1RFVA

Crystal structure of pyridoxal kinase complexed with adp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
309
structure length
306
Chain Sequence
ECRVLSIQSHVVRGYVGNRAATFPLQVLGFEVDAVNSVQFSNHTGYSHWKGQVLNSDELQELYDGLKLNHVNQYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGDQRNGEGAMYVPDDLLPVYREKVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLHSMGPDTVVITSSNLLSPRGSDYLMALGSQRTRGSVVTQRIRMEMHKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSAMHHVLQRTIKCAKAKSGEGVKPSPAQLELRMVQSKKDIESPEIVVQATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational changes in the reaction of pyridoxal kinase
pubmed doi rcsb
molecule tags Transferase
molecule keywords pyridoxal kinase
total genus 96
structure length 306
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2003-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 1rfvA00
3GO7A 1EKQA 4C5MA 4E8YA 4KBEA 3RS9A 4O1GA 3B3LA 1RKAA 3RTBA 4E8ZA 3MBJA 4KADA 3LOOA 1UA4A 4B8RA 3FHYA 5BYEA 3RQ5A 1KYHA 1RK2A 3NL3A 4U7XA 2YXUA 1DGMA 2HQQA 3QAIA 3BGKA 3RO4A 4EUMA 3RTDA 2F02A 5COJA 3RQ6A 3NM1A 1BX4A 4KAHA 4LC4A 4LBXA 3RT9A 5CGAA 4K8TA 4YWRA 3RRJA 1JXHA 3RTAA 2PKKA 2PKFA 3NL2A 2YXTA 3JULA 1L2LA 4WJMA 4XF6A 5BYCA 3NM3A 4K8KA 3RT7A 3RM5A 3RQQA 1LIOA 1TZ6A 1V1BA 2DDWA 3IKHA 3RRFA 4KALA 3B1RA 3RREA 3UMOA 5TQIA 4JJPA 4S1HA 4XF7A 3QA2A 1V19A 3B1NA 1JXIA 2A9YA 4DC3A 1RFVA 4XCKA 3NCAA 1LHPA 4LCAA 2AFBA 3RPZA 3IN1A 3ZS7A 4C5NA 1GQTA 4O1LA 3NL6A 1RFUA 1RKDA 2AJRA 2I6AA 2AB8A 3RSSA 5BYFA 3UMPA 3Q1YA 1ESQA 5C41A 4EBUA 1LIKA 2DCNA 1VI9A 3B1OA 3H49A 2HW1A 3OTXA 4K93A 2C49A 5EYNA 3RSQA 4XDAA 3KEUA 3KD6A 3UQ9A 2JG1A 3HICA 3K5WA 3DRWA 3KTNA 2ABSA 4X8FA 4E3AA 4S1IA 4S1MA 3NBVA 3IQ0A 3UQEA 1RKSA 3KZHA 3RS8A 3N1CA 3HYOA 1ESJA 2QCVA 3NL5A 2DDOA 4YL5A 2NWHA 4K9CA 3W4SA 4C5KA 3RQ2A 3UBOA 1TZ3A 1YHJA 2ABQA 3BF5A 5TRWA 4K9IA 3VAQA 3NBWA 2AX3A 2I6BA 3B1PA 4EN4A 1TD2A 2A9ZA 5EY7A 5F0ZA 3H74A 3NC2A 1GC5A 3IE7A 4DU5A 5CM5A 3RSFA 3LKIA 5C3ZA 4E69A 3RQXA 1YGKA 2VARA 3MBHA 3NC9A 3RTEA 4GM6A 3PZSA 3RU3A 3HPDA 4KANA 4N09A 5BYDA 5F11A 4S1IB 1V1AA 3LJSA 3K9EA 3PL2A 4UBEA 3RPHA 1C3QA 1EKKA 3GO6A 3IH0A 2RBCA 3UQDA 2AWDA 4PVVA 1LHRA 3UQ6A 3RSGA 4JKUA 3RU2A 5CGEA 2PKNA 2V78A 1RFTA 2JGVA 4E8WA 2QHPA 2JG5A 3DZVA 3RTGA 1VK4A 3B1QA 1V1SA 1WYEA 4LBGA 3RQ8A 3RRBA 4C5LA 3FHXA 1VM7A 1UB0A 2F7KA 3Q92A 4N08A 2AA0A 4E84A 1LIIA 2HLZA 2C4EA 4K8PA 5C40A 3RQHA 3I3YA 2FV7A 2DDMA 1YGJA 2R3EA 1LIJA 4EOHA 5C3YA 1TYYA 3LHXA 4C5JA 3RTCA 3EWMA 3CQDA 2I5BA 3GBUA 1U2XA 2XTBA 3IBQA 4K8CA 4JKSA 3RY7A 3VASA 5B6AA 2Q5RA 2PKMA 4B8SA 2AJPA 2R3BA
chains in the Genus database with same CATH superfamily
3GO7A 1EKQA 4C5MA 4E8YA 3EAGA 4KBEA 3RS9A 1W78A 2VTDA 1RKAA 3B3LA 4O1GA 3MBJA 3RTBA 4KADA 4E8ZA 3LOOA 1UA4A 4B8RA 3FHYA 5BYEA 3RQ5A 1KYHA 1RK2A 3NL3A 4U7XA 2YXUA 1DGMA 2HQQA 3QAIA 3BGKA 4UAGA 3RO4A 4EUMA 3RTDA 2F02A 5COJA 3RQ6A 5A5FA 1P3DA 1BX4A 3NM1A 4KAHA 4LC4A 2Y66A 4LBXA 3RT9A 5CGAA 4K8TA 4YWRA 3RRJA 1JXHA 3RTAA 2PKKA 2JFFA 2PKFA 3NL2A 2YXTA 3JULA 1L2LA 4WJMA 4XF6A 5BYCA 3NM3A 2XPCA 4K8KA 3RT7A 3RM5A 3RQQA 4BUBA 1LIOA 1TZ6A 3LK7A 1V1BA 2DDWA 2UAGA 3VAQA 3IKHA 3RRFA 1GQQA 4KALA 3B1RA 3RREA 1UAGA 3UMOA 4BUCA 5TQIA 4JJPA 4S1HA 1E8CA 1GG4A 4XF7A 3QA2A 1V19A 3B1NA 1FGSA 1JXIA 2A9YA 4DC3A 1RFVA 4XCKA 3NCAA 1LHPA 4LCAA 2AFBA 4C12A 4C13A 3RPZA 3IN1A 3ZS7A 4C5NA 1GQTA 4O1LA 3NL6A 1RFUA 1RKDA 2AJRA 2I6AA 2AB8A 4QDIA 3RSSA 3QCZA 3UMPA 5BYFA 1O5ZA 3Q1YA 1ESQA 5C41A 2AM2A 4EBUA 1LIKA 2AM1A 2JFHA 3NRSA 2DCNA 1VI9A 3B1OA 3H49A 2HW1A 3OTXA 4K93A 2C49A 5EYNA 3ZM5A 2GC5A 2GCAA 4XDAA 3KEUA 5TRWA 3KD6A 3RSQA 3UQ9A 2JG1A 3HICA 3UBOA 2F00A 3DRWA 3K5WA 4HV4A 3KTNA 2ABSA 3PYZA 4X8FA 2GCBA 4E3AA 4S1IA 4S1MA 3NBVA 3IQ0A 3UQEA 1RKSA 3KZHA 3RS8A 5A5EA 2GC6A 3N1CA 3HYOA 1ESJA 2QCVA 3NL5A 2DDOA 2VTEA 4YL5A 2NWHA 4K9CA 3W4SA 4CVKA 4C5KA 4QF5A 3RQ2A 1TZ3A 1YHJA 2ABQA 2UUPA 2Y68A 3BF5A 1J6UA 2JFGA 3HJ6A 3NBWA 2AX3A 2I6BA 3B1PA 4K9IA 1TD2A 2A9ZA 5EY7A 2Y67A 4EN4A 5F0ZA 4CVMA 3H74A 3NC2A 1JBWA 1EEHA 1GC5A 2WTZA 3IE7A 4DU5A 5CM5A 3RSFA 3LKIA 5C3ZA 4E69A 3RQXA 1YGKA 2VARA 3MBHA 3NC9A 3RTEA 2X5OA 3PZSA 4GM6A 3RU3A 3HPDA 4CVLA 4KANA 4N09A 5BYDA 5F11A 4S1IB 1V1AA 3LJSA 3K9EA 1GQYA 3PL2A 4UBEA 3RPHA 2WJPA 1C3QA 1EKKA 3GO6A 3IH0A 2RBCA 2VOSA 3UQDA 2AWDA 4PVVA 1LHRA 3UQ6A 3RSGA 4JKUA 3RU2A 5CGEA 2PKNA 2V78A 1RFTA 2UUOA 2JGVA 1P31A 4E8WA 2QHPA 2JG5A 1W7KA 3DZVA 3HN7A 2XJAA 1VK4A 3B1QA 1V1SA 1WYEA 4LBGA 3RQ8A 3RRBA 3RTGA 3FHXA 1VM7A 4C5LA 1UB0A 2F7KA 3Q92A 3ZL8A 3ZM6A 4N08A 2AA0A 4E84A 1LIIA 2HLZA 2C4EA 4K8PA 5C40A 3RQHA 2VORA 3I3YA 2FV7A 3N2AA 2DDMA 1YGJA 2R3EA 1LIJA 3UAGA 4EOHA 5C3YA 1TYYA 3LHXA 4C5JA 2Y1OA 3RTCA 3EWMA 3CQDA 2I5BA 3GBUA 1U2XA 2XTBA 3IBQA 1E0DA 4K8CA 1JBVA 4JKSA 3RY7A 3VASA 5B6AA 2Q5RA 2PKMA 4B8SA 2AJPA 2R3BA 4ZIYA
chains in the Genus database with same CATH topology
3GO7A 1EKQA 4C5MA 4E8YA 4KBEA 3RS9A 4O1GA 3B3LA 1RKAA 3RTBA 4E8ZA 3MBJA 4KADA 3LOOA 1UA4A 4B8RA 3FHYA 5BYEA 3RQ5A 1KYHA 1RK2A 3NL3A 4U7XA 2YXUA 1DGMA 2HQQA 3QAIA 3BGKA 3RO4A 4EUMA 3RTDA 2F02A 5COJA 3RQ6A 3NM1A 1BX4A 4KAHA 4LC4A 4LBXA 3RT9A 5CGAA 4K8TA 4YWRA 3RRJA 1JXHA 3RTAA 2PKKA 2PKFA 3NL2A 2YXTA 3JULA 1L2LA 4WJMA 4XF6A 5BYCA 3NM3A 4K8KA 3RT7A 3RM5A 3RQQA 1LIOA 1TZ6A 1V1BA 2DDWA 3IKHA 3RRFA 4KALA 3B1RA 3RREA 3UMOA 5TQIA 4JJPA 4S1HA 4XF7A 3QA2A 1V19A 3B1NA 1JXIA 2A9YA 4DC3A 1RFVA 4XCKA 3NCAA 1LHPA 4LCAA 2AFBA 3RPZA 3IN1A 3ZS7A 4C5NA 1GQTA 4O1LA 3NL6A 1RFUA 1RKDA 2AJRA 2I6AA 2AB8A 3RSSA 5BYFA 3UMPA 3Q1YA 1ESQA 5C41A 4EBUA 1LIKA 2DCNA 1VI9A 3B1OA 3H49A 2HW1A 3OTXA 4K93A 2C49A 5EYNA 3RSQA 4XDAA 3KEUA 3KD6A 3UQ9A 2JG1A 3HICA 3K5WA 3DRWA 3KTNA 2ABSA 4X8FA 4E3AA 4S1IA 4S1MA 3NBVA 3IQ0A 3UQEA 1RKSA 3KZHA 3RS8A 3N1CA 3HYOA 1ESJA 2QCVA 3NL5A 2DDOA 4YL5A 2NWHA 4K9CA 3W4SA 4C5KA 3RQ2A 3UBOA 1TZ3A 1YHJA 2ABQA 3BF5A 5TRWA 4K9IA 3HJ6A 3VAQA 3NBWA 2AX3A 2I6BA 3B1PA 4EN4A 1TD2A 2A9ZA 5EY7A 5F0ZA 3H74A 3NC2A 1GC5A 3IE7A 4DU5A 5CM5A 3RSFA 3LKIA 5C3ZA 4E69A 3RQXA 1YGKA 2VARA 3MBHA 3NC9A 3RTEA 4GM6A 3PZSA 3RU3A 3HPDA 4KANA 4N09A 5BYDA 5F11A 4S1IB 1V1AA 3LJSA 3K9EA 3PL2A 4UBEA 3RPHA 1C3QA 1EKKA 3GO6A 3IH0A 2RBCA 3UQDA 2AWDA 4PVVA 1LHRA 3UQ6A 3RSGA 4JKUA 3RU2A 5CGEA 2PKNA 2V78A 1RFTA 2JGVA 4E8WA 2QHPA 2JG5A 3DZVA 3RTGA 1VK4A 3B1QA 1V1SA 1WYEA 4LBGA 3RQ8A 3RRBA 4C5LA 3FHXA 1VM7A 1UB0A 2F7KA 3Q92A 4N08A 2AA0A 4E84A 1LIIA 2HLZA 2C4EA 4K8PA 5C40A 3RQHA 3I3YA 2FV7A 2DDMA 1YGJA 2R3EA 1LIJA 4EOHA 5C3YA 1TYYA 3LHXA 4C5JA 3RTCA 3EWMA 3CQDA 2I5BA 3GBUA 1U2XA 2XTBA 3IBQA 4K8CA 4JKSA 3RY7A 3VASA 5B6AA 2Q5RA 2PKMA 4B8SA 2AJPA 2R3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GO7 A;  1EKQ A;  4C5M A;  4E8Y A;  4KBE A;  3RS9 A;  4O1G A;  3B3L A;  1RKA A;  3RTB A;  4E8Z A;  3MBJ A;  4KAD A;  3LOO A;  1UA4 A;  4B8R A;  3FHY A;  5BYE A;  3RQ5 A;  1KYH A;  1RK2 A;  3NL3 A;  4U7X A;  2YXU A;  1DGM A;  2HQQ A;  3QAI A;  3BGK A;  3RO4 A;  4EUM A;  3RTD A;  2F02 A;  5COJ A;  3RQ6 A;  3NM1 A;  1BX4 A;  4KAH A;  4LC4 A;  4LBX A;  3RT9 A;  5CGA A;  4K8T A;  4YWR A;  3RRJ A;  1JXH A;  3RTA A;  2PKK A;  2PKF A;  3NL2 A;  2YXT A;  3JUL A;  1L2L A;  4WJM A;  4XF6 A;  5BYC A;  3NM3 A;  4K8K A;  3RT7 A;  3RM5 A;  3RQQ A;  1LIO A;  1TZ6 A;  1V1B A;  2DDW A;  3IKH A;  3RRF A;  4KAL A;  3B1R A;  3RRE A;  3UMO A;  5TQI A;  4JJP A;  4S1H A;  4XF7 A;  3QA2 A;  1V19 A;  3B1N A;  1JXI A;  2A9Y A;  4DC3 A;  1RFV A;  4XCK A;  3NCA A;  1LHP A;  4LCA A;  2AFB A;  3RPZ A;  3IN1 A;  3ZS7 A;  4C5N A;  1GQT A;  4O1L A;  3NL6 A;  1RFU A;  1RKD A;  2AJR A;  2I6A A;  2AB8 A;  3RSS A;  5BYF A;  3UMP A;  3Q1Y A;  1ESQ A;  5C41 A;  4EBU A;  1LIK A;  2DCN A;  1VI9 A;  3B1O A;  3H49 A;  2HW1 A;  3OTX A;  4K93 A;  2C49 A;  5EYN A;  3RSQ A;  4XDA A;  3KEU A;  3KD6 A;  3UQ9 A;  2JG1 A;  3HIC A;  3K5W A;  3DRW A;  3KTN A;  2ABS A;  4X8F A;  4E3A A;  4S1I A;  4S1M A;  3NBV A;  3IQ0 A;  3UQE A;  1RKS A;  3KZH A;  3RS8 A;  3N1C A;  3HYO A;  1ESJ A;  2QCV A;  3NL5 A;  2DDO A;  4YL5 A;  2NWH A;  4K9C A;  3W4S A;  4C5K A;  3RQ2 A;  3UBO A;  1TZ3 A;  1YHJ A;  2ABQ A;  3BF5 A;  5TRW A;  4K9I A;  3VAQ A;  3NBW A;  2AX3 A;  2I6B A;  3B1P A;  4EN4 A;  1TD2 A;  2A9Z A;  5EY7 A;  5F0Z A;  3H74 A;  3NC2 A;  1GC5 A;  3IE7 A;  4DU5 A;  5CM5 A;  3RSF A;  3LKI A;  5C3Z A;  4E69 A;  3RQX A;  1YGK A;  2VAR A;  3MBH A;  3NC9 A;  3RTE A;  4GM6 A;  3PZS A;  3RU3 A;  3HPD A;  4KAN A;  4N09 A;  5BYD A;  5F11 A;  4S1I B;  1V1A A;  3LJS A;  3K9E A;  3PL2 A;  4UBE A;  3RPH A;  1C3Q A;  1EKK A;  3GO6 A;  3IH0 A;  2RBC A;  3UQD A;  2AWD A;  4PVV A;  1LHR A;  3UQ6 A;  3RSG A;  4JKU A;  3RU2 A;  5CGE A;  2PKN A;  2V78 A;  1RFT A;  2JGV A;  4E8W A;  2QHP A;  2JG5 A;  3DZV A;  3RTG A;  1VK4 A;  3B1Q A;  1V1S A;  1WYE A;  4LBG A;  3RQ8 A;  3RRB A;  4C5L A;  3FHX A;  1VM7 A;  1UB0 A;  2F7K A;  3Q92 A;  4N08 A;  2AA0 A;  4E84 A;  1LII A;  2HLZ A;  2C4E A;  4K8P A;  5C40 A;  3RQH A;  3I3Y A;  2FV7 A;  2DDM A;  1YGJ A;  2R3E A;  1LIJ A;  4EOH A;  5C3Y A;  1TYY A;  3LHX A;  4C5J A;  3RTC A;  3EWM A;  3CQD A;  2I5B A;  3GBU A;  1U2X A;  2XTB A;  3IBQ A;  4K8C A;  4JKS A;  3RY7 A;  3VAS A;  5B6A A;  2Q5R A;  2PKM A;  4B8S A;  2AJP A;  2R3B A; 
#chains in the Genus database with same CATH topology
 3GO7 A;  1EKQ A;  4C5M A;  4E8Y A;  3EAG A;  4KBE A;  3RS9 A;  1W78 A;  2VTD A;  1RKA A;  3B3L A;  4O1G A;  3MBJ A;  3RTB A;  4KAD A;  4E8Z A;  3LOO A;  1UA4 A;  4B8R A;  3FHY A;  5BYE A;  3RQ5 A;  1KYH A;  1RK2 A;  3NL3 A;  4U7X A;  2YXU A;  1DGM A;  2HQQ A;  3QAI A;  3BGK A;  4UAG A;  3RO4 A;  4EUM A;  3RTD A;  2F02 A;  5COJ A;  3RQ6 A;  5A5F A;  1P3D A;  1BX4 A;  3NM1 A;  4KAH A;  4LC4 A;  2Y66 A;  4LBX A;  3RT9 A;  5CGA A;  4K8T A;  4YWR A;  3RRJ A;  1JXH A;  3RTA A;  2PKK A;  2JFF A;  2PKF A;  3NL2 A;  2YXT A;  3JUL A;  1L2L A;  4WJM A;  4XF6 A;  5BYC A;  3NM3 A;  2XPC A;  4K8K A;  3RT7 A;  3RM5 A;  3RQQ A;  4BUB A;  1LIO A;  1TZ6 A;  3LK7 A;  1V1B A;  2DDW A;  2UAG A;  3VAQ A;  3IKH A;  3RRF A;  1GQQ A;  4KAL A;  3B1R A;  3RRE A;  1UAG A;  3UMO A;  4BUC A;  5TQI A;  4JJP A;  4S1H A;  1E8C A;  1GG4 A;  4XF7 A;  3QA2 A;  1V19 A;  3B1N A;  1FGS A;  1JXI A;  2A9Y A;  4DC3 A;  1RFV A;  4XCK A;  3NCA A;  1LHP A;  4LCA A;  2AFB A;  4C12 A;  4C13 A;  3RPZ A;  3IN1 A;  3ZS7 A;  4C5N A;  1GQT A;  4O1L A;  3NL6 A;  1RFU A;  1RKD A;  2AJR A;  2I6A A;  2AB8 A;  4QDI A;  3RSS A;  3QCZ A;  3UMP A;  5BYF A;  1O5Z A;  3Q1Y A;  1ESQ A;  5C41 A;  2AM2 A;  4EBU A;  1LIK A;  2AM1 A;  2JFH A;  3NRS A;  2DCN A;  1VI9 A;  3B1O A;  3H49 A;  2HW1 A;  3OTX A;  4K93 A;  2C49 A;  5EYN A;  3ZM5 A;  2GC5 A;  2GCA A;  4XDA A;  3KEU A;  5TRW A;  3KD6 A;  3RSQ A;  3UQ9 A;  2JG1 A;  3HIC A;  3UBO A;  2F00 A;  3DRW A;  3K5W A;  4HV4 A;  3KTN A;  2ABS A;  3PYZ A;  4X8F A;  2GCB A;  4E3A A;  4S1I A;  4S1M A;  3NBV A;  3IQ0 A;  3UQE A;  1RKS A;  3KZH A;  3RS8 A;  5A5E A;  2GC6 A;  3N1C A;  3HYO A;  1ESJ A;  2QCV A;  3NL5 A;  2DDO A;  2VTE A;  4YL5 A;  2NWH A;  4K9C A;  3W4S A;  4CVK A;  4C5K A;  4QF5 A;  3RQ2 A;  1TZ3 A;  1YHJ A;  2ABQ A;  2UUP A;  2Y68 A;  3BF5 A;  1J6U A;  2JFG A;  3HJ6 A;  3NBW A;  2AX3 A;  2I6B A;  3B1P A;  4K9I A;  1TD2 A;  2A9Z A;  5EY7 A;  2Y67 A;  4EN4 A;  5F0Z A;  4CVM A;  3H74 A;  3NC2 A;  1JBW A;  1EEH A;  1GC5 A;  2WTZ A;  3IE7 A;  4DU5 A;  5CM5 A;  3RSF A;  3LKI A;  5C3Z A;  4E69 A;  3RQX A;  1YGK A;  2VAR A;  3MBH A;  3NC9 A;  3RTE A;  2X5O A;  3PZS A;  4GM6 A;  3RU3 A;  3HPD A;  4CVL A;  4KAN A;  4N09 A;  5BYD A;  5F11 A;  4S1I B;  1V1A A;  3LJS A;  3K9E A;  1GQY A;  3PL2 A;  4UBE A;  3RPH A;  2WJP A;  1C3Q A;  1EKK A;  3GO6 A;  3IH0 A;  2RBC A;  2VOS A;  3UQD A;  2AWD A;  4PVV A;  1LHR A;  3UQ6 A;  3RSG A;  4JKU A;  3RU2 A;  5CGE A;  2PKN A;  2V78 A;  1RFT A;  2UUO A;  2JGV A;  1P31 A;  4E8W A;  2QHP A;  2JG5 A;  1W7K A;  3DZV A;  3HN7 A;  2XJA A;  1VK4 A;  3B1Q A;  1V1S A;  1WYE A;  4LBG A;  3RQ8 A;  3RRB A;  3RTG A;  3FHX A;  1VM7 A;  4C5L A;  1UB0 A;  2F7K A;  3Q92 A;  3ZL8 A;  3ZM6 A;  4N08 A;  2AA0 A;  4E84 A;  1LII A;  2HLZ A;  2C4E A;  4K8P A;  5C40 A;  3RQH A;  2VOR A;  3I3Y A;  2FV7 A;  3N2A A;  2DDM A;  1YGJ A;  2R3E A;  1LIJ A;  3UAG A;  4EOH A;  5C3Y A;  1TYY A;  3LHX A;  4C5J A;  2Y1O A;  3RTC A;  3EWM A;  3CQD A;  2I5B A;  3GBU A;  1U2X A;  2XTB A;  3IBQ A;  1E0D A;  4K8C A;  1JBV A;  4JKS A;  3RY7 A;  3VAS A;  5B6A A;  2Q5R A;  2PKM A;  4B8S A;  2AJP A;  2R3B A;  4ZIY A; 
#chains in the Genus database with same CATH homology
 3GO7 A;  1EKQ A;  4C5M A;  4E8Y A;  4KBE A;  3RS9 A;  4O1G A;  3B3L A;  1RKA A;  3RTB A;  4E8Z A;  3MBJ A;  4KAD A;  3LOO A;  1UA4 A;  4B8R A;  3FHY A;  5BYE A;  3RQ5 A;  1KYH A;  1RK2 A;  3NL3 A;  4U7X A;  2YXU A;  1DGM A;  2HQQ A;  3QAI A;  3BGK A;  3RO4 A;  4EUM A;  3RTD A;  2F02 A;  5COJ A;  3RQ6 A;  3NM1 A;  1BX4 A;  4KAH A;  4LC4 A;  4LBX A;  3RT9 A;  5CGA A;  4K8T A;  4YWR A;  3RRJ A;  1JXH A;  3RTA A;  2PKK A;  2PKF A;  3NL2 A;  2YXT A;  3JUL A;  1L2L A;  4WJM A;  4XF6 A;  5BYC A;  3NM3 A;  4K8K A;  3RT7 A;  3RM5 A;  3RQQ A;  1LIO A;  1TZ6 A;  1V1B A;  2DDW A;  3IKH A;  3RRF A;  4KAL A;  3B1R A;  3RRE A;  3UMO A;  5TQI A;  4JJP A;  4S1H A;  4XF7 A;  3QA2 A;  1V19 A;  3B1N A;  1JXI A;  2A9Y A;  4DC3 A;  1RFV A;  4XCK A;  3NCA A;  1LHP A;  4LCA A;  2AFB A;  3RPZ A;  3IN1 A;  3ZS7 A;  4C5N A;  1GQT A;  4O1L A;  3NL6 A;  1RFU A;  1RKD A;  2AJR A;  2I6A A;  2AB8 A;  3RSS A;  5BYF A;  3UMP A;  3Q1Y A;  1ESQ A;  5C41 A;  4EBU A;  1LIK A;  2DCN A;  1VI9 A;  3B1O A;  3H49 A;  2HW1 A;  3OTX A;  4K93 A;  2C49 A;  5EYN A;  3RSQ A;  4XDA A;  3KEU A;  3KD6 A;  3UQ9 A;  2JG1 A;  3HIC A;  3K5W A;  3DRW A;  3KTN A;  2ABS A;  4X8F A;  4E3A A;  4S1I A;  4S1M A;  3NBV A;  3IQ0 A;  3UQE A;  1RKS A;  3KZH A;  3RS8 A;  3N1C A;  3HYO A;  1ESJ A;  2QCV A;  3NL5 A;  2DDO A;  4YL5 A;  2NWH A;  4K9C A;  3W4S A;  4C5K A;  3RQ2 A;  3UBO A;  1TZ3 A;  1YHJ A;  2ABQ A;  3BF5 A;  5TRW A;  4K9I A;  3HJ6 A;  3VAQ A;  3NBW A;  2AX3 A;  2I6B A;  3B1P A;  4EN4 A;  1TD2 A;  2A9Z A;  5EY7 A;  5F0Z A;  3H74 A;  3NC2 A;  1GC5 A;  3IE7 A;  4DU5 A;  5CM5 A;  3RSF A;  3LKI A;  5C3Z A;  4E69 A;  3RQX A;  1YGK A;  2VAR A;  3MBH A;  3NC9 A;  3RTE A;  4GM6 A;  3PZS A;  3RU3 A;  3HPD A;  4KAN A;  4N09 A;  5BYD A;  5F11 A;  4S1I B;  1V1A A;  3LJS A;  3K9E A;  3PL2 A;  4UBE A;  3RPH A;  1C3Q A;  1EKK A;  3GO6 A;  3IH0 A;  2RBC A;  3UQD A;  2AWD A;  4PVV A;  1LHR A;  3UQ6 A;  3RSG A;  4JKU A;  3RU2 A;  5CGE A;  2PKN A;  2V78 A;  1RFT A;  2JGV A;  4E8W A;  2QHP A;  2JG5 A;  3DZV A;  3RTG A;  1VK4 A;  3B1Q A;  1V1S A;  1WYE A;  4LBG A;  3RQ8 A;  3RRB A;  4C5L A;  3FHX A;  1VM7 A;  1UB0 A;  2F7K A;  3Q92 A;  4N08 A;  2AA0 A;  4E84 A;  1LII A;  2HLZ A;  2C4E A;  4K8P A;  5C40 A;  3RQH A;  3I3Y A;  2FV7 A;  2DDM A;  1YGJ A;  2R3E A;  1LIJ A;  4EOH A;  5C3Y A;  1TYY A;  3LHX A;  4C5J A;  3RTC A;  3EWM A;  3CQD A;  2I5B A;  3GBU A;  1U2X A;  2XTB A;  3IBQ A;  4K8C A;  4JKS A;  3RY7 A;  3VAS A;  5B6A A;  2Q5R A;  2PKM A;  4B8S A;  2AJP A;  2R3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...