1RFYA

Crystal structure of quorum-sensing antiactivator tram
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
KKVELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEMHAQMSALNTLISILGFIPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quorum-sensing antiactivator TraM forms a dimer that dissociates to inhibit TraR
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transcription
molecule keywords Transcriptional repressor traM
total genus 33
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09228 Prok-TraM Prokaryotic Transcriptional repressor TraM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1rfyA00
1CXZB 2HJDA 2RMKB 1UPGA 4DYLA 4IGGA 4NKGB 1US6A 4NB5A 2Q0OC 1RFYA 1URFA
chains in the Genus database with same CATH superfamily
2R72A 3ZMUA 4DV5B 4ZKIA 1DTOA 3K59A 3APOA 5J2TB 1P7GA 3HPLC 3VQWA 2RN9A 1M56B 4JI0O 1P49A 4JI3O 4FLUA 2XAGA 1K33A 1JMKC 1XREA 3U0ZA 2W6JG 3L9DA 2ZM6O 2OWOA 3ZX6A 5B5EZ 2B5UA 2ZT9B 1AJPA 4QNHB 4UXNA 2UXBO 1B04A 2HLDG 1I5XA 5J2TA 2DYSB 1DGSA 4B7EA 2R70A 2QWOB 2WLIA 3WU2Z 1YVWA 2GUZB 2PZSA 2YXLA 5EBLC 3OAAG 1VQ4V 3JCZA 4Q20A 1IX9A 4HBNA 1TAEA 4J80A 3AG3B 3CS5A 2JEUA 4EKWA 3AG4C 3MD0A 1XNQO 3JARA 3EXAA 1BS3A 1EBOA 4X62O 2W6IG 4G27B 3VQXA 3EVKA 2GDSA 3ABMB 3FB5C 3T1HB 1HNZO 1JVMA 1FXHA 1I5YA 3E83A 4ZI7A 5IJ0B 1BE3H 1J95A 4K3AA 4LFBB 4TQDA 3ETEA 3JASB 1AI5A 5IYZA 4DK1A 1OCOC 4JZGA 3FAVB 4TV8B 1J5EO 1L0LH 4JYYA 5K1PA 2YSUB 3BPZA 1X59A 4DR2B 1S5LZ 4F6RB 1O9HA 5IY5B 5LXTB 1EN5A 3ABLB 1PNMA 1LNQA 1XMOB 4GZRB 5E1AC 1JCHA 4JI1O 1QNMA 4OGQB 4ABMA 3ASOC 3Q4HB 3JD3A 4ASUG 1RM1B 2HVJC 5DEDA 2CUGA 1UJWB 4NXNO 4RO2A 2NN4A 2HJDA 1DF5A 4O4HB 1YITV 3OR6C 2EIMC 5JVDB 4UVAA 1HNWO 1PNKA 2WLMA 1AP6A 4TV9B 1GO3F 1S0VA 2ILMA 1QBZA 4P30A 5KUKA 1XMQO 3LSUA 1G4YB 2JGUA 1FXVA 1OCRC 1UFIA 4GX1A 1OCRB 4MS2A 4H33A 4FLYA 3BEHA 2VQFB 4R7CA 1AB3A 3CHXA 4DV4B 4RAIA 4JYAO 1KECA 3F7VC 1F4MA 1XHXA 1NT2B 4J10A 1OCZB 2HHHB 1V54C 4LFCO 3I5DA 4XDLA 3CP1A 5EIBD 4YHHO 1IBMO 3ASOB 4DUZO 1PV0A 1R6NA 5IY5C 3K5NA 2A7WA 1OV9A 2CAZC 1MZEA 2JS5A 1Q8IA 1IXMA 3KKYA 3E22A 4TV9A 5JJNB 4QE9A 3ABLC 2Q73A 1H2MA 4DV6B 2X6BA 4B3RO 5LGUA 1XL6A 2UU9B 2A79B 1L0NH 4JI2B 4AQYO 1N34B 2LFSA 1ORQC 2PF4E 3R66A 3C90A 2YEVA 2F95B 3OM3B 3TJTA 1WP8A 3SPGA 5LXTA 2EX3A 3FFQA 3BVOA 4LR3A 2VWJA 3RT3C 2ZINA 4KFMA 3N2KB 1SQQH 3AG1C 3WFVA 4WBNA 4TQFA 4DR1B 3STZC 2M6YA 1Q90D 5KLVH 2YIAA 1VF7A 2UXCB 2QWPB 4H44B 1SQVH 3T4DA 4R8CA 2O57A 2D2CB 4X65B 1ENVA 4RUEA 1NS1A 4IT5A 4BW9A 1SETA 3CYOA 1THZA 3RYFB 2R9IA 4IIJA 4MVOA 5ITZB 2RMKB 4LH6A 4TSFG 4UV8A 3D3IA 3CMEV 5B1NA 2ZCEA 3CJHB 1H2LA 1HNXO 3CC4V 2PI4A 4A5UB 1FKAO 3ZRWB 1EFRG 3ZN1A 1PKXA 3QO8A 4FLVA 2B1IA 2ZNJA 4HNAA 4IIJB 1KC8W 2UUBB 1N0JA 4BAYA 1SQGA 4AHCA 3AG1B 5EIBC 3TXSA 2YI8A 1EN6A 5CB4A 5IYZB 3PN1A 4AI8A 1L1FA 4DR5B 3LDCA 4DV0O 1SQBH 1XBLA 4DV6O 4IHJB 1ZX3A 3SYCA 2Y69C 3SJAC 1IBKO 2L35A 4OPHA 2QA4V 2XASA 3UCSC 2L6LA 3BA9A 3OT7A 1COWG 3S3XA 1XNRB 1YF2A 1WJZA 1SA0A 2ATKC 4PV1B 1Q6UA 4J7JA 4LNUA 3CC2V 1KB9F 2Y69B 2CH7A 1I94O 4JI0B 5JH7B 1PL4A 3CCEV 3K0GA 4P9PA 1Q86W 2XUMA 4B3TO 2C2AA 1O9GA 1OCZC 1RSOA 3K08A 3TETA 3HKBA 4CS3A 4BWAA 4DXWA 2XT9A 4DR4O 1RP3B 1EZJA 3CRQA 3JAMN 3KG2A 4FIPC 2IH3C 1S5JA 2EIKB 3E2EA 2QKCA 5EK0A 1X4TA 3J81N 1K34A 2LFRA 5CMUA 4BIZA 2ZR2A 1Q81W 1DK1A 5GTHZ 2HP8A 1VQ9V 4JV5O 2EULA 1PP9H 4UCRA 2PYJA 2VS0A 3CRRA 3OR7C 3FYIB 2CTPA 4MTXA 2OCHA 2XAQA 3ZMTA 3JCUZ 2DQ0A 2QDOA 4U3JB 3THOA 4WFHA 3W7SA 4LF5O 4DR3B 1RSOB 4PA9A 4LWSB 2PUSA 3BHPA 4MVZA 1WP7A 3K0DA 1E1RG 1IDSA 4OXSA 5KUMA 1YJ9V 1VQ8V 1Y76B 4I50A 3E8FA 4GYCB 4KL1A 1YSCA 1KP3A 2WAMA 3HKDB 1M90W 5JJEB 4UV9A 3KZIZ 3W7UA 4G28B 3MHHC 3FB7C 4CH6A 4F6RA 2DN9A 4FZ0A 3GVMA 2EIKC 4NXMB 3WB1A 2QWNB 3ETGA 3HKBB 4JI6B 5GONB 4O4IA 1T5EA 2LW1A 3SPIA 3NXSA 2NLJC 3QF7A 1SS3A 2Y0IA 5KHKA 2HFEC 5KMGB 1AI6A 2IH1C 1TUBB 3B8NA 3CMAV 2CH7B 1B06A 1QLEC 5JH7A 1S76D 5KHHA 4DK0A 2ODMA 4FLZA 3RGBA 4OX9O 1IURA 5KAIZ 5IDJA 1D5AA 2JDIG 1SRYA 4UCUA 1JR9A 3G6BA 3HKEB 3SYQA 4JI2O 1S72V 4J42A 2YICA 3W7XA 1BHAA 2ZQMA 3SPJA 4TOIA 1N36B 4PDMA 1CXZB 1P4RA 1M9NA 2ITCC 1ZL8B 2DW4A 1AVMA 2ZR3A 3OGIB 2XAHA 2E75B 2FTKA 2IJHA 3N2GB 2M7WA 4R50A 3ZHQA 3CWBH 4QGPA 3D36C 2ZE5A 1NR7A 4DRXB 1VQPV 2RJZA 2ZXWB 1TA8A 4LF5B 1FAFA 2BSKB 3BFRA 3ZHVA 4W4LA 2F4VB 2N05A 1SQFA 2ZIMA 4B3RB 4DV7B 2WLNA 1RM1C 1YJNV 2ADQB 3AK1A 4R6ZA 4DUYO 1Q7YW 4CBCA 2V7QG 5B1BC 3K9AA 4UVBA 3QO5A 2GUZA 4GCZA 3QVNA 1GH6A 1LUWA 4B3SO 4B7KA 2HHHO 2ETNA 2Z3YA 4JV5B 3SPCA 5FPOA 2WLJA 4YHHB 2N74A 4JI4B 4FZ1A 4DUZB 3GWKC 2QKAA 4PA4A 3BCCH 2VQEB 3WB2A 2MK3A 1JFFA 1BT8A 4KP4A 2VQFO 3L71H 2AHYA 3Q4HA 4DV4O 4DR7O 1K73W 5J2UB 3ZEDA 5BZBA 4O2BB 2ZD9A 1GN6A 1GKFA 2Q8VA 3KCYA 1F7YA 1GK9A 1R3JC 3LUTB 3L72H 4B3MO 4X20A 3RYCA 1N36O 4K8XA 3CC7V 3UO3A 5FPRA 4JTCB 5A2QN 2JVDA 4YY3B 1IBLB 4JI6O 3EHBB 3ASNC 3G67A 2GTAA 2YS8A 5EC1C 5B1AB 4LF9O 2DJVA 2VWKA 1JPXA 2BTQA 2W0FC 1Q6HA 1N32B 4MW3A 3OMAB 3T1CA 5LHHA 3JAKB 3JD2A 4GX5A 2EIJB 4DV3O 1GMGA 1SA0B 1F4NA 2JEXA 3UM7A 1NTZH 1TVKA 3JSNA 5DECA 4B08A 1BQ0A 1TUEB 4DV1O 4X9QA 2QEXV 1GM8A 2ZXWC 1CEZA 4AILC 4JI3B 4X8AA 1KD1W 3HKEA 3T1HO 1OZ0A 3H1IH 3UQ8A 4CH4A 3FB8C 1RFYA 4I9QA 3DTUB 3OUSA 2FB5A 4U7OA 3ZBHA 2EBOA 3ETDA 4WCEV 1VQNV 4ZHQA 2PY5A 4WFEA 1R3IC 1J5EB 4QPJA 5LMUO 2N04A 5FL7G 1KU9A 2AHZA 4UCOA 1Y74B 3APQA 4DR7B 2P90A 1AI4A 3BRCA 3KCXA 2WLKA 2JJ2G 1K4DC 3FD9A 3T1YO 3X2QC 1KBHA 4ZHQB 3OW2U 4NTWA 1NTKH 1URFA 4XDJA 3OTOB 3ABUA 4K35A 3B2EE 5LP6C 3E35A 1XEQA 2WA4A 3RYIA 3VQVA 1XILA 4I5SA 3VQYA 2JJ1G 4E2LA 1Q5OA 1BL8A 2XHBA 2UXBB 4RUFA 4UFZA 3GWOA 5CBFA 4O4LA 1GRJA 3L73H 4IGGA 3VBBA 2RCVA 1I7FA 2CTWA 1GM7A 1OCCB 2FL4A 2BOCC 4WBNB 1V9PA 3ML0A 3K06A 3CCJV 1AR1B 1XQ8A 2DWDC 2EJ7A 4UCTA 4BR6A 2HKOA 3ZRSA 1G8MA 3CCQV 4Z1MG 5IWAO 3OTOO 4NXNB 2DYSC 4E4EA 4JI5O 1BQZA 1FPOA 5LYJA 5FLXN 5LBQA 4K0KB 4J7KA 1VF5B 4UCVA 3E8BA 4MT8A 5CBGA 4EEQA 4MVSA 3OEEG 3IFXA 5JQGA 3SGIA 4CH5A 4PA7A 3H9VA 1Z5VA 3P3NA 2F93B 3B09A 1M4UA 5IJ9A 5IJ9B 1Q3EA 3UO2A 5LMUB 4BW5A 4PELA 2YDEA 4QJFB 2WLHA 5JWPA 1AR4A 4PI0A 4J7ZA 5L3BA 4GKKB 5JQGB 5LGNA 1Y6XA 2QSAA 3OMNB 1H8EG 3I55V 2JS3A 5EC2C 4XDKA 1JFFB 2DQ3A 3CRAA 2YIBA 4LF4B 2EIMB 2ZIOA 4TT3G 1VF6C 2Q5ZA 4HNAB 5IYBO 1MA1A 2AXTZ 2QM8A 2JGDB 4NXMO 1SKVA 2AW9A 4DR3O 1BSMA 2WLLB 1KMIZ 4JI5B 2IU3A 3SYPA 4EB6B 3OUFA 2E5LB 2B1GA 5LOVB 3N27A 4JI4O 2ZKOA 2BE3A 5H6RA 3FAVA 1B3QA 2Q7HA 3IC9A 1XMOO 3T2MA 5BR8B 3D8CA 4O4LB 4JYAB 4J9YB 2EZPA 1SQXH 1EN4A 1OCOB 3CCVV 4O4JB 1NR1A 1RPOA 4H37A 1A32A 2CGNA 3CXCU 1WA8A 3IJ4A 4LH7A 1H38A 3K04A 2QR4A 3FKSG 2AGAA 1QHTA 2Y0PA 3BAAA 4JI8B 1IZ3A 1K92A 4DV2B 2UXDB 4X89A 4B3SB 1QR9A 2DYRB 5A9GA 1H2SB 3AG3C 1NTMH 2H94A 1AILA 4NVPA 4MSWC 1BZKA 2LP7A 3RYFA 4LBEC 4IYIA 1OHHG 2QGNA 4KUMA 3D36A 4JGSA 5EYPB 3RVYA 1E1QG 3JD4A 4DO2A 4YJ2B 2RNBA 3E89A 2Q7GA 3AK2A 2R9RB 3HKCA 2PI5A 4JZ2A 1QVFU 5KHJA 1MG1A 2ITDC 4O4HA 3CE2A 1WB7A 3A0RA 2HR3A 2BOBC 1NI8A 3ZS8C 4MTOA 4OPAA 5CA0B 4I4TB 4YJ3A 4YJ2A 2QWQB 1GN2A 3M8AA 5EYPA 1G6UA 4H0LB 1MABG 1IVSA 1DLBA 1P84F 4L87A 1WPBA 4N21A 4ZOLA 3ZHUA 1NBMG 5CA0A 1WN7A 3SJBC 1TGOA 2QM4A 2E76B 4FLWA 1WA8B 1VQ7V 1YI2V 2BTQB 2BCCH 5IYDO 4K8ZA 1Y76A 2YIBD 4UB6Z 4X88A 1SQPH 5KMGA 2JK5C 1CPYA 3A2FA 3JYCA 4WFGA 1VIBA 2GBOA 1HDJA 3T4ZA 4DR1O 4PA3A 3UT5A 2KKWA 2ZE7A 3E8GA 2MW2B 3OE7G 4FJCC 4YY3O 1IBLO 3MDSA 2QM7A 4NTXA 1HWYA 4X65O 5D5PA 3L74H 2JGDA 3CB2A 2OTLV 1FJGO 3JALB 5TISZ 4IL6Z 4H13B 3OEHG 3TK1A 4LWSA 2YUAA 3STLC 4DR2O 2X6CA 4JYCA 3ZHRA 2X6AA 1FFTB 2ADPA 3ABTA 3ZHTA 3P3PA 5CA1B 2KQXA 4B3MB 2FKXA 2XAJA 1N33O 3ZCCA 5DN6G 2Y4TA 4FPPA 2UUBO 2G38A 1WAZA 5B3SB 2Y4UA 3CRMA 5C8YB 2QWRB 1NJIW 4LF7B 3SPHA 1WPXA 1ZL8A 1FFXA 3LSQA 2Z5UA 2X0LA 3AG7A 1VQMV 4HZ3A 3ZIAG 4LFAO 4I9WA 3ZMVA 5F2VO 1HR0O 5D5QA 4X1YA 2EZOA 5GW7A 2PGGA 2ZDIC 3SYAA 1FXKA 1NU1H 2QTSA 3ABKB 2BSKA 3GB7C 3M99B 2GHYA 5E79Z 1NQTA 1BGYH 2CDYA 4JYBA 3ETQA 4PJ0Z 3N2GA 4EFEA 2QE7G 3T1YB 4LFCB 1N33B 3BY6A 3HB3B 4CC5A 5EZYB 2R9AA 1TUBA 1SF9A 4FMTA 2Q0AA 4TWKA 4MTFA 5CBHA 2JIZG 4ZIBA 3CCLV 4LF7O 1M57B 4TUYB 4JI7B 4WFAV 1XHZA 1F51A 1M57C 4DR4B 4NB5A 4D6TH 2E5LO 1S5HC 1GAXA 2IJKA 2W0XA 1FXKC 2KB1A 3NR7A 3DXRB 1AR5A 1HP8A 1KKCA 2GTSA 4YXWG 5BMVB 1AROP 4DUYB 3AEIA 2XTAA 4DW1A 2CTQA 5J2UA 3ZRXA 2DOSA 3DSQA 4Z2WA 5K1XA 2UUCO 1HNXB 2F66C 2F1MA 5BY1A 3TXQA 4LC1A 5KA5A 1NZ6A 5CA1A 1NVPD 2Q68A 4FFBA 5KA6A 3ABKC 1V55B 4QE7A 4C7UA 1NKDA 1V55C 2GSMB 2NR5A 1XNQB 1L8DA 1KP2A 4P2ZA 5B1BB 3TCUA 4LF6O 2WLIB 3RFRA 4GX2A 1Y67A 1JJOA 1N8RW 3JASA 2DWEC 1SERA 4I4TA 5IWAB 3HR0A 4MW8A 4UCSA 3ZHSA 3E8HA 1AJQA 1PD3A 4K0KO 5C93A 4W4KA 1H8HG 4UB8Z 5LYJB 3ZRVA 1M1KW 3SDLA 3G71V 2EILC 2XAFA 3RYHA 1U97A 1KUQA 2JRIA 3E86A 5FNVB 5LP6B 1HNZB 4JI7O 3J80N 2YIDA 2ZM6B 1SZTA 2WSSG 5LHIA 2OIEA 1WLEA 1VF6A 4B3TB 3SJQC 1I08A 1LUVA 4I7ZB 4JASA 4DV5O 2XOKG 4WF9V 2KG7A 1MSDA 4WFFA 4DR6B 2UXNA 2E3CA 4DV1B 1K97A 1W59A 5KX5A 2IW5A 4D7TA 1NH2D 2IJIA 4NYKA 5CA3A 5IYCO 2EJRA 3ZJZA 4AQYB 1N34O 4PDRA 3JARB 2DE0X 4CS4A 2KG7B 2YXYA 2HG5C 1VQKV 3BA8A 3N2KA 2HVKC 3WB0A 5IE9A 1BCCH 2P5OA 3IGAC 5JJJB 3C3TA 5EBMC 3AG4B 3JAWB 4J9ZB 1N0NA 4NR1A 2CE4A 5EBWC 2IJJA 2YXHA 2A9HA 3CCMV 1FS0G 5J9PC 3VOUA 5B3SC 4X20B 1XDCA 1Z2GA 4PA6A 1YTFB 4DW0A 1S3JA 4JF3A 1R3KC 1KYOF 1XUQA 1U96A 2FYUH 3P30A 1JX9A 1XOUA 4FLXA 4U3FH 3K58A 3K5LA 1FD9A 2P4VA 4I0XA 1Y74A 4RQFA 1Y4MA 1Q43A 3OTFA 2E74B 1YJWV 4JI8O 4LF8O 3D3QA 3JAKA 5JCOC 4JAVA 5HFMA 5B1AC 1QQCA 1D2DA 2OCCB 4QIWF 5DM6V 3ASNB 3JALA 3UKMA 2P4KA 2Q67A 2ZE8A 4X64O 2QTOA 2WLLA 4PDLA 4KXRA 3JATB 4I0XB 4KHPO 1VQ5V 3FB6C 3B77A 5BR8O 4TV8A 4PHZA 5CN0A 2YEVB 2AZ0A 5B1OA 2UXCO 1SC5B 5EZYA 2IBZH 2DYRC 1TVKB 5L3DA 1R6TA 2OT5A 1OCCC 5FNVA 5IT9N 3F5WC 1H2GA 1FJGB 2CK3G 4QPKA 2A0LA 1MNGA 3PJSK 4OX9B 5C8YA 3RVZA 4ZI7B 5IJ0A 3G80A 3H01A 3CD6V 1Q6IA 3JAWA 1K4CC 1MMMA 4YJ3B 4RWUA 3K9SA 1GTOA 3F7YC 3DXRA 3A8TA 4LCUC 3CPWU 3X2QB 3IAYA 4LF9B 2V1DA 4ZOLB 1XMQB 2YI9A 1P7BA 3K5MA 1N32O 4X62B 3RBZA 5HFLA 5GONA 1B6QA 3K79A 4F6EA 2CTRA 3RYHB 1QLNA 1BHBA 2EILB 1PM9A 1XI1A 2D3OW 3P32A 2F4VO 2P06A 1SESA 4MVRA 1M56C 4IHJA 3HKDA 1K3EA 1VP7A 4P9OA 2OTJV 3A0HZ 1VQ6V 2EINB 4FFBB 2Y48A 5LGTA 1MZFA 1GN3A 4LF8B 3R65A 3SYOA 3DC5A 3A0BZ 4G2KA 4X1KA 1CP9A 3H1HH 4X1IB 4CH3A 3U10A 4HYOA 4X64B 4DYLA 5L3EA 5KAFZ 4FM2A 1N4CA 4CS2A 3ZMZA 5BMVA 4L8JA 1KQSU 1W0JG 2VQEO 5LMNO 4NTYA 2HEPA 4ZBMA 4DR5O 4YIPA 3JATA 2UXXA 2QJ1A 2LW7A 2OIGA 4I50B 4GKKO 4MVQA 4PD4F 1YEWA 3CJHA 4DV7O 4J11A 3EFFK 5L3FA 4JTAB 2A06H 4JAAA 1QLEB 3ZMSA 3OD4A 1PNLA 1K5SA 4U3JA 1BMFG 1R73A 2P7TC 2LGWA 1NVPB 4X1KB 2DMXA 2P67A 3H1LH 5BXZA 1QR8A 3W7TA 4LP8A 4CC6A 3U11A 2WWWA 3E22B 4GKJB 1VMGA 4JI1B 5KX5B 3LDEA 2H3OA 2FMLA 2UUAB 4LNUB 1M5IA 4GT1A 3ZRWA 2Q69A 5LA6B 1PL0A 2RQ6A 2IU0A 2YC0A 4MVUA 3S3WA 3FX7A 1QVGU 2ZE6A 2VRZA 3LSSA 2WA3A 3M7MX 4MVMA 4D7SA 1US6A 2WPDG 1OJHA 1EZVH 2A3QA 2CGOA 3B4SA 1MSWD 1Q82W 4JAUA 3G6EV 1GM9A 2X7RB 1YIJV 3J7AU 3QG5A 4DV2O 5L3GA 4PDVA 3H1JH 1XNRO 3RWRD 2PTMA 3MAQA 3I56V 1H2NA 5CB4B 5H2FZ 1HNWB 1H2KA 4GKJO 3CXHF 1QCEA 1K8AW 1Y66A 1ZLZA 1IBKB 3JD0A 2EINC 4JTDB 3AG2C 1WB8A 2LJ2A 4X1YB 1IXBA 2AZ2A 1JQ0A 1JJ2U 5H6QA 4BIOA 1SZXA 3AG2B 3CCSV 2Q4PA 1K9MW 4YIOA 2Q7EA 4FLTA 4I55B 3K03A 3JD1A 1AP5A 5H9CA 2H8PC 3C3SA 1JOYA 1I94B 1ZTEA 1KKDA 3TGUH 1WNSA 1ZWIC 2EIJC 3BABA 4FM1A 1R3LC 2IM9A 3OFNG 4F4LA 1ZUQA 2BTOA 1F23A 3QNEA 1EM1A 5AG2A 4ICGA 3LDDA 4X66B 2UUAO 4EFBA 4I55A 5LMNB 2B9ZA 4O2AB 1ZSPA 5KHIA 3G4SV 5GTIZ 3SJCC 3DGEA 1NH2B 5LA6A 4NKGB 3K5OA 4DV0B 1YTFD 4EB6A 4CZZA 4J41A 5ITZA 1E79G 2K9PA 4IYHA 1QU7A 4O4JA 1YCIA 4DR6O 4FFKA 3UT5B 1IBMB 1GN4A 3K57A 1VARA 1YDXA 3ZN0A 2K1EA 2GV9A 2ARHA 4UVCA 1Z5WA 3DC6A 4LF6B 2LQTA 3LNNA 2RDCA 2Q0OC 4LFAB 1VEWA 5LOVA 4FK5C 1LR1A 3RW0A 2UU9O 4Z1VA 3CEIA 4RQEA 3CCRV 4O4IB 2OCCC 4FVMA 3CCUV 2QKSA 1MOFA 1K7DA 1K5QA 1W0KG 2ZDIA 2Z0AA 4GUNA 2KSDA 1V54B 4DV3B 3CSXA 5LP6A 1D5NA 4X1IA 1ZAUA 1AI7A 3OMIB 1M93A 2V4DA 4O2BA 5LL6Y 4LF4O 4HAMA 1G1XB 5B66Z 5JCOA 2PYLA 3CX5F 3B40A 4N23A 3H1KH 4LFBO 5H5NA 1DF4A 1S77D 1FXKB 3HKCB 4X66O 3SR2C 3F5TA 3W7WA 4U7NA 1HW7A 2P22C 3OGCC 1AJNA 2OYQA 3JSLA 3RYCB 1FFXB 1VQLV 3MHSC 2LGQA 2Q6AA 2Q9LA 4GLXA 3CRCA 3FYEB 3RYIB 3K3WA 3WG7C 2UUCB 3O65A 2NNUA 2LO1A 1FYJA 2XNDG 3L75H 1ROPA 1I0HA 2F43G 4JPRA 1R6KA 1UPGA 5JVDA 4KHPB 1VQOV 3L70H 4FM0A 3O9OA 5LHGA 3B8MA 2UXDO 3RN4A 5KHGA 1RPRA 1HR0B 4DRXA 3AK3A 3QO7A 3ICXA 4MTGA 4XBFA 1JA8A 3IC7A 3LNMB 2F23A 4Q6GA 4WFBV 1YXBA 4BIUA 1YHQV 3WG7B 2ZNIA 3QTCA 1W2BU 4PI2A 2HJFC 1XL4A 3ABMC 4GX0A 4UUJC 1R1BA 5L3CA 1YZBA 4O2AA 4TUYA 2P6JA 1PPJH
chains in the Genus database with same CATH topology
1CXZB 2HJDA 2RMKB 1UPGA 4DYLA 4IGGA 4NKGB 1US6A 4NB5A 2Q0OC 1RFYA 1URFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CXZ B;  2HJD A;  2RMK B;  1UPG A;  4DYL A;  4IGG A;  4NKG B;  1US6 A;  4NB5 A;  2Q0O C;  1RFY A;  1URF A; 
#chains in the Genus database with same CATH topology
 2R72 A;  3ZMU A;  4DV5 B;  4ZKI A;  1DTO A;  3K59 A;  3APO A;  5J2T B;  1P7G A;  3HPL C;  3VQW A;  2RN9 A;  1M56 B;  4JI0 O;  1P49 A;  4JI3 O;  4FLU A;  2XAG A;  1K33 A;  1JMK C;  1XRE A;  3U0Z A;  2W6J G;  3L9D A;  2ZM6 O;  2OWO A;  3ZX6 A;  5B5E Z;  2B5U A;  2ZT9 B;  1AJP A;  4QNH B;  4UXN A;  2UXB O;  1B04 A;  2HLD G;  1I5X A;  5J2T A;  2DYS B;  1DGS A;  4B7E A;  2R70 A;  2QWO B;  2WLI A;  3WU2 Z;  1YVW A;  2GUZ B;  2PZS A;  2YXL A;  5EBL C;  3OAA G;  1VQ4 V;  3JCZ A;  4Q20 A;  1IX9 A;  4HBN A;  1TAE A;  4J80 A;  3AG3 B;  3CS5 A;  2JEU A;  4EKW A;  3AG4 C;  3MD0 A;  1XNQ O;  3JAR A;  3EXA A;  1BS3 A;  1EBO A;  4X62 O;  2W6I G;  4G27 B;  3VQX A;  3EVK A;  2GDS A;  3ABM B;  3FB5 C;  3T1H B;  1HNZ O;  1JVM A;  1FXH A;  1I5Y A;  3E83 A;  4ZI7 A;  5IJ0 B;  1BE3 H;  1J95 A;  4K3A A;  4LFB B;  4TQD A;  3ETE A;  3JAS B;  1AI5 A;  5IYZ A;  4DK1 A;  1OCO C;  4JZG A;  3FAV B;  4TV8 B;  1J5E O;  1L0L H;  4JYY A;  5K1P A;  2YSU B;  3BPZ A;  1X59 A;  4DR2 B;  1S5L Z;  4F6R B;  1O9H A;  5IY5 B;  5LXT B;  1EN5 A;  3ABL B;  1PNM A;  1LNQ A;  1XMO B;  4GZR B;  5E1A C;  1JCH A;  4JI1 O;  1QNM A;  4OGQ B;  4ABM A;  3ASO C;  3Q4H B;  3JD3 A;  4ASU G;  1RM1 B;  2HVJ C;  5DED A;  2CUG A;  1UJW B;  4NXN O;  4RO2 A;  2NN4 A;  2HJD A;  1DF5 A;  4O4H B;  1YIT V;  3OR6 C;  2EIM C;  5JVD B;  4UVA A;  1HNW O;  1PNK A;  2WLM A;  1AP6 A;  4TV9 B;  1GO3 F;  1S0V A;  2ILM A;  1QBZ A;  4P30 A;  5KUK A;  1XMQ O;  3LSU A;  1G4Y B;  2JGU A;  1FXV A;  1OCR C;  1UFI A;  4GX1 A;  1OCR B;  4MS2 A;  4H33 A;  4FLY A;  3BEH A;  2VQF B;  4R7C A;  1AB3 A;  3CHX A;  4DV4 B;  4RAI A;  4JYA O;  1KEC A;  3F7V C;  1F4M A;  1XHX A;  1NT2 B;  4J10 A;  1OCZ B;  2HHH B;  1V54 C;  4LFC O;  3I5D A;  4XDL A;  3CP1 A;  5EIB D;  4YHH O;  1IBM O;  3ASO B;  4DUZ O;  1PV0 A;  1R6N A;  5IY5 C;  3K5N A;  2A7W A;  1OV9 A;  2CAZ C;  1MZE A;  2JS5 A;  1Q8I A;  1IXM A;  3KKY A;  3E22 A;  4TV9 A;  5JJN B;  4QE9 A;  3ABL C;  2Q73 A;  1H2M A;  4DV6 B;  2X6B A;  4B3R O;  5LGU A;  1XL6 A;  2UU9 B;  2A79 B;  1L0N H;  4JI2 B;  4AQY O;  1N34 B;  2LFS A;  1ORQ C;  2PF4 E;  3R66 A;  3C90 A;  2YEV A;  2F95 B;  3OM3 B;  3TJT A;  1WP8 A;  3SPG A;  5LXT A;  2EX3 A;  3FFQ A;  3BVO A;  4LR3 A;  2VWJ A;  3RT3 C;  2ZIN A;  4KFM A;  3N2K B;  1SQQ H;  3AG1 C;  3WFV A;  4WBN A;  4TQF A;  4DR1 B;  3STZ C;  2M6Y A;  1Q90 D;  5KLV H;  2YIA A;  1VF7 A;  2UXC B;  2QWP B;  4H44 B;  1SQV H;  3T4D A;  4R8C A;  2O57 A;  2D2C B;  4X65 B;  1ENV A;  4RUE A;  1NS1 A;  4IT5 A;  4BW9 A;  1SET A;  3CYO A;  1THZ A;  3RYF B;  2R9I A;  4IIJ A;  4MVO A;  5ITZ B;  2RMK B;  4LH6 A;  4TSF G;  4UV8 A;  3D3I A;  3CME V;  5B1N A;  2ZCE A;  3CJH B;  1H2L A;  1HNX O;  3CC4 V;  2PI4 A;  4A5U B;  1FKA O;  3ZRW B;  1EFR G;  3ZN1 A;  1PKX A;  3QO8 A;  4FLV A;  2B1I A;  2ZNJ A;  4HNA A;  4IIJ B;  1KC8 W;  2UUB B;  1N0J A;  4BAY A;  1SQG A;  4AHC A;  3AG1 B;  5EIB C;  3TXS A;  2YI8 A;  1EN6 A;  5CB4 A;  5IYZ B;  3PN1 A;  4AI8 A;  1L1F A;  4DR5 B;  3LDC A;  4DV0 O;  1SQB H;  1XBL A;  4DV6 O;  4IHJ B;  1ZX3 A;  3SYC A;  2Y69 C;  3SJA C;  1IBK O;  2L35 A;  4OPH A;  2QA4 V;  2XAS A;  3UCS C;  2L6L A;  3BA9 A;  3OT7 A;  1COW G;  3S3X A;  1XNR B;  1YF2 A;  1WJZ A;  1SA0 A;  2ATK C;  4PV1 B;  1Q6U A;  4J7J A;  4LNU A;  3CC2 V;  1KB9 F;  2Y69 B;  2CH7 A;  1I94 O;  4JI0 B;  5JH7 B;  1PL4 A;  3CCE V;  3K0G A;  4P9P A;  1Q86 W;  2XUM A;  4B3T O;  2C2A A;  1O9G A;  1OCZ C;  1RSO A;  3K08 A;  3TET A;  3HKB A;  4CS3 A;  4BWA A;  4DXW A;  2XT9 A;  4DR4 O;  1RP3 B;  1EZJ A;  3CRQ A;  3JAM N;  3KG2 A;  4FIP C;  2IH3 C;  1S5J A;  2EIK B;  3E2E A;  2QKC A;  5EK0 A;  1X4T A;  3J81 N;  1K34 A;  2LFR A;  5CMU A;  4BIZ A;  2ZR2 A;  1Q81 W;  1DK1 A;  5GTH Z;  2HP8 A;  1VQ9 V;  4JV5 O;  2EUL A;  1PP9 H;  4UCR A;  2PYJ A;  2VS0 A;  3CRR A;  3OR7 C;  3FYI B;  2CTP A;  4MTX A;  2OCH A;  2XAQ A;  3ZMT A;  3JCU Z;  2DQ0 A;  2QDO A;  4U3J B;  3THO A;  4WFH A;  3W7S A;  4LF5 O;  4DR3 B;  1RSO B;  4PA9 A;  4LWS B;  2PUS A;  3BHP A;  4MVZ A;  1WP7 A;  3K0D A;  1E1R G;  1IDS A;  4OXS A;  5KUM A;  1YJ9 V;  1VQ8 V;  1Y76 B;  4I50 A;  3E8F A;  4GYC B;  4KL1 A;  1YSC A;  1KP3 A;  2WAM A;  3HKD B;  1M90 W;  5JJE B;  4UV9 A;  3KZI Z;  3W7U A;  4G28 B;  3MHH C;  3FB7 C;  4CH6 A;  4F6R A;  2DN9 A;  4FZ0 A;  3GVM A;  2EIK C;  4NXM B;  3WB1 A;  2QWN B;  3ETG A;  3HKB B;  4JI6 B;  5GON B;  4O4I A;  1T5E A;  2LW1 A;  3SPI A;  3NXS A;  2NLJ C;  3QF7 A;  1SS3 A;  2Y0I A;  5KHK A;  2HFE C;  5KMG B;  1AI6 A;  2IH1 C;  1TUB B;  3B8N A;  3CMA V;  2CH7 B;  1B06 A;  1QLE C;  5JH7 A;  1S76 D;  5KHH A;  4DK0 A;  2ODM A;  4FLZ A;  3RGB A;  4OX9 O;  1IUR A;  5KAI Z;  5IDJ A;  1D5A A;  2JDI G;  1SRY A;  4UCU A;  1JR9 A;  3G6B A;  3HKE B;  3SYQ A;  4JI2 O;  1S72 V;  4J42 A;  2YIC A;  3W7X A;  1BHA A;  2ZQM A;  3SPJ A;  4TOI A;  1N36 B;  4PDM A;  1CXZ B;  1P4R A;  1M9N A;  2ITC C;  1ZL8 B;  2DW4 A;  1AVM A;  2ZR3 A;  3OGI B;  2XAH A;  2E75 B;  2FTK A;  2IJH A;  3N2G B;  2M7W A;  4R50 A;  3ZHQ A;  3CWB H;  4QGP A;  3D36 C;  2ZE5 A;  1NR7 A;  4DRX B;  1VQP V;  2RJZ A;  2ZXW B;  1TA8 A;  4LF5 B;  1FAF A;  2BSK B;  3BFR A;  3ZHV A;  4W4L A;  2F4V B;  2N05 A;  1SQF A;  2ZIM A;  4B3R B;  4DV7 B;  2WLN A;  1RM1 C;  1YJN V;  2ADQ B;  3AK1 A;  4R6Z A;  4DUY O;  1Q7Y W;  4CBC A;  2V7Q G;  5B1B C;  3K9A A;  4UVB A;  3QO5 A;  2GUZ A;  4GCZ A;  3QVN A;  1GH6 A;  1LUW A;  4B3S O;  4B7K A;  2HHH O;  2ETN A;  2Z3Y A;  4JV5 B;  3SPC A;  5FPO A;  2WLJ A;  4YHH B;  2N74 A;  4JI4 B;  4FZ1 A;  4DUZ B;  3GWK C;  2QKA A;  4PA4 A;  3BCC H;  2VQE B;  3WB2 A;  2MK3 A;  1JFF A;  1BT8 A;  4KP4 A;  2VQF O;  3L71 H;  2AHY A;  3Q4H A;  4DV4 O;  4DR7 O;  1K73 W;  5J2U B;  3ZED A;  5BZB A;  4O2B B;  2ZD9 A;  1GN6 A;  1GKF A;  2Q8V A;  3KCY A;  1F7Y A;  1GK9 A;  1R3J C;  3LUT B;  3L72 H;  4B3M O;  4X20 A;  3RYC A;  1N36 O;  4K8X A;  3CC7 V;  3UO3 A;  5FPR A;  4JTC B;  5A2Q N;  2JVD A;  4YY3 B;  1IBL B;  4JI6 O;  3EHB B;  3ASN C;  3G67 A;  2GTA A;  2YS8 A;  5EC1 C;  5B1A B;  4LF9 O;  2DJV A;  2VWK A;  1JPX A;  2BTQ A;  2W0F C;  1Q6H A;  1N32 B;  4MW3 A;  3OMA B;  3T1C A;  5LHH A;  3JAK B;  3JD2 A;  4GX5 A;  2EIJ B;  4DV3 O;  1GMG A;  1SA0 B;  1F4N A;  2JEX A;  3UM7 A;  1NTZ H;  1TVK A;  3JSN A;  5DEC A;  4B08 A;  1BQ0 A;  1TUE B;  4DV1 O;  4X9Q A;  2QEX V;  1GM8 A;  2ZXW C;  1CEZ A;  4AIL C;  4JI3 B;  4X8A A;  1KD1 W;  3HKE A;  3T1H O;  1OZ0 A;  3H1I H;  3UQ8 A;  4CH4 A;  3FB8 C;  1RFY A;  4I9Q A;  3DTU B;  3OUS A;  2FB5 A;  4U7O A;  3ZBH A;  2EBO A;  3ETD A;  4WCE V;  1VQN V;  4ZHQ A;  2PY5 A;  4WFE A;  1R3I C;  1J5E B;  4QPJ A;  5LMU O;  2N04 A;  5FL7 G;  1KU9 A;  2AHZ A;  4UCO A;  1Y74 B;  3APQ A;  4DR7 B;  2P90 A;  1AI4 A;  3BRC A;  3KCX A;  2WLK A;  2JJ2 G;  1K4D C;  3FD9 A;  3T1Y O;  3X2Q C;  1KBH A;  4ZHQ B;  3OW2 U;  4NTW A;  1NTK H;  1URF A;  4XDJ A;  3OTO B;  3ABU A;  4K35 A;  3B2E E;  5LP6 C;  3E35 A;  1XEQ A;  2WA4 A;  3RYI A;  3VQV A;  1XIL A;  4I5S A;  3VQY A;  2JJ1 G;  4E2L A;  1Q5O A;  1BL8 A;  2XHB A;  2UXB B;  4RUF A;  4UFZ A;  3GWO A;  5CBF A;  4O4L A;  1GRJ A;  3L73 H;  4IGG A;  3VBB A;  2RCV A;  1I7F A;  2CTW A;  1GM7 A;  1OCC B;  2FL4 A;  2BOC C;  4WBN B;  1V9P A;  3ML0 A;  3K06 A;  3CCJ V;  1AR1 B;  1XQ8 A;  2DWD C;  2EJ7 A;  4UCT A;  4BR6 A;  2HKO A;  3ZRS A;  1G8M A;  3CCQ V;  4Z1M G;  5IWA O;  3OTO O;  4NXN B;  2DYS C;  4E4E A;  4JI5 O;  1BQZ A;  1FPO A;  5LYJ A;  5FLX N;  5LBQ A;  4K0K B;  4J7K A;  1VF5 B;  4UCV A;  3E8B A;  4MT8 A;  5CBG A;  4EEQ A;  4MVS A;  3OEE G;  3IFX A;  5JQG A;  3SGI A;  4CH5 A;  4PA7 A;  3H9V A;  1Z5V A;  3P3N A;  2F93 B;  3B09 A;  1M4U A;  5IJ9 A;  5IJ9 B;  1Q3E A;  3UO2 A;  5LMU B;  4BW5 A;  4PEL A;  2YDE A;  4QJF B;  2WLH A;  5JWP A;  1AR4 A;  4PI0 A;  4J7Z A;  5L3B A;  4GKK B;  5JQG B;  5LGN A;  1Y6X A;  2QSA A;  3OMN B;  1H8E G;  3I55 V;  2JS3 A;  5EC2 C;  4XDK A;  1JFF B;  2DQ3 A;  3CRA A;  2YIB A;  4LF4 B;  2EIM B;  2ZIO A;  4TT3 G;  1VF6 C;  2Q5Z A;  4HNA B;  5IYB O;  1MA1 A;  2AXT Z;  2QM8 A;  2JGD B;  4NXM O;  1SKV A;  2AW9 A;  4DR3 O;  1BSM A;  2WLL B;  1KMI Z;  4JI5 B;  2IU3 A;  3SYP A;  4EB6 B;  3OUF A;  2E5L B;  2B1G A;  5LOV B;  3N27 A;  4JI4 O;  2ZKO A;  2BE3 A;  5H6R A;  3FAV A;  1B3Q A;  2Q7H A;  3IC9 A;  1XMO O;  3T2M A;  5BR8 B;  3D8C A;  4O4L B;  4JYA B;  4J9Y B;  2EZP A;  1SQX H;  1EN4 A;  1OCO B;  3CCV V;  4O4J B;  1NR1 A;  1RPO A;  4H37 A;  1A32 A;  2CGN A;  3CXC U;  1WA8 A;  3IJ4 A;  4LH7 A;  1H38 A;  3K04 A;  2QR4 A;  3FKS G;  2AGA A;  1QHT A;  2Y0P A;  3BAA A;  4JI8 B;  1IZ3 A;  1K92 A;  4DV2 B;  2UXD B;  4X89 A;  4B3S B;  1QR9 A;  2DYR B;  5A9G A;  1H2S B;  3AG3 C;  1NTM H;  2H94 A;  1AIL A;  4NVP A;  4MSW C;  1BZK A;  2LP7 A;  3RYF A;  4LBE C;  4IYI A;  1OHH G;  2QGN A;  4KUM A;  3D36 A;  4JGS A;  5EYP B;  3RVY A;  1E1Q G;  3JD4 A;  4DO2 A;  4YJ2 B;  2RNB A;  3E89 A;  2Q7G A;  3AK2 A;  2R9R B;  3HKC A;  2PI5 A;  4JZ2 A;  1QVF U;  5KHJ A;  1MG1 A;  2ITD C;  4O4H A;  3CE2 A;  1WB7 A;  3A0R A;  2HR3 A;  2BOB C;  1NI8 A;  3ZS8 C;  4MTO A;  4OPA A;  5CA0 B;  4I4T B;  4YJ3 A;  4YJ2 A;  2QWQ B;  1GN2 A;  3M8A A;  5EYP A;  1G6U A;  4H0L B;  1MAB G;  1IVS A;  1DLB A;  1P84 F;  4L87 A;  1WPB A;  4N21 A;  4ZOL A;  3ZHU A;  1NBM G;  5CA0 A;  1WN7 A;  3SJB C;  1TGO A;  2QM4 A;  2E76 B;  4FLW A;  1WA8 B;  1VQ7 V;  1YI2 V;  2BTQ B;  2BCC H;  5IYD O;  4K8Z A;  1Y76 A;  2YIB D;  4UB6 Z;  4X88 A;  1SQP H;  5KMG A;  2JK5 C;  1CPY A;  3A2F A;  3JYC A;  4WFG A;  1VIB A;  2GBO A;  1HDJ A;  3T4Z A;  4DR1 O;  4PA3 A;  3UT5 A;  2KKW A;  2ZE7 A;  3E8G A;  2MW2 B;  3OE7 G;  4FJC C;  4YY3 O;  1IBL O;  3MDS A;  2QM7 A;  4NTX A;  1HWY A;  4X65 O;  5D5P A;  3L74 H;  2JGD A;  3CB2 A;  2OTL V;  1FJG O;  3JAL B;  5TIS Z;  4IL6 Z;  4H13 B;  3OEH G;  3TK1 A;  4LWS A;  2YUA A;  3STL C;  4DR2 O;  2X6C A;  4JYC A;  3ZHR A;  2X6A A;  1FFT B;  2ADP A;  3ABT A;  3ZHT A;  3P3P A;  5CA1 B;  2KQX A;  4B3M B;  2FKX A;  2XAJ A;  1N33 O;  3ZCC A;  5DN6 G;  2Y4T A;  4FPP A;  2UUB O;  2G38 A;  1WAZ A;  5B3S B;  2Y4U A;  3CRM A;  5C8Y B;  2QWR B;  1NJI W;  4LF7 B;  3SPH A;  1WPX A;  1ZL8 A;  1FFX A;  3LSQ A;  2Z5U A;  2X0L A;  3AG7 A;  1VQM V;  4HZ3 A;  3ZIA G;  4LFA O;  4I9W A;  3ZMV A;  5F2V O;  1HR0 O;  5D5Q A;  4X1Y A;  2EZO A;  5GW7 A;  2PGG A;  2ZDI C;  3SYA A;  1FXK A;  1NU1 H;  2QTS A;  3ABK B;  2BSK A;  3GB7 C;  3M99 B;  2GHY A;  5E79 Z;  1NQT A;  1BGY H;  2CDY A;  4JYB A;  3ETQ A;  4PJ0 Z;  3N2G A;  4EFE A;  2QE7 G;  3T1Y B;  4LFC B;  1N33 B;  3BY6 A;  3HB3 B;  4CC5 A;  5EZY B;  2R9A A;  1TUB A;  1SF9 A;  4FMT A;  2Q0A A;  4TWK A;  4MTF A;  5CBH A;  2JIZ G;  4ZIB A;  3CCL V;  4LF7 O;  1M57 B;  4TUY B;  4JI7 B;  4WFA V;  1XHZ A;  1F51 A;  1M57 C;  4DR4 B;  4NB5 A;  4D6T H;  2E5L O;  1S5H C;  1GAX A;  2IJK A;  2W0X A;  1FXK C;  2KB1 A;  3NR7 A;  3DXR B;  1AR5 A;  1HP8 A;  1KKC A;  2GTS A;  4YXW G;  5BMV B;  1ARO P;  4DUY B;  3AEI A;  2XTA A;  4DW1 A;  2CTQ A;  5J2U A;  3ZRX A;  2DOS A;  3DSQ A;  4Z2W A;  5K1X A;  2UUC O;  1HNX B;  2F66 C;  2F1M A;  5BY1 A;  3TXQ A;  4LC1 A;  5KA5 A;  1NZ6 A;  5CA1 A;  1NVP D;  2Q68 A;  4FFB A;  5KA6 A;  3ABK C;  1V55 B;  4QE7 A;  4C7U A;  1NKD A;  1V55 C;  2GSM B;  2NR5 A;  1XNQ B;  1L8D A;  1KP2 A;  4P2Z A;  5B1B B;  3TCU A;  4LF6 O;  2WLI B;  3RFR A;  4GX2 A;  1Y67 A;  1JJO A;  1N8R W;  3JAS A;  2DWE C;  1SER A;  4I4T A;  5IWA B;  3HR0 A;  4MW8 A;  4UCS A;  3ZHS A;  3E8H A;  1AJQ A;  1PD3 A;  4K0K O;  5C93 A;  4W4K A;  1H8H G;  4UB8 Z;  5LYJ B;  3ZRV A;  1M1K W;  3SDL A;  3G71 V;  2EIL C;  2XAF A;  3RYH A;  1U97 A;  1KUQ A;  2JRI A;  3E86 A;  5FNV B;  5LP6 B;  1HNZ B;  4JI7 O;  3J80 N;  2YID A;  2ZM6 B;  1SZT A;  2WSS G;  5LHI A;  2OIE A;  1WLE A;  1VF6 A;  4B3T B;  3SJQ C;  1I08 A;  1LUV A;  4I7Z B;  4JAS A;  4DV5 O;  2XOK G;  4WF9 V;  2KG7 A;  1MSD A;  4WFF A;  4DR6 B;  2UXN A;  2E3C A;  4DV1 B;  1K97 A;  1W59 A;  5KX5 A;  2IW5 A;  4D7T A;  1NH2 D;  2IJI A;  4NYK A;  5CA3 A;  5IYC O;  2EJR A;  3ZJZ A;  4AQY B;  1N34 O;  4PDR A;  3JAR B;  2DE0 X;  4CS4 A;  2KG7 B;  2YXY A;  2HG5 C;  1VQK V;  3BA8 A;  3N2K A;  2HVK C;  3WB0 A;  5IE9 A;  1BCC H;  2P5O A;  3IGA C;  5JJJ B;  3C3T A;  5EBM C;  3AG4 B;  3JAW B;  4J9Z B;  1N0N A;  4NR1 A;  2CE4 A;  5EBW C;  2IJJ A;  2YXH A;  2A9H A;  3CCM V;  1FS0 G;  5J9P C;  3VOU A;  5B3S C;  4X20 B;  1XDC A;  1Z2G A;  4PA6 A;  1YTF B;  4DW0 A;  1S3J A;  4JF3 A;  1R3K C;  1KYO F;  1XUQ A;  1U96 A;  2FYU H;  3P30 A;  1JX9 A;  1XOU A;  4FLX A;  4U3F H;  3K58 A;  3K5L A;  1FD9 A;  2P4V A;  4I0X A;  1Y74 A;  4RQF A;  1Y4M A;  1Q43 A;  3OTF A;  2E74 B;  1YJW V;  4JI8 O;  4LF8 O;  3D3Q A;  3JAK A;  5JCO C;  4JAV A;  5HFM A;  5B1A C;  1QQC A;  1D2D A;  2OCC B;  4QIW F;  5DM6 V;  3ASN B;  3JAL A;  3UKM A;  2P4K A;  2Q67 A;  2ZE8 A;  4X64 O;  2QTO A;  2WLL A;  4PDL A;  4KXR A;  3JAT B;  4I0X B;  4KHP O;  1VQ5 V;  3FB6 C;  3B77 A;  5BR8 O;  4TV8 A;  4PHZ A;  5CN0 A;  2YEV B;  2AZ0 A;  5B1O A;  2UXC O;  1SC5 B;  5EZY A;  2IBZ H;  2DYR C;  1TVK B;  5L3D A;  1R6T A;  2OT5 A;  1OCC C;  5FNV A;  5IT9 N;  3F5W C;  1H2G A;  1FJG B;  2CK3 G;  4QPK A;  2A0L A;  1MNG A;  3PJS K;  4OX9 B;  5C8Y A;  3RVZ A;  4ZI7 B;  5IJ0 A;  3G80 A;  3H01 A;  3CD6 V;  1Q6I A;  3JAW A;  1K4C C;  1MMM A;  4YJ3 B;  4RWU A;  3K9S A;  1GTO A;  3F7Y C;  3DXR A;  3A8T A;  4LCU C;  3CPW U;  3X2Q B;  3IAY A;  4LF9 B;  2V1D A;  4ZOL B;  1XMQ B;  2YI9 A;  1P7B A;  3K5M A;  1N32 O;  4X62 B;  3RBZ A;  5HFL A;  5GON A;  1B6Q A;  3K79 A;  4F6E A;  2CTR A;  3RYH B;  1QLN A;  1BHB A;  2EIL B;  1PM9 A;  1XI1 A;  2D3O W;  3P32 A;  2F4V O;  2P06 A;  1SES A;  4MVR A;  1M56 C;  4IHJ A;  3HKD A;  1K3E A;  1VP7 A;  4P9O A;  2OTJ V;  3A0H Z;  1VQ6 V;  2EIN B;  4FFB B;  2Y48 A;  5LGT A;  1MZF A;  1GN3 A;  4LF8 B;  3R65 A;  3SYO A;  3DC5 A;  3A0B Z;  4G2K A;  4X1K A;  1CP9 A;  3H1H H;  4X1I B;  4CH3 A;  3U10 A;  4HYO A;  4X64 B;  4DYL A;  5L3E A;  5KAF Z;  4FM2 A;  1N4C A;  4CS2 A;  3ZMZ A;  5BMV A;  4L8J A;  1KQS U;  1W0J G;  2VQE O;  5LMN O;  4NTY A;  2HEP A;  4ZBM A;  4DR5 O;  4YIP A;  3JAT A;  2UXX A;  2QJ1 A;  2LW7 A;  2OIG A;  4I50 B;  4GKK O;  4MVQ A;  4PD4 F;  1YEW A;  3CJH A;  4DV7 O;  4J11 A;  3EFF K;  5L3F A;  4JTA B;  2A06 H;  4JAA A;  1QLE B;  3ZMS A;  3OD4 A;  1PNL A;  1K5S A;  4U3J A;  1BMF G;  1R73 A;  2P7T C;  2LGW A;  1NVP B;  4X1K B;  2DMX A;  2P67 A;  3H1L H;  5BXZ A;  1QR8 A;  3W7T A;  4LP8 A;  4CC6 A;  3U11 A;  2WWW A;  3E22 B;  4GKJ B;  1VMG A;  4JI1 B;  5KX5 B;  3LDE A;  2H3O A;  2FML A;  2UUA B;  4LNU B;  1M5I A;  4GT1 A;  3ZRW A;  2Q69 A;  5LA6 B;  1PL0 A;  2RQ6 A;  2IU0 A;  2YC0 A;  4MVU A;  3S3W A;  3FX7 A;  1QVG U;  2ZE6 A;  2VRZ A;  3LSS A;  2WA3 A;  3M7M X;  4MVM A;  4D7S A;  1US6 A;  2WPD G;  1OJH A;  1EZV H;  2A3Q A;  2CGO A;  3B4S A;  1MSW D;  1Q82 W;  4JAU A;  3G6E V;  1GM9 A;  2X7R B;  1YIJ V;  3J7A U;  3QG5 A;  4DV2 O;  5L3G A;  4PDV A;  3H1J H;  1XNR O;  3RWR D;  2PTM A;  3MAQ A;  3I56 V;  1H2N A;  5CB4 B;  5H2F Z;  1HNW B;  1H2K A;  4GKJ O;  3CXH F;  1QCE A;  1K8A W;  1Y66 A;  1ZLZ A;  1IBK B;  3JD0 A;  2EIN C;  4JTD B;  3AG2 C;  1WB8 A;  2LJ2 A;  4X1Y B;  1IXB A;  2AZ2 A;  1JQ0 A;  1JJ2 U;  5H6Q A;  4BIO A;  1SZX A;  3AG2 B;  3CCS V;  2Q4P A;  1K9M W;  4YIO A;  2Q7E A;  4FLT A;  4I55 B;  3K03 A;  3JD1 A;  1AP5 A;  5H9C A;  2H8P C;  3C3S A;  1JOY A;  1I94 B;  1ZTE A;  1KKD A;  3TGU H;  1WNS A;  1ZWI C;  2EIJ C;  3BAB A;  4FM1 A;  1R3L C;  2IM9 A;  3OFN G;  4F4L A;  1ZUQ A;  2BTO A;  1F23 A;  3QNE A;  1EM1 A;  5AG2 A;  4ICG A;  3LDD A;  4X66 B;  2UUA O;  4EFB A;  4I55 A;  5LMN B;  2B9Z A;  4O2A B;  1ZSP A;  5KHI A;  3G4S V;  5GTI Z;  3SJC C;  3DGE A;  1NH2 B;  5LA6 A;  4NKG B;  3K5O A;  4DV0 B;  1YTF D;  4EB6 A;  4CZZ A;  4J41 A;  5ITZ A;  1E79 G;  2K9P A;  4IYH A;  1QU7 A;  4O4J A;  1YCI A;  4DR6 O;  4FFK A;  3UT5 B;  1IBM B;  1GN4 A;  3K57 A;  1VAR A;  1YDX A;  3ZN0 A;  2K1E A;  2GV9 A;  2ARH A;  4UVC A;  1Z5W A;  3DC6 A;  4LF6 B;  2LQT A;  3LNN A;  2RDC A;  2Q0O C;  4LFA B;  1VEW A;  5LOV A;  4FK5 C;  1LR1 A;  3RW0 A;  2UU9 O;  4Z1V A;  3CEI A;  4RQE A;  3CCR V;  4O4I B;  2OCC C;  4FVM A;  3CCU V;  2QKS A;  1MOF A;  1K7D A;  1K5Q A;  1W0K G;  2ZDI A;  2Z0A A;  4GUN A;  2KSD A;  1V54 B;  4DV3 B;  3CSX A;  5LP6 A;  1D5N A;  4X1I A;  1ZAU A;  1AI7 A;  3OMI B;  1M93 A;  2V4D A;  4O2B A;  5LL6 Y;  4LF4 O;  4HAM A;  1G1X B;  5B66 Z;  5JCO A;  2PYL A;  3CX5 F;  3B40 A;  4N23 A;  3H1K H;  4LFB O;  5H5N A;  1DF4 A;  1S77 D;  1FXK B;  3HKC B;  4X66 O;  3SR2 C;  3F5T A;  3W7W A;  4U7N A;  1HW7 A;  2P22 C;  3OGC C;  1AJN A;  2OYQ A;  3JSL A;  3RYC B;  1FFX B;  1VQL V;  3MHS C;  2LGQ A;  2Q6A A;  2Q9L A;  4GLX A;  3CRC A;  3FYE B;  3RYI B;  3K3W A;  3WG7 C;  2UUC B;  3O65 A;  2NNU A;  2LO1 A;  1FYJ A;  2XND G;  3L75 H;  1ROP A;  1I0H A;  2F43 G;  4JPR A;  1R6K A;  1UPG A;  5JVD A;  4KHP B;  1VQO V;  3L70 H;  4FM0 A;  3O9O A;  5LHG A;  3B8M A;  2UXD O;  3RN4 A;  5KHG A;  1RPR A;  1HR0 B;  4DRX A;  3AK3 A;  3QO7 A;  3ICX A;  4MTG A;  4XBF A;  1JA8 A;  3IC7 A;  3LNM B;  2F23 A;  4Q6G A;  4WFB V;  1YXB A;  4BIU A;  1YHQ V;  3WG7 B;  2ZNI A;  3QTC A;  1W2B U;  4PI2 A;  2HJF C;  1XL4 A;  3ABM C;  4GX0 A;  4UUJ C;  1R1B A;  5L3C A;  1YZB A;  4O2A A;  4TUY A;  2P6J A;  1PPJ H; 
#chains in the Genus database with same CATH homology
 1CXZ B;  2HJD A;  2RMK B;  1UPG A;  4DYL A;  4IGG A;  4NKG B;  1US6 A;  4NB5 A;  2Q0O C;  1RFY A;  1URF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...