1RFSA

Rieske soluble fragment from spinach
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
b'TIAKDALGNDVIAAEWLKTHAPGDRTLTQGLKGDPTYLVVESDKTLATFGINAVCTHLGCVVPFNAAENKFICPCHGSQYNNQGRVVRGPAPLSLALAHCDVDDGKVVFVPWTETDFRTGEAPWWSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIESKE PROTEIN
publication title Biological identity and diversity in photosynthesis and respiration: structure of the lumen-side domain of the chloroplast Rieske protein.
pubmed doi rcsb
molecule tags Iron-sulfur protein
total genus 25
structure length 127
sequence length 127
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1rfsA00
1PP9E 1Q90C 4HM7A 3GL2A 1VCKA 3EQQA 4NBAD 2IBZE 3EN1A 2FYNC 3N0QA 4PV1D 2D2CD 3GCEA 4HM8A 2HMOA 5CXMA 1BE3E 1NDOA 3L74E 2YFJA 2NWFA 3L73E 1BCCE 1SQQE 2NVEA 5BOKA 1NYKA 3D89A 5AEUA 1PPJE 1ZRTE 1UUWA 1O7HA 2NUMA 2NVGA 4QUPA 5KLVE 3GKEA 5HL4A 2QJPC 2E75D 3L70E 1EZVE 3GTSA 2E4QA 4HJLA 3GL0A 1KYOE 2YFLA 2ZYLA 1O7WA 3FOUA 2BMQA 2CKFA 1G8KB 3L72E 4HKVA 4HM0A 4NBGD 3GZXA 1RIEA 1O7NA 2XSOA 3L75E 2GBWA 4H44D 2Q3WA 1NTKE 3GB4A 4QDFA 2A06E 4NBFD 4NBHD 4QDDA 3H1LE 2XR8A 2YFIA 1UUVA 2JO6A 3VMID 1EG9A 2QJKC 2XSHA 4PD4E 5KLIC 4HM3A 1L0LE 2JZAA 4HM5A 2ZT9D 2B24A 3GZYA 4HM4A 2B1XA 2DE5D 3H1KE 4QURA 1NU1E 2GBXA 1O7PA 2E76D 4HM6A 1VM9A 1P84E 3VCAA 1WQLA 2YVJB 1L0NE 4H13D 5KKZC 1VF5D 2YIUC 2NVFA 4NBDD 1NTME 4HM1A 2HMJA 3VCPA 2HMLA 2HMMA 3DQYA 4OGQD 2HMNA 4QDCA 1SQXE 1RFSA 4NBBD 2DE7D 2E4PA 4NB8D 1NTZE 1SQBE 3CX5E 4HM2A 5AEWA 1O7MA 1O7GA 2BMOA 3TGUE 4P1CH 4QDFB 4NBCD 3VMGD 4AIVA 1SQPE 3H1IE 4H0LD 2QPZA 4AAYB 4QUQA 2E74D 1ULJA 3L71E 1SQVE 2QJYC 1ULIA 2FYUE 2BCCE 4U3FE 3H1HE 3H1JE 3C0DA 4P1BH 1KB9E 3BCCE 2NUKA 3VMHD 2HMKA 3GTEA 2I7FA 4QCKA 1JM1A 2BMRA 4EMJB 2XRXA 3AZCA 3CWBE 4NB9D 1FQTA 2DE6D 3GOBA 4NBED 1SJGA 3CXHE 1G8JB
chains in the Genus database with same CATH superfamily
1PP9E 1Q90C 4HM7A 3GL2A 1VCKA 3EQQA 4NBAD 2IBZE 3EN1A 2FYNC 3N0QA 4PV1D 2D2CD 3GCEA 4HM8A 2HMOA 5CXMA 1BE3E 1NDOA 3L74E 2YFJA 2NWFA 3L73E 1BCCE 1SQQE 2NVEA 5BOKA 1NYKA 3D89A 5AEUA 1PPJE 1ZRTE 1UUWA 1O7HA 2NUMA 2NVGA 4QUPA 5KLVE 3GKEA 5HL4A 2QJPC 2E75D 3L70E 1EZVE 3GTSA 2E4QA 4HJLA 3GL0A 1KYOE 2YFLA 2ZYLA 1O7WA 3FOUA 2BMQA 2CKFA 1G8KB 3L72E 4HKVA 4HM0A 4NBGD 3GZXA 1RIEA 1O7NA 2XSOA 3L75E 2GBWA 4H44D 2Q3WA 1NTKE 3GB4A 4QDFA 2A06E 4NBFD 4NBHD 4QDDA 3H1LE 2XR8A 2YFIA 1UUVA 2JO6A 3VMID 1EG9A 2QJKC 2XSHA 4PD4E 5KLIC 4HM3A 1L0LE 2JZAA 4HM5A 2ZT9D 2B24A 3GZYA 4HM4A 2B1XA 2DE5D 3H1KE 4QURA 1NU1E 2GBXA 1O7PA 2E76D 4HM6A 1VM9A 1P84E 3VCAA 1WQLA 2YVJB 1L0NE 4H13D 5KKZC 1VF5D 2YIUC 2NVFA 4NBDD 1NTME 4HM1A 2HMJA 3VCPA 2HMLA 2HMMA 3DQYA 4OGQD 2HMNA 4QDCA 1SQXE 1RFSA 4NBBD 2DE7D 2E4PA 4NB8D 1NTZE 1SQBE 3CX5E 4HM2A 5AEWA 1O7MA 1O7GA 2BMOA 3TGUE 4P1CH 4QDFB 4NBCD 3VMGD 4AIVA 1SQPE 3H1IE 4H0LD 2QPZA 4AAYB 4QUQA 2E74D 1ULJA 3L71E 1SQVE 2QJYC 1ULIA 2FYUE 2BCCE 4U3FE 3H1HE 3H1JE 3C0DA 4P1BH 1KB9E 3BCCE 2NUKA 3VMHD 2HMKA 3GTEA 2I7FA 4QCKA 1JM1A 2BMRA 4EMJB 2XRXA 3AZCA 3CWBE 4NB9D 1FQTA 2DE6D 3GOBA 4NBED 1SJGA 3CXHE 1G8JB
chains in the Genus database with same CATH topology
1PP9E 1Q90C 4HM7A 3GL2A 1VCKA 3EQQA 4NBAD 2IBZE 3EN1A 2FYNC 3N0QA 4PV1D 2D2CD 3GCEA 4HM8A 2HMOA 5CXMA 1BE3E 1NDOA 3L74E 2YFJA 2NWFA 3L73E 1BCCE 1SQQE 2NVEA 5BOKA 1NYKA 3D89A 5AEUA 1PPJE 1ZRTE 1UUWA 1O7HA 2NUMA 2NVGA 4QUPA 5KLVE 3GKEA 5HL4A 2QJPC 2E75D 3L70E 1EZVE 3GTSA 2E4QA 4HJLA 3GL0A 1KYOE 2YFLA 2ZYLA 1O7WA 3FOUA 2BMQA 2CKFA 1G8KB 3L72E 4HKVA 4HM0A 4NBGD 3GZXA 1RIEA 1O7NA 2XSOA 3L75E 2GBWA 4H44D 2Q3WA 1NTKE 3GB4A 4QDFA 2A06E 4NBFD 4NBHD 4QDDA 3H1LE 2XR8A 2YFIA 1UUVA 2JO6A 3VMID 1EG9A 2QJKC 2XSHA 4PD4E 5KLIC 4HM3A 1L0LE 2JZAA 4HM5A 2ZT9D 2B24A 3GZYA 4HM4A 2B1XA 2DE5D 3H1KE 4QURA 1NU1E 2GBXA 1O7PA 2E76D 4HM6A 1VM9A 1P84E 3VCAA 1WQLA 2YVJB 1L0NE 4H13D 5KKZC 1VF5D 2YIUC 2NVFA 4NBDD 1NTME 4HM1A 2HMJA 3VCPA 2HMLA 2HMMA 3DQYA 4OGQD 2HMNA 4QDCA 1SQXE 1RFSA 4NBBD 2DE7D 2E4PA 4NB8D 1NTZE 1SQBE 3CX5E 4HM2A 5AEWA 1O7MA 1O7GA 2BMOA 3TGUE 4P1CH 4QDFB 4NBCD 3VMGD 4AIVA 1SQPE 3H1IE 4H0LD 2QPZA 4AAYB 4QUQA 2E74D 1ULJA 3L71E 1SQVE 2QJYC 1ULIA 2FYUE 2BCCE 4U3FE 3H1HE 3H1JE 3C0DA 4P1BH 1KB9E 3BCCE 2NUKA 3VMHD 2HMKA 3GTEA 2I7FA 4QCKA 1JM1A 2BMRA 4EMJB 2XRXA 3AZCA 3CWBE 4NB9D 1FQTA 2DE6D 3GOBA 4NBED 1SJGA 3CXHE 1G8JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 E;  1Q90 C;  4HM7 A;  3GL2 A;  1VCK A;  3EQQ A;  4NBA D;  2IBZ E;  3EN1 A;  2FYN C;  3N0Q A;  4PV1 D;  2D2C D;  3GCE A;  4HM8 A;  2HMO A;  5CXM A;  1BE3 E;  1NDO A;  3L74 E;  2YFJ A;  2NWF A;  3L73 E;  1BCC E;  1SQQ E;  2NVE A;  5BOK A;  1NYK A;  3D89 A;  5AEU A;  1PPJ E;  1ZRT E;  1UUW A;  1O7H A;  2NUM A;  2NVG A;  4QUP A;  5KLV E;  3GKE A;  5HL4 A;  2QJP C;  2E75 D;  3L70 E;  1EZV E;  3GTS A;  2E4Q A;  4HJL A;  3GL0 A;  1KYO E;  2YFL A;  2ZYL A;  1O7W A;  3FOU A;  2BMQ A;  2CKF A;  1G8K B;  3L72 E;  4HKV A;  4HM0 A;  4NBG D;  3GZX A;  1RIE A;  1O7N A;  2XSO A;  3L75 E;  2GBW A;  4H44 D;  2Q3W A;  1NTK E;  3GB4 A;  4QDF A;  2A06 E;  4NBF D;  4NBH D;  4QDD A;  3H1L E;  2XR8 A;  2YFI A;  1UUV A;  2JO6 A;  3VMI D;  1EG9 A;  2QJK C;  2XSH A;  4PD4 E;  5KLI C;  4HM3 A;  1L0L E;  2JZA A;  4HM5 A;  2ZT9 D;  2B24 A;  3GZY A;  4HM4 A;  2B1X A;  2DE5 D;  3H1K E;  4QUR A;  1NU1 E;  2GBX A;  1O7P A;  2E76 D;  4HM6 A;  1VM9 A;  1P84 E;  3VCA A;  1WQL A;  2YVJ B;  1L0N E;  4H13 D;  5KKZ C;  1VF5 D;  2YIU C;  2NVF A;  4NBD D;  1NTM E;  4HM1 A;  2HMJ A;  3VCP A;  2HML A;  2HMM A;  3DQY A;  4OGQ D;  2HMN A;  4QDC A;  1SQX E;  1RFS A;  4NBB D;  2DE7 D;  2E4P A;  4NB8 D;  1NTZ E;  1SQB E;  3CX5 E;  4HM2 A;  5AEW A;  1O7M A;  1O7G A;  2BMO A;  3TGU E;  4P1C H;  4QDF B;  4NBC D;  3VMG D;  4AIV A;  1SQP E;  3H1I E;  4H0L D;  2QPZ A;  4AAY B;  4QUQ A;  2E74 D;  1ULJ A;  3L71 E;  1SQV E;  2QJY C;  1ULI A;  2FYU E;  2BCC E;  4U3F E;  3H1H E;  3H1J E;  3C0D A;  4P1B H;  1KB9 E;  3BCC E;  2NUK A;  3VMH D;  2HMK A;  3GTE A;  2I7F A;  4QCK A;  1JM1 A;  2BMR A;  4EMJ B;  2XRX A;  3AZC A;  3CWB E;  4NB9 D;  1FQT A;  2DE6 D;  3GOB A;  4NBE D;  1SJG A;  3CXH E;  1G8J B; 
#chains in the Genus database with same CATH topology
 1PP9 E;  1Q90 C;  4HM7 A;  3GL2 A;  1VCK A;  3EQQ A;  4NBA D;  2IBZ E;  3EN1 A;  2FYN C;  3N0Q A;  4PV1 D;  2D2C D;  3GCE A;  4HM8 A;  2HMO A;  5CXM A;  1BE3 E;  1NDO A;  3L74 E;  2YFJ A;  2NWF A;  3L73 E;  1BCC E;  1SQQ E;  2NVE A;  5BOK A;  1NYK A;  3D89 A;  5AEU A;  1PPJ E;  1ZRT E;  1UUW A;  1O7H A;  2NUM A;  2NVG A;  4QUP A;  5KLV E;  3GKE A;  5HL4 A;  2QJP C;  2E75 D;  3L70 E;  1EZV E;  3GTS A;  2E4Q A;  4HJL A;  3GL0 A;  1KYO E;  2YFL A;  2ZYL A;  1O7W A;  3FOU A;  2BMQ A;  2CKF A;  1G8K B;  3L72 E;  4HKV A;  4HM0 A;  4NBG D;  3GZX A;  1RIE A;  1O7N A;  2XSO A;  3L75 E;  2GBW A;  4H44 D;  2Q3W A;  1NTK E;  3GB4 A;  4QDF A;  2A06 E;  4NBF D;  4NBH D;  4QDD A;  3H1L E;  2XR8 A;  2YFI A;  1UUV A;  2JO6 A;  3VMI D;  1EG9 A;  2QJK C;  2XSH A;  4PD4 E;  5KLI C;  4HM3 A;  1L0L E;  2JZA A;  4HM5 A;  2ZT9 D;  2B24 A;  3GZY A;  4HM4 A;  2B1X A;  2DE5 D;  3H1K E;  4QUR A;  1NU1 E;  2GBX A;  1O7P A;  2E76 D;  4HM6 A;  1VM9 A;  1P84 E;  3VCA A;  1WQL A;  2YVJ B;  1L0N E;  4H13 D;  5KKZ C;  1VF5 D;  2YIU C;  2NVF A;  4NBD D;  1NTM E;  4HM1 A;  2HMJ A;  3VCP A;  2HML A;  2HMM A;  3DQY A;  4OGQ D;  2HMN A;  4QDC A;  1SQX E;  1RFS A;  4NBB D;  2DE7 D;  2E4P A;  4NB8 D;  1NTZ E;  1SQB E;  3CX5 E;  4HM2 A;  5AEW A;  1O7M A;  1O7G A;  2BMO A;  3TGU E;  4P1C H;  4QDF B;  4NBC D;  3VMG D;  4AIV A;  1SQP E;  3H1I E;  4H0L D;  2QPZ A;  4AAY B;  4QUQ A;  2E74 D;  1ULJ A;  3L71 E;  1SQV E;  2QJY C;  1ULI A;  2FYU E;  2BCC E;  4U3F E;  3H1H E;  3H1J E;  3C0D A;  4P1B H;  1KB9 E;  3BCC E;  2NUK A;  3VMH D;  2HMK A;  3GTE A;  2I7F A;  4QCK A;  1JM1 A;  2BMR A;  4EMJ B;  2XRX A;  3AZC A;  3CWB E;  4NB9 D;  1FQT A;  2DE6 D;  3GOB A;  4NBE D;  1SJG A;  3CXH E;  1G8J B; 
#chains in the Genus database with same CATH homology
 1PP9 E;  1Q90 C;  4HM7 A;  3GL2 A;  1VCK A;  3EQQ A;  4NBA D;  2IBZ E;  3EN1 A;  2FYN C;  3N0Q A;  4PV1 D;  2D2C D;  3GCE A;  4HM8 A;  2HMO A;  5CXM A;  1BE3 E;  1NDO A;  3L74 E;  2YFJ A;  2NWF A;  3L73 E;  1BCC E;  1SQQ E;  2NVE A;  5BOK A;  1NYK A;  3D89 A;  5AEU A;  1PPJ E;  1ZRT E;  1UUW A;  1O7H A;  2NUM A;  2NVG A;  4QUP A;  5KLV E;  3GKE A;  5HL4 A;  2QJP C;  2E75 D;  3L70 E;  1EZV E;  3GTS A;  2E4Q A;  4HJL A;  3GL0 A;  1KYO E;  2YFL A;  2ZYL A;  1O7W A;  3FOU A;  2BMQ A;  2CKF A;  1G8K B;  3L72 E;  4HKV A;  4HM0 A;  4NBG D;  3GZX A;  1RIE A;  1O7N A;  2XSO A;  3L75 E;  2GBW A;  4H44 D;  2Q3W A;  1NTK E;  3GB4 A;  4QDF A;  2A06 E;  4NBF D;  4NBH D;  4QDD A;  3H1L E;  2XR8 A;  2YFI A;  1UUV A;  2JO6 A;  3VMI D;  1EG9 A;  2QJK C;  2XSH A;  4PD4 E;  5KLI C;  4HM3 A;  1L0L E;  2JZA A;  4HM5 A;  2ZT9 D;  2B24 A;  3GZY A;  4HM4 A;  2B1X A;  2DE5 D;  3H1K E;  4QUR A;  1NU1 E;  2GBX A;  1O7P A;  2E76 D;  4HM6 A;  1VM9 A;  1P84 E;  3VCA A;  1WQL A;  2YVJ B;  1L0N E;  4H13 D;  5KKZ C;  1VF5 D;  2YIU C;  2NVF A;  4NBD D;  1NTM E;  4HM1 A;  2HMJ A;  3VCP A;  2HML A;  2HMM A;  3DQY A;  4OGQ D;  2HMN A;  4QDC A;  1SQX E;  1RFS A;  4NBB D;  2DE7 D;  2E4P A;  4NB8 D;  1NTZ E;  1SQB E;  3CX5 E;  4HM2 A;  5AEW A;  1O7M A;  1O7G A;  2BMO A;  3TGU E;  4P1C H;  4QDF B;  4NBC D;  3VMG D;  4AIV A;  1SQP E;  3H1I E;  4H0L D;  2QPZ A;  4AAY B;  4QUQ A;  2E74 D;  1ULJ A;  3L71 E;  1SQV E;  2QJY C;  1ULI A;  2FYU E;  2BCC E;  4U3F E;  3H1H E;  3H1J E;  3C0D A;  4P1B H;  1KB9 E;  3BCC E;  2NUK A;  3VMH D;  2HMK A;  3GTE A;  2I7F A;  4QCK A;  1JM1 A;  2BMR A;  4EMJ B;  2XRX A;  3AZC A;  3CWB E;  4NB9 D;  1FQT A;  2DE6 D;  3GOB A;  4NBE D;  1SJG A;  3CXH E;  1G8J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...