJ A;  4KD4 A;  1HR0 Q;  4XQN A;  1STN A;  3U4Z A;  5C3E G;  4LAA A;  1JJG A;  1ESR A;  3OMC A;  5BR8 Q;  1YBY A;  5C4X B;  3TN2 A;  2AMC B;  1D5M C;  2R7F A;  2UUA L;  1XX8 A;  1XMQ L;  2JEA I;  3TP8 A;  3A8J E;  2FIN B;  1UE6 A;  2KHI A;  1ICF B;  5C0X J;  5I6W A;  4R9W A;  4OHJ A;  4WRD A;  4GS3 A;  3R2T A;  1Y8N B;  1Q81 C;  1WCM B;  1LAC A;  1Y1V B;  1YIT A;  5ELO A;  3L7Z C;  1CSP A;  2CWA A;  3KF6 A;  4AIM A;  3HZX A;  4GLA C;  2KVM A;  2UUB L;  2MO1 A;  5M5X B;  3ERQ A;  1EIY B;  3E5S A;  3RLN A;  3TP6 A;  4BBR H;  4X66 L;  1A8V A;  1P16 A;  1O7I A;  3I72 A;  2JA5 H;  3A54 A;  5IYC G;  2UXC L;  2B63 G;  4YWK A;  1N33 L;  2JA5 G;  1K8A C;  5EKK A;  3MZ5 A;  2BDN A;  1N34 Q;  1RL2 A;  5IGD A;  4V0B A;  2F0O A;  3HOW H;  4P74 A;  3I3C A;  1YJN A;  3HOW G;  5C5L A;  1ZEQ X;  3UI2 A;  1CZW A;  2PZT A;  4JOI C;  1AE3 A;  1JOO A;  1VQD A;  2LKV A;  4BXX H;  1RTO A;  1ZYR D;  4BXX G;  1TU2 B;  4JPB W;  3G4S A;  2AQ2 B;  2AKW B;  2K5W A;  5KYI A;  4YCV A;  4I7A A;  1KLU D;  3CCJ A;  2RSO A;  2OQK A;  4BBR B;  4U68 A;  1VQC A;  1G6P A;  3MEF A;  3K7A H;  3A0J A;  1V8Q A;  5IOC A;  4E6I A;  2I46 A;  4RHR A;  2JA5 B;  5M5W H;  1EEI D;  3PIP A;  3ERO A;  1GKH A;  5AJ3 L;  1HZB A;  3HOW B;  3Q6S A;  3UDF A;  1I5F A;  2EY6 A;  1XPO A;  3FPP A;  4M1U B;  4GKK L;  1QWY A;  1NTG A;  2N8N A;  1R9T H;  2I5H A;  1EQQ A;  1PTO C;  3MVV A;  3CC2 A;  3CCE A;  2F0V A;  1YIJ A;  4OWX B;  3ITP A;  4A3G B;  4BA2 I;  4DV5 Q;  1UE5 A;  5FLX L;  3J81 j;  1KL9 A;  2K32 A;  3K7A B;  5C3X A;  2YU9 B;  2CWP A;  1H9J A;  4ZK9 B;  3S1N H;  1XNQ Q;  2CFM A;  3BDL A;  4JVZ A;  1HRJ A;  2NVY H;  1JC7 A;  3R93 A;  4DNR B;  5M5W B;  2NB0 A;  1EIG A;  3K7U C;  2K5Q A;  3MAQ A;  3K0X A;  5CV9 A;  5LMN W;  1PRT B;  1SYF A;  1Y8P B;  3ND9 A;  3H6M A;  4LF7 L;  1J5E L;  3LX0 A;  2PO4 A;  1EU3 A;  4DV3 L;  1PZK D;  3S16 H;  2E2I H;  1SR3 A;  3DM1 A;  4DR4 Q;  3H91 A;  1R9T B;  4IFD H;  2XIW A;  4JI4 Q;  4JI8 L;  4IFD G;  5JVH 3;  3NWT A;  5IE8 A;  3SVM A;  3NTI A;  4CKC A;  1B8A A;  2JEB I;  3JAM c;  2HHH L;  3EN2 A;  1PDQ A;  2RCN A;  1LUZ A;  2AQ3 B;  2EIF A;  2R92 H;  3A8K E;  4LFC L;  4CDF C;  3S1N B;  4N9P A;  2R92 G;  1V43 A;  1JB7 A;  2NVY B;  4LUV A;  2HIV A;  1YZ6 A;  3ULP A;  1C7Y A;  1L1O B;  5ISR A;  1EU4 A;  2QDL A;  1JWM D;  5BN4 A;  3CMA A;  3KDF A;  3J7A V;  4DR1 L;  3GTM B;  1SNC A;  1PZI D;  4HID A;  1JT8 A;  1F2L A;  1HH2 P;  2L0C A;  3N52 A;  4IPH A;  1BKB A;  3BS1 A;  4IUT A;  2HCC A;  2UU9 Q;  3S16 B;  2E2I B;  3DUZ A;  2OCE A;  3HRZ C;  1K28 A;  1PH7 A;  2MNA A;  1M1K C;  2PI2 A;  1X32 A;  5L37 A;  1JR0 D;  2PMZ E;  4LJZ C;  1QVG A;  1HUN A;  2PYK A;  4G7Z C;  1HZ9 A;  4CJ2 C;  3JC6 6;  5GAH C;  1PYW D;  2OTJ A;  1I94 Q;  4DK1 A;  4HSV A;  2R92 B;  2X6G A;  3IAY A;  1WOC A;  3H3V I;  2N55 A;  1TQO A;  2H5X A;  1K3R A;  1U5K A;  3SGI A;  5C44 H;  4K0K Q;  5IYB H;  1SMY C;  2F0W A;  3V96 A;  3NBH A;  5C44 G;  5IYB G;  1H9K A;  3VYR A;  3UE1 A;  1I4P A;  4DR3 Q;  1TR5 A;  3K5O A;  3OWF A;  3L3O C;  1UEA B;  3BVG A;  1PTO F;  2YTX A;  4LF4 L;  2JJQ A;  2CH4 A;  2QW7 A;  5KYL A;  3T1H Q;  1HA6 A;  1BBW A;  2A69 C;  5EPK A;  3J7Z C;  2WAQ E;  3V05 A;  2IW3 A;  4X3T A;  4JI5 L;  5LMU Q;  4R4T A;  1PHJ A;  3PSI A;  1OXV A;  4GLV B;  1BBU A;  2QEJ C;  1DM0 B;  2B2T A;  2RA4 A;  4QF4 A;  1EQT A;  1IBM L;  1S72 A;  3C46 A;  3ZYY X;  2I07 B;  5T1I A;  3GTK H;  2F0N A;  1VQL A;  3BVM A;  1K0R A;  5IIF A;  1AE2 A;  3G7L A;  5C44 B;  5EPJ A;  5G3L F;  3RZO B;  2EPB A;  3TRZ A;  4N8X 1;  2NTS A;  4RGO S;  2SNS A;  3HOZ H;  3VR2 A;  1BOS A;  3HOZ G;  3M4Y A;  5K5P A;  3A5Z B;  1I4X A;  4J15 A;  2Q2T A;  1QUQ B;  4TQU S;  3O13 A;  5DM7 3;  2N78 A;  4DF7 A;  3S15 H;  4GN4 B;  1HFN A;  3KJO A;  4DR5 L;  3AU7 A;  4JI3 L;  1EFI D;  3I70 A;  1EEF D;  1LLR D;  2K52 A;  2KJX A;  4PV1 C;  1KAW A;  1B9N A;  2KEE A;  2Q8R E;  1BQQ T;  5GRO A;  4DK6 C;  2AUJ D;  2JQO A;  4GOP A;  2K75 A;  3GTK B;  3GTP H;  2NZO A;  2DGY A;  4KN7 C;  1PMR A;  1TWG H;  4UHV A;  3A74 A;  3CC4 A;  1IW7 D;  1PH5 A;  3C1E A;  3D6C A;  5C4Z A;  1RF2 D;  4XYO A;  1FGB D;  3QG1 A;  4IQZ A;  4EQ5 A;  2G5D A;  3HOZ B;  1Z7T A;  1O7Z A;  4KK7 A;  5I9P A;  2R7Z H;  5JJI A;  2F0Q A;  2L11 A;  3QO2 A;  5BN5 A;  4KKS A;  3UDX A;  4DV4 L;  2ZM6 Q;  1S5B D;  1TWC H;  3CF5 A;  1CT1 D;  2EJG C;  3A5U A;  1LTG D;  3PCO B;  3ICE A;  1HJP A;  3RZD H;  1IBK L;  4G7H C;  1O78 A;  3TEH B;  1PFB A;  3S15 B;  4GLX A;  4P2C B;  2YTY A;  3Q22 A;  1WTR A;  3CCV A;  3JAM L;  5FO8 B;  3J80 i;  2VQE L;  2Z9H A;  3PQI A;  5TSS A;  5KND A;  1E2W A;  1GHK A;  4KV6 A;  1MJC A;  2XRQ D;  3HS0 C;  2F03 A;  3M7G A;  3RD4 A;  3GTP B;  4IUQ A;  5ELN A;  2A6H C;  2F0F A;  5M5Y H;  5CGK A;  4R4Q A;  1TWG B;  1LO5 D;  1HQM C;  2F3W A;  4DR2 Q;  4YY3 L;  4NKL A;  1CHQ D;  1KQS A;  3VR5 A;  1L1O C;  1O80 A;  3CRK C;  3J81 L;  4UP9 A;  1PH9 A;  3PUZ A;  1PH4 A;  1F9S A;  1QVC A;  2R7Z B;  3MC0 B;  1O7L A;  1AH9 A;  2Y0S G;  1EYA A;  2GA4 B;  4ZYS A;  1NMG A;  1B9M A;  3EVQ A;  1TWC B;  2EY1 A;  3OPO A;  2B2W A;  4RGT A;  4DV1 L;  1PH3 A;  3RZD B;  1A63 A;  3W5O A;  4K2K A;  4RG1 A;  4JBK A;  2IT1 A;  1Y14 B;  1H9S B;  5E7N A;  4P75 A;  4K2L A;  3EQL C;  4LUZ A;  5FKA C;  2HD3 A;  2GN5 A;  2O5I C;  4JC0 A;  2E76 C;  1VQ7 A;  2B2Y A;  4ODG A;  2NN6 I;  4IJL A;  5M5Y B;  4B3R Q;  3GP7 A;  1S3O A;  1GOZ A;  4K14 A;  1XMO Q;  1QB5 D;  2KA7 A;  1D1K A;  3IFD A;  1HA5 A;  2ENB A;  3GV3 A;  2F0P A;  4PZ8 A;  2KED A;  2Z4H A;  2Y0S B;  5IT9 E;  2ALY B;  4IUN A;  3A56 A;  1JJC B;  3SE0 A;  1NAP A;  1DZ1 A;  3S17 H;  1EOV A;  1ET6 A;  5GAE C;  1YNN C;  1A6X A;  2XGT A;  1VQE A;  4UDU C;  3U58 A;  4LF6 L;  4OON A;  3R3O A;  3FDT A;  1B2T A;  2RDH A;  5CV8 A;  4M8A A;  1FNV A;  1STH A;  3Q0A A;  1LV9 A;  1ROD A;  1A2T A;  3FVQ A;  1TWH H;  1WTV A;  4A3C H;  4RKB A;  4DK3 C;  3S9W A;  3D8G A;  4A3C G;  3PO2 H;  1VQF A;  2G9H D;  1Q8K A;  1N36 L;  3PO2 G;  3RN2 A;  4JBM A;  4PZ6 A;  4NDX A;  4JI0 Q;  4PNY A;  3EBE A;  1U4R A;  2OWO A;  2JA8 H;  1WD1 A;  4WJ3 M;  3I4O A;  1PRT F;  3RLO A;  2CKZ B;  3M3Y H;  3CQZ B;  1B3Q A;  4IUV A;  1Y1W G;  2JA8 G;  2LS0 1;  3BU2 A;  3I55 A;  4HCE A;  5JJL A;  1XTD A;  4NXM Q;  4ME5 A;  3S17 B;  1FJG Q;  1HNZ L;  2CCZ A;  3I2Z A;  2E2J H;  1N9W A;  4LF9 L;  2L15 A;  3ULL A;  1BVS A;  3BYY B;  2A74 C;  3BZD B;  2KEC A;  2YTV A;  2A6E C;  3H15 A;  4PG3 A;  4B08 A;  1K73 C;  4HJ8 A;  1EUJ A;  4HR7 B;  4F88 A;  5IWA Q;  1H95 A;  5C0X I;  1DGS A;  2Z6K C;  4BS9 A;  1TWH B;  4QGU A;  1NBW A;  1D5X C;  5I6Y A;  1CK1 A;  3K57 A;  3ERS X;  3PO2 B;  1I4R A;  2XWJ B;  2MP1 A;  1F2Z A;  5JOB A;  3FKI G;  1MJE A;  3NTK A;  4U67 3;  2F1M A;  2JA8 B;  4GZY C;  1H9M A;  1Q12 A;  1QG7 A;  3F1Z A;  3M3Y B;  2PMZ B;  1D6E C;  2ID0 A;  3CCS A;  1BR9 A;  1HCZ A;  5K36 H;  4GNX A;  1W3S A;  5CV7 A;  5K36 G;  1LM0 A;  4C3H H;  1S5F D;  2Z0S A;  5FLX c;  2E2J B;  1GUS A;  4C3H G;  4HCS A;  3OMG A;  3HOY H;  2LSS A;  1LTI D;  4A3I H;  3HOY G;  1GVP A;  5C5M A;  4XQQ A;  2XVS A;  3GTG H;  1GHJ A;  4A3I G;  3M4O H;  1LTL A;  3K8A A;  2DNC A;  4IOC A;  2F0L A;  2FMC A;  1PZJ D;  3ULJ A;  4EX5 A;  4H0L C;  1SMX A;  2B2U C;  2MFI A;  2PNH A;  4HN7 A;  3K0Y A;  1V1P B;  2PQA B;  4DUY Q;  1OO9 B;  2K5V A;  2F4V L;  2L4N A;  1YNJ D;  3SXH A;  1PYB A;  4IOA A;  4DV6 L;  1VQN A;  2AWO A;  1K0S A;  3L9A X;  3STB D;  1EY9 A;  3HP3 A;  3Q23 A;  1SBB B;  1IZ6 A;  4UAI A;  3UDG A;  2C9O A;  1M4V A;  2F0I A;  1NE3 A;  3NTH A;  3SDZ A;  4Z9C B;  3KF8 B;  1RDP D;  1TII D;  4C3H B;  4RHS A;  2EOT A;  4QIW B;  3RNU A;  3HOY B;  1W2B A;  1F9Q A;  1U0L A;  2B2V A;  3WDN A;  2FMM A;  4A3I B;  3MFG A;  3GTG B;  2N88 A;  5IP7 H;  1O7Y A;  3M4O B;  4C3I H;  5IP7 G;  2EYM A;  2BA1 A;  3DEO A;  5C3E H;  3Q8D A;  4C3I G;  1F77 A;  4RGM A;  1SNO A;  3TBI B;  4XQJ A;  1BF4 A;  4YHH L;  1MBY A;  5DNF A;  4Y52 H;  2NZH A;  2MGS A;  4A76 A;  1PVO A;  3DWP A;  5D3I B;  4WOR A;  1VQO A;  4QQB X;  2JA9 A;  4X62 Q;  3CAM A;  3K58 A;  4XXE A;  3FHW A;  3QWN A;  2CVR A;  4H13 C;  3OTO Q;  5ELF A;  2E75 C;  1SNQ A;  3ONA B;  4YWM A;  1EFW A;  2IJ0 A;  3LGJ A;  2LXK A;  1GXD C;  1B44 D;  2QEX A;  1Q3L A;  1YI2 A;  4DV7 Q;  2JA6 H;  2RVL A;  1RD9 D;  3J80 E;  3GTQ H;  5IYC H;  1Q82 C;  2JA6 G;  2B63 H;  2SEB D;  2WFW A;  1ZKO A;  4C3I B;  3CC7 A;  5C3E B;  4DR6 L;  4DV2 L;  1NR4 A;  4B9W A;  2E2H H;  4XTC S;  3VYT A;  4C3J H;  5CMD A;  4C3J G;  5IGB A;  2E5L Q;  1S5C D;  3QJY A;  2DY8 A;  4RMF A;  4GKJ Q;  4DA2 A;  5LL6 S;  4X64 Q;  4R8I A;  2HCI A;  1VQK A;  2Q2H A;  2UXD L;  1DOL A;  2NYZ D;  4B3T L;  2C35 B;  1VQ6 A;  1RJT A;  4C2M H;  1J9O A;  1F9P A;  1JWU D;  1GO3 E;  3FP9 A;  2PW5 A;  2JA6 B;  4K0K L;  5G3L D;  2SDF A;  1RIP A;  2WB1 G;  1PH8 A;  1EL0 A;  3K80 C;  2B63 B;  5DM6 3;  3BVZ A;  3D0F A;  4KHP Q;  2UXB L;  4X65 Q;  2K50 A;  1X55 A;  3F2B A;  2R7D A;  3S1M H;  4HJ7 A;  2EVB A;  1SRO A;  2G9D A;  1STY A;  2E2H B;  4OX9 L;  1EYD A;  4L5R C;  1Y69 U;  4C3J B;  2Q2I A;  2KCM A;  4DNI A;  3TSS A;  4CKE A;  4PMW A;  1WTX A;  1W6J A;  4A3M H;  3G71 A;  4JI1 Q;  4JBW A;  4RCN A;  1CM9 A;  1II3 A;  4MZ9 A;  4OXP A;  4A3M G;  1HUM A;  4LF8 L;  3PUW A;  2QIL A;  2AWN A;  4OL7 A;  2Y0S E;  4C2M B;  2WKC A;  1ENA A;  3S2D H;  1JE5 A;  1YJ9 A;  1LTA D;  4ID6 A;  2EE1 A;  4LUO A;  2JE6 I;  2WB1 B;  3NXW A;  3RUZ A;  1AZP A;  4JI6 Q;  4B3M L;  3OIQ A;  1BDO A;  1LYL A;  3CCQ A;  3ZJY C;  2NVQ H;  3S1Q H;  1A15 A;  1CQF A;  5JJK A;  3E9I A;  3S1M B;  2D0P A;  2Z8L A;  3HEJ A;  1HHV A;  1A0I A;  3EIV A;  2RHS B;  3L0O A;  1TWF H;  3FEW X;  5DLQ E;  2VY3 A;  3D4R A;  1Q1E A;  4O2D A;  3KLW A;  1WFQ A;  1M8A A;  1IL2 A;  4A3M B;  2J7Z A;  1XTC D;  1KRT A;  1SND A;  1ZYR C;  4PZ7 A;  2NVX H;  1BUV T;  4ZKC B;  4JYA Q;  4GN3 B;  4IPD A;  4RKL A;  1ENF A;  3S2D B;  1LT5 D;  1VQA A;  2Q8T A;  1U4M A;  3TRE A;  2XN9 C;  2PQE A;  3SK6 A;  4LFA Q;  4RAU C;  1CKN A;  3U9O A;  1XMQ Q;  3G6J B;  2NVQ B;  4HIK A;  2VB3 X;  3S1Q B;  4DV0 L;  1CTM A;  2IX3 A;  1SNM A;  2BOS A;  3IL8 A;  1AZQ A;  1I4H A;  3J81 c;  1PFS A;  2WIN B;  1TWF B;  5J3B A;  3TDQ A;  2OEO A;  1K9M C;  1ET9 A;  3MXG A;  2MUY A;  2UUB Q;  5JJZ A;  4DAY A;  2KOL A;  4POF A;  1X54 A;  2DNE A;  4QB4 A;  2QDB A;  1GM5 A;  2NVX B;  2OQ0 A;  4FF4 A;  4X66 Q;  4J6H A;  5M9O A;  1WD0 A;  2K14 A;  4PMB A;  4ZAI A;  1Q1B A;  1EY4 A;  4YWL A;  5KNB A;  4FF2 A;  1N33 Q;  4G7O C;  1D2B A;  3L2P A;  1X3G A;  2EZV A;  2NN6 H;  4IPG A;  2NN6 G;  1UE1 A;  4IAL A;  1QE6 A;  4TSS A;  1EZ8 A;  1EIF A;  2F0M A;  1CA5 A;  4KI0 A;  2L55 A;  2B2T C;  1VCI A;  4X3K A;  5IOD A;  2KCT A;  1PFM A;  1X3Q A;  3K6O A;  3HOU H;  2LFN A;  3H09 A;  3HOU G;  1F2Y A;  4LF5 L;  2EQS A;  2KHJ A;  3CPF A;  5JEA H;  5JEA G;  1GUT A;  1EY7 A;  2FHT A;  4DAM A;  3QOL A;  1VQM A;  4CHT B;  2P5Z X;  3NEL A;  1BBX C;  5EBD A;  3E0E A;  1Q46 A;  2L1B A;  1VS0 A;  4HTH A;  4AQY L;  3J7A 5;  1C0A A;  1UUP A;  4XT1 B;  1EY0 A;  3U9S A;  3PV0 A;  1QIL A;  1WYD A;  1QZH A;  3HKZ G;  3T51 B;  3JAM i;  4YCW A;  3LWU A;  4QIW E;  1XNR L;  1PRT D;  2BCO A;  3KUP A;  2K5N A;  4HJ5 A;  5J39 A;  5IGE A;  1DCZ A;  4DR7 L;  1B3A A;  3IFT A;  4HAE A;  5JPM C;  1PH2 A;  1FNU A;  3CCR A;  2HQE A;  4IPC A;  1EY8 A;  3BG3 A;  4GOP C;  3HOU B;  4DUZ L;  4GKK Q;  4JV5 Q;  2CW0 D;  2OTL A;  1U4P A;  1TKW B;  2K6A A;  2B39 A;  2WP8 J;  3MXN B;  3NHH A;  3J81 i;  1Q7Y C;  2PZW A;  4JG2 A;  5CV4 A;  5EKL A;  3AEV A;  1VQH A;  3QIA A;  3D6W A;  1K8G A;  1KLG D;  4PQX A;  2CHB D;  4GNX B;  1L0Y B;  3I4N H;  4MN3 A;  1C8C A;  2CQO A;  3I4N G;  4DPG A;  3A7L A;  5C6A A;  2QF7 A;  4K5W A;  1SEB D;  5E1F A;  5C0X H;  2EYP A;  1G29 1;  5FLX E;  3K5M A;  4A3K H;  1K8O A;  5C0X G;  3I91 A;  4A3K G;  2M2L A;  3TP5 A;  3HKZ B;  3W3A A;  3SK8 A;  4NXN L;  1F9R A;  1SNP A;  1A3V A;  2OF1 A;  1QJO A;  1EYG A;  1OXT A;  1HNX L;  1BO0 A;  2DN8 A;  4LF7 Q;  1J5E Q;  4A3D H;  4P71 A;  3I73 A;  1Q86 C;  5COY A;  1OXS C;  3DM3 A;  4A3D G;  2EYO A;  2RF4 A;  2Z4I A;  4RA8 A;  1V9P A;  3QR8 A;  4ZQ3 A;  3KBG A;  2O2L D;  5EPL A;  1DON A;  3EA6 A;  4FYD A;  2L9H A;  2Z6B A;  2XWB B;  4JI8 Q;  1BCP D;  5JPN C;  5COR A;  4IN3 A;  2JSO A;  3PUX A;  1NCV A;  3SEB A;  2O5J C;  2HT1 A;  2BE5 D;  3I4N B;  1B7Y B;  1U9R A;  2HHH Q;  2R61 A;  5CR3 A;  2XSC A;  1EWC A;  1B4O A;  1ILQ A;  5HY6 A;  2D5D A;  1XPR A;  2YYZ A;  4B9X A;  4A3K B;  2F0S A;  5IGG A;  2B2W C;  1V1Q A;  1GD7 A;  1UEB A;  3KLR A;  4UP8 A;  4APV A;  4FDB A;  2IX1 A;  3BJU A;  3CKI B;  2WAC A;  4DR1 Q;  2ZTD A;  4CBV A;  3D3R A;  5IP9 H;  4A3D B;  5A2Q L;  1IBL L;  5IP9 G;  2FJ2 A;  4KJO A;  1HNW Q;  2HIX A;  4IFD I;  1TT2 A;  2E74 C;  1I50 H;  1AFP A;  5LL6 X;  3I4L A;  1HXY D;  3PUY A;  3CCM A;  1N32 L;  3T16 A;  4BBS G;  1G2S A;  2VS1 A;  3KF6 B;  5EQ0 A;  1KAB A;  2WKD A;  5DEH A;  4KY6 A;  2XTI A;  2KQ3 A;  1Y8O B;  2VZA A;  1JOR A;  3GDE A;  3AMU A;  4KD3 A;  4CJ1 B;  4HJA A;  1E0B A;  5M3F H;  1GUN A;  4OO1 I;  4DUY L;  2R6G A;  5M3F G;  1YNX A;  4MTN A;  4L5T A;  3KLS X;  2F0T A;  5GAD C;  1QOH A;  4JI7 L;  2MO0 A;  2QA4 A;  2WB1 E;  4R1J A;  4FF3 A;  1PLF A;  1CQV A;  4H44 C;  1N8R C;  2UUC L;  3MWY W;  3W1G A;  2VNU D;  4V19 0;  2KUM A;  3CW2 C;  1GUO A;  5I4D A;  4HSP A;  1IW7 C;  3IKJ A;  3PF5 A;  3AB9 A;  4AYB G;  4J8Q A;  1NR2 A;  4HMJ A;  4N8F A;  5LMN L;  1WTP A;  2MHV A;  2EXD A;  1I50 B;  1SE4 A;  1EQV A;  3CRL C;  3DMU A;  1H9R A;  3MTS A;  4JI5 Q;  3HG9 A;  4RCO A;  1FVI A;  2IPK D;  1HR0 L;  3PIO 3;  1E3P A;  1L1O A;  1E22 A;  2QKI C;  1KTK A;  2EY2 A;  5BR8 L;  2ES2 A;  1U4L A;  4A3E H;  4X3S A;  1L0W A;  5M3F B;  4A3E G;  3P7J A;  3RLF A;  1IBM Q;  2VXW A;  4X3U A;  5E4X A;  4R4O A;  3KOJ A;  4ILW A;  3F8T A;  1D8L A;  3Q24 A;  2VL6 A;  2A8V A;  3OTO L;  2TSS A;  2CH4 W;  4K8J A;  1YEZ A;  4ZLT F;  2A5H A;  4LNQ A;  1WTQ A;  4XYQ A;  2F0J A;  4QUF A;  4AYB B;  2D2C C;  4CJ0 B;  1Y1W H;  2PZU A;  2F0G A;  3NEM A;  2BH2 A;  4L63 B;  1SJE D;  5HUR A;  3T53 B;  2ZTE A;  4IFD J;  3P1H A;  1C4Q A;  5CBE E;  1J8I A;  1I6H H;  4DR5 Q;  4JI3 Q;  3VDY A;  3NBI A;  3MA2 B;  1N34 L;  4GNX C;  4LWC A;  4KTA A;  4A3E B;  1Z47 A;  5T1G A;  1FNW A;  4IUP A;  3B6Y A;  3ER0 A;  3OOC A;  3DWQ A;  3X3N A;  1E24 A;  1TS4 A;  1A3U A;  2JN4 A;  4Y7N H;  2K5D A;  1I6V C;  1JMC A;  4R4C A;  1SYG A;  1UAP A;  5C4H A;  4KKU A;  3FKI H;  1D5Z C;  3CHB D;  4FVM A;  1RKN A;  3E0J A;  2H4O A;  1CFM A;  5CV5 A;  3H0G H;  2H1E A;  4F87 A;  4DV4 Q;  3H0G G;  2F0K A;  4OEL B;  1Y1W B;  1TY0 A;  4B3S Q;  4K6L A;  1SFO H;  4X6A H;  1S5D D;  4EQP A;  2E8G A;  1IBK Q;  1JWS D;  3CCL A;  4JW0 A;  3W1B A;  2I5L X;  2F0D A;  1I6H B;  1X6O A;  1JOK A;  2ZXP A;  3U50 C;  5EKI A;  1KD1 C;  1LTS D;  1TWA H;  5KIX A;  2VQE Q;  4WJW A;  2GVA A;  2NVT H;  1VF5 C;  4JI2 Q;  3JAM E;  2BA0 A;  4DXG A;  3PIO A;  1VQ9 A;  2M9V A;  1KIX A;  4Y7N B;  2V4D A;  2B2V C;  2QCP X;  4MTK A;  1MHW C;  2ZT9 C;  1SYB A;  1QUQ A;  4YY3 Q;  3HGB A;  1JQY D;  2RDF A;  5ELB A;  3KDF B;  1RTN A;  3FKI B;  1SDF A;  3VA7 A;  4HIO A;  3I90 A;  3J81 E;  3H0G B;  1I3Q H;  4QMG A;  4DV5 L;  4K5V A;  1HPC A;  2OXP A;  2EYJ A;  5C4J H;  3M4Q A;  2A68 D;  1SFO B;  3K81 C;  4DV1 Q;  1D1I A;  1PH6 A;  4MIU A;  1KC8 C;  1XNQ L;  1GJX A;  1IKM A;  1ENC A;  1VQI A;  1ICW A;  2KCN A;  3KYH C;  3RR5 A;  1VQ4 A;  4RWS C;  1EOT A;  1TWA B;  4UY8 C;  2NVT B;  1E7Z A;  4ZUJ A;  1X65 A;  5FK9 C;  4KHZ A;  1BXT A;  1MSH A;  1WCM G; 
#chains in the Genus database with same CATH homology
 1KDA A;  1TY2 A;  4YIJ A;  2J0T D;  1SXT A;  1LT6 D;  4KMU C;  1PXU A;  2KHS A;  2SOB A;  1CI3 M;  4FP5 D;  5LHY 1;  4CKB A;  4L6T B;  1TS3 A;  3X3M A;  4IUU A;  1Q90 A;  4DK0 A;  1I3Q B;  2NUC A;  1G91 A;  1TS2 A;  1V1O A;  1SSO A;  3NUC A;  4WFN 3;  3DEP A;  1G8Z D;  5C4J B;  5ELD A;  3RMH A;  4JK1 C;  4O1N A;  1F2M A;  2A73 B;  4Q0F A;  1GUW A;  1IKL A;  1IYV A;  4LK1 C;  3T4A C;  2HUG A;  1S5E D;  1TVX A;  4HED A;  1PTO D;  4TRD A;  3GD7 A;  4XIG S;  3C1F A;  1YNJ C;  4OIJ A;  4TKO B;  1RCV D;  1H9S A;  1HFG A;  3T56 B;  3R2I A;  4QCL A;  1WVL A;  3A7A B;  2HDM A;  2A68 C;  2MPM A;  4I65 A;  1STB A;  4KY7 A;  1T5X D;  3F2U A;  4IZ8 A;  2K33 A;  5KEE A;  4DU9 A;  2EJM A;  1STG A;  3GTQ B;  2NZ1 D;  4ZUI A;  2MJ8 A;  5EBC A;  1EWH A;  4Q5V A;  4J1M A;  4DXF A;  1CHP D;  4G4K A;  3M7N A;  3NE5 B;  3BYT B;  2EJF C;  1QNK A;  1KNA A;  3FMC A;  2D9U A;  4A3J B;  4FXG C;  3W2D A;  2PW7 A;  1LTT D;  4LMQ D;  3P75 A;  4DNT B;  3HOV B;  1MGS A;  4FXK C;  2EY5 A;  3GTJ B;  1AN8 A;  1PFN A;  1DXM A;  2ZXR A;  3NPP A;  3PO3 B;  2EXZ A;  1GUG A;  3SHL A;  2VUM B;  1JIC A;  2B8G A;  2XNA C;  1VDZ A;  3SK4 A;  4NP5 A;  1EY6 A;  4XT3 B;  1B1Z A;  3TZD A;  1SYE A;  4KJN A;  3MFY A;  4RGN A;  3K5L A;  3LWE A;  5I2Y A;  3SK5 A;  2EYF A;  2IX0 A;  1LAB A;  1SMY D;  3FPU B;  1SYD A;  2FFK B;  3DHQ A;  4DFA A;  3OW7 A;  1MSG A;  2K03 A;  1G2T A;  1B53 A;  2PNR C;  2F0U A;  1R4Q B;  1VMC A;  5IGF A;  4EQN A;  2IWH A;  3NQI A;  2WII B;  2A69 D;  2WV6 D;  2BDO A;  2K1B A;  2XRS D;  2LY7 A;  3QB3 A;  4OGQ C;  1HTL D;  3C2P A;  1DOK A;  3DWA A;  2K05 A;  3OWE B;  4FXD A;  4CGY B;  5JAV A;  4OO1 H;  2JA7 B;  3C3L A;  4OO1 G;  3M85 A;  3VYU A;  1V1P A;  1XYI A;  2Z1C A;  1EY5 A;  1EIH A;  1VF7 A;  3S1R B;  4DN4 M;  3BDC A;  2SNM A;  2ICE C;  3MEH A;  2J4X A;  3KF8 A;  2NWG A;  1BCP B;  5E4W C;  4KKT A;  3VR4 A;  2ZXO A;  3TME A;  1E2V A;  1B50 A;  5J22 A;  3V2T A;  2L12 A;  1KNE A;  4BY1 B;  1STE A;  1JCK B;  1KAA A;  1Q8I A;  4EGV A;  2ICI A;  5C3W A;  3MXP A;  1W6K A;  2PPB C;  1I4Q A;  3KK7 A;  2X6L A;  2O4X A;  2RBM A;  1E2Z A;  4NMZ A;  4K8I A;  2M00 A;  2TMP A;  4F8M A;  5KNC A;  4KY5 A;  5FO7 B;  1JE4 A;  3H3V C;  5D65 A;  5IT9 L;  4EQO A;  3GO5 A;  2R3Z A;  4MHE A;  1SE2 A;  1RHP A;  1ILP A;  3WOF A;  3URY A;  1IL8 A;  3SR1 A;  4PMC A;  3HOX B;  5FOB B;  3TZU A;  4L8J A;  1AP0 A;  3OHX C;  4FO2 A;  1SYC A;  1JB3 A;  1XWE A;  2NTT A;  2A6H D;  1SAP A;  5D3D A;  2K04 A;  4FNF A;  5M3M B;  3ND8 A;  5BN3 A;  4A3F B;  5JVG 3;  3NSW A;  1KDB A;  3EJI A;  2K28 A;  1LTR D;  5F2D A;  4DGZ A;  2KCC A;  1A3T A;  5KGU A;  5NUC A;  5I9O A;  5A35 A;  5IGC A;  5J1Z A;  3R8B A;  1QNU A;  3OIP A;  3GV6 A;  4ZRZ A;  1EZ6 A;  2K7V A;  1IYU A;  1ESF A;  4DAV A;  1DYQ A;  1G6Z A;  1EYC A;  1UNS A;  1AW7 A;  4KHV A;  1STA A;  1LT4 D;  1PRT C;  1JOQ A;  2K01 A;  1HTP A;  3K59 A;  1IHZ A;  1OXX K;  3D31 A;  1DD2 A;  1YNN D;  3VYS A;  1K8M A;  5AFW A;  2B2Y C;  2CW0 C;  4R8N A;  2EYL A;  2EYH A;  5CV6 A;  5CYU A;  3D4D A;  4EVO A;  3NK9 A;  3KLS A;  4O42 A;  5EGT A;  3A55 A;  3PMF A;  3PUV A;  3I4M B;  1MD2 D;  2IL8 A;  2R93 B;  1L0X B;  2F3V A;  4BA1 I;  5EJW A;  3E6Z X;  3DXJ C;  2L5T A;  1NUC A;  1S4Z A;  1CZG A;  2DY7 A;  5DAU A;  4F7X A;  2B8F A;  2VB2 X;  3A8I E;  4IUR A;  1Z6H A;  4A3B B;  4I7Z C;  4RH6 A;  2LMC B;  2F4I A;  2JYO A;  2A6E D;  1BCP C;  5CC4 A;  4BBS B;  1WTW A;  3K5N A;  3D4W A;  5KRU A;  2BE5 C;  1CA6 A;  4A93 B;  5E3F A;  3GTO B;  3VA5 A;  3FRP B;  4C1N I;  4FF1 A;  1OXU A;  2F0E A;  1SE3 A;  1QCB D;  4HMI A;  3TP7 A;  1C48 A;  1K83 B;  3WOE A;  5CBA E;  1HQR D;  3MHB A;  4RFB A;  4G57 A;  1AEX A;  1T5E A;  3CU7 A;  1X3P A;  1BNZ A;  3J7A F;  4ULL A;  4NW2 A;  3J80 L;  1ONL A;  3I8Z A;  3MXU A;  2RDG A;  4OIK A;  3N6R A;  4K5X A;  2D62 A;  1PTO H;  5HGT A;  1DOM A;  1FD7 D;  1FR3 A;  1I4G A;  3T13 A;  3OSO A;  3KBX A;  4N9T A;  3VR3 A;  4BY7 B;  4BWG B;  3GTL B;  2AQ1 B;  1ML0 D;  3EFX D;  3VR6 A;  5D14 A;  2E2D C;  2AUK A;  1PTO B;  2F0H A;  1A2U A;  1TS5 A;  3MXN A;  2JXM B;  5FO9 B;  3NQT A;  2HDL A;  1MI2 A;  2C5C A;  3S2H B;  5ELE A;  3LNN A;  2RSN A;  5A2Q E;  1LT3 D;  1DJR D;  4C56 C;  3S14 B;  1BCP F;  3NWS A;  4QUC A;  5JEA J;  1VMP A;  1SJH D;  1FYC A;  4ZKB B;  2RKS A;  2PCF B;  3P20 A;  5ELC A;  4K6D A;  5I2X A;  2JP1 A;  2Q8I B;  3BDO A;  1XXG A;  1LTB D;  2NBF A;  3H94 A;  4KN4 C;  4H7B A;  4S3S A;  1NSN S;  2WAQ B;  3GQB A;  2EDG A;  2RQX A;  1WTO A;  1R4P B;  4C1N K;  2CQA A;  4ABN A;  1ZXT A;  4DAP A;  1KDC A;  3NP8 A;  3PIP 3;  2B2U A;  2OT2 A;  3J7Y W;  4XDX A;  2X69 A;  3QOJ A;  4KD4 A;  4XQN A;  1STN A;  4LAA A;  1ESR A;  3OMC A;  5C4X B;  3TN2 A;  1D5M C;  1XX8 A;  2JEA I;  3TP8 A;  3A8J E;  2FIN B;  5C0X J;  5I6W A;  4R9W A;  4OHJ A;  4WRD A;  3R2T A;  1Y8N B;  1WCM B;  1LAC A;  1Y1V B;  3L7Z C;  3HZX A;  2KVM A;  5M5X B;  3ERQ A;  3E5S A;  3TP6 A;  3I72 A;  3A54 A;  5EKK A;  3MZ5 A;  2BDN A;  5IGD A;  4V0B A;  2F0O A;  3I3C A;  5C5L A;  1ZEQ X;  3UI2 A;  1CZW A;  2PZT A;  1JOO A;  2LKV A;  1RTO A;  1ZYR D;  1TU2 B;  2AQ2 B;  2K5W A;  5KYI A;  1KLU D;  2RSO A;  4BBR B;  4U68 A;  1V8Q A;  5IOC A;  4E6I A;  2I46 A;  4RHR A;  2JA5 B;  1EEI D;  3ERO A;  3HOW B;  3Q6S A;  2EY6 A;  3FPP A;  4M1U B;  1QWY A;  1PTO C;  3MVV A;  2F0V A;  3ITP A;  4A3G B;  4BA2 I;  5FLX L;  2K32 A;  3K7A B;  5C3X A;  2YU9 B;  1H9J A;  4ZK9 B;  3BDL A;  1HRJ A;  1JC7 A;  3R93 A;  4DNR B;  5M5W B;  2NB0 A;  1EIG A;  2K5Q A;  3MAQ A;  5CV9 A;  1PRT B;  1SYF A;  1Y8P B;  3ND9 A;  3H6M A;  3LX0 A;  2PO4 A;  1EU3 A;  1PZK D;  3DM1 A;  3H91 A;  1R9T B;  4IFD H;  2XIW A;  4IFD G;  5JVH 3;  3NWT A;  3SVM A;  3NTI A;  4CKC A;  2JEB I;  1PDQ A;  2AQ3 B;  3A8K E;  3S1N B;  4N9P A;  1V43 A;  2NVY B;  5ISR A;  1EU4 A;  1JWM D;  5BN4 A;  3J7A V;  3GTM B;  1SNC A;  1PZI D;  1F2L A;  2L0C A;  3N52 A;  3BS1 A;  4IUT A;  2HCC A;  3S16 B;  2E2I B;  3DUZ A;  3HRZ C;  1X32 A;  1JR0 D;  4LJZ C;  1HUN A;  2PYK A;  4G7Z C;  4CJ2 C;  1PYW D;  4DK1 A;  4HSV A;  2R92 B;  2X6G A;  3IAY A;  2N55 A;  1TQO A;  1SMY C;  2F0W A;  3V96 A;  3NBH A;  1H9K A;  3VYR A;  1I4P A;  1TR5 A;  3K5O A;  3OWF A;  3L3O C;  1UEA B;  3BVG A;  1PTO F;  5KYL A;  1HA6 A;  2A69 C;  5EPK A;  3V05 A;  2IW3 A;  4X3T A;  1OXV A;  2QEJ C;  1DM0 B;  2B2T A;  2RA4 A;  4QF4 A;  1EQT A;  3C46 A;  3ZYY X;  2I07 B;  5T1I A;  2F0N A;  3BVM A;  5IIF A;  3G7L A;  5C44 B;  5EPJ A;  5G3L F;  3RZO B;  2EPB A;  2NTS A;  4RGO S;  2SNS A;  3VR2 A;  1BOS A;  3M4Y A;  5K5P A;  1I4X A;  4TQU S;  3O13 A;  5DM7 3;  4DF7 A;  1HFN A;  3AU7 A;  1EFI D;  3I70 A;  1EEF D;  1LLR D;  2KJX A;  4PV1 C;  1B9N A;  2KEE A;  2Q8R E;  1BQQ T;  2AUJ D;  3GTK B;  4KN7 C;  1PMR A;  1IW7 D;  3C1E A;  3D6C A;  5C4Z A;  1RF2 D;  4XYO A;  1FGB D;  3QG1 A;  4IQZ A;  3HOZ B;  1Z7T A;  1O7Z A;  4KK7 A;  5I9P A;  2F0Q A;  2L11 A;  3QO2 A;  5BN5 A;  4KKS A;  1S5B D;  1CT1 D;  2EJG C;  1LTG D;  4G7H C;  1O78 A;  1PFB A;  3S15 B;  4P2C B;  3Q22 A;  1WTR A;  3JAM L;  5FO8 B;  5KND A;  5TSS A;  1GHK A;  1E2W A;  4KV6 A;  2XRQ D;  3HS0 C;  2F03 A;  3M7G A;  3RD4 A;  3GTP B;  4IUQ A;  2A6H C;  2F0F A;  5CGK A;  1TWG B;  1LO5 D;  1HQM C;  2F3W A;  4NKL A;  1CHQ D;  3VR5 A;  1O80 A;  3CRK C;  3J81 L;  3PUZ A;  1F9S A;  2R7Z B;  3MC0 B;  1O7L A;  1EYA A;  2GA4 B;  4ZYS A;  1B9M A;  3EVQ A;  1TWC B;  2EY1 A;  3OPO A;  2B2W A;  4RGT A;  3RZD B;  4K2K A;  2IT1 A;  1H9S B;  4K2L A;  3EQL C;  5FKA C;  2O5I C;  2E76 C;  2B2Y A;  4ODG A;  2NN6 I;  5M5Y B;  3GP7 A;  1GOZ A;  4K14 A;  1QB5 D;  2KA7 A;  1D1K A;  3IFD A;  1HA5 A;  2ENB A;  3GV3 A;  2F0P A;  2KED A;  2Z4H A;  2Y0S B;  5IT9 E;  4IUN A;  3A56 A;  3SE0 A;  1NAP A;  1DZ1 A;  1ET6 A;  1YNN C;  1A6X A;  4UDU C;  3R3O A;  3FDT A;  1B2T A;  2RDH A;  5CV8 A;  4M8A A;  1FNV A;  1STH A;  3Q0A A;  1LV9 A;  1ROD A;  1A2T A;  3FVQ A;  1WTV A;  4RKB A;  3S9W A;  3D8G A;  2G9H D;  4NDX A;  4PNY A;  1U4R A;  1WD1 A;  1PRT F;  3CQZ B;  4IUV A;  2LS0 1;  4HCE A;  4ME5 A;  3S17 B;  3BYY B;  2A74 C;  3BZD B;  2KEC A;  2A6E C;  4B08 A;  4HR7 B;  4F88 A;  5C0X I;  4BS9 A;  1TWH B;  1D5X C;  5I6Y A;  1CK1 A;  3K57 A;  3PO2 B;  1I4R A;  2XWJ B;  2MP1 A;  1F2Z A;  5JOB A;  3NTK A;  4U67 3;  2F1M A;  2JA8 B;  4GZY C;  1H9M A;  1Q12 A;  1QG7 A;  3M3Y B;  2PMZ B;  1D6E C;  2ID0 A;  1BR9 A;  1HCZ A;  5K36 H;  5CV7 A;  5K36 G;  1S5F D;  2E2J B;  1GUS A;  4C3H G;  4HCS A;  3OMG A;  1LTI D;  4XQQ A;  5C5M A;  2XVS A;  1GHJ A;  2DNC A;  2F0L A;  2FMC A;  1PZJ D;  4H0L C;  2B2U C;  4HN7 A;  3K0Y A;  1V1P B;  1OO9 B;  2L4N A;  1YNJ D;  3SXH A;  2AWO A;  3L9A X;  1EY9 A;  3HP3 A;  3Q23 A;  1SBB B;  4UAI A;  2C9O A;  1M4V A;  2F0I A;  3NTH A;  3SDZ A;  4Z9C B;  1RDP D;  1TII D;  4C3H B;  4RHS A;  2EOT A;  4QIW B;  3HOY B;  1F9Q A;  2B2V A;  4A3I B;  3WDN A;  2FMM A;  3MFG A;  3GTG B;  2N88 A;  1O7Y A;  3M4O B;  2EYM A;  2BA1 A;  3DEO A;  4C3I G;  1BF4 A;  1F77 A;  4RGM A;  1SNO A;  3TBI B;  4XQJ A;  1MBY A;  5DNF A;  2MGS A;  3DWP A;  5D3I B;  4WOR A;  3K58 A;  4XXE A;  3QWN A;  2CVR A;  4H13 C;  5ELF A;  2E75 C;  1SNQ A;  3ONA B;  2IJ0 A;  1GXD C;  1B44 D;  1Q3L A;  2RVL A;  1RD9 D;  3J80 E;  2SEB D;  1ZKO A;  4C3I B;  5C3E B;  1NR4 A;  4B9W A;  4XTC S;  3VYT A;  5CMD A;  4C3J G;  5IGB A;  1S5C D;  3QJY A;  2DY8 A;  4DA2 A;  5LL6 S;  4R8I A;  2HCI A;  1DOL A;  2NYZ D;  1RJT A;  1J9O A;  1F9P A;  1JWU D;  2PW5 A;  2JA6 B;  5G3L D;  2SDF A;  1EL0 A;  2B63 B;  5DM6 3;  3BVZ A;  2EVB A;  2G9D A;  1STY A;  2E2H B;  1EYD A;  1Y69 U;  4C3J B;  4CKE A;  3TSS A;  4PMW A;  1WTX A;  1W6J A;  4JBW A;  4RCN A;  1CM9 A;  1II3 A;  1HUM A;  3PUW A;  2QIL A;  2AWN A;  4OL7 A;  4C2M B;  2WKC A;  1ENA A;  1LTA D;  4ID6 A;  2EE1 A;  2JE6 I;  2WB1 B;  3NXW A;  3RUZ A;  1AZP A;  3OIQ A;  1BDO A;  1A15 A;  1CQF A;  3S1M B;  2Z8L A;  3HEJ A;  1HHV A;  3FEW X;  3D4R A;  1Q1E A;  1M8A A;  4A3M B;  2J7Z A;  1XTC D;  1SND A;  1ZYR C;  1BUV T;  4ZKC B;  4RKL A;  1ENF A;  3S2D B;  1LT5 D;  2Q8T A;  1U4M A;  2XN9 C;  2PQE A;  3SK6 A;  4RAU C;  3U9O A;  2NVQ B;  3G6J B;  2VB3 X;  3S1Q B;  1CTM A;  2IX3 A;  1SNM A;  2BOS A;  3IL8 A;  1AZQ A;  1I4H A;  2WIN B;  1TWF B;  3TDQ A;  2OEO A;  1ET9 A;  3MXG A;  2MUY A;  5JJZ A;  4DAY A;  2KOL A;  2DNE A;  4QB4 A;  2QDB A;  2NVX B;  4FF4 A;  4J6H A;  5M9O A;  1WD0 A;  4PMB A;  4ZAI A;  1Q1B A;  1EY4 A;  5KNB A;  4FF2 A;  4G7O C;  1D2B A;  2EZV A;  2NN6 H;  2NN6 G;  4IAL A;  1QE6 A;  4TSS A;  1EZ8 A;  2F0M A;  1CA5 A;  4KI0 A;  2L55 A;  2B2T C;  1VCI A;  4X3K A;  5IOD A;  1PFM A;  1X3Q A;  3K6O A;  2LFN A;  3H09 A;  1F2Y A;  5JEA H;  5JEA G;  1GUT A;  1EY7 A;  2FHT A;  3QOL A;  4CHT B;  1BBX C;  5EBD A;  2L1B A;  4HTH A;  1UUP A;  4XT1 B;  1EY0 A;  3U9S A;  3PV0 A;  1QIL A;  3T51 B;  3LWU A;  1PRT D;  2BCO A;  3KUP A;  5J39 A;  5IGE A;  1DCZ A;  1B3A A;  3IFT A;  4HAE A;  5JPM C;  1FNU A;  2HQE A;  3HOU B;  1EY8 A;  3BG3 A;  2CW0 D;  1U4P A;  1TKW B;  2K6A A;  2B39 A;  2WP8 J;  3NHH A;  2PZW A;  5CV4 A;  5EKL A;  3QIA A;  3D6W A;  1KLG D;  4PQX A;  2CHB D;  1L0Y B;  4MN3 A;  1C8C A;  3A7L A;  5C6A A;  2QF7 A;  4K5W A;  1SEB D;  5E1F A;  5C0X H;  2EYP A;  1G29 1;  5FLX E;  3K5M A;  1K8O A;  5C0X G;  3I91 A;  2M2L A;  3TP5 A;  3HKZ B;  3W3A A;  3SK8 A;  1F9R A;  1SNP A;  1A3V A;  2OF1 A;  1QJO A;  1OXT A;  1BO0 A;  2DN8 A;  3I73 A;  5COY A;  1OXS C;  2EYO A;  2Z4I A;  4RA8 A;  4ZQ3 A;  3KBG A;  2O2L D;  5EPL A;  1DON A;  3EA6 A;  4FYD A;  2L9H A;  2XWB B;  1BCP D;  5JPN C;  5COR A;  4IN3 A;  2JSO A;  3PUX A;  1NCV A;  3SEB A;  2O5J C;  2BE5 D;  3I4N B;  1U9R A;  2R61 A;  5CR3 A;  2XSC A;  1EWC A;  1B4O A;  1ILQ A;  2D5D A;  2YYZ A;  4B9X A;  4A3K B;  2F0S A;  5IGG A;  2B2W C;  3KLR A;  2IX1 A;  3CKI B;  2WAC A;  4CBV A;  3D3R A;  4A3D B;  5A2Q L;  2FJ2 A;  4KJO A;  4IFD I;  1TT2 A;  2E74 C;  1AFP A;  5LL6 X;  3I4L A;  1HXY D;  3PUY A;  3T16 A;  1G2S A;  5EQ0 A;  1KAB A;  2WKD A;  5DEH A;  4KY6 A;  2KQ3 A;  1Y8O B;  1JOR A;  3AMU A;  4KD3 A;  4CJ1 B;  1E0B A;  4OO1 I;  1GUN A;  2R6G A;  3KLS X;  2F0T A;  1QOH A;  4FF3 A;  1PLF A;  1CQV A;  4H44 C;  3MWY W;  2VNU D;  4V19 0;  2KUM A;  1GUO A;  5I4D A;  4HSP A;  1IW7 C;  3IKJ A;  3AB9 A;  4J8Q A;  1NR2 A;  4HMJ A;  1WTP A;  2MHV A;  1I50 B;  1SE4 A;  1EQV A;  3CRL C;  3DMU A;  1H9R A;  3MTS A;  3HG9 A;  4RCO A;  2IPK D;  3PIO 3;  2QKI C;  1KTK A;  2EY2 A;  1U4L A;  4X3S A;  5M3F B;  3P7J A;  3RLF A;  2VXW A;  4X3U A;  5E4X A;  4ILW A;  3Q24 A;  2TSS A;  4K8J A;  4ZLT F;  2A5H A;  1WTQ A;  4XYQ A;  2F0J A;  4QUF A;  4AYB B;  2D2C C;  4CJ0 B;  2PZU A;  2F0G A;  4L63 B;  1SJE D;  5HUR A;  3T53 B;  4IFD J;  3P1H A;  1C4Q A;  5CBE E;  1J8I A;  3NBI A;  3MA2 B;  4KTA A;  4A3E B;  1Z47 A;  5T1G A;  1FNW A;  4IUP A;  3OOC A;  3DWQ A;  3X3N A;  1TS4 A;  1A3U A;  2K5D A;  1I6V C;  1SYG A;  1UAP A;  5C4H A;  4KKU A;  1D5Z C;  3CHB D;  4FVM A;  1RKN A;  3E0J A;  2H4O A;  1CFM A;  5CV5 A;  2H1E A;  4F87 A;  2F0K A;  1Y1W B;  1TY0 A;  4K6L A;  1S5D D;  4EQP A;  1JWS D;  2F0D A;  1I6H B;  1JOK A;  2ZXP A;  5EKI A;  1LTS D;  5KIX A;  4WJW A;  1VF5 C;  3JAM E;  2BA0 A;  4DXG A;  2M9V A;  4Y7N B;  2V4D A;  2B2V C;  2QCP X;  2ZT9 C;  1SYB A;  3HGB A;  1JQY D;  2RDF A;  5ELB A;  1RTN A;  3FKI B;  1SDF A;  3VA7 A;  3I90 A;  3J81 E;  3H0G B;  4QMG A;  4K5V A;  1HPC A;  2OXP A;  2EYJ A;  2A68 D;  1SFO B;  1D1I A;  4MIU A;  1GJX A;  1IKM A;  1ENC A;  2KCN A;  1ICW A;  4RWS C;  1EOT A;  1TWA B;  2NVT B;  4ZUJ A;  5FK9 C;  4KHZ A;  1BXT A;  1MSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...