1RF2D

Cholera toxin b-pentamer complexed with bivalent nitrophenol-galactoside ligand bv4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cholera toxin B protein (CTB)
publication title Nonspanning bivalent ligands as improved surface receptor binding inhibitors of the cholera toxin B pentamer.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 25
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rf2D00
1I4HA 1HA5A 1PZJD 1RCVD 1SE2A 3EA6A 3MC0B 1PTOH 2QILA 1FNWA 3GP7A 1TS2A 1FNUA 2XRQD 4OHJA 5ELDA 3W2DA 1SJHD 1CK1A 1LLRD 1F77A 1LT5D 5D3DA 1I4GA 1SBBB 1LO5D 1S5BD 1RD9D 1PYWD 4DXGA 1S5ED 4RGNA 3EFXD 1TY0A 2AQ2B 1XXGA 1G8ZD 1KLUD 3DWQA 1EU4A 3DWPA 1PTOC 5ELEA 1S5FD 1EEID 1DJRD 2XRSD 2SEBD 4RHSA 1I4RA 1PZKD 1TY2A 4RHRA 1CHPD 1B44D 1CQVA 2G9HD 2NTSA 1BCPD 3TSSA 1PRTD 1ENFA 1GOZA 1HXYD 2IPKD 1TS3A 1S5DD 3R8BA 3DWAA 4RCOA 1S5CD 1EFID 2RDHA 1LT4D 3KLSX 1RF2D 2TSSA 1FGBD 1RDPD 1TS4A 1BCPB 1LTBD 1LT3D 1MD2D 3R2IA 4RGOS 3BYTB 2O2LD 2R61A 1JWSD 1D5MC 1V1PA 1I4QA 1FNVA 1FD7D 3CHBD 1PZID 4L63B 1KLGD 2Z8LA 1PTOD 5ELFA 1JR0D 5TSSA 2XNAC 1T5XD 5ELCA 4RFBA 1EU3A 1STEA 1D5ZC 1JQYD 3BVGA 1I4PA 5D3IB 2XN9C 5I4DA 1BCPF 3BVMA 1PRTF 1SE3A 1V1PB 2QEJC 2WV6D 3MFGA 1M4VA 2AQ1B 2CHBD 1SE4A 2NTTA 1EEFD 2RDGA 1HTLD 5FKAC 3O13A 1UUPA 1PRTB 4RH6A 5ELBA 1LTRD 4DXFA 1LTAD 1D5XC 1LT6D 1L0XB 1I4XA 1JWMD 1V1OA 4UDUC 4K6LA 3BVZA 1L0YB 3URYA 1TS5A 3BYYB 3V05A 3R2TA 4TSSA 1JWUD 1AW7A 1LTGD 1BXTA 1JCKB 1SEBD 3OWEB 1PTOB 1BCPC 1PRTC 4BWGB 1SXTA 4L6TB 1SJED 1UNSA 1CT1D 1D6EC 1XTCD 2ICIA 4O1NA 3SEBA 1ESFA 1ET6A 1LTID 1AN8A 1CHQD 4RGMA 1EWCA 1HQRD 5FK9C 4Z9CB 1DYQA 3BZDB 1QILA 2J4XA 4ZYSA 2IJ0A 4C56C 1LTTD 2AQ3B 1ET9A 1PTOF 1KTKA 1B1ZA 1LTSD 4RGTA
chains in the Genus database with same CATH superfamily
3CQZH 1RCVD 1E1TA 4KY5A 1XNRQ 2QILA 1RTNA 1FNUA 2NVTB 1PFMA 1TWCH 4POGA 1SBBB 1EOVA 3I3CA 2NBFA 1WD1A 4DXGA 3H15A 4DR3L 1XMQL 2A19A 2Z6BA 1IZ6A 3VA7A 1S5FD 2JA5H 1O7ZA 2SNSA 3QR8A 4A3MG 1B53A 1CKNA 2WACA 3NUCA 3S15B 1KNAA 4DGZA 3K5MA 2ZJRA 1K8MA 4JBMA 4HR7B 1C4QA 4FYDA 1KQSA 3CCVA 1A2UA 4OELB 2EYMA 4XQQA 3S2DB 4A93B 5JJKA 4YCUA 4LF4Q 5H1SE 1H9MA 1VQLA 2A6EC 3FDTA 2F0WA 3CD6A 3CHBD 2BH2A 3NTHA 3QOLA 2Z8LA 1B8AA 4HJAA 2K5WA 3T1YQ 1VQGA 3F1ZA 1VMCA 2K03A 3F8TA 2LKVA 5C3WA 3H3VC 4DR4Q 1K28A 2Y0SG 1GO3E 3H09A 2J0TD 1IKMA 1M4VA 2MFIA 1QZGA 5EBCA 2JA5G 3W3AA 2PZUA 4XYOA 1G291 3M7GA 3W5OA 1RJTA 1RL2A 2OTLA 2J7ZA 3ND8A 2QW7A 5M5XB 1I4XA 4HCEA 1IBLL 1C7YA 1ILQA 1PV4A 5LL6S 3EROA 3V05A 5C3EH 1F2MA 5M5YH 3A8IE 4PMWA 4BWGB 5IGGA 5GAEC 4LF7Q 3PGZA 3D31A 4HEDA 1EWHA 4F87A 1E22A 3CC4A 1QNUA 4DAVA 1X54A 2CWPA 3GTMB 2E2HH 3NWTA 1HQRD 2CVRA 2KUMA 2LFNA 2BDOA 3KLWA 4F7XA 1LTTD 2E2JB 1KTKA 1EFWA 3I70A 3PUWA 1PZJD 3K5OA 1D1IA 1SMYD 4MTNA 2B2VA 2ZJQA 2F0EA 1MJCA 3M4YA 5IOCA 3T16A 2L4NA 4X62Q 4UY8C 1Y1WH 3RLOA 4IUTA 1QOHA 3JAMc 3J81c 1O7IA 3CAMA 5D3DA 2EIFA 4JOIA 4G57A 5C3EG 3CCMA 1VQNA 4DV7L 2AKWB 1Z9FA 1J5EQ 4RWSC 3M4PA 1EQRA 3SK6A 1AZQA 1I4RA 2K05A 5G3LD 2ALYB 3GTKB 3GTGB 3L2PA 1HXYD 5GADC 2NZ1D 1L1OA 3C3LA 1DOKA 1CA6A 2EE1A 3SK4A 4LF5Q 3R2IA 4G7OC 1T5EA 1T9HA 1U5KA 1V1PA 4K0KQ 2LS01 1BO0A 2KENA 3MXPA 4DR7Q 1GXDC 3HKZG 3TP6A 1VQIA 4X65L 1AFPA 1PA6A 2R7ZB 1VQFA 3BDOA 2RDFA 1D5ZC 3GQBA 1KC8C 2XTIA 4HJ7A 1KXLA 4OONA 3GD7A 4BY7H 2PMZB 4EQOA 3BU2A 1CKOA 1BQQT 2CHBD 4GOPC 3KUPA 1H9RA 3S24A 3QJYA 2HDMA 4HIMA 1D5XC 1U4LA 4ME3A 3GTJB 4UDUC 3GTOB 1N9WA 2RQXA 5M3FH 4DR2L 1TS5A 1ONLA 1LTGD 3OWEB 2QA4A 1TQOA 3NXWA 3VYUA 1NBWA 4NKLA 1KABA 1B4OA 1O80A 2WAQG 1QNKA 1M1KC 1TWFH 4ZRZA 2K33A 3P20A 5KEEA 4BY7G 2MNAA 1GVPA 4GNXC 3NE5B 3U4VA 4R4OA 1WTOA 1OTCA 4K8JA 4JV5Q 3PIP3 1FVIA 2HCIA 2XSCA 2KCNA 2WKCA 3L3OC 3MXNA 1YHBA 4OHJA 4A75A 5CV9A 3FP9A 2BE5C 5M3FG 4DAPA 3HOZG 4L5QA 2DY8A 2Z6KC 1XJVA 1S5ED 3RZOH 4R8NA 2AQ2B 2EYOA 5EPLA 3TBIB 1O7YA 4DV5L 1IBMQ 3DWQA 3ULPA 4M8AA 1PTOC 4LF8L 3FHWA 3CRLC 4GZYC 3NPPA 3M3YB 3IFTA 3MXUA 2EPBA 1E7ZA 1B9NA 3KDFB 1H9SB 1L2FA 3R8BA 4X3UA 2WFWA 4DR6Q 2KJXA 3TN2A 1TS4A 1C0AA 2R92G 3S2HH 2K28A 2UXCL 4ZCKA 1KLGD 1A15A 1X6OA 4UAIA 4ZQ3A 1MJEA 1RKNA 1STEA 3V96A 1VQ5A 1QUQB 5NUCA 3H91A 3TS2A 1NUCA 1YNJD 2IL8A 1SNPA 2JJQA 4P74A 2RSOA 2A68D 4ME5A 4F8MA 1DXMA 2RDGA 2ZT9C 2OF1A 3NHHA 1LTRD 2A6HC 1W6JA 5IY0A 3MXGA 3ITPA 5IP9H 3OPOA 4PV1C 4BXXH 2Z4HA 1JWMD 2F1MA 3J80L 4RAUC 3BVZA 2F0FA 4FNFA 2D2CC 1GUNA 2UU9L 1XMQQ 4TSSA 2WP8J 1SEBD 1X65A 4A3DB 2EVBA 1Y8OB 1UNSA 1STBA 3H94A 5JJLA 2X69A 1ET6A 2AUKA 4LF9Q 4RGMA 5FJ8H 3UDXA 1BVSA 5DM73 1X3GA 1IYVA 2K04A 4ZYSA 1E2VA 2SNMA 2PZWA 4ALPA 1Q7YC 2K50A 2JA6B 1LTLA 3EA6A 5AFWA 1KRTA 1FNWA 1HZAA 1KL9A 4N8FA 5IP9G 4BXXG 1CK1A 1C48A 4YY3Q 1FJGQ 3KLSA 4DV2L 1TWHB 2UXDQ 3CC2A 1PMRA 5JEAH 2RSNA 4RMFA 2DUDA 5JPNC 1HR0L 1B2TA 5KYIA 5C0XJ 1MSGA 3Q6SA 5K5PA 4NXMQ 2KQ3A 1IBLQ 1XX8A 3P75A 2NZOA 4DV6L 5FLXL 2ZM6Q 1Q82C 4NB3A 5C4XH 3Q24A 3RUZA 4MNOA 2R93H 3VYTA 4XDXA 1IL8A 1RDPD 2V1CC 2VY3A 2KA7A 4RGOS 4DV3Q 2R61A 2XWJB 1I3QH 1ICFB 3KFUA 2C35B 2N88A 1XPUA 1JC7A 5JVG3 3ONAB 3CQZB 4DAMA 1Y69U 4MN3A 1EWIA 1WTVA 5G3LF 3Q23A 2OWOA 1EY8A 5CV7A 2N49A 4WJ3M 5LMUL 4CDDC 2Q2HA 5T1IA 3NQTA 3E0EA 1Z7TA 4DV1L 1K0RA 3U9OA 4DXFA 4JYAL 4DPGA 5EKIA 3WDNA 4OEMB 3WOEA 1ICWA 2Y0SB 1WYDA 3WOFA 3DMUA 5C4XG 2JA5B 2R93G 4DV7Q 4ODGA 1I6HH 1YHQA 1L0YB 2EY2A 1JORA 5IE8A 4YHHL 3G4SA 2F0GA 3NK9A 4EGVA 4C3IH 4R4IA 3KBXA 1LYLA 5J39A 1HCZA 3K57A 3FVQA 3CMAA 1TVXA 5GQOA 2ICIA 1CSPA 1ESFA 4GKKL 4WORA 1XNQQ 4BBSG 1WFQA 2BDNA 4OIJA 4A3KH 1ZKOA 3K8AA 3NTKA 4H02A 2NN6I 2XWBB 2PZTA 1NY4A 4IPHA 2B2TA 5C5LA 3GP7A 2F0QA 2BA0A 3TP8A 1R9TB 1WCMG 4X65Q 4HJ8A 2YU9H 3FKIB 3FMCA 2CKZB 5ELDA 4QF4A 1LLRD 1NE3A 1WTHA 2L15A 5FLXE 3I56A 3CCEA 4K14A 1AP0A 4ULLA 4AYBE 2F0HA 4IZ8A 5KRUA 1PYWD 4C3IG 3CCQA 1I94L 3EFXD 4KHPL 1ZYRC 1HUNA 3PUZA 2A69C 4DUZQ 3QB3A 2EY5A 4KJNA 1PXUA 3MZ5A 4FXDA 4X66L 2HQEA 1CHPD 1VQDA 5M5YB 3GTLH 4JI5L 1YJ9A 2IPKD 4KD3A 3SVMA 1SYBA 1EFID 2B2VC 3DEPA 2O4XA 3KLSX 3CCJA 1LTBD 2E2HB 4JC0A 1YNNC 4IO9A 2QDLA 3DHQA 2IX1A 2O5JC 3S16H 1JE5A 4JG2A 4NMZA 4DK6C 3D0FA 1NR4A 2F52A 2VS1A 4JOIC 2VQEQ 1NR2A 3TREA 1BBXC 4KKUA 4GOPB 1N33Q 1STYA 3J80c 2E2DC 1JQYD 1I50H 3MAQA 1VQ7A 4XIGS 4C2MH 5KGUA 3AQQA 2WB1G 1Y1WB 5IWAQ 3KF6B 2P5ZX 4JPBW 1EUJA 3SHLA 1WTRA 1UWVA 5ELBA 4DV0Q 1Z47A 4A3CH 1LTAD 4J8QA 1BF4A 4JI0Q 5CYUA 2F0OA 1G6ZA 3G48A 5E7NA 1PYSB 4BBRH 4CJ1B 3UE1A 2HHHQ 4JBWA 2PQAB 1AW7A 4BS9A 4GNXB 4L6TB 2ICEC 4X6AH 4UP7A 1R4PB 1CT1D 3STBD 1ENCA 2B8FA 2R6GA 3QOJA 3HOUH 4C3JH 2HQLA 4A3JB 3DXJC 5FK9C 4FF2A 1QILA 3OYYA 3HGBA 2UXCQ 1HA5A 2L12A 1VQBA 1WD0A 4ILWA 1JB7A 2K5QA 1KNEA 1EOTA 4A3CG 2G5DA 1MKHA 4BY7B 3PUVA 4C1NI 4A3FH 1D2BA 1NSNS 2PO4A 5COYA 4BBRG 1CM9A 5FLXc 3MEHA 1EIHA 3OWFA 3TP7A 4K6DA 2GA4B 2IX0A 3DM1A 2IHFA 1S3OA 2PNHA 4LFCL 1XXGA 2EJFC 4JI6Q 4O2DA 2F0PA 1A3VA 1AE2A 1PH5A 5M3FB 3HOUG 1PZKD 4C3JG 4XYQA 3A5UA 3FPPA 5HGTA 2F0MA 5F2DA 2UU9Q 1F2ZA 1IHZA 1KAAA 4X3TA 5I2YA 3S17H 2N3SA 2SOBA 1TWFB 4J15A 2CCZA 1H9JA 3MHBA 5CORA 2F0LA 4OL7A 3SXHA 4CKCA 5I6YA 3Q22A 4A3FG 3D4DA 4B3SQ 1N36Q 1O78A 2EXZA 4N8X1 2L0CA 1A0IA 4LUZA 2AWOA 5JJIA 3TQYA 2D0PA 5FO7B 4A3GH 1HPCA 3K80C 2NZHA 1OXUA 2QCPX 1CFMA 3A7LA 3GTPB 4A3EB 2Y0SE 4DV2Q 1AH9A 1JJGA 4GS3A 3GDEA 3K7UC 4GLVB 4B9WA 1EY9A 1HFGA 3IL8A 5IYDG 1VQAA 4DF7A 3OTOL 4G7ZC 3J7AV 3PIO3 2B2WA 4DN4M 4DNIA 1A63A 1F2YA 2K01A 4RG1A 2B2UA 3A0JA 2MUYA 1BBWA 4A3BB 4GN5A 2I5HA 4B3TL 4LFAQ 3NSWA 2CH4A 4DV6Q 2VUMB 3J7YW 1CHQD 3AFPA 1TWAH 4WJWA 3RZDB 1DYQA 3HOVB 3P1HA 4CBVA 1SNQA 3K5LA 5J3BA 4BY1B 1VQJA 4A3GG 1MSHA 3I73A 3I2ZA 1K83H 2JEBI 4I7ZC 5DNFA 3I4NH 4B3RQ 4CDCC 4JI2Q 3VR6A 3C2PA 4GN4B 2FXQA 1F77A 4OWTB 1I4GA 1OXVA 2I46A 5CR3A 1JE4A 3MA2B 1E0BA 2EZVA 3I91A 5LMUQ 2MJ8A 3DWPA 1A3UA 4RKLA 1Y8NB 4APVA 3J81j 3CW2C 1ML0D 4RKBA 1VQKA 4DV1Q 1MHWC 4JYAQ 1SFOH 4RHSA 2Q8TA 1TY2A 4JI7L 1HNXL 4LF6L 2K4KA 3GV3A 1BCPD 1ENFA 3PO3G 1UE7A 2CW0D 4P72A 3CF5A 2NVXH 1DM0B 4HJ9A 4OWWB 1S5CD 2RDHA 1ASZA 2YV5A 1LT3D 4JI4Q 4IFDJ 4KV6A 3BYTB 3I4NG 2E8GA 1CKNB 1CI3M 4AH6A 2MPMA 3HOXG 4QJFA 2NN6H 2E5LL 4IPDA 3HRZC 4GKKQ 1XPOA 1K8AC 4F88A 1VQMA 4C3HH 1PYBA 2ZJPA 1JJ2A 4LFBQ 2Q2UA 1F9QA 1V1QA 3GO5A 4U68A 4X64L 3K0YA 3S1QH 3HZXA 5IT9L 2UXBL 1R4QB 2LXJA 3NP8A 4FVMA 2F0IA 4KLKA 5GROA 4HJ5A 4OO1I 1D8LA 2NVQB 5EQ0A 1NTGA 1Q3LA 3Q8DA 4LWCA 1DZ1A 3J7ZC 1VQCA 1I94Q 4KHPQ 4IOCA 1YHAA 2HIXA 4PZ7A 4CDFC 4JBJA 5C6AA 4NXNL 1PH4A 1K8OA 2NN6G 3T1HL 1BBUA 2R7DA 5C4XB 2MO1A 4FXGC 4PNYA 5I6WA 2R93B 2K7VA 4LUVA 5IYBH 4O1NA 1SLJA 4C3HG 4GKJL 3OW2A 1LTID 1CA5A 3ZYYX 3M4OH 2ZTCA 5KIXA 4FP5D 4FO2A 4DNTB 2R7FA 4X3KA 1UE6A 4IUUA 1I3QB 2AUJD 4DU9A 3PUXA 1SYDA 1K9MC 2IJ0A 1HNZQ 5EKLA 2CQOA 2DNEA 1VQPA 3N6RA 4AQYL 5FKAC 1B1ZA 1HQMC 3DUZA 3UI2A 1JOQA 1HNWL 5IGFA 1KRSA 2JA7H 3K5NA 3HOZH 3IRBA 1PTOH 4H13C 1GUSA 3E9IA 2IWHA 1QCBD 4IPCA 3H0GG 3F2CA 3S1NB 2NYZD 1NCVA 3OW7A 4LW1A 1K73C 4DAYA 1HJPA 1EYDA 4QCLA 1NMFA 3SE0A 1Y1VB 2RCNA 2F3WA 5C3XA 1G8ZD 4UP9A 3TRZA 3L0OA 3KF8B 1VQOA 2F0SA 5IYBG 5IGEA 2SEBD 4QIWB 4RHRA 1B44D 2FJ2A 1CUKA 2UUCL 2R92H 1Q86C 5GAGC 1Q46A 2EY6A 2NTSA 1PRTD 2NVTH 4CDEC 1TS3A 1S5DD 1PLFA 4B3MQ 4J6HA 3C46A 1FGBD 1UE1A 2JA7G 1U4RA 4P2CB 5IT9E 1HR0W 1A62A 3UDFA 2EQSA 4AYBB 4A3KB 2QGQA 3OIQA 2K75A 1PTOD 1LM0A 2BH8A 3AYHB 4DR5Q 2XNAC 2YYZA 3HOWH 1EIFA 1L1OB 5C44G 3G6JB 3CPFA 5C0XI 3HFZB 4K5VA 2YU9B 3JC66 1M8AA 1SRUA 4R1JA 3M85A 1X9NA 4JI3Q 3T56B 4YCVA 1V1PB 3JAMi 1X3FA 2D62A 3J81i 2VQFL 1EYCA 2B63B 3S2DH 4A93H 5DAUA 1HTLD 1UUPA 1N34Q 2PNRC 4RA8A 1N8RC 4DFAA 3B6YA 2B2YC 3M7NA 2N55A 5JPMC 3T4AC 1PH8A 1N32L 5K36H 2PI2A 4JI1L 3HEJA 4QGUA 1BXTA 3A5ZB 4CKBA 3QO2A 1PH2A 2KEEA 3CU7A 1D6EC 3HOWG 3PO2H 5BN3A 2EYLA 1JT8A 4MTKA 4OGQC 1AN8A 3RN2A 1EWCA 3K0XA 4K5WA 3AU7A 4JVZA 3S16B 3E3XA 1STAA 4OWXB 5EAYA 2J4XA 4R9WA 4A93G 3QIAA 1GKHA 1I4HA 4XXEA 1I50B 4DR3Q 2WINB 1YNJC 2EYFA 3CCSA 4ZAIA 2A68C 1A2TA 5AJ3L 3GTMH 2OT2A 5K36G 3H3VI 2BOSA 2PW5A 2PW7A 1TY0A 5CV6A 3W1GA 1IBKL 2GN5A 1QWYA 1XNRL 2MQHA 4BBRB 4DR1L 2E2JH 3PO2G 2HT1A 1DJRD 2F0DA 1KHIA 4FF1A 3LGJA 3MWYW 2NUCA 3NBHA 1JICA 2LMCB 3OTOQ 5BR8L 1Q12A 4IPGA 3HOUB 4Q0FA 1YZ6A 2F0TA 5IT9c 4LJZC 5ISRA 2UUBL 4KY7A 2DJFC 1FNVA 4I7AA 4B3TQ 1EZ6A 3G71A 5ELFA 4CGYB 4UP8A 4DKAC 1JR0D 2UUAL 1X55A 1VCIA 2XVSA 5EGTA 5D3IB 4TQUS 4LF4L 2JK8A 1BCPF 1CSQA 3SK5A 3IKJA 1JOOA 3J7AF 3I55A 4NW2A 1X3PA 1P8LA 4EVOA 1FL0A 4A3MB 3T1YL 4PZ6A 4P73A 5BN5A 1O7LA 1UE5A 2CFMA 2MP1A 1CKMA 2E76C 1LUZA 3OHXC 4YIJA 2B8GA 4DR4L 2D5DA 5JVH3 2KOLA 3URYA 1A3TA 3E5SA 2VL6A 3R2TA 4K2KA 4FXKC 3PF4A 3C1FA 4BBSH 3HOYH 1WTXA 2XIWA 1E2ZA 3MEFA 1LACA 4X3SA 2HCCA 4JI7Q 5LL6X 3GV6A 3I72A 4KN4C 1TWCB 3N52A 2VB2X 1B3AA 1OXTA 1WCMH 4HCSA 4ZUJA 1OO9B 3AFQA 4QMGA 2DJGC 4JI8L 3GTJH 2PCFB 3GTOH 3KK7A 1I5FA 4LF7L 2RVLA 3R93A 1IXRA 4B9XA 1TKWB 3UDIA 2R7ZG 2AWNA 3QG1A 3E9HA 3K7AH 5E4XA 4C1NK 1SDFA 5EPJA 3ULJA 4YCWA 4X64Q 4N9PA 4HSVA 5FLMH 3HOYG 2F3IA 5DM63 2EOTA 4OO1H 2UXBQ 4EQ5A 1KLUD 5J1ZA 4L5RC 1IW7C 4QIWE 4K5XA 1VF5C 4CHTB 1JJCB 2JSOA 4A4IA 2F03A 2RHSB 3NENA 1GD7A 1VQ6A 4ZLTF 1J5EL 2FFKB 3S14H 3S9WA 1WOCA 1BCPB 2OTJA 4NXNQ 5IYCH 1D7QA 1HRJA 3T1HQ 2H5XA 5IP7H 1E3PA 1SROA 3IAYA 4KHVA 3S1MH 3G7LA 1F9RA 4J1MA 2K32A 4EQPA 4ABNA 4P71A 4Y7NH 1TXYA 4XT3B 1V8QA 1EYAA 4DK3C 5C3EB 3BZCA 4LF5L 5FLMG 2D9UA 3M9BA 3GTQH 1HH2P 4OO1G 2Z6KA 1PRTF 2B29A 4LNQA 4DR2Q 5GAHC 4DR7L 4TRDA 1SE4A 2NTTA 4JCVE 3CMEA 3RMHA 1EEFD 2DNCA 1SYGA 1KDAA 4ZKBB 3DEOA 4A3IH 3PCOB 2WB1E 1XYIA 2DY7A 1A6XA 2KVMA 3ZJYC 1SFOB 5IYCG 5EPKA 2YTXA 1JWUD 5IP7G 1NNXA 2FMCA 2YTVA 1GHKA 3HS0C 3HKZB 3R3OA 3VR3A 4IN3A 3V2TA 5L37A 1TIID 2E74C 1M90C 1VQHA 4A76A 4HIKA 1L1OC 2IY5B 4RCNA 2G9DA 1PH6A 1ILPA 2JP1A 4WJ4A 1GHJA 2ZTEA 3RR5A 3TMEA 4C3HB 5C0XH 5BN4A 4A3DH 4DV5Q 5LMNW 2QEXA 4A3IG 1MIUA 3ER0A 5ELOA 5M3MH 4LF8Q 3S1QB 5C4HA 4JBKA 4OIKA 2ASBA 2BA1A 2OQKA 4PMCA 3PF5A 1Q8KA 3T51B 2VQFQ 3PQIA 2RKSA 1GUGA 5A35A 1J9OA 1EU4A 4OX9L 1EQVA 1WJJA 2JA6H 1HA6A 1SYCA 1SSOA 4KKTA 1CQVA 2WAQB 4MHEA 3W1BA 3A55A 3S1RH 5C4JH 5M9OA 4PQXA 3STBC 4ZUIA 1VQ9A 1DCZA 3DWAA 4Y52H 1KAWA 1YI2A 1TWHH 3WWVA 2Z1CA 4WFN3 5C0XG 2E2IH 2QDBA 1YITA 2JA8H 1HZBA 2F4IA 4A3DG 2Q2TA 5CBEE 1JWSD 1X3QA 5T1GA 1PFNA 4N9TA 5M3MG 4POFA 4S3SA 1PZID 4L63B 3DLLA 4MIUA 3A56A 2HDLA 1EU3A 2I5MX 4R4TA 1U9RA 1K3BC 2M00A 3HOZB 3LWEA 4NPSA 2V4DA 1S40A 4H7BA 1SAPA 2F4VL 1I6VC 4HN7A 2ID0A 1LV9A 3UE0A 2JA6G 2NB0A 2K5DA 3H3VH 4L5SA 1ZXTA 4IUQA 3TS0A 3K6OA 3PIPA 4RH6A 5IYDH 1EY0A 5D14A 5C5MA 5JOBA 4IFDI 1D1KA 5AJ3Q 2K6AA 1GJXA 2C5CA 2LXKA 5CBAE 2JA8G 2VXWA 3BYYB 1IBKQ 3X3MA 1XMOL 3OOCA 2R92B 1JCKB 5E4WC 4DR1Q 1YNXA 3DM3A 4CJ0B 3G6EA 3JAME 3J81E 3CXCA 2IT1A 3NTIA 2VW9A 1EIYB 4O42A 1QJOA 5BR8Q 1GUOA 2A6ED 3RZOB 2MGSA 3HP3A 5HY6A 2C9OA 3NBIA 4BA1I 2UUBQ 3HOWB 2SDFA 1LTSD 2ATWA 3J80i 1HR0Q 3MFYA 5IGCA 1B50A 4V0BA 2UUAQ 4UPAA 4LF9L 5LMNL 1EYGA 1SYEA 1SJHD 1WI5A 5JAVA 2JE6I 2EY1A 3NEMA 4H0LC 3AMUA 1S5BD 4K8IA 1MBYA 1RD9D 1S72A 3S2HB 1IYUA 3PO3H 2VZAA 5ELEA 3U4ZA 3F2BA 4GLAC 3EJIA 4YY3L 3NELA 1R9TH 1OXXK 3CCUA 1FJGL 3FKIH 2UXDL 1HTPA 1U0LA 1NJIC 1EY7A 3T13A 3HOXH 4XQJA 1V43A 3PO2B 4QQBX 1LT4D 1RF2D 1MD2D 1H9KA 1YBYA 2F3VA 4NXML 1RHPA 1AZPA 2PQEA 1CQFA 5HURA 5LHY1 2GVBA 3ERQA 2ZM6L 3RLNA 4JI8Q 2KHSA 2Q8RE 3SR1A 1MGSA 2F0JA 2WIIB 3EN2A 4DV3L 1EY4A 2WV6D 2LY7A 3C1EA 2OEOA 5EKKA 1FGUA 4U673 4YHHQ 4GLXA 3VYRA 1Q1BA 4ZK9B 1Q1EA 3PUYA 3U50C 3FKIG 5CV8A 1JOKA 2RBMA 3A8KE 4IUPA 1LT6D 3OIPA 1Z6HA 1TWGH 2F0VA 3VA5A 4K6LA 2Q8IB 3EIVA 2IW3A 3LWUA 3EQLC 3KBGA 1SMYC 3KF8A 1BCPC 1RTOA 2CW0C 3HKZE 4IALA 1DONA 2JXMB 4UHVA 3AEVA 4QL5A 3U58A 5HGQA 2A73B 5C4ZA 3BZKA 4V190 3EBEA 3MTSA 1VS0A 4LMQD 1CZWA 4KJOA 2EJMA 3H0GH 3T53B 2ZXRA 4IQZA 3VR4A 3LX0A 5I2XA 4RGTA 1KIXA 4QY7A 3I8ZA 3OMGA 1XNQL 3W2DA 4X66Q 5KYLA 3Q0AA 2K14A 2IHEA 4JI5Q 4ZKCB 4A3JH 1E2WA 3E0JA 4ID6A 1AE3A 3VDYA 1BR9A 3KDFA 2N8NA 1K0SA 1H9SA 1PHJA 3CCRA 1Y1WG 2CH4W 1II3A 3LNNA 1EEID 4XTCS 1EY5A 1AEXA 4GN3B 2WAQE 1W6KA 1MI2A 1F9SA 2QKIC 2O5IC 3HOYB 4BBSB 1PH7A 2K5VA 1VQEA 5CV4A 5IIFA 2Z4IA 1U4PA 1QUQA 1PH3A 4DUZL 3I4MH 5JEAJ 3A74A 1B9MA 1G51A 5C44H 4KHZA 3F2DA 2OCEA 1WCMB 2L55A 3HKSA 3ULLA 1JB3A 5I9OA 1HUMA 3TP5A 2NVYH 1H95A 2RCFA 1EIGA 2I5LX 1FR3A 2F0KA 2K5NA 5M5WH 1G2TA 1ZEQX 1SE8A 1I6HB 1QVGA 4A3JG 3D4WA 1I4PA 2MO0A 1YVCA 4C3IB 2XN9C 2B2TC 3K7AB 2AQ1B 2BE5D 3RNUA 4E6IA 2VQEL 1SNDA 1N33L 4L5TA 2Q2IA 1JMCA 5E3FA 4YWMA 2JN4A 1K8GA 2A1AA 1U4MA 5KNDA 2RA4A 3FRPB 3I4MG 1XTDA 4LAAA 4QB4A 5IWAL 4KN7C 2VNUD 4DUYL 3S15H 4OX9Q 5D65A 1PRTC 3I90A 1SJED 2I0QA 4IOAA 4DV0L 1XTCD 3E6ZX 4JI0L 3S14B 1EQQA 1F9PA 3SEBA 1Q90A 4KD4A 5E1FA 2A8VA 1STGA 2HHHL 2M2LA 3GTPH 4A3EH 3S1MB 3IFDA 1VMPA 1K3RA 5CGKA 5ELNA 2OQ0A 2WB1B 1UEAB 3D3RA 4PMBA 1RIPA 4Y7NB 1SN8A 4I65A 4LFCQ 4NDXA 3GTQB 4DK0A 3GTLB 3A8JE 1TS2A 3RD4A 3PMFA 1NMGA 4A3BH 1ENAA 3CRKC 2VUMH 4YWLA 4FF4A 2HUGA 4A3IB 5KNCA 2F4VQ 4IFDH 2I07B 3RZDH 4RGNA 3HOVH 2A6HD 3QWNA 2K1BA 4BY1H 1XPRA 1LABA 4DV4L 5M5XH 3VR2A 2RHQB 4DNRB 2GVAA 2DN8A 4DAYB 4HMIA 1E1OA 4A3EG 2QF7A 4K2LA 4LUOA 3TSSA 4C2MB 1YIJA 1GOZA 3BDCA 2EDGA 4LK1C 1XMOQ 3PSIA 1G91A 1Q8IA 4JI6L 2AHOB 4HAEA 2K5HA 1I4QA 1FD7D 1BNZA 1QG7A 2OXPA 4A3BG 5IGDA 5FO9B 1SMXA 1T5XD 3MXNB 4RFBA 1ASYA 2VUMG 3X3NA 3BS1A 3BVGA 4IFDG 1VDZA 3HOVG 4HSPA 5M3MB 1QZHA 4QUFA 2KCTA 4BY1G 1IKLA 4B08A 2L11A 4B3SL 2DGYA 2JYOA 1EY6A 2CWAA 1XWEA 5KNBA 4KY6A 1X3EA 1QE6A 5LMNQ 1N36L 3P7JA 2EYPA 4C3JB 3CCLA 3ERSX 3I4OA 1A8VA 1BUVT 1P16A 2N78A 1V1OA 1HZ9A 1BOSA 4AIMA 4L8JA 1YJWA 1F2LA 3S1RB 3GTKH 5C4JB 3GTGH 1SXTA 1S4ZA 2B3GA 2K52A 2ZTDA 3UDGA 2H4OA 3CPWA 1X32A 4A3FB 1QB5D 2BCOA 3SDZA 2E2IB 2JA8B 3PV0A 1DOLA 3D6CA 4DK1A 4JW0A 3OSOA 3ND9A 3TEHB 2NVQH 5FO8B 1PVOA 2R7ZH 2AQ3B 1ET9A 5JJZA 3D6WA 4H44C 4KK7A 3H6MA 2KECA 1VF7A 1SE2A 5FJ8G 3RN5A 4TKOB 4LFAL 1RODA 2Z9HA 1L0WA 1J6QA 1B7YB 2XRQD 3KOJA 1TU2B 2ENBA 4XT1B 1B3QA 4PZ8A 1LT5D 1HNXQ 4LF6Q 3S17B 1LO5D 2JA9A 2HIVA 3KLRA 2KHJA 3VR5A 4R4QA 1HFNA 3HG9A 1NAPA 4B3RL 4JI2L 2XRSD 2AMCB 4A3LH 3J80E 5JEAG 1STHA 4CKEA 2E5LQ 4M1UB 2PMZE 2G9HD 2Z0SA 1UAPA 3S1NH 1HZCA 4GOPA 4EX5A 2JEAI 3U9SA 2HD3A 3M4QA 1FYCA 2CQAA 1E24A 1WTPA 4A3GB 2TMPA 2B2WC 1X56A 1Y1VH 2B2UC 2O2LD 1PH9A 1EZ8A 1SNOA 3PIOA 3KF6A 3NBHB 5TSSA 1IW7D 5ELCA 1SR3A 1VQ4A 3KJPA 4X62L 2X6GA 3A54A 4TVAB 4R8IA 4HIDA 2E75C 4JI4L 5I4DA 1BKBA 2QEJC 1TT2A 2L5TA 1IYJB 5CC4A 1BDOA 2PQAA 2L1BA 2F0NA 4XQNA 3K58A 4A3LG 1HHVA 3KJOA 4GNXA 3RLFA 1TWAB 3NQIA 3F2UA 4LFBL 1ZYRD 3PO3B 2A69D 4EQNA 4GKJQ 3ICEA 1YEZA 2FMMA 4IJHA 1W2BA 4KMUC 1K83B 1OXSC 3FPUB 1Y1VG 5CMDA 3M3YH 1WTQA 1PFSA 5IODA 2EXDA 3I4NB 1STNA 3HOXB 4AQYQ 1EL0A 1SNCA 3BG3A 1HNWQ 2B63H 2XGTA 4K0KL 2A74C 2EJGC 1G6PA 4KTAA 1PH1A 1YJNA 1YNND 5EBDA 3A7AB 4O0AA 2WKDA 1W3SA 2NWGA 2IX3A 1PTOF 5FOBB 3K81C 3BDLA 1Q81C 4FF3A 5A2QL 3MC0B 2F0UA 4AYBG 4A3KG 3I7FA 4IURA 1ESRA 3AB9A 1VQ8A 2NVXB 2A5HA 3EVQA 2UUCQ 3SK8A 2B2YA 5J22A 2RF4A 4HIOA 1GUTA 3CP0A 3I4LA 1HNZL 4QUCA 2KEDA 2ZXPA 2ZXOA 4NP5A 4P75A 1TWGB 2R3ZA 2B63G 2YTYA 3TZDA 1Y14B 1IL2A 1GUWA 1DGSA 1KDCA 2KCCA 4MZ9A 1CZGA 2KCMA 4WRDA 4G7HC 1J8IA 3JAML 3J81L 3L9AX 2L9HA 2EYHA 2H1EA 1KD1C 4CJ2C 4RCOA 3SGIA 1C8CA 4DUYQ 2TSSA 3MVVA 3TDQA 2VB3X 1SNMA 1V9PA 2ES2A 1QVCA 5DLQE 1D5MC 2PPBC 2PYKA 3K59A 4JV5L 5DEHA 3H0GB 2B39A 4KKSA 3CKIB 3D4RA 4HTHA 1DOMA 4FDBA 3BJUA 2JQOA 4B3ML 4OXPA 2KHIA 1GM5A 4R4CA 3J7A5 1WTWA 1KDBA 1TR5A 1QVFA 3BVMA 1SE3A 3MFGA 1PDQA 1C9OA 1N32Q 5CV5A 2LSSA 4IUNA 4JI1Q 1WVLA 1CTMA 1IBML 4DR5L 3O13A 3CC7A 1PRTB 3TZUA 2EYJA 3M4OB 1DD2A 1B70B 1L0XB 4HMJA 4JI3L 3D8GA 2MHVA 3FEWX 1SYFA 2JA7B 4JK1C 4DR6L 3VYSA 4DV4Q 1PTOB 5I9PA 4DA2A 2M9VA 2FHTA 5A2QE 1N34L 4KI0A 1G2SA 4YWKA 3OMCA 4IJLA 4Q5VA 1Y8PB 3I4MB 4A3MH 1EQTA 4IUVA 5EJWA 5C44B 2D0OA 2PI2E 2KBNA 3NWSA 4G4KA 1PFBA 4Z9CB 1UEBA 3BZDB 4PG3A 3KYHC 2FINB 2NVYB 3L7ZC 4C56C 5M5WB 5IGBA 2X6LA 4BA2I
chains in the Genus database with same CATH topology
1RCVD 4KY5A 2QILA 1RTNA 1FNUA 2NVTB 1PFMA 1SBBB 3I3CA 2NBFA 1WD1A 4DXGA 3VA7A 1S5FD 1O7ZA 2SNSA 1B53A 2WACA 3NUCA 3S15B 1KNAA 4DGZA 3K5MA 1K8MA 4HR7B 1C4QA 4FYDA 1A2UA 2EYMA 4XQQA 3S2DB 4A93B 1H9MA 2A6EC 3FDTA 2F0WA 3CHBD 3NTHA 3QOLA 2Z8LA 2K5WA 1VMCA 2K03A 2LKVA 5C3WA 3H3VC 1IKMA 3H09A 2J0TD 1M4VA 5EBCA 3W3AA 2PZUA 4XYOA 1G291 3M7GA 1RJTA 2J7ZA 3ND8A 5M5XB 1I4XA 4HCEA 1ILQA 5LL6S 3EROA 3V05A 1F2MA 3A8IE 4PMWA 4BWGB 5IGGA 4HEDA 3D31A 1EWHA 4F87A 1QNUA 4DAVA 3GTMB 3NWTA 1HQRD 2CVRA 2KUMA 2LFNA 2BDOA 4F7XA 1LTTD 2E2JB 1KTKA 3I70A 3PUWA 1PZJD 3K5OA 1D1IA 1SMYD 2B2VA 2F0EA 3M4YA 5IOCA 3T16A 2L4NA 4IUTA 1QOHA 5D3DA 4G57A 4RWSC 3SK6A 1AZQA 1I4RA 2K05A 5G3LD 3GTKB 3GTGB 1HXYD 2NZ1D 3C3LA 1DOKA 1CA6A 2EE1A 3SK4A 3R2IA 4G7OC 1T5EA 1V1PA 2LS01 1BO0A 3MXPA 1GXDC 3TP6A 1AFPA 2R7ZB 3BDOA 2RDFA 1D5ZC 3GQBA 3GD7A 2PMZB 4EQOA 1BQQT 2CHBD 3KUPA 1H9RA 3QJYA 2HDMA 1D5XC 1U4LA 3GTJB 4UDUC 3GTOB 2RQXA 1TS5A 1ONLA 1LTGD 3OWEB 1TQOA 3NXWA 3VYUA 4NKLA 1KABA 1B4OA 1O80A 1QNKA 4ZRZA 2K33A 3P20A 5KEEA 3NE5B 1WTOA 4K8JA 3PIP3 2HCIA 2XSCA 2KCNA 2WKCA 3L3OC 3MXNA 4OHJA 5CV9A 2BE5C 4DAPA 2DY8A 1S5ED 4R8NA 2AQ2B 2EYOA 5EPLA 3TBIB 1O7YA 3DWQA 4M8AA 1PTOC 3CRLC 4GZYC 3NPPA 3M3YB 3IFTA 3MXUA 2EPBA 1B9NA 1H9SB 3R8BA 4X3UA 2KJXA 3TN2A 1TS4A 2K28A 1KLGD 1A15A 4UAIA 4ZQ3A 1RKNA 1STEA 3V96A 5NUCA 3H91A 1NUCA 1YNJD 2IL8A 1SNPA 2RSOA 2A68D 4ME5A 4F8MA 1DXMA 2RDGA 2ZT9C 2OF1A 3NHHA 1LTRD 2A6HC 1W6JA 3MXGA 3ITPA 3OPOA 4PV1C 2Z4HA 1JWMD 2F1MA 3J80L 4RAUC 3BVZA 2F0FA 4FNFA 2D2CC 1GUNA 4TSSA 2WP8J 1SEBD 4A3DB 2EVBA 1Y8OB 1UNSA 1STBA 3H94A 2X69A 1ET6A 2AUKA 4RGMA 5DM73 1IYVA 2K04A 4ZYSA 1E2VA 2SNMA 2PZWA 2JA6B 3EA6A 5AFWA 1FNWA 1CK1A 1C48A 3KLSA 1TWHB 1PMRA 5JEAH 2RSNA 5JPNC 1B2TA 5KYIA 5C0XJ 1MSGA 3Q6SA 5K5PA 2KQ3A 1XX8A 3P75A 5FLXL 3Q24A 3RUZA 3VYTA 4XDXA 1IL8A 1RDPD 2KA7A 4RGOS 2R61A 2XWJB 2N88A 1JC7A 5JVG3 3ONAB 3CQZB 1Y69U 4MN3A 1WTVA 5G3LF 3Q23A 1EY8A 5CV7A 5T1IA 3NQTA 1Z7TA 3U9OA 4DXFA 5EKIA 3WOEA 3WDNA 1ICWA 2Y0SB 3WOFA 3DMUA 2JA5B 4ODGA 1L0YB 2EY2A 1JORA 2F0GA 3NK9A 4EGVA 3KBXA 5J39A 1HCZA 3K57A 3FVQA 1TVXA 2ICIA 1ESFA 4WORA 2BDNA 4OIJA 1ZKOA 3NTKA 2NN6I 2XWBB 2PZTA 5C5LA 2B2TA 3GP7A 2F0QA 2BA0A 3TP8A 1R9TB 3FKIB 3FMCA 5ELDA 4QF4A 1LLRD 5FLXE 4K14A 1AP0A 4ULLA 2F0HA 4IZ8A 5KRUA 1PYWD 4C3IG 3EFXD 1ZYRC 1HUNA 3PUZA 2A69C 3QB3A 2EY5A 4KJNA 1PXUA 3MZ5A 4FXDA 2HQEA 1CHPD 5M5YB 2IPKD 4KD3A 3SVMA 1SYBA 1EFID 2B2VC 3DEPA 2O4XA 3KLSX 1LTBD 2E2HB 1YNNC 3DHQA 2IX1A 2O5JC 4NMZA 1NR4A 1NR2A 1BBXC 4KKUA 1STYA 2E2DC 1JQYD 3MAQA 4XIGS 5KGUA 1Y1WB 3SHLA 1WTRA 5ELBA 1Z47A 1LTAD 4J8QA 1BF4A 5CYUA 2F0OA 1G6ZA 4CJ1B 4JBWA 1AW7A 4BS9A 4L6TB 2ICEC 1R4PB 1CT1D 1ENCA 2B8FA 2R6GA 3QOJA 4A3JB 3DXJC 5FK9C 4FF2A 1QILA 3HGBA 1HA5A 2L12A 1WD0A 4ILWA 2K5QA 1KNEA 1EOTA 4BY7B 3PUVA 4C1NI 1D2BA 1NSNS 2PO4A 5COYA 1CM9A 3MEHA 1EIHA 3OWFA 3TP7A 4K6DA 2GA4B 2IX0A 3DM1A 1XXGA 2EJFC 2F0PA 1A3VA 5M3FB 1PZKD 4C3JG 4XYQA 3FPPA 5HGTA 2F0MA 5F2DA 1F2ZA 1IHZA 1KAAA 4X3TA 5I2YA 2SOBA 1TWFB 1H9JA 3MHBA 5I6YA 2F0LA 5CORA 4CKCA 3SXHA 4OL7A 3Q22A 3D4DA 1O78A 2EXZA 2L0CA 2AWOA 5FO7B 1HPCA 1OXUA 2QCPX 1CFMA 3A7LA 3GTPB 4A3EB 4B9WA 1EY9A 1HFGA 3IL8A 4DF7A 4G7ZC 3J7AV 3PIO3 4DN4M 2B2WA 1F2YA 2K01A 2B2UA 2MUYA 4A3BB 3NSWA 2VUMB 3J7YW 1CHQD 4WJWA 3RZDB 1DYQA 3HOVB 3P1HA 4CBVA 1SNQA 3K5LA 4BY1B 1MSHA 3I73A 2JEBI 4I7ZC 5DNFA 3VR6A 3C2PA 1F77A 1I4GA 1OXVA 2I46A 5CR3A 1JE4A 3MA2B 1E0BA 2EZVA 3I91A 2MJ8A 3DWPA 1A3UA 4RKLA 1Y8NB 1ML0D 4RKBA 4RHSA 2Q8TA 1TY2A 3GV3A 1BCPD 1ENFA 2CW0D 1DM0B 1S5CD 2RDHA 1LT3D 4IFDJ 4KV6A 3BYTB 1CI3M 2MPMA 2NN6H 3HRZC 4F88A 1F9QA 3GO5A 4U68A 3K0YA 3HZXA 5IT9L 1R4QB 3NP8A 4FVMA 2F0IA 4OO1I 2NVQB 5EQ0A 1Q3LA 1DZ1A 5C6AA 1K8OA 2NN6G 5C4XB 4FXGC 4PNYA 5I6WA 2R93B 2K7VA 4O1NA 4C3HG 1LTID 1CA5A 3ZYYX 5KIXA 4FP5D 4FO2A 4DNTB 4X3KA 4IUUA 1I3QB 2AUJD 4DU9A 3PUXA 1SYDA 2IJ0A 5EKLA 2DNEA 3N6RA 1JOQA 5FKAC 1B1ZA 1HQMC 3DUZA 3UI2A 5IGFA 3K5NA 1PTOH 4H13C 1GUSA 2IWHA 1QCBD 3S1NB 2NYZD 1NCVA 3OW7A 4DAYA 1EYDA 4QCLA 3SE0A 1Y1VB 2F3WA 5C3XA 1G8ZD 2F0SA 5IGEA 2SEBD 4QIWB 4RHRA 1B44D 2FJ2A 2EY6A 2NTSA 1PRTD 1TS3A 1S5DD 1PLFA 4J6HA 3C46A 1FGBD 1U4RA 4P2CB 5IT9E 4AYBB 4A3KB 3OIQA 1PTOD 2XNAC 2YYZA 3G6JB 5C0XI 4K5VA 2YU9B 1M8AA 3M85A 3T56B 1V1PB 2D62A 1EYCA 2B63B 5DAUA 1HTLD 1UUPA 2PNRC 4RA8A 4DFAA 2B2YC 3M7NA 2N55A 5JPMC 3T4AC 5K36H 3HEJA 1BXTA 4CKBA 3QO2A 2KEEA 3CU7A 1D6EC 5BN3A 2EYLA 4OGQC 1AN8A 1EWCA 4K5WA 3AU7A 3S16B 1STAA 2J4XA 4R9WA 3QIAA 1I4HA 4XXEA 1I50B 2WINB 1YNJC 2EYFA 4ZAIA 2A68C 1A2TA 2OT2A 5K36G 2BOSA 2PW5A 2PW7A 1TY0A 5CV6A 1QWYA 4BBRB 1DJRD 2F0DA 4FF1A 3MWYW 2NUCA 3NBHA 1JICA 2LMCB 1Q12A 3HOUB 4Q0FA 2F0TA 4LJZC 5ISRA 4KY7A 1FNVA 1EZ6A 5ELFA 4CGYB 1JR0D 1VCIA 2XVSA 5EGTA 5D3IB 4TQUS 1BCPF 3SK5A 3IKJA 1JOOA 3J7AF 4NW2A 1X3PA 4EVOA 4A3MB 5BN5A 1O7LA 2MP1A 2E76C 3OHXC 4YIJA 2B8GA 2D5DA 5JVH3 2KOLA 3URYA 1A3TA 3E5SA 3R2TA 4K2KA 4FXKC 3C1FA 1WTXA 2XIWA 1E2ZA 1LACA 4X3SA 2HCCA 5LL6X 3GV6A 3I72A 4KN4C 1TWCB 3N52A 2VB2X 1B3AA 1OXTA 4HCSA 4ZUJA 1OO9B 4QMGA 2PCFB 3KK7A 2RVLA 3R93A 4B9XA 1TKWB 2AWNA 3QG1A 4C1NK 5E4XA 1SDFA 5EPJA 4N9PA 4HSVA 5DM63 2EOTA 4OO1H 1KLUD 5J1ZA 1IW7C 4K5XA 1VF5C 4CHTB 2JSOA 2F03A 4ZLTF 2FFKB 3S9WA 1BCPB 1HRJA 3IAYA 4KHVA 3G7LA 1F9RA 4J1MA 2K32A 4EQPA 4ABNA 4XT3B 1V8QA 1EYAA 5C3EB 2D9UA 4OO1G 1PRTF 4TRDA 1SE4A 2NTTA 3RMHA 1EEFD 2DNCA 1SYGA 1KDAA 4ZKBB 3DEOA 1XYIA 2DY7A 1A6XA 2KVMA 1SFOB 5EPKA 1JWUD 2FMCA 1GHKA 3HS0C 3HKZB 3R3OA 3VR3A 4IN3A 3V2TA 1TIID 2E74C 4RCNA 2G9DA 1ILPA 2JP1A 1GHJA 3TMEA 4C3HB 5C0XH 5BN4A 3S1QB 5C4HA 4OIKA 2BA1A 4PMCA 3T51B 2RKSA 1GUGA 5A35A 1J9OA 1EU4A 1EQVA 1HA6A 1SYCA 1SSOA 4KKTA 1CQVA 2WAQB 4MHEA 3A55A 5M9OA 4PQXA 4ZUIA 1DCZA 3DWAA 2Z1CA 4WFN3 5C0XG 2QDBA 2F4IA 5CBEE 1JWSD 1X3QA 5T1GA 1PFNA 4N9TA 4S3SA 1PZID 4L63B 4MIUA 3A56A 2HDLA 1EU3A 1U9RA 2M00A 3HOZB 3LWEA 2V4DA 4H7BA 1SAPA 1I6VC 4HN7A 2ID0A 1LV9A 2NB0A 2K5DA 1ZXTA 4IUQA 3K6OA 4RH6A 1EY0A 5D14A 5C5MA 5JOBA 4IFDI 1D1KA 2K6AA 1GJXA 2C5CA 5CBAE 2VXWA 3BYYB 3X3MA 3OOCA 2R92B 1JCKB 5E4WC 4CJ0B 3JAME 3J81E 2IT1A 3NTIA 4O42A 1QJOA 1GUOA 2A6ED 3RZOB 2MGSA 3HP3A 2C9OA 3NBIA 4BA1I 3HOWB 2SDFA 1LTSD 3MFYA 5IGCA 1B50A 4V0BA 1SYEA 1SJHD 5JAVA 2JE6I 2EY1A 4H0LC 3AMUA 1S5BD 4K8IA 1MBYA 1RD9D 3S2HB 1IYUA 5ELEA 3EJIA 1OXXK 1HTPA 1EY7A 3T13A 4XQJA 1V43A 3PO2B 1LT4D 1RF2D 1MD2D 1H9KA 2F3VA 1RHPA 1AZPA 2PQEA 1CQFA 5HURA 5LHY1 3ERQA 2KHSA 2Q8RE 3SR1A 1MGSA 2F0JA 2WIIB 1EY4A 2WV6D 2LY7A 3C1EA 2OEOA 5EKKA 4U673 3VYRA 4ZK9B 1Q1BA 1Q1EA 3PUYA 5CV8A 1JOKA 2RBMA 3A8KE 4IUPA 1LT6D 1Z6HA 3OIPA 2F0VA 3VA5A 4K6LA 2Q8IB 2IW3A 3LWUA 3EQLC 3KBGA 1SMYC 3KF8A 1BCPC 1RTOA 2CW0C 4IALA 1DONA 2JXMB 2A73B 5C4ZA 4V190 3MTSA 4LMQD 1CZWA 4KJOA 2EJMA 3T53B 2ZXRA 4IQZA 3VR4A 3LX0A 5I2XA 4RGTA 3I8ZA 3OMGA 3W2DA 5KYLA 3Q0AA 4ZKCB 1E2WA 3E0JA 4ID6A 1BR9A 1H9SA 1II3A 3LNNA 1EEID 4XTCS 1EY5A 1AEXA 1W6KA 1MI2A 1F9SA 2QKIC 2O5IC 3HOYB 4BBSB 5CV4A 5IIFA 2Z4IA 1U4PA 5JEAJ 1B9MA 4KHZA 1WCMB 2L55A 1JB3A 5I9OA 1HUMA 3TP5A 1EIGA 1FR3A 2F0KA 1G2TA 1ZEQX 1I6HB 3D4WA 1I4PA 4C3IB 2XN9C 2B2TC 3K7AB 2AQ1B 2BE5D 4E6IA 1SNDA 5E3FA 1U4MA 5KNDA 2RA4A 3FRPB 4LAAA 4QB4A 4KN7C 2VNUD 5D65A 1PRTC 3I90A 1SJED 1XTCD 3E6ZX 3S14B 1F9PA 3SEBA 1Q90A 4KD4A 5E1FA 1STGA 2M2LA 3S1MB 3IFDA 1VMPA 5CGKA 2WB1B 1UEAB 3D3RA 4PMBA 4Y7NB 4I65A 4NDXA 3GTQB 4DK0A 3GTLB 3A8JE 1TS2A 3RD4A 3PMFA 1ENAA 3CRKC 4FF4A 2HUGA 4A3IB 5KNCA 4IFDH 2I07B 4RGNA 2A6HD 3QWNA 2K1BA 1LABA 3VR2A 4DNRB 2DN8A 4HMIA 2QF7A 4K2LA 3TSSA 4C2MB 1GOZA 3BDCA 2EDGA 4LK1C 1G91A 1Q8IA 4HAEA 1I4QA 1FD7D 1BNZA 1QG7A 2OXPA 5IGDA 5FO9B 1T5XD 4RFBA 3X3NA 3BS1A 3BVGA 4IFDG 1VDZA 4HSPA 5M3MB 4QUFA 1IKLA 4B08A 2L11A 2JYOA 1EY6A 1XWEA 5KNBA 4KY6A 1QE6A 3P7JA 2EYPA 4C3JB 1BUVT 1V1OA 1BOSA 4L8JA 1F2LA 3S1RB 5C4JB 1SXTA 1S4ZA 2H4OA 1X32A 4A3FB 1QB5D 2BCOA 3SDZA 2E2IB 2JA8B 3PV0A 1DOLA 3D6CA 4DK1A 3OSOA 3ND9A 5FO8B 2AQ3B 1ET9A 5JJZA 3D6WA 4H44C 4KK7A 3H6MA 2KECA 1VF7A 1SE2A 4TKOB 1RODA 2XRQD 1TU2B 2ENBA 4XT1B 1LT5D 3S17B 1LO5D 3KLRA 3VR5A 1HFNA 3HG9A 1NAPA 2XRSD 3J80E 5JEAG 1STHA 4CKEA 4M1UB 2G9HD 1UAPA 2JEAI 3U9SA 1FYCA 2CQAA 1WTPA 4A3GB 2TMPA 2B2WC 2O2LD 2B2UC 1EZ8A 1SNOA 5TSSA 1IW7D 5ELCA 2X6GA 3A54A 4R8IA 2E75C 5I4DA 2QEJC 1TT2A 2L5TA 5CC4A 1BDOA 4XQNA 2L1BA 2F0NA 3K58A 1HHVA 3RLFA 1TWAB 3NQIA 3F2UA 1ZYRD 3PO3B 2A69D 4EQNA 2FMMA 4KMUC 1K83B 1OXSC 3FPUB 5CMDA 1WTQA 5IODA 3I4NB 1STNA 3HOXB 1EL0A 1SNCA 3BG3A 2A74C 2EJGC 4KTAA 1YNND 5EBDA 3A7AB 2WKDA 2NWGA 2IX3A 5FOBB 1PTOF 3BDLA 4FF3A 5A2QL 3MC0B 2F0UA 4IURA 1ESRA 3AB9A 2NVXB 2A5HA 3EVQA 3SK8A 2B2YA 5J22A 1GUTA 3I4LA 4QUCA 2KEDA 2ZXPA 2ZXOA 4NP5A 1TWGB 2R3ZA 3TZDA 1GUWA 1KDCA 2KCCA 1CZGA 4WRDA 4G7HC 1J8IA 3JAML 3J81L 3L9AX 2L9HA 2EYHA 2H1EA 4CJ2C 4RCOA 1C8CA 2TSSA 3MVVA 3TDQA 2VB3X 1SNMA 1D5MC 2PPBC 2PYKA 3K59A 5DEHA 3H0GB 2B39A 4KKSA 3CKIB 3D4RA 4HTHA 1DOMA 1WTWA 1KDBA 1TR5A 3BVMA 1SE3A 3MFGA 1PDQA 5CV5A 4IUNA 1WVLA 1CTMA 3O13A 1PRTB 3TZUA 2EYJA 3M4OB 1DD2A 1L0XB 4HMJA 3D8GA 2MHVA 3FEWX 1SYFA 2JA7B 4JK1C 3VYSA 1PTOB 5I9PA 4DA2A 2M9VA 2FHTA 5A2QE 4KI0A 1G2SA 3OMCA 4Q5VA 1Y8PB 3I4MB 1EQTA 4IUVA 5EJWA 5C44B 3NWSA 4G4KA 1PFBA 4Z9CB 3BZDB 2FINB 2NVYB 3L7ZC 4C56C 5M5WB 5IGBA 2X6LA 4BA2I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I4H A;  1HA5 A;  1PZJ D;  1RCV D;  1SE2 A;  3EA6 A;  3MC0 B;  1PTO H;  2QIL A;  1FNW A;  3GP7 A;  1TS2 A;  1FNU A;  2XRQ D;  4OHJ A;  5ELD A;  3W2D A;  1SJH D;  1CK1 A;  1LLR D;  1F77 A;  1LT5 D;  5D3D A;  1I4G A;  1SBB B;  1LO5 D;  1S5B D;  1RD9 D;  1PYW D;  4DXG A;  1S5E D;  4RGN A;  3EFX D;  1TY0 A;  2AQ2 B;  1XXG A;  1G8Z D;  1KLU D;  3DWQ A;  1EU4 A;  3DWP A;  1PTO C;  5ELE A;  1S5F D;  1EEI D;  1DJR D;  2XRS D;  2SEB D;  4RHS A;  1I4R A;  1PZK D;  1TY2 A;  4RHR A;  1CHP D;  1B44 D;  1CQV A;  2G9H D;  2NTS A;  1BCP D;  3TSS A;  1PRT D;  1ENF A;  1GOZ A;  1HXY D;  2IPK D;  1TS3 A;  1S5D D;  3R8B A;  3DWA A;  4RCO A;  1S5C D;  1EFI D;  2RDH A;  1LT4 D;  3KLS X;  1RF2 D;  2TSS A;  1FGB D;  1RDP D;  1TS4 A;  1BCP B;  1LTB D;  1LT3 D;  1MD2 D;  3R2I A;  4RGO S;  3BYT B;  2O2L D;  2R61 A;  1JWS D;  1D5M C;  1V1P A;  1I4Q A;  1FNV A;  1FD7 D;  3CHB D;  1PZI D;  4L63 B;  1KLG D;  2Z8L A;  1PTO D;  5ELF A;  1JR0 D;  5TSS A;  2XNA C;  1T5X D;  5ELC A;  4RFB A;  1EU3 A;  1STE A;  1D5Z C;  1JQY D;  3BVG A;  1I4P A;  5D3I B;  2XN9 C;  5I4D A;  1BCP F;  3BVM A;  1PRT F;  1SE3 A;  1V1P B;  2QEJ C;  2WV6 D;  3MFG A;  1M4V A;  2AQ1 B;  2CHB D;  1SE4 A;  2NTT A;  1EEF D;  2RDG A;  1HTL D;  5FKA C;  3O13 A;  1UUP A;  1PRT B;  4RH6 A;  5ELB A;  1LTR D;  4DXF A;  1LTA D;  1D5X C;  1LT6 D;  1L0X B;  1I4X A;  1JWM D;  1V1O A;  4UDU C;  4K6L A;  3BVZ A;  1L0Y B;  3URY A;  1TS5 A;  3BYY B;  3V05 A;  3R2T A;  4TSS A;  1JWU D;  1AW7 A;  1LTG D;  1BXT A;  1JCK B;  1SEB D;  3OWE B;  1PTO B;  1BCP C;  1PRT C;  4BWG B;  1SXT A;  4L6T B;  1SJE D;  1UNS A;  1CT1 D;  1D6E C;  1XTC D;  2ICI A;  4O1N A;  3SEB A;  1ESF A;  1ET6 A;  1LTI D;  1AN8 A;  1CHQ D;  4RGM A;  1EWC A;  1HQR D;  5FK9 C;  4Z9C B;  1DYQ A;  3BZD B;  1QIL A;  2J4X A;  4ZYS A;  2IJ0 A;  4C56 C;  1LTT D;  2AQ3 B;  1ET9 A;  1PTO F;  1KTK A;  1B1Z A;  1LTS D;  4RGT A; 
#chains in the Genus database with same CATH topology
 3CQZ H;  1RCV D;  1E1T A;  4KY5 A;  1XNR Q;  2QIL A;  1RTN A;  1FNU A;  2NVT B;  1PFM A;  1TWC H;  4POG A;  1SBB B;  1EOV A;  3I3C A;  2NBF A;  1WD1 A;  4DXG A;  3H15 A;  4DR3 L;  1XMQ L;  2A19 A;  2Z6B A;  1IZ6 A;  3VA7 A;  1S5F D;  2JA5 H;  1O7Z A;  2SNS A;  3QR8 A;  4A3M G;  1B53 A;  1CKN A;  2WAC A;  3NUC A;  3S15 B;  1KNA A;  4DGZ A;  3K5M A;  2ZJR A;  1K8M A;  4JBM A;  4HR7 B;  1C4Q A;  4FYD A;  1KQS A;  3CCV A;  1A2U A;  4OEL B;  2EYM A;  4XQQ A;  3S2D B;  4A93 B;  5JJK A;  4YCU A;  4LF4 Q;  5H1S E;  1H9M A;  1VQL A;  2A6E C;  3FDT A;  2F0W A;  3CD6 A;  3CHB D;  2BH2 A;  3NTH A;  3QOL A;  2Z8L A;  1B8A A;  4HJA A;  2K5W A;  3T1Y Q;  1VQG A;  3F1Z A;  1VMC A;  2K03 A;  3F8T A;  2LKV A;  5C3W A;  3H3V C;  4DR4 Q;  1K28 A;  2Y0S G;  1GO3 E;  3H09 A;  2J0T D;  1IKM A;  1M4V A;  2MFI A;  1QZG A;  5EBC A;  2JA5 G;  3W3A A;  2PZU A;  4XYO A;  1G29 1;  3M7G A;  3W5O A;  1RJT A;  1RL2 A;  2OTL A;  2J7Z A;  3ND8 A;  2QW7 A;  5M5X B;  1I4X A;  4HCE A;  1IBL L;  1C7Y A;  1ILQ A;  1PV4 A;  5LL6 S;  3ERO A;  3V05 A;  5C3E H;  1F2M A;  5M5Y H;  3A8I E;  4PMW A;  4BWG B;  5IGG A;  5GAE C;  4LF7 Q;  3PGZ A;  3D31 A;  4HED A;  1EWH A;  4F87 A;  1E22 A;  3CC4 A;  1QNU A;  4DAV A;  1X54 A;  2CWP A;  3GTM B;  2E2H H;  3NWT A;  1HQR D;  2CVR A;  2KUM A;  2LFN A;  2BDO A;  3KLW A;  4F7X A;  1LTT D;  2E2J B;  1KTK A;  1EFW A;  3I70 A;  3PUW A;  1PZJ D;  3K5O A;  1D1I A;  1SMY D;  4MTN A;  2B2V A;  2ZJQ A;  2F0E A;  1MJC A;  3M4Y A;  5IOC A;  3T16 A;  2L4N A;  4X62 Q;  4UY8 C;  1Y1W H;  3RLO A;  4IUT A;  1QOH A;  3JAM c;  3J81 c;  1O7I A;  3CAM A;  5D3D A;  2EIF A;  4JOI A;  4G57 A;  5C3E G;  3CCM A;  1VQN A;  4DV7 L;  2AKW B;  1Z9F A;  1J5E Q;  4RWS C;  3M4P A;  1EQR A;  3SK6 A;  1AZQ A;  1I4R A;  2K05 A;  5G3L D;  2ALY B;  3GTK B;  3GTG B;  3L2P A;  1HXY D;  5GAD C;  2NZ1 D;  1L1O A;  3C3L A;  1DOK A;  1CA6 A;  2EE1 A;  3SK4 A;  4LF5 Q;  3R2I A;  4G7O C;  1T5E A;  1T9H A;  1U5K A;  1V1P A;  4K0K Q;  2LS0 1;  1BO0 A;  2KEN A;  3MXP A;  4DR7 Q;  1GXD C;  3HKZ G;  3TP6 A;  1VQI A;  4X65 L;  1AFP A;  1PA6 A;  2R7Z B;  1VQF A;  3BDO A;  2RDF A;  1D5Z C;  3GQB A;  1KC8 C;  2XTI A;  4HJ7 A;  1KXL A;  4OON A;  3GD7 A;  4BY7 H;  2PMZ B;  4EQO A;  3BU2 A;  1CKO A;  1BQQ T;  2CHB D;  4GOP C;  3KUP A;  1H9R A;  3S24 A;  3QJY A;  2HDM A;  4HIM A;  1D5X C;  1U4L A;  4ME3 A;  3GTJ B;  4UDU C;  3GTO B;  1N9W A;  2RQX A;  5M3F H;  4DR2 L;  1TS5 A;  1ONL A;  1LTG D;  3OWE B;  2QA4 A;  1TQO A;  3NXW A;  3VYU A;  1NBW A;  4NKL A;  1KAB A;  1B4O A;  1O80 A;  2WAQ G;  1QNK A;  1M1K C;  1TWF H;  4ZRZ A;  2K33 A;  3P20 A;  5KEE A;  4BY7 G;  2MNA A;  1GVP A;  4GNX C;  3NE5 B;  3U4V A;  4R4O A;  1WTO A;  1OTC A;  4K8J A;  4JV5 Q;  3PIP 3;  1FVI A;  2HCI A;  2XSC A;  2KCN A;  2WKC A;  3L3O C;  3MXN A;  1YHB A;  4OHJ A;  4A75 A;  5CV9 A;  3FP9 A;  2BE5 C;  5M3F G;  4DAP A;  3HOZ G;  4L5Q A;  2DY8 A;  2Z6K C;  1XJV A;  1S5E D;  3RZO H;  4R8N A;  2AQ2 B;  2EYO A;  5EPL A;  3TBI B;  1O7Y A;  4DV5 L;  1IBM Q;  3DWQ A;  3ULP A;  4M8A A;  1PTO C;  4LF8 L;  3FHW A;  3CRL C;  4GZY C;  3NPP A;  3M3Y B;  3IFT A;  3MXU A;  2EPB A;  1E7Z A;  1B9N A;  3KDF B;  1H9S B;  1L2F A;  3R8B A;  4X3U A;  2WFW A;  4DR6 Q;  2KJX A;  3TN2 A;  1TS4 A;  1C0A A;  2R92 G;  3S2H H;  2K28 A;  2UXC L;  4ZCK A;  1KLG D;  1A15 A;  1X6O A;  4UAI A;  4ZQ3 A;  1MJE A;  1RKN A;  1STE A;  3V96 A;  1VQ5 A;  1QUQ B;  5NUC A;  3H91 A;  3TS2 A;  1NUC A;  1YNJ D;  2IL8 A;  1SNP A;  2JJQ A;  4P74 A;  2RSO A;  2A68 D;  4ME5 A;  4F8M A;  1DXM A;  2RDG A;  2ZT9 C;  2OF1 A;  3NHH A;  1LTR D;  2A6H C;  1W6J A;  5IY0 A;  3MXG A;  3ITP A;  5IP9 H;  3OPO A;  4PV1 C;  4BXX H;  2Z4H A;  1JWM D;  2F1M A;  3J80 L;  4RAU C;  3BVZ A;  2F0F A;  4FNF A;  2D2C C;  1GUN A;  2UU9 L;  1XMQ Q;  4TSS A;  2WP8 J;  1SEB D;  1X65 A;  4A3D B;  2EVB A;  1Y8O B;  1UNS A;  1STB A;  3H94 A;  5JJL A;  2X69 A;  1ET6 A;  2AUK A;  4LF9 Q;  4RGM A;  5FJ8 H;  3UDX A;  1BVS A;  5DM7 3;  1X3G A;  1IYV A;  2K04 A;  4ZYS A;  1E2V A;  2SNM A;  2PZW A;  4ALP A;  1Q7Y C;  2K50 A;  2JA6 B;  1LTL A;  3EA6 A;  5AFW A;  1KRT A;  1FNW A;  1HZA A;  1KL9 A;  4N8F A;  5IP9 G;  4BXX G;  1CK1 A;  1C48 A;  4YY3 Q;  1FJG Q;  3KLS A;  4DV2 L;  1TWH B;  2UXD Q;  3CC2 A;  1PMR A;  5JEA H;  2RSN A;  4RMF A;  2DUD A;  5JPN C;  1HR0 L;  1B2T A;  5KYI A;  5C0X J;  1MSG A;  3Q6S A;  5K5P A;  4NXM Q;  2KQ3 A;  1IBL Q;  1XX8 A;  3P75 A;  2NZO A;  4DV6 L;  5FLX L;  2ZM6 Q;  1Q82 C;  4NB3 A;  5C4X H;  3Q24 A;  3RUZ A;  4MNO A;  2R93 H;  3VYT A;  4XDX A;  1IL8 A;  1RDP D;  2V1C C;  2VY3 A;  2KA7 A;  4RGO S;  4DV3 Q;  2R61 A;  2XWJ B;  1I3Q H;  1ICF B;  3KFU A;  2C35 B;  2N88 A;  1XPU A;  1JC7 A;  5JVG 3;  3ONA B;  3CQZ B;  4DAM A;  1Y69 U;  4MN3 A;  1EWI A;  1WTV A;  5G3L F;  3Q23 A;  2OWO A;  1EY8 A;  5CV7 A;  2N49 A;  4WJ3 M;  5LMU L;  4CDD C;  2Q2H A;  5T1I A;  3NQT A;  3E0E A;  1Z7T A;  4DV1 L;  1K0R A;  3U9O A;  4DXF A;  4JYA L;  4DPG A;  5EKI A;  3WDN A;  4OEM B;  3WOE A;  1ICW A;  2Y0S B;  1WYD A;  3WOF A;  3DMU A;  5C4X G;  2JA5 B;  2R93 G;  4DV7 Q;  4ODG A;  1I6H H;  1YHQ A;  1L0Y B;  2EY2 A;  1JOR A;  5IE8 A;  4YHH L;  3G4S A;  2F0G A;  3NK9 A;  4EGV A;  4C3I H;  4R4I A;  3KBX A;  1LYL A;  5J39 A;  1HCZ A;  3K57 A;  3FVQ A;  3CMA A;  1TVX A;  5GQO A;  2ICI A;  1CSP A;  1ESF A;  4GKK L;  4WOR A;  1XNQ Q;  4BBS G;  1WFQ A;  2BDN A;  4OIJ A;  4A3K H;  1ZKO A;  3K8A A;  3NTK A;  4H02 A;  2NN6 I;  2XWB B;  2PZT A;  1NY4 A;  4IPH A;  2B2T A;  5C5L A;  3GP7 A;  2F0Q A;  2BA0 A;  3TP8 A;  1R9T B;  1WCM G;  4X65 Q;  4HJ8 A;  2YU9 H;  3FKI B;  3FMC A;  2CKZ B;  5ELD A;  4QF4 A;  1LLR D;  1NE3 A;  1WTH A;  2L15 A;  5FLX E;  3I56 A;  3CCE A;  4K14 A;  1AP0 A;  4ULL A;  4AYB E;  2F0H A;  4IZ8 A;  5KRU A;  1PYW D;  4C3I G;  3CCQ A;  1I94 L;  3EFX D;  4KHP L;  1ZYR C;  1HUN A;  3PUZ A;  2A69 C;  4DUZ Q;  3QB3 A;  2EY5 A;  4KJN A;  1PXU A;  3MZ5 A;  4FXD A;  4X66 L;  2HQE A;  1CHP D;  1VQD A;  5M5Y B;  3GTL H;  4JI5 L;  1YJ9 A;  2IPK D;  4KD3 A;  3SVM A;  1SYB A;  1EFI D;  2B2V C;  3DEP A;  2O4X A;  3KLS X;  3CCJ A;  1LTB D;  2E2H B;  4JC0 A;  1YNN C;  4IO9 A;  2QDL A;  3DHQ A;  2IX1 A;  2O5J C;  3S16 H;  1JE5 A;  4JG2 A;  4NMZ A;  4DK6 C;  3D0F A;  1NR4 A;  2F52 A;  2VS1 A;  4JOI C;  2VQE Q;  1NR2 A;  3TRE A;  1BBX C;  4KKU A;  4GOP B;  1N33 Q;  1STY A;  3J80 c;  2E2D C;  1JQY D;  1I50 H;  3MAQ A;  1VQ7 A;  4XIG S;  4C2M H;  5KGU A;  3AQQ A;  2WB1 G;  1Y1W B;  5IWA Q;  3KF6 B;  2P5Z X;  4JPB W;  1EUJ A;  3SHL A;  1WTR A;  1UWV A;  5ELB A;  4DV0 Q;  1Z47 A;  4A3C H;  1LTA D;  4J8Q A;  1BF4 A;  4JI0 Q;  5CYU A;  2F0O A;  1G6Z A;  3G48 A;  5E7N A;  1PYS B;  4BBR H;  4CJ1 B;  3UE1 A;  2HHH Q;  4JBW A;  2PQA B;  1AW7 A;  4BS9 A;  4GNX B;  4L6T B;  2ICE C;  4X6A H;  4UP7 A;  1R4P B;  1CT1 D;  3STB D;  1ENC A;  2B8F A;  2R6G A;  3QOJ A;  3HOU H;  4C3J H;  2HQL A;  4A3J B;  3DXJ C;  5FK9 C;  4FF2 A;  1QIL A;  3OYY A;  3HGB A;  2UXC Q;  1HA5 A;  2L12 A;  1VQB A;  1WD0 A;  4ILW A;  1JB7 A;  2K5Q A;  1KNE A;  1EOT A;  4A3C G;  2G5D A;  1MKH A;  4BY7 B;  3PUV A;  4C1N I;  4A3F H;  1D2B A;  1NSN S;  2PO4 A;  5COY A;  4BBR G;  1CM9 A;  5FLX c;  3MEH A;  1EIH A;  3OWF A;  3TP7 A;  4K6D A;  2GA4 B;  2IX0 A;  3DM1 A;  2IHF A;  1S3O A;  2PNH A;  4LFC L;  1XXG A;  2EJF C;  4JI6 Q;  4O2D A;  2F0P A;  1A3V A;  1AE2 A;  1PH5 A;  5M3F B;  3HOU G;  1PZK D;  4C3J G;  4XYQ A;  3A5U A;  3FPP A;  5HGT A;  2F0M A;  5F2D A;  2UU9 Q;  1F2Z A;  1IHZ A;  1KAA A;  4X3T A;  5I2Y A;  3S17 H;  2N3S A;  2SOB A;  1TWF B;  4J15 A;  2CCZ A;  1H9J A;  3MHB A;  5COR A;  2F0L A;  4OL7 A;  3SXH A;  4CKC A;  5I6Y A;  3Q22 A;  4A3F G;  3D4D A;  4B3S Q;  1N36 Q;  1O78 A;  2EXZ A;  4N8X 1;  2L0C A;  1A0I A;  4LUZ A;  2AWO A;  5JJI A;  3TQY A;  2D0P A;  5FO7 B;  4A3G H;  1HPC A;  3K80 C;  2NZH A;  1OXU A;  2QCP X;  1CFM A;  3A7L A;  3GTP B;  4A3E B;  2Y0S E;  4DV2 Q;  1AH9 A;  1JJG A;  4GS3 A;  3GDE A;  3K7U C;  4GLV B;  4B9W A;  1EY9 A;  1HFG A;  3IL8 A;  5IYD G;  1VQA A;  4DF7 A;  3OTO L;  4G7Z C;  3J7A V;  3PIO 3;  2B2W A;  4DN4 M;  4DNI A;  1A63 A;  1F2Y A;  2K01 A;  4RG1 A;  2B2U A;  3A0J A;  2MUY A;  1BBW A;  4A3B B;  4GN5 A;  2I5H A;  4B3T L;  4LFA Q;  3NSW A;  2CH4 A;  4DV6 Q;  2VUM B;  3J7Y W;  1CHQ D;  3AFP A;  1TWA H;  4WJW A;  3RZD B;  1DYQ A;  3HOV B;  3P1H A;  4CBV A;  1SNQ A;  3K5L A;  5J3B A;  4BY1 B;  1VQJ A;  4A3G G;  1MSH A;  3I73 A;  3I2Z A;  1K83 H;  2JEB I;  4I7Z C;  5DNF A;  3I4N H;  4B3R Q;  4CDC C;  4JI2 Q;  3VR6 A;  3C2P A;  4GN4 B;  2FXQ A;  1F77 A;  4OWT B;  1I4G A;  1OXV A;  2I46 A;  5CR3 A;  1JE4 A;  3MA2 B;  1E0B A;  2EZV A;  3I91 A;  5LMU Q;  2MJ8 A;  3DWP A;  1A3U A;  4RKL A;  1Y8N B;  4APV A;  3J81 j;  3CW2 C;  1ML0 D;  4RKB A;  1VQK A;  4DV1 Q;  1MHW C;  4JYA Q;  1SFO H;  4RHS A;  2Q8T A;  1TY2 A;  4JI7 L;  1HNX L;  4LF6 L;  2K4K A;  3GV3 A;  1BCP D;  1ENF A;  3PO3 G;  1UE7 A;  2CW0 D;  4P72 A;  3CF5 A;  2NVX H;  1DM0 B;  4HJ9 A;  4OWW B;  1S5C D;  2RDH A;  1ASZ A;  2YV5 A;  1LT3 D;  4JI4 Q;  4IFD J;  4KV6 A;  3BYT B;  3I4N G;  2E8G A;  1CKN B;  1CI3 M;  4AH6 A;  2MPM A;  3HOX G;  4QJF A;  2NN6 H;  2E5L L;  4IPD A;  3HRZ C;  4GKK Q;  1XPO A;  1K8A C;  4F88 A;  1VQM A;  4C3H H;  1PYB A;  2ZJP A;  1JJ2 A;  4LFB Q;  2Q2U A;  1F9Q A;  1V1Q A;  3GO5 A;  4U68 A;  4X64 L;  3K0Y A;  3S1Q H;  3HZX A;  5IT9 L;  2UXB L;  1R4Q B;  2LXJ A;  3NP8 A;  4FVM A;  2F0I A;  4KLK A;  5GRO A;  4HJ5 A;  4OO1 I;  1D8L A;  2NVQ B;  5EQ0 A;  1NTG A;  1Q3L A;  3Q8D A;  4LWC A;  1DZ1 A;  3J7Z C;  1VQC A;  1I94 Q;  4KHP Q;  4IOC A;  1YHA A;  2HIX A;  4PZ7 A;  4CDF C;  4JBJ A;  5C6A A;  4NXN L;  1PH4 A;  1K8O A;  2NN6 G;  3T1H L;  1BBU A;  2R7D A;  5C4X B;  2MO1 A;  4FXG C;  4PNY A;  5I6W A;  2R93 B;  2K7V A;  4LUV A;  5IYB H;  4O1N A;  1SLJ A;  4C3H G;  4GKJ L;  3OW2 A;  1LTI D;  1CA5 A;  3ZYY X;  3M4O H;  2ZTC A;  5KIX A;  4FP5 D;  4FO2 A;  4DNT B;  2R7F A;  4X3K A;  1UE6 A;  4IUU A;  1I3Q B;  2AUJ D;  4DU9 A;  3PUX A;  1SYD A;  1K9M C;  2IJ0 A;  1HNZ Q;  5EKL A;  2CQO A;  2DNE A;  1VQP A;  3N6R A;  4AQY L;  5FKA C;  1B1Z A;  1HQM C;  3DUZ A;  3UI2 A;  1JOQ A;  1HNW L;  5IGF A;  1KRS A;  2JA7 H;  3K5N A;  3HOZ H;  3IRB A;  1PTO H;  4H13 C;  1GUS A;  3E9I A;  2IWH A;  1QCB D;  4IPC A;  3H0G G;  3F2C A;  3S1N B;  2NYZ D;  1NCV A;  3OW7 A;  4LW1 A;  1K73 C;  4DAY A;  1HJP A;  1EYD A;  4QCL A;  1NMF A;  3SE0 A;  1Y1V B;  2RCN A;  2F3W A;  5C3X A;  1G8Z D;  4UP9 A;  3TRZ A;  3L0O A;  3KF8 B;  1VQO A;  2F0S A;  5IYB G;  5IGE A;  2SEB D;  4QIW B;  4RHR A;  1B44 D;  2FJ2 A;  1CUK A;  2UUC L;  2R92 H;  1Q86 C;  5GAG C;  1Q46 A;  2EY6 A;  2NTS A;  1PRT D;  2NVT H;  4CDE C;  1TS3 A;  1S5D D;  1PLF A;  4B3M Q;  4J6H A;  3C46 A;  1FGB D;  1UE1 A;  2JA7 G;  1U4R A;  4P2C B;  5IT9 E;  1HR0 W;  1A62 A;  3UDF A;  2EQS A;  4AYB B;  4A3K B;  2QGQ A;  3OIQ A;  2K75 A;  1PTO D;  1LM0 A;  2BH8 A;  3AYH B;  4DR5 Q;  2XNA C;  2YYZ A;  3HOW H;  1EIF A;  1L1O B;  5C44 G;  3G6J B;  3CPF A;  5C0X I;  3HFZ B;  4K5V A;  2YU9 B;  3JC6 6;  1M8A A;  1SRU A;  4R1J A;  3M85 A;  1X9N A;  4JI3 Q;  3T56 B;  4YCV A;  1V1P B;  3JAM i;  1X3F A;  2D62 A;  3J81 i;  2VQF L;  1EYC A;  2B63 B;  3S2D H;  4A93 H;  5DAU A;  1HTL D;  1UUP A;  1N34 Q;  2PNR C;  4RA8 A;  1N8R C;  4DFA A;  3B6Y A;  2B2Y C;  3M7N A;  2N55 A;  5JPM C;  3T4A C;  1PH8 A;  1N32 L;  5K36 H;  2PI2 A;  4JI1 L;  3HEJ A;  4QGU A;  1BXT A;  3A5Z B;  4CKB A;  3QO2 A;  1PH2 A;  2KEE A;  3CU7 A;  1D6E C;  3HOW G;  3PO2 H;  5BN3 A;  2EYL A;  1JT8 A;  4MTK A;  4OGQ C;  1AN8 A;  3RN2 A;  1EWC A;  3K0X A;  4K5W A;  3AU7 A;  4JVZ A;  3S16 B;  3E3X A;  1STA A;  4OWX B;  5EAY A;  2J4X A;  4R9W A;  4A93 G;  3QIA A;  1GKH A;  1I4H A;  4XXE A;  1I50 B;  4DR3 Q;  2WIN B;  1YNJ C;  2EYF A;  3CCS A;  4ZAI A;  2A68 C;  1A2T A;  5AJ3 L;  3GTM H;  2OT2 A;  5K36 G;  3H3V I;  2BOS A;  2PW5 A;  2PW7 A;  1TY0 A;  5CV6 A;  3W1G A;  1IBK L;  2GN5 A;  1QWY A;  1XNR L;  2MQH A;  4BBR B;  4DR1 L;  2E2J H;  3PO2 G;  2HT1 A;  1DJR D;  2F0D A;  1KHI A;  4FF1 A;  3LGJ A;  3MWY W;  2NUC A;  3NBH A;  1JIC A;  2LMC B;  3OTO Q;  5BR8 L;  1Q12 A;  4IPG A;  3HOU B;  4Q0F A;  1YZ6 A;  2F0T A;  5IT9 c;  4LJZ C;  5ISR A;  2UUB L;  4KY7 A;  2DJF C;  1FNV A;  4I7A A;  4B3T Q;  1EZ6 A;  3G71 A;  5ELF A;  4CGY B;  4UP8 A;  4DKA C;  1JR0 D;  2UUA L;  1X55 A;  1VCI A;  2XVS A;  5EGT A;  5D3I B;  4TQU S;  4LF4 L;  2JK8 A;  1BCP F;  1CSQ A;  3SK5 A;  3IKJ A;  1JOO A;  3J7A F;  3I55 A;  4NW2 A;  1X3P A;  1P8L A;  4EVO A;  1FL0 A;  4A3M B;  3T1Y L;  4PZ6 A;  4P73 A;  5BN5 A;  1O7L A;  1UE5 A;  2CFM A;  2MP1 A;  1CKM A;  2E76 C;  1LUZ A;  3OHX C;  4YIJ A;  2B8G A;  4DR4 L;  2D5D A;  5JVH 3;  2KOL A;  3URY A;  1A3T A;  3E5S A;  2VL6 A;  3R2T A;  4K2K A;  4FXK C;  3PF4 A;  3C1F A;  4BBS H;  3HOY H;  1WTX A;  2XIW A;  1E2Z A;  3MEF A;  1LAC A;  4X3S A;  2HCC A;  4JI7 Q;  5LL6 X;  3GV6 A;  3I72 A;  4KN4 C;  1TWC B;  3N52 A;  2VB2 X;  1B3A A;  1OXT A;  1WCM H;  4HCS A;  4ZUJ A;  1OO9 B;  3AFQ A;  4QMG A;  2DJG C;  4JI8 L;  3GTJ H;  2PCF B;  3GTO H;  3KK7 A;  1I5F A;  4LF7 L;  2RVL A;  3R93 A;  1IXR A;  4B9X A;  1TKW B;  3UDI A;  2R7Z G;  2AWN A;  3QG1 A;  3E9H A;  3K7A H;  5E4X A;  4C1N K;  1SDF A;  5EPJ A;  3ULJ A;  4YCW A;  4X64 Q;  4N9P A;  4HSV A;  5FLM H;  3HOY G;  2F3I A;  5DM6 3;  2EOT A;  4OO1 H;  2UXB Q;  4EQ5 A;  1KLU D;  5J1Z A;  4L5R C;  1IW7 C;  4QIW E;  4K5X A;  1VF5 C;  4CHT B;  1JJC B;  2JSO A;  4A4I A;  2F03 A;  2RHS B;  3NEN A;  1GD7 A;  1VQ6 A;  4ZLT F;  1J5E L;  2FFK B;  3S14 H;  3S9W A;  1WOC A;  1BCP B;  2OTJ A;  4NXN Q;  5IYC H;  1D7Q A;  1HRJ A;  3T1H Q;  2H5X A;  5IP7 H;  1E3P A;  1SRO A;  3IAY A;  4KHV A;  3S1M H;  3G7L A;  1F9R A;  4J1M A;  2K32 A;  4EQP A;  4ABN A;  4P71 A;  4Y7N H;  1TXY A;  4XT3 B;  1V8Q A;  1EYA A;  4DK3 C;  5C3E B;  3BZC A;  4LF5 L;  5FLM G;  2D9U A;  3M9B A;  3GTQ H;  1HH2 P;  4OO1 G;  2Z6K A;  1PRT F;  2B29 A;  4LNQ A;  4DR2 Q;  5GAH C;  4DR7 L;  4TRD A;  1SE4 A;  2NTT A;  4JCV E;  3CME A;  3RMH A;  1EEF D;  2DNC A;  1SYG A;  1KDA A;  4ZKB B;  3DEO A;  4A3I H;  3PCO B;  2WB1 E;  1XYI A;  2DY7 A;  1A6X A;  2KVM A;  3ZJY C;  1SFO B;  5IYC G;  5EPK A;  2YTX A;  1JWU D;  5IP7 G;  1NNX A;  2FMC A;  2YTV A;  1GHK A;  3HS0 C;  3HKZ B;  3R3O A;  3VR3 A;  4IN3 A;  3V2T A;  5L37 A;  1TII D;  2E74 C;  1M90 C;  1VQH A;  4A76 A;  4HIK A;  1L1O C;  2IY5 B;  4RCN A;  2G9D A;  1PH6 A;  1ILP A;  2JP1 A;  4WJ4 A;  1GHJ A;  2ZTE A;  3RR5 A;  3TME A;  4C3H B;  5C0X H;  5BN4 A;  4A3D H;  4DV5 Q;  5LMN W;  2QEX A;  4A3I G;  1MIU A;  3ER0 A;  5ELO A;  5M3M H;  4LF8 Q;  3S1Q B;  5C4H A;  4JBK A;  4OIK A;  2ASB A;  2BA1 A;  2OQK A;  4PMC A;  3PF5 A;  1Q8K A;  3T51 B;  2VQF Q;  3PQI A;  2RKS A;  1GUG A;  5A35 A;  1J9O A;  1EU4 A;  4OX9 L;  1EQV A;  1WJJ A;  2JA6 H;  1HA6 A;  1SYC A;  1SSO A;  4KKT A;  1CQV A;  2WAQ B;  4MHE A;  3W1B A;  3A55 A;  3S1R H;  5C4J H;  5M9O A;  4PQX A;  3STB C;  4ZUI A;  1VQ9 A;  1DCZ A;  3DWA A;  4Y52 H;  1KAW A;  1YI2 A;  1TWH H;  3WWV A;  2Z1C A;  4WFN 3;  5C0X G;  2E2I H;  2QDB A;  1YIT A;  2JA8 H;  1HZB A;  2F4I A;  4A3D G;  2Q2T A;  5CBE E;  1JWS D;  1X3Q A;  5T1G A;  1PFN A;  4N9T A;  5M3M G;  4POF A;  4S3S A;  1PZI D;  4L63 B;  3DLL A;  4MIU A;  3A56 A;  2HDL A;  1EU3 A;  2I5M X;  4R4T A;  1U9R A;  1K3B C;  2M00 A;  3HOZ B;  3LWE A;  4NPS A;  2V4D A;  1S40 A;  4H7B A;  1SAP A;  2F4V L;  1I6V C;  4HN7 A;  2ID0 A;  1LV9 A;  3UE0 A;  2JA6 G;  2NB0 A;  2K5D A;  3H3V H;  4L5S A;  1ZXT A;  4IUQ A;  3TS0 A;  3K6O A;  3PIP A;  4RH6 A;  5IYD H;  1EY0 A;  5D14 A;  5C5M A;  5JOB A;  4IFD I;  1D1K A;  5AJ3 Q;  2K6A A;  1GJX A;  2C5C A;  2LXK A;  5CBA E;  2JA8 G;  2VXW A;  3BYY B;  1IBK Q;  3X3M A;  1XMO L;  3OOC A;  2R92 B;  1JCK B;  5E4W C;  4DR1 Q;  1YNX A;  3DM3 A;  4CJ0 B;  3G6E A;  3JAM E;  3J81 E;  3CXC A;  2IT1 A;  3NTI A;  2VW9 A;  1EIY B;  4O42 A;  1QJO A;  5BR8 Q;  1GUO A;  2A6E D;  3RZO B;  2MGS A;  3HP3 A;  5HY6 A;  2C9O A;  3NBI A;  4BA1 I;  2UUB Q;  3HOW B;  2SDF A;  1LTS D;  2ATW A;  3J80 i;  1HR0 Q;  3MFY A;  5IGC A;  1B50 A;  4V0B A;  2UUA Q;  4UPA A;  4LF9 L;  5LMN L;  1EYG A;  1SYE A;  1SJH D;  1WI5 A;  5JAV A;  2JE6 I;  2EY1 A;  3NEM A;  4H0L C;  3AMU A;  1S5B D;  4K8I A;  1MBY A;  1RD9 D;  1S72 A;  3S2H B;  1IYU A;  3PO3 H;  2VZA A;  5ELE A;  3U4Z A;  3F2B A;  4GLA C;  3EJI A;  4YY3 L;  3NEL A;  1R9T H;  1OXX K;  3CCU A;  1FJG L;  3FKI H;  2UXD L;  1HTP A;  1U0L A;  1NJI C;  1EY7 A;  3T13 A;  3HOX H;  4XQJ A;  1V43 A;  3PO2 B;  4QQB X;  1LT4 D;  1RF2 D;  1MD2 D;  1H9K A;  1YBY A;  2F3V A;  4NXM L;  1RHP A;  1AZP A;  2PQE A;  1CQF A;  5HUR A;  5LHY 1;  2GVB A;  3ERQ A;  2ZM6 L;  3RLN A;  4JI8 Q;  2KHS A;  2Q8R E;  3SR1 A;  1MGS A;  2F0J A;  2WII B;  3EN2 A;  4DV3 L;  1EY4 A;  2WV6 D;  2LY7 A;  3C1E A;  2OEO A;  5EKK A;  1FGU A;  4U67 3;  4YHH Q;  4GLX A;  3VYR A;  1Q1B A;  4ZK9 B;  1Q1E A;  3PUY A;  3U50 C;  3FKI G;  5CV8 A;  1JOK A;  2RBM A;  3A8K E;  4IUP A;  1LT6 D;  3OIP A;  1Z6H A;  1TWG H;  2F0V A;  3VA5 A;  4K6L A;  2Q8I B;  3EIV A;  2IW3 A;  3LWU A;  3EQL C;  3KBG A;  1SMY C;  3KF8 A;  1BCP C;  1RTO A;  2CW0 C;  3HKZ E;  4IAL A;  1DON A;  2JXM B;  4UHV A;  3AEV A;  4QL5 A;  3U58 A;  5HGQ A;  2A73 B;  5C4Z A;  3BZK A;  4V19 0;  3EBE A;  3MTS A;  1VS0 A;  4LMQ D;  1CZW A;  4KJO A;  2EJM A;  3H0G H;  3T53 B;  2ZXR A;  4IQZ A;  3VR4 A;  3LX0 A;  5I2X A;  4RGT A;  1KIX A;  4QY7 A;  3I8Z A;  3OMG A;  1XNQ L;  3W2D A;  4X66 Q;  5KYL A;  3Q0A A;  2K14 A;  2IHE A;  4JI5 Q;  4ZKC B;  4A3J H;  1E2W A;  3E0J A;  4ID6 A;  1AE3 A;  3VDY A;  1BR9 A;  3KDF A;  2N8N A;  1K0S A;  1H9S A;  1PHJ A;  3CCR A;  1Y1W G;  2CH4 W;  1II3 A;  3LNN A;  1EEI D;  4XTC S;  1EY5 A;  1AEX A;  4GN3 B;  2WAQ E;  1W6K A;  1MI2 A;  1F9S A;  2QKI C;  2O5I C;  3HOY B;  4BBS B;  1PH7 A;  2K5V A;  1VQE A;  5CV4 A;  5IIF A;  2Z4I A;  1U4P A;  1QUQ A;  1PH3 A;  4DUZ L;  3I4M H;  5JEA J;  3A74 A;  1B9M A;  1G51 A;  5C44 H;  4KHZ A;  3F2D A;  2OCE A;  1WCM B;  2L55 A;  3HKS A;  3ULL A;  1JB3 A;  5I9O A;  1HUM A;  3TP5 A;  2NVY H;  1H95 A;  2RCF A;  1EIG A;  2I5L X;  1FR3 A;  2F0K A;  2K5N A;  5M5W H;  1G2T A;  1ZEQ X;  1SE8 A;  1I6H B;  1QVG A;  4A3J G;  3D4W A;  1I4P A;  2MO0 A;  1YVC A;  4C3I B;  2XN9 C;  2B2T C;  3K7A B;  2AQ1 B;  2BE5 D;  3RNU A;  4E6I A;  2VQE L;  1SND A;  1N33 L;  4L5T A;  2Q2I A;  1JMC A;  5E3F A;  4YWM A;  2JN4 A;  1K8G A;  2A1A A;  1U4M A;  5KND A;  2RA4 A;  3FRP B;  3I4M G;  1XTD A;  4LAA A;  4QB4 A;  5IWA L;  4KN7 C;  2VNU D;  4DUY L;  3S15 H;  4OX9 Q;  5D65 A;  1PRT C;  3I90 A;  1SJE D;  2I0Q A;  4IOA A;  4DV0 L;  1XTC D;  3E6Z X;  4JI0 L;  3S14 B;  1EQQ A;  1F9P A;  3SEB A;  1Q90 A;  4KD4 A;  5E1F A;  2A8V A;  1STG A;  2HHH L;  2M2L A;  3GTP H;  4A3E H;  3S1M B;  3IFD A;  1VMP A;  1K3R A;  5CGK A;  5ELN A;  2OQ0 A;  2WB1 B;  1UEA B;  3D3R A;  4PMB A;  1RIP A;  4Y7N B;  1SN8 A;  4I65 A;  4LFC Q;  4NDX A;  3GTQ B;  4DK0 A;  3GTL B;  3A8J E;  1TS2 A;  3RD4 A;  3PMF A;  1NMG A;  4A3B H;  1ENA A;  3CRK C;  2VUM H;  4YWL A;  4FF4 A;  2HUG A;  4A3I B;  5KNC A;  2F4V Q;  4IFD H;  2I07 B;  3RZD H;  4RGN A;  3HOV H;  2A6H D;  3QWN A;  2K1B A;  4BY1 H;  1XPR A;  1LAB A;  4DV4 L;  5M5X H;  3VR2 A;  2RHQ B;  4DNR B;  2GVA A;  2DN8 A;  4DAY B;  4HMI A;  1E1O A;  4A3E G;  2QF7 A;  4K2L A;  4LUO A;  3TSS A;  4C2M B;  1YIJ A;  1GOZ A;  3BDC A;  2EDG A;  4LK1 C;  1XMO Q;  3PSI A;  1G91 A;  1Q8I A;  4JI6 L;  2AHO B;  4HAE A;  2K5H A;  1I4Q A;  1FD7 D;  1BNZ A;  1QG7 A;  2OXP A;  4A3B G;  5IGD A;  5FO9 B;  1SMX A;  1T5X D;  3MXN B;  4RFB A;  1ASY A;  2VUM G;  3X3N A;  3BS1 A;  3BVG A;  4IFD G;  1VDZ A;  3HOV G;  4HSP A;  5M3M B;  1QZH A;  4QUF A;  2KCT A;  4BY1 G;  1IKL A;  4B08 A;  2L11 A;  4B3S L;  2DGY A;  2JYO A;  1EY6 A;  2CWA A;  1XWE A;  5KNB A;  4KY6 A;  1X3E A;  1QE6 A;  5LMN Q;  1N36 L;  3P7J A;  2EYP A;  4C3J B;  3CCL A;  3ERS X;  3I4O A;  1A8V A;  1BUV T;  1P16 A;  2N78 A;  1V1O A;  1HZ9 A;  1BOS A;  4AIM A;  4L8J A;  1YJW A;  1F2L A;  3S1R B;  3GTK H;  5C4J B;  3GTG H;  1SXT A;  1S4Z A;  2B3G A;  2K52 A;  2ZTD A;  3UDG A;  2H4O A;  3CPW A;  1X32 A;  4A3F B;  1QB5 D;  2BCO A;  3SDZ A;  2E2I B;  2JA8 B;  3PV0 A;  1DOL A;  3D6C A;  4DK1 A;  4JW0 A;  3OSO A;  3ND9 A;  3TEH B;  2NVQ H;  5FO8 B;  1PVO A;  2R7Z H;  2AQ3 B;  1ET9 A;  5JJZ A;  3D6W A;  4H44 C;  4KK7 A;  3H6M A;  2KEC A;  1VF7 A;  1SE2 A;  5FJ8 G;  3RN5 A;  4TKO B;  4LFA L;  1ROD A;  2Z9H A;  1L0W A;  1J6Q A;  1B7Y B;  2XRQ D;  3KOJ A;  1TU2 B;  2ENB A;  4XT1 B;  1B3Q A;  4PZ8 A;  1LT5 D;  1HNX Q;  4LF6 Q;  3S17 B;  1LO5 D;  2JA9 A;  2HIV A;  3KLR A;  2KHJ A;  3VR5 A;  4R4Q A;  1HFN A;  3HG9 A;  1NAP A;  4B3R L;  4JI2 L;  2XRS D;  2AMC B;  4A3L H;  3J80 E;  5JEA G;  1STH A;  4CKE A;  2E5L Q;  4M1U B;  2PMZ E;  2G9H D;  2Z0S A;  1UAP A;  3S1N H;  1HZC A;  4GOP A;  4EX5 A;  2JEA I;  3U9S A;  2HD3 A;  3M4Q A;  1FYC A;  2CQA A;  1E24 A;  1WTP A;  4A3G B;  2TMP A;  2B2W C;  1X56 A;  1Y1V H;  2B2U C;  2O2L D;  1PH9 A;  1EZ8 A;  1SNO A;  3PIO A;  3KF6 A;  3NBH B;  5TSS A;  1IW7 D;  5ELC A;  1SR3 A;  1VQ4 A;  3KJP A;  4X62 L;  2X6G A;  3A54 A;  4TVA B;  4R8I A;  4HID A;  2E75 C;  4JI4 L;  5I4D A;  1BKB A;  2QEJ C;  1TT2 A;  2L5T A;  1IYJ B;  5CC4 A;  1BDO A;  2PQA A;  2L1B A;  2F0N A;  4XQN A;  3K58 A;  4A3L G;  1HHV A;  3KJO A;  4GNX A;  3RLF A;  1TWA B;  3NQI A;  3F2U A;  4LFB L;  1ZYR D;  3PO3 B;  2A69 D;  4EQN A;  4GKJ Q;  3ICE A;  1YEZ A;  2FMM A;  4IJH A;  1W2B A;  4KMU C;  1K83 B;  1OXS C;  3FPU B;  1Y1V G;  5CMD A;  3M3Y H;  1WTQ A;  1PFS A;  5IOD A;  2EXD A;  3I4N B;  1STN A;  3HOX B;  4AQY Q;  1EL0 A;  1SNC A;  3BG3 A;  1HNW Q;  2B63 H;  2XGT A;  4K0K L;  2A74 C;  2EJG C;  1G6P A;  4KTA A;  1PH1 A;  1YJN A;  1YNN D;  5EBD A;  3A7A B;  4O0A A;  2WKD A;  1W3S A;  2NWG A;  2IX3 A;  1PTO F;  5FOB B;  3K81 C;  3BDL A;  1Q81 C;  4FF3 A;  5A2Q L;  3MC0 B;  2F0U A;  4AYB G;  4A3K G;  3I7F A;  4IUR A;  1ESR A;  3AB9 A;  1VQ8 A;  2NVX B;  2A5H A;  3EVQ A;  2UUC Q;  3SK8 A;  2B2Y A;  5J22 A;  2RF4 A;  4HIO A;  1GUT A;  3CP0 A;  3I4L A;  1HNZ L;  4QUC A;  2KED A;  2ZXP A;  2ZXO A;  4NP5 A;  4P75 A;  1TWG B;  2R3Z A;  2B63 G;  2YTY A;  3TZD A;  1Y14 B;  1IL2 A;  1GUW A;  1DGS A;  1KDC A;  2KCC A;  4MZ9 A;  1CZG A;  2KCM A;  4WRD A;  4G7H C;  1J8I A;  3JAM L;  3J81 L;  3L9A X;  2L9H A;  2EYH A;  2H1E A;  1KD1 C;  4CJ2 C;  4RCO A;  3SGI A;  1C8C A;  4DUY Q;  2TSS A;  3MVV A;  3TDQ A;  2VB3 X;  1SNM A;  1V9P A;  2ES2 A;  1QVC A;  5DLQ E;  1D5M C;  2PPB C;  2PYK A;  3K59 A;  4JV5 L;  5DEH A;  3H0G B;  2B39 A;  4KKS A;  3CKI B;  3D4R A;  4HTH A;  1DOM A;  4FDB A;  3BJU A;  2JQO A;  4B3M L;  4OXP A;  2KHI A;  1GM5 A;  4R4C A;  3J7A 5;  1WTW A;  1KDB A;  1TR5 A;  1QVF A;  3BVM A;  1SE3 A;  3MFG A;  1PDQ A;  1C9O A;  1N32 Q;  5CV5 A;  2LSS A;  4IUN A;  4JI1 Q;  1WVL A;  1CTM A;  1IBM L;  4DR5 L;  3O13 A;  3CC7 A;  1PRT B;  3TZU A;  2EYJ A;  3M4O B;  1DD2 A;  1B70 B;  1L0X B;  4HMJ A;  4JI3 L;  3D8G A;  2MHV A;  3FEW X;  1SYF A;  2JA7 B;  4JK1 C;  4DR6 L;  3VYS A;  4DV4 Q;  1PTO B;  5I9P A;  4DA2 A;  2M9V A;  2FHT A;  5A2Q E;  1N34 L;  4KI0 A;  1G2S A;  4YWK A;  3OMC A;  4IJL A;  4Q5V A;  1Y8P B;  3I4M B;  4A3M H;  1EQT A;  4IUV A;  5EJW A;  5C44 B;  2D0O A;  2PI2 E;  2KBN A;  3NWS A;  4G4K A;  1PFB A;  4Z9C B;  1UEB A;  3BZD B;  4PG3 A;  3KYH C;  2FIN B;  2NVY B;  3L7Z C;  4C56 C;  5M5W B;  5IGB A;  2X6L A;  4BA2 I; 
#chains in the Genus database with same CATH homology
 1RCV D;  4KY5 A;  2QIL A;  1RTN A;  1FNU A;  2NVT B;  1PFM A;  1SBB B;  3I3C A;  2NBF A;  1WD1 A;  4DXG A;  3VA7 A;  1S5F D;  1O7Z A;  2SNS A;  1B53 A;  2WAC A;  3NUC A;  3S15 B;  1KNA A;  4DGZ A;  3K5M A;  1K8M A;  4HR7 B;  1C4Q A;  4FYD A;  1A2U A;  2EYM A;  4XQQ A;  3S2D B;  4A93 B;  1H9M A;  2A6E C;  3FDT A;  2F0W A;  3CHB D;  3NTH A;  3QOL A;  2Z8L A;  2K5W A;  1VMC A;  2K03 A;  2LKV A;  5C3W A;  3H3V C;  1IKM A;  3H09 A;  2J0T D;  1M4V A;  5EBC A;  3W3A A;  2PZU A;  4XYO A;  1G29 1;  3M7G A;  1RJT A;  2J7Z A;  3ND8 A;  5M5X B;  1I4X A;  4HCE A;  1ILQ A;  5LL6 S;  3ERO A;  3V05 A;  1F2M A;  3A8I E;  4PMW A;  4BWG B;  5IGG A;  4HED A;  3D31 A;  1EWH A;  4F87 A;  1QNU A;  4DAV A;  3GTM B;  3NWT A;  1HQR D;  2CVR A;  2KUM A;  2LFN A;  2BDO A;  4F7X A;  1LTT D;  2E2J B;  1KTK A;  3I70 A;  3PUW A;  1PZJ D;  3K5O A;  1D1I A;  1SMY D;  2B2V A;  2F0E A;  3M4Y A;  5IOC A;  3T16 A;  2L4N A;  4IUT A;  1QOH A;  5D3D A;  4G57 A;  4RWS C;  3SK6 A;  1AZQ A;  1I4R A;  2K05 A;  5G3L D;  3GTK B;  3GTG B;  1HXY D;  2NZ1 D;  3C3L A;  1DOK A;  1CA6 A;  2EE1 A;  3SK4 A;  3R2I A;  4G7O C;  1T5E A;  1V1P A;  2LS0 1;  1BO0 A;  3MXP A;  1GXD C;  3TP6 A;  1AFP A;  2R7Z B;  3BDO A;  2RDF A;  1D5Z C;  3GQB A;  3GD7 A;  2PMZ B;  4EQO A;  1BQQ T;  2CHB D;  3KUP A;  1H9R A;  3QJY A;  2HDM A;  1D5X C;  1U4L A;  3GTJ B;  4UDU C;  3GTO B;  2RQX A;  1TS5 A;  1ONL A;  1LTG D;  3OWE B;  1TQO A;  3NXW A;  3VYU A;  4NKL A;  1KAB A;  1B4O A;  1O80 A;  1QNK A;  4ZRZ A;  2K33 A;  3P20 A;  5KEE A;  3NE5 B;  1WTO A;  4K8J A;  3PIP 3;  2HCI A;  2XSC A;  2KCN A;  2WKC A;  3L3O C;  3MXN A;  4OHJ A;  5CV9 A;  2BE5 C;  4DAP A;  2DY8 A;  1S5E D;  4R8N A;  2AQ2 B;  2EYO A;  5EPL A;  3TBI B;  1O7Y A;  3DWQ A;  4M8A A;  1PTO C;  3CRL C;  4GZY C;  3NPP A;  3M3Y B;  3IFT A;  3MXU A;  2EPB A;  1B9N A;  1H9S B;  3R8B A;  4X3U A;  2KJX A;  3TN2 A;  1TS4 A;  2K28 A;  1KLG D;  1A15 A;  4UAI A;  4ZQ3 A;  1RKN A;  1STE A;  3V96 A;  5NUC A;  3H91 A;  1NUC A;  1YNJ D;  2IL8 A;  1SNP A;  2RSO A;  2A68 D;  4ME5 A;  4F8M A;  1DXM A;  2RDG A;  2ZT9 C;  2OF1 A;  3NHH A;  1LTR D;  2A6H C;  1W6J A;  3MXG A;  3ITP A;  3OPO A;  4PV1 C;  2Z4H A;  1JWM D;  2F1M A;  3J80 L;  4RAU C;  3BVZ A;  2F0F A;  4FNF A;  2D2C C;  1GUN A;  4TSS A;  2WP8 J;  1SEB D;  4A3D B;  2EVB A;  1Y8O B;  1UNS A;  1STB A;  3H94 A;  2X69 A;  1ET6 A;  2AUK A;  4RGM A;  5DM7 3;  1IYV A;  2K04 A;  4ZYS A;  1E2V A;  2SNM A;  2PZW A;  2JA6 B;  3EA6 A;  5AFW A;  1FNW A;  1CK1 A;  1C48 A;  3KLS A;  1TWH B;  1PMR A;  5JEA H;  2RSN A;  5JPN C;  1B2T A;  5KYI A;  5C0X J;  1MSG A;  3Q6S A;  5K5P A;  2KQ3 A;  1XX8 A;  3P75 A;  5FLX L;  3Q24 A;  3RUZ A;  3VYT A;  4XDX A;  1IL8 A;  1RDP D;  2KA7 A;  4RGO S;  2R61 A;  2XWJ B;  2N88 A;  1JC7 A;  5JVG 3;  3ONA B;  3CQZ B;  1Y69 U;  4MN3 A;  1WTV A;  5G3L F;  3Q23 A;  1EY8 A;  5CV7 A;  5T1I A;  3NQT A;  1Z7T A;  3U9O A;  4DXF A;  5EKI A;  3WOE A;  3WDN A;  1ICW A;  2Y0S B;  3WOF A;  3DMU A;  2JA5 B;  4ODG A;  1L0Y B;  2EY2 A;  1JOR A;  2F0G A;  3NK9 A;  4EGV A;  3KBX A;  5J39 A;  1HCZ A;  3K57 A;  3FVQ A;  1TVX A;  2ICI A;  1ESF A;  4WOR A;  2BDN A;  4OIJ A;  1ZKO A;  3NTK A;  2NN6 I;  2XWB B;  2PZT A;  5C5L A;  2B2T A;  3GP7 A;  2F0Q A;  2BA0 A;  3TP8 A;  1R9T B;  3FKI B;  3FMC A;  5ELD A;  4QF4 A;  1LLR D;  5FLX E;  4K14 A;  1AP0 A;  4ULL A;  2F0H A;  4IZ8 A;  5KRU A;  1PYW D;  4C3I G;  3EFX D;  1ZYR C;  1HUN A;  3PUZ A;  2A69 C;  3QB3 A;  2EY5 A;  4KJN A;  1PXU A;  3MZ5 A;  4FXD A;  2HQE A;  1CHP D;  5M5Y B;  2IPK D;  4KD3 A;  3SVM A;  1SYB A;  1EFI D;  2B2V C;  3DEP A;  2O4X A;  3KLS X;  1LTB D;  2E2H B;  1YNN C;  3DHQ A;  2IX1 A;  2O5J C;  4NMZ A;  1NR4 A;  1NR2 A;  1BBX C;  4KKU A;  1STY A;  2E2D C;  1JQY D;  3MAQ A;  4XIG S;  5KGU A;  1Y1W B;  3SHL A;  1WTR A;  5ELB A;  1Z47 A;  1LTA D;  4J8Q A;  1BF4 A;  5CYU A;  2F0O A;  1G6Z A;  4CJ1 B;  4JBW A;  1AW7 A;  4BS9 A;  4L6T B;  2ICE C;  1R4P B;  1CT1 D;  1ENC A;  2B8F A;  2R6G A;  3QOJ A;  4A3J B;  3DXJ C;  5FK9 C;  4FF2 A;  1QIL A;  3HGB A;  1HA5 A;  2L12 A;  1WD0 A;  4ILW A;  2K5Q A;  1KNE A;  1EOT A;  4BY7 B;  3PUV A;  4C1N I;  1D2B A;  1NSN S;  2PO4 A;  5COY A;  1CM9 A;  3MEH A;  1EIH A;  3OWF A;  3TP7 A;  4K6D A;  2GA4 B;  2IX0 A;  3DM1 A;  1XXG A;  2EJF C;  2F0P A;  1A3V A;  5M3F B;  1PZK D;  4C3J G;  4XYQ A;  3FPP A;  5HGT A;  2F0M A;  5F2D A;  1F2Z A;  1IHZ A;  1KAA A;  4X3T A;  5I2Y A;  2SOB A;  1TWF B;  1H9J A;  3MHB A;  5I6Y A;  2F0L A;  5COR A;  4CKC A;  3SXH A;  4OL7 A;  3Q22 A;  3D4D A;  1O78 A;  2EXZ A;  2L0C A;  2AWO A;  5FO7 B;  1HPC A;  1OXU A;  2QCP X;  1CFM A;  3A7L A;  3GTP B;  4A3E B;  4B9W A;  1EY9 A;  1HFG A;  3IL8 A;  4DF7 A;  4G7Z C;  3J7A V;  3PIO 3;  4DN4 M;  2B2W A;  1F2Y A;  2K01 A;  2B2U A;  2MUY A;  4A3B B;  3NSW A;  2VUM B;  3J7Y W;  1CHQ D;  4WJW A;  3RZD B;  1DYQ A;  3HOV B;  3P1H A;  4CBV A;  1SNQ A;  3K5L A;  4BY1 B;  1MSH A;  3I73 A;  2JEB I;  4I7Z C;  5DNF A;  3VR6 A;  3C2P A;  1F77 A;  1I4G A;  1OXV A;  2I46 A;  5CR3 A;  1JE4 A;  3MA2 B;  1E0B A;  2EZV A;  3I91 A;  2MJ8 A;  3DWP A;  1A3U A;  4RKL A;  1Y8N B;  1ML0 D;  4RKB A;  4RHS A;  2Q8T A;  1TY2 A;  3GV3 A;  1BCP D;  1ENF A;  2CW0 D;  1DM0 B;  1S5C D;  2RDH A;  1LT3 D;  4IFD J;  4KV6 A;  3BYT B;  1CI3 M;  2MPM A;  2NN6 H;  3HRZ C;  4F88 A;  1F9Q A;  3GO5 A;  4U68 A;  3K0Y A;  3HZX A;  5IT9 L;  1R4Q B;  3NP8 A;  4FVM A;  2F0I A;  4OO1 I;  2NVQ B;  5EQ0 A;  1Q3L A;  1DZ1 A;  5C6A A;  1K8O A;  2NN6 G;  5C4X B;  4FXG C;  4PNY A;  5I6W A;  2R93 B;  2K7V A;  4O1N A;  4C3H G;  1LTI D;  1CA5 A;  3ZYY X;  5KIX A;  4FP5 D;  4FO2 A;  4DNT B;  4X3K A;  4IUU A;  1I3Q B;  2AUJ D;  4DU9 A;  3PUX A;  1SYD A;  2IJ0 A;  5EKL A;  2DNE A;  3N6R A;  1JOQ A;  5FKA C;  1B1Z A;  1HQM C;  3DUZ A;  3UI2 A;  5IGF A;  3K5N A;  1PTO H;  4H13 C;  1GUS A;  2IWH A;  1QCB D;  3S1N B;  2NYZ D;  1NCV A;  3OW7 A;  4DAY A;  1EYD A;  4QCL A;  3SE0 A;  1Y1V B;  2F3W A;  5C3X A;  1G8Z D;  2F0S A;  5IGE A;  2SEB D;  4QIW B;  4RHR A;  1B44 D;  2FJ2 A;  2EY6 A;  2NTS A;  1PRT D;  1TS3 A;  1S5D D;  1PLF A;  4J6H A;  3C46 A;  1FGB D;  1U4R A;  4P2C B;  5IT9 E;  4AYB B;  4A3K B;  3OIQ A;  1PTO D;  2XNA C;  2YYZ A;  3G6J B;  5C0X I;  4K5V A;  2YU9 B;  1M8A A;  3M85 A;  3T56 B;  1V1P B;  2D62 A;  1EYC A;  2B63 B;  5DAU A;  1HTL D;  1UUP A;  2PNR C;  4RA8 A;  4DFA A;  2B2Y C;  3M7N A;  2N55 A;  5JPM C;  3T4A C;  5K36 H;  3HEJ A;  1BXT A;  4CKB A;  3QO2 A;  2KEE A;  3CU7 A;  1D6E C;  5BN3 A;  2EYL A;  4OGQ C;  1AN8 A;  1EWC A;  4K5W A;  3AU7 A;  3S16 B;  1STA A;  2J4X A;  4R9W A;  3QIA A;  1I4H A;  4XXE A;  1I50 B;  2WIN B;  1YNJ C;  2EYF A;  4ZAI A;  2A68 C;  1A2T A;  2OT2 A;  5K36 G;  2BOS A;  2PW5 A;  2PW7 A;  1TY0 A;  5CV6 A;  1QWY A;  4BBR B;  1DJR D;  2F0D A;  4FF1 A;  3MWY W;  2NUC A;  3NBH A;  1JIC A;  2LMC B;  1Q12 A;  3HOU B;  4Q0F A;  2F0T A;  4LJZ C;  5ISR A;  4KY7 A;  1FNV A;  1EZ6 A;  5ELF A;  4CGY B;  1JR0 D;  1VCI A;  2XVS A;  5EGT A;  5D3I B;  4TQU S;  1BCP F;  3SK5 A;  3IKJ A;  1JOO A;  3J7A F;  4NW2 A;  1X3P A;  4EVO A;  4A3M B;  5BN5 A;  1O7L A;  2MP1 A;  2E76 C;  3OHX C;  4YIJ A;  2B8G A;  2D5D A;  5JVH 3;  2KOL A;  3URY A;  1A3T A;  3E5S A;  3R2T A;  4K2K A;  4FXK C;  3C1F A;  1WTX A;  2XIW A;  1E2Z A;  1LAC A;  4X3S A;  2HCC A;  5LL6 X;  3GV6 A;  3I72 A;  4KN4 C;  1TWC B;  3N52 A;  2VB2 X;  1B3A A;  1OXT A;  4HCS A;  4ZUJ A;  1OO9 B;  4QMG A;  2PCF B;  3KK7 A;  2RVL A;  3R93 A;  4B9X A;  1TKW B;  2AWN A;  3QG1 A;  4C1N K;  5E4X A;  1SDF A;  5EPJ A;  4N9P A;  4HSV A;  5DM6 3;  2EOT A;  4OO1 H;  1KLU D;  5J1Z A;  1IW7 C;  4K5X A;  1VF5 C;  4CHT B;  2JSO A;  2F03 A;  4ZLT F;  2FFK B;  3S9W A;  1BCP B;  1HRJ A;  3IAY A;  4KHV A;  3G7L A;  1F9R A;  4J1M A;  2K32 A;  4EQP A;  4ABN A;  4XT3 B;  1V8Q A;  1EYA A;  5C3E B;  2D9U A;  4OO1 G;  1PRT F;  4TRD A;  1SE4 A;  2NTT A;  3RMH A;  1EEF D;  2DNC A;  1SYG A;  1KDA A;  4ZKB B;  3DEO A;  1XYI A;  2DY7 A;  1A6X A;  2KVM A;  1SFO B;  5EPK A;  1JWU D;  2FMC A;  1GHK A;  3HS0 C;  3HKZ B;  3R3O A;  3VR3 A;  4IN3 A;  3V2T A;  1TII D;  2E74 C;  4RCN A;  2G9D A;  1ILP A;  2JP1 A;  1GHJ A;  3TME A;  4C3H B;  5C0X H;  5BN4 A;  3S1Q B;  5C4H A;  4OIK A;  2BA1 A;  4PMC A;  3T51 B;  2RKS A;  1GUG A;  5A35 A;  1J9O A;  1EU4 A;  1EQV A;  1HA6 A;  1SYC A;  1SSO A;  4KKT A;  1CQV A;  2WAQ B;  4MHE A;  3A55 A;  5M9O A;  4PQX A;  4ZUI A;  1DCZ A;  3DWA A;  2Z1C A;  4WFN 3;  5C0X G;  2QDB A;  2F4I A;  5CBE E;  1JWS D;  1X3Q A;  5T1G A;  1PFN A;  4N9T A;  4S3S A;  1PZI D;  4L63 B;  4MIU A;  3A56 A;  2HDL A;  1EU3 A;  1U9R A;  2M00 A;  3HOZ B;  3LWE A;  2V4D A;  4H7B A;  1SAP A;  1I6V C;  4HN7 A;  2ID0 A;  1LV9 A;  2NB0 A;  2K5D A;  1ZXT A;  4IUQ A;  3K6O A;  4RH6 A;  1EY0 A;  5D14 A;  5C5M A;  5JOB A;  4IFD I;  1D1K A;  2K6A A;  1GJX A;  2C5C A;  5CBA E;  2VXW A;  3BYY B;  3X3M A;  3OOC A;  2R92 B;  1JCK B;  5E4W C;  4CJ0 B;  3JAM E;  3J81 E;  2IT1 A;  3NTI A;  4O42 A;  1QJO A;  1GUO A;  2A6E D;  3RZO B;  2MGS A;  3HP3 A;  2C9O A;  3NBI A;  4BA1 I;  3HOW B;  2SDF A;  1LTS D;  3MFY A;  5IGC A;  1B50 A;  4V0B A;  1SYE A;  1SJH D;  5JAV A;  2JE6 I;  2EY1 A;  4H0L C;  3AMU A;  1S5B D;  4K8I A;  1MBY A;  1RD9 D;  3S2H B;  1IYU A;  5ELE A;  3EJI A;  1OXX K;  1HTP A;  1EY7 A;  3T13 A;  4XQJ A;  1V43 A;  3PO2 B;  1LT4 D;  1RF2 D;  1MD2 D;  1H9K A;  2F3V A;  1RHP A;  1AZP A;  2PQE A;  1CQF A;  5HUR A;  5LHY 1;  3ERQ A;  2KHS A;  2Q8R E;  3SR1 A;  1MGS A;  2F0J A;  2WII B;  1EY4 A;  2WV6 D;  2LY7 A;  3C1E A;  2OEO A;  5EKK A;  4U67 3;  3VYR A;  4ZK9 B;  1Q1B A;  1Q1E A;  3PUY A;  5CV8 A;  1JOK A;  2RBM A;  3A8K E;  4IUP A;  1LT6 D;  1Z6H A;  3OIP A;  2F0V A;  3VA5 A;  4K6L A;  2Q8I B;  2IW3 A;  3LWU A;  3EQL C;  3KBG A;  1SMY C;  3KF8 A;  1BCP C;  1RTO A;  2CW0 C;  4IAL A;  1DON A;  2JXM B;  2A73 B;  5C4Z A;  4V19 0;  3MTS A;  4LMQ D;  1CZW A;  4KJO A;  2EJM A;  3T53 B;  2ZXR A;  4IQZ A;  3VR4 A;  3LX0 A;  5I2X A;  4RGT A;  3I8Z A;  3OMG A;  3W2D A;  5KYL A;  3Q0A A;  4ZKC B;  1E2W A;  3E0J A;  4ID6 A;  1BR9 A;  1H9S A;  1II3 A;  3LNN A;  1EEI D;  4XTC S;  1EY5 A;  1AEX A;  1W6K A;  1MI2 A;  1F9S A;  2QKI C;  2O5I C;  3HOY B;  4BBS B;  5CV4 A;  5IIF A;  2Z4I A;  1U4P A;  5JEA J;  1B9M A;  4KHZ A;  1WCM B;  2L55 A;  1JB3 A;  5I9O A;  1HUM A;  3TP5 A;  1EIG A;  1FR3 A;  2F0K A;  1G2T A;  1ZEQ X;  1I6H B;  3D4W A;  1I4P A;  4C3I B;  2XN9 C;  2B2T C;  3K7A B;  2AQ1 B;  2BE5 D;  4E6I A;  1SND A;  5E3F A;  1U4M A;  5KND A;  2RA4 A;  3FRP B;  4LAA A;  4QB4 A;  4KN7 C;  2VNU D;  5D65 A;  1PRT C;  3I90 A;  1SJE D;  1XTC D;  3E6Z X;  3S14 B;  1F9P A;  3SEB A;  1Q90 A;  4KD4 A;  5E1F A;  1STG A;  2M2L A;  3S1M B;  3IFD A;  1VMP A;  5CGK A;  2WB1 B;  1UEA B;  3D3R A;  4PMB A;  4Y7N B;  4I65 A;  4NDX A;  3GTQ B;  4DK0 A;  3GTL B;  3A8J E;  1TS2 A;  3RD4 A;  3PMF A;  1ENA A;  3CRK C;  4FF4 A;  2HUG A;  4A3I B;  5KNC A;  4IFD H;  2I07 B;  4RGN A;  2A6H D;  3QWN A;  2K1B A;  1LAB A;  3VR2 A;  4DNR B;  2DN8 A;  4HMI A;  2QF7 A;  4K2L A;  3TSS A;  4C2M B;  1GOZ A;  3BDC A;  2EDG A;  4LK1 C;  1G91 A;  1Q8I A;  4HAE A;  1I4Q A;  1FD7 D;  1BNZ A;  1QG7 A;  2OXP A;  5IGD A;  5FO9 B;  1T5X D;  4RFB A;  3X3N A;  3BS1 A;  3BVG A;  4IFD G;  1VDZ A;  4HSP A;  5M3M B;  4QUF A;  1IKL A;  4B08 A;  2L11 A;  2JYO A;  1EY6 A;  1XWE A;  5KNB A;  4KY6 A;  1QE6 A;  3P7J A;  2EYP A;  4C3J B;  1BUV T;  1V1O A;  1BOS A;  4L8J A;  1F2L A;  3S1R B;  5C4J B;  1SXT A;  1S4Z A;  2H4O A;  1X32 A;  4A3F B;  1QB5 D;  2BCO A;  3SDZ A;  2E2I B;  2JA8 B;  3PV0 A;  1DOL A;  3D6C A;  4DK1 A;  3OSO A;  3ND9 A;  5FO8 B;  2AQ3 B;  1ET9 A;  5JJZ A;  3D6W A;  4H44 C;  4KK7 A;  3H6M A;  2KEC A;  1VF7 A;  1SE2 A;  4TKO B;  1ROD A;  2XRQ D;  1TU2 B;  2ENB A;  4XT1 B;  1LT5 D;  3S17 B;  1LO5 D;  3KLR A;  3VR5 A;  1HFN A;  3HG9 A;  1NAP A;  2XRS D;  3J80 E;  5JEA G;  1STH A;  4CKE A;  4M1U B;  2G9H D;  1UAP A;  2JEA I;  3U9S A;  1FYC A;  2CQA A;  1WTP A;  4A3G B;  2TMP A;  2B2W C;  2O2L D;  2B2U C;  1EZ8 A;  1SNO A;  5TSS A;  1IW7 D;  5ELC A;  2X6G A;  3A54 A;  4R8I A;  2E75 C;  5I4D A;  2QEJ C;  1TT2 A;  2L5T A;  5CC4 A;  1BDO A;  4XQN A;  2L1B A;  2F0N A;  3K58 A;  1HHV A;  3RLF A;  1TWA B;  3NQI A;  3F2U A;  1ZYR D;  3PO3 B;  2A69 D;  4EQN A;  2FMM A;  4KMU C;  1K83 B;  1OXS C;  3FPU B;  5CMD A;  1WTQ A;  5IOD A;  3I4N B;  1STN A;  3HOX B;  1EL0 A;  1SNC A;  3BG3 A;  2A74 C;  2EJG C;  4KTA A;  1YNN D;  5EBD A;  3A7A B;  2WKD A;  2NWG A;  2IX3 A;  5FOB B;  1PTO F;  3BDL A;  4FF3 A;  5A2Q L;  3MC0 B;  2F0U A;  4IUR A;  1ESR A;  3AB9 A;  2NVX B;  2A5H A;  3EVQ A;  3SK8 A;  2B2Y A;  5J22 A;  1GUT A;  3I4L A;  4QUC A;  2KED A;  2ZXP A;  2ZXO A;  4NP5 A;  1TWG B;  2R3Z A;  3TZD A;  1GUW A;  1KDC A;  2KCC A;  1CZG A;  4WRD A;  4G7H C;  1J8I A;  3JAM L;  3J81 L;  3L9A X;  2L9H A;  2EYH A;  2H1E A;  4CJ2 C;  4RCO A;  1C8C A;  2TSS A;  3MVV A;  3TDQ A;  2VB3 X;  1SNM A;  1D5M C;  2PPB C;  2PYK A;  3K59 A;  5DEH A;  3H0G B;  2B39 A;  4KKS A;  3CKI B;  3D4R A;  4HTH A;  1DOM A;  1WTW A;  1KDB A;  1TR5 A;  3BVM A;  1SE3 A;  3MFG A;  1PDQ A;  5CV5 A;  4IUN A;  1WVL A;  1CTM A;  3O13 A;  1PRT B;  3TZU A;  2EYJ A;  3M4O B;  1DD2 A;  1L0X B;  4HMJ A;  3D8G A;  2MHV A;  3FEW X;  1SYF A;  2JA7 B;  4JK1 C;  3VYS A;  1PTO B;  5I9P A;  4DA2 A;  2M9V A;  2FHT A;  5A2Q E;  4KI0 A;  1G2S A;  3OMC A;  4Q5V A;  1Y8P B;  3I4M B;  1EQT A;  4IUV A;  5EJW A;  5C44 B;  3NWS A;  4G4K A;  1PFB A;  4Z9C B;  3BZD B;  2FIN B;  2NVY B;  3L7Z C;  4C56 C;  5M5W B;  5IGB A;  2X6L A;  4BA2 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...