1RFSA

Rieske soluble fragment from spinach
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
TIAKDALGNDVIAAEWLKTHAPGDRTLTQGLKGDPTYLVVESDKTLATFGINAVCTHLGCVVPFNAAENKFICPCHGSQYNNQGRVVRGPAPLSLALAHCDVDDGKVVFVPWTETDFRTGEAPWWSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biological identity and diversity in photosynthesis and respiration: structure of the lumen-side domain of the chloroplast Rieske protein.
pubmed doi rcsb
molecule tags Iron-sulfur protein
molecule keywords RIESKE PROTEIN
total genus 25
structure length 127
sequence length 127
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1rfsA00
1G8KB 2QJYC 2YVJB 1SQPE 1O7HA 5KKZC 3VCAA 1NU1E 1EZVE 4H0LD 2HMNA 4HM0A 2QJPC 4HM7A 3FOUA 1O7GA 2Q3WA 3C0DA 1O7PA 2E76D 3DQYA 4QDDA 5KLIC 3GTSA 3EN1A 1ULJA 2IBZE 4H13D 5AEUA 3AZCA 3H1IE 4HM6A 2YFLA 1VM9A 2JZAA 3GZXA 4HM2A 1UUWA 5BOKA 3GKEA 2FYNC 2D2CD 3N0QA 4HKVA 2A06E 1SQBE 2JO6A 4EMJB 4NBAD 4AAYB 4QURA 4PD4E 2B1XA 2GBWA 2DE5D 5KLVE 3GB4A 4QUQA 2YFJA 1VCKA 3H1KE 4H44D 3VCPA 4U3FE 1P84E 1UUVA 2YFIA 2XSHA 4PV1D 3L70E 1JM1A 4NBCD 5CXMA 1O7WA 3L71E 4QDCA 2I7FA 2XR8A 2HMLA 3H1HE 4HM4A 3VMHD 3GL0A 4NBHD 2E75D 1RIEA 2E74D 3H1LE 1FQTA 3L72E 4NBBD 4HJLA 4NBDD 4QDFA 1L0NE 1SJGA 4NBED 3H1JE 2NVFA 1ZRTE 2YIUC 3L73E 1WQLA 3L74E 3VMID 3TGUE 1BCCE 1BE3E 2BMOA 1PP9E 3EQQA 1SQQE 2HMOA 5HL4A 4NB8D 4HM1A 2BMRA 2ZYLA 3GOBA 1O7NA 2NUMA 1G8JB 2NWFA 1NTME 3BCCE 2QPZA 3D89A 4NBGD 2E4PA 1Q90C 2NVEA 2ZT9D 4NBFD 1SQVE 2XSOA 2QJKC 1SQXE 1PPJE 2XRXA 4P1BH 1O7MA 3CWBE 3GTEA 1EG9A 2DE6D 2HMKA 1KB9E 2BCCE 4QCKA 4HM8A 1KYOE 4P1CH 2BMQA 4QUPA 2DE7D 3CX5E 3GCEA 4OGQD 1NTKE 1NYKA 2NVGA 2B24A 1NTZE 1NDOA 4AIVA 4NB9D 1RFSA 2HMJA 2NUKA 1VF5D 3GZYA 3L75E 4HM5A 3VMGD 4QDFB 1L0LE 2CKFA 2HMMA 4HM3A 2GBXA 3CXHE 3GL2A 2E4QA 1ULIA 5AEWA 2FYUE
chains in the Genus database with same CATH superfamily
1G8KB 2QJYC 2YVJB 1SQPE 1O7HA 5KKZC 3VCAA 1NU1E 1EZVE 4H0LD 2HMNA 4HM0A 2QJPC 4HM7A 3FOUA 1O7GA 2Q3WA 3C0DA 1O7PA 2E76D 3DQYA 4QDDA 5KLIC 3GTSA 3EN1A 1ULJA 2IBZE 4H13D 5AEUA 3AZCA 3H1IE 4HM6A 2YFLA 1VM9A 2JZAA 3GZXA 4HM2A 1UUWA 5BOKA 3GKEA 2FYNC 2D2CD 3N0QA 4HKVA 2A06E 1SQBE 2JO6A 4EMJB 4NBAD 4AAYB 4QURA 4PD4E 2B1XA 2GBWA 2DE5D 5KLVE 3GB4A 4QUQA 2YFJA 1VCKA 3H1KE 4H44D 3VCPA 4U3FE 1P84E 1UUVA 2YFIA 2XSHA 4PV1D 3L70E 1JM1A 4NBCD 5CXMA 1O7WA 3L71E 4QDCA 2I7FA 2XR8A 2HMLA 3H1HE 4HM4A 3VMHD 3GL0A 4NBHD 2E75D 1RIEA 2E74D 3H1LE 1FQTA 3L72E 4NBBD 4HJLA 4NBDD 4QDFA 1L0NE 1SJGA 4NBED 3H1JE 2NVFA 1ZRTE 2YIUC 3L73E 1WQLA 3L74E 3VMID 3TGUE 1BCCE 1BE3E 2BMOA 1PP9E 3EQQA 1SQQE 2HMOA 5HL4A 4NB8D 4HM1A 2BMRA 2ZYLA 3GOBA 1O7NA 2NUMA 1G8JB 2NWFA 1NTME 3BCCE 2QPZA 3D89A 4NBGD 2E4PA 1Q90C 2NVEA 2ZT9D 4NBFD 1SQVE 2XSOA 2QJKC 1SQXE 1PPJE 2XRXA 4P1BH 1O7MA 3CWBE 3GTEA 1EG9A 2DE6D 2HMKA 1KB9E 2BCCE 4QCKA 4HM8A 1KYOE 4P1CH 2BMQA 4QUPA 2DE7D 3CX5E 3GCEA 4OGQD 1NTKE 1NYKA 2NVGA 2B24A 1NTZE 1NDOA 4AIVA 4NB9D 1RFSA 2HMJA 2NUKA 1VF5D 3GZYA 3L75E 4HM5A 3VMGD 4QDFB 1L0LE 2CKFA 2HMMA 4HM3A 2GBXA 3CXHE 3GL2A 2E4QA 1ULIA 5AEWA 2FYUE
chains in the Genus database with same CATH topology
1G8KB 2QJYC 2YVJB 1SQPE 1O7HA 5KKZC 3VCAA 1NU1E 1EZVE 4H0LD 2HMNA 4HM0A 2QJPC 4HM7A 3FOUA 1O7GA 2Q3WA 3C0DA 1O7PA 2E76D 3DQYA 4QDDA 5KLIC 3GTSA 3EN1A 1ULJA 2IBZE 4H13D 5AEUA 3AZCA 3H1IE 4HM6A 2YFLA 1VM9A 2JZAA 3GZXA 4HM2A 1UUWA 5BOKA 3GKEA 2FYNC 2D2CD 3N0QA 4HKVA 2A06E 1SQBE 2JO6A 4EMJB 4NBAD 4AAYB 4QURA 4PD4E 2B1XA 2GBWA 2DE5D 5KLVE 3GB4A 4QUQA 2YFJA 1VCKA 3H1KE 4H44D 3VCPA 4U3FE 1P84E 1UUVA 2YFIA 2XSHA 4PV1D 3L70E 1JM1A 4NBCD 5CXMA 1O7WA 3L71E 4QDCA 2I7FA 2XR8A 2HMLA 3H1HE 4HM4A 3VMHD 3GL0A 4NBHD 2E75D 1RIEA 2E74D 3H1LE 1FQTA 3L72E 4NBBD 4HJLA 4NBDD 4QDFA 1L0NE 1SJGA 4NBED 3H1JE 2NVFA 1ZRTE 2YIUC 3L73E 1WQLA 3L74E 3VMID 3TGUE 1BCCE 1BE3E 2BMOA 1PP9E 3EQQA 1SQQE 2HMOA 5HL4A 4NB8D 4HM1A 2BMRA 2ZYLA 3GOBA 1O7NA 2NUMA 1G8JB 2NWFA 1NTME 3BCCE 2QPZA 3D89A 4NBGD 2E4PA 1Q90C 2NVEA 2ZT9D 4NBFD 1SQVE 2XSOA 2QJKC 1SQXE 1PPJE 2XRXA 4P1BH 1O7MA 3CWBE 3GTEA 1EG9A 2DE6D 2HMKA 1KB9E 2BCCE 4QCKA 4HM8A 1KYOE 4P1CH 2BMQA 4QUPA 2DE7D 3CX5E 3GCEA 4OGQD 1NTKE 1NYKA 2NVGA 2B24A 1NTZE 1NDOA 4AIVA 4NB9D 1RFSA 2HMJA 2NUKA 1VF5D 3GZYA 3L75E 4HM5A 3VMGD 4QDFB 1L0LE 2CKFA 2HMMA 4HM3A 2GBXA 3CXHE 3GL2A 2E4QA 1ULIA 5AEWA 2FYUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G8K B;  2QJY C;  2YVJ B;  1SQP E;  1O7H A;  5KKZ C;  3VCA A;  1NU1 E;  1EZV E;  4H0L D;  2HMN A;  4HM0 A;  2QJP C;  4HM7 A;  3FOU A;  1O7G A;  2Q3W A;  3C0D A;  1O7P A;  2E76 D;  3DQY A;  4QDD A;  5KLI C;  3GTS A;  3EN1 A;  1ULJ A;  2IBZ E;  4H13 D;  5AEU A;  3AZC A;  3H1I E;  4HM6 A;  2YFL A;  1VM9 A;  2JZA A;  3GZX A;  4HM2 A;  1UUW A;  5BOK A;  3GKE A;  2FYN C;  2D2C D;  3N0Q A;  4HKV A;  2A06 E;  1SQB E;  2JO6 A;  4EMJ B;  4NBA D;  4AAY B;  4QUR A;  4PD4 E;  2B1X A;  2GBW A;  2DE5 D;  5KLV E;  3GB4 A;  4QUQ A;  2YFJ A;  1VCK A;  3H1K E;  4H44 D;  3VCP A;  4U3F E;  1P84 E;  1UUV A;  2YFI A;  2XSH A;  4PV1 D;  3L70 E;  1JM1 A;  4NBC D;  5CXM A;  1O7W A;  3L71 E;  4QDC A;  2I7F A;  2XR8 A;  2HML A;  3H1H E;  4HM4 A;  3VMH D;  3GL0 A;  4NBH D;  2E75 D;  1RIE A;  2E74 D;  3H1L E;  1FQT A;  3L72 E;  4NBB D;  4HJL A;  4NBD D;  4QDF A;  1L0N E;  1SJG A;  4NBE D;  3H1J E;  2NVF A;  1ZRT E;  2YIU C;  3L73 E;  1WQL A;  3L74 E;  3VMI D;  3TGU E;  1BCC E;  1BE3 E;  2BMO A;  1PP9 E;  3EQQ A;  1SQQ E;  2HMO A;  5HL4 A;  4NB8 D;  4HM1 A;  2BMR A;  2ZYL A;  3GOB A;  1O7N A;  2NUM A;  1G8J B;  2NWF A;  1NTM E;  3BCC E;  2QPZ A;  3D89 A;  4NBG D;  2E4P A;  1Q90 C;  2NVE A;  2ZT9 D;  4NBF D;  1SQV E;  2XSO A;  2QJK C;  1SQX E;  1PPJ E;  2XRX A;  4P1B H;  1O7M A;  3CWB E;  3GTE A;  1EG9 A;  2DE6 D;  2HMK A;  1KB9 E;  2BCC E;  4QCK A;  4HM8 A;  1KYO E;  4P1C H;  2BMQ A;  4QUP A;  2DE7 D;  3CX5 E;  3GCE A;  4OGQ D;  1NTK E;  1NYK A;  2NVG A;  2B24 A;  1NTZ E;  1NDO A;  4AIV A;  4NB9 D;  1RFS A;  2HMJ A;  2NUK A;  1VF5 D;  3GZY A;  3L75 E;  4HM5 A;  3VMG D;  4QDF B;  1L0L E;  2CKF A;  2HMM A;  4HM3 A;  2GBX A;  3CXH E;  3GL2 A;  2E4Q A;  1ULI A;  5AEW A;  2FYU E; 
#chains in the Genus database with same CATH topology
 1G8K B;  2QJY C;  2YVJ B;  1SQP E;  1O7H A;  5KKZ C;  3VCA A;  1NU1 E;  1EZV E;  4H0L D;  2HMN A;  4HM0 A;  2QJP C;  4HM7 A;  3FOU A;  1O7G A;  2Q3W A;  3C0D A;  1O7P A;  2E76 D;  3DQY A;  4QDD A;  5KLI C;  3GTS A;  3EN1 A;  1ULJ A;  2IBZ E;  4H13 D;  5AEU A;  3AZC A;  3H1I E;  4HM6 A;  2YFL A;  1VM9 A;  2JZA A;  3GZX A;  4HM2 A;  1UUW A;  5BOK A;  3GKE A;  2FYN C;  2D2C D;  3N0Q A;  4HKV A;  2A06 E;  1SQB E;  2JO6 A;  4EMJ B;  4NBA D;  4AAY B;  4QUR A;  4PD4 E;  2B1X A;  2GBW A;  2DE5 D;  5KLV E;  3GB4 A;  4QUQ A;  2YFJ A;  1VCK A;  3H1K E;  4H44 D;  3VCP A;  4U3F E;  1P84 E;  1UUV A;  2YFI A;  2XSH A;  4PV1 D;  3L70 E;  1JM1 A;  4NBC D;  5CXM A;  1O7W A;  3L71 E;  4QDC A;  2I7F A;  2XR8 A;  2HML A;  3H1H E;  4HM4 A;  3VMH D;  3GL0 A;  4NBH D;  2E75 D;  1RIE A;  2E74 D;  3H1L E;  1FQT A;  3L72 E;  4NBB D;  4HJL A;  4NBD D;  4QDF A;  1L0N E;  1SJG A;  4NBE D;  3H1J E;  2NVF A;  1ZRT E;  2YIU C;  3L73 E;  1WQL A;  3L74 E;  3VMI D;  3TGU E;  1BCC E;  1BE3 E;  2BMO A;  1PP9 E;  3EQQ A;  1SQQ E;  2HMO A;  5HL4 A;  4NB8 D;  4HM1 A;  2BMR A;  2ZYL A;  3GOB A;  1O7N A;  2NUM A;  1G8J B;  2NWF A;  1NTM E;  3BCC E;  2QPZ A;  3D89 A;  4NBG D;  2E4P A;  1Q90 C;  2NVE A;  2ZT9 D;  4NBF D;  1SQV E;  2XSO A;  2QJK C;  1SQX E;  1PPJ E;  2XRX A;  4P1B H;  1O7M A;  3CWB E;  3GTE A;  1EG9 A;  2DE6 D;  2HMK A;  1KB9 E;  2BCC E;  4QCK A;  4HM8 A;  1KYO E;  4P1C H;  2BMQ A;  4QUP A;  2DE7 D;  3CX5 E;  3GCE A;  4OGQ D;  1NTK E;  1NYK A;  2NVG A;  2B24 A;  1NTZ E;  1NDO A;  4AIV A;  4NB9 D;  1RFS A;  2HMJ A;  2NUK A;  1VF5 D;  3GZY A;  3L75 E;  4HM5 A;  3VMG D;  4QDF B;  1L0L E;  2CKF A;  2HMM A;  4HM3 A;  2GBX A;  3CXH E;  3GL2 A;  2E4Q A;  1ULI A;  5AEW A;  2FYU E; 
#chains in the Genus database with same CATH homology
 1G8K B;  2QJY C;  2YVJ B;  1SQP E;  1O7H A;  5KKZ C;  3VCA A;  1NU1 E;  1EZV E;  4H0L D;  2HMN A;  4HM0 A;  2QJP C;  4HM7 A;  3FOU A;  1O7G A;  2Q3W A;  3C0D A;  1O7P A;  2E76 D;  3DQY A;  4QDD A;  5KLI C;  3GTS A;  3EN1 A;  1ULJ A;  2IBZ E;  4H13 D;  5AEU A;  3AZC A;  3H1I E;  4HM6 A;  2YFL A;  1VM9 A;  2JZA A;  3GZX A;  4HM2 A;  1UUW A;  5BOK A;  3GKE A;  2FYN C;  2D2C D;  3N0Q A;  4HKV A;  2A06 E;  1SQB E;  2JO6 A;  4EMJ B;  4NBA D;  4AAY B;  4QUR A;  4PD4 E;  2B1X A;  2GBW A;  2DE5 D;  5KLV E;  3GB4 A;  4QUQ A;  2YFJ A;  1VCK A;  3H1K E;  4H44 D;  3VCP A;  4U3F E;  1P84 E;  1UUV A;  2YFI A;  2XSH A;  4PV1 D;  3L70 E;  1JM1 A;  4NBC D;  5CXM A;  1O7W A;  3L71 E;  4QDC A;  2I7F A;  2XR8 A;  2HML A;  3H1H E;  4HM4 A;  3VMH D;  3GL0 A;  4NBH D;  2E75 D;  1RIE A;  2E74 D;  3H1L E;  1FQT A;  3L72 E;  4NBB D;  4HJL A;  4NBD D;  4QDF A;  1L0N E;  1SJG A;  4NBE D;  3H1J E;  2NVF A;  1ZRT E;  2YIU C;  3L73 E;  1WQL A;  3L74 E;  3VMI D;  3TGU E;  1BCC E;  1BE3 E;  2BMO A;  1PP9 E;  3EQQ A;  1SQQ E;  2HMO A;  5HL4 A;  4NB8 D;  4HM1 A;  2BMR A;  2ZYL A;  3GOB A;  1O7N A;  2NUM A;  1G8J B;  2NWF A;  1NTM E;  3BCC E;  2QPZ A;  3D89 A;  4NBG D;  2E4P A;  1Q90 C;  2NVE A;  2ZT9 D;  4NBF D;  1SQV E;  2XSO A;  2QJK C;  1SQX E;  1PPJ E;  2XRX A;  4P1B H;  1O7M A;  3CWB E;  3GTE A;  1EG9 A;  2DE6 D;  2HMK A;  1KB9 E;  2BCC E;  4QCK A;  4HM8 A;  1KYO E;  4P1C H;  2BMQ A;  4QUP A;  2DE7 D;  3CX5 E;  3GCE A;  4OGQ D;  1NTK E;  1NYK A;  2NVG A;  2B24 A;  1NTZ E;  1NDO A;  4AIV A;  4NB9 D;  1RFS A;  2HMJ A;  2NUK A;  1VF5 D;  3GZY A;  3L75 E;  4HM5 A;  3VMG D;  4QDF B;  1L0L E;  2CKF A;  2HMM A;  4HM3 A;  2GBX A;  3CXH E;  3GL2 A;  2E4Q A;  1ULI A;  5AEW A;  2FYU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...