1RFYA

Crystal structure of quorum-sensing antiactivator tram
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
KKVELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEMHAQMSALNTLISILGFIPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quorum-sensing antiactivator TraM forms a dimer that dissociates to inhibit TraR
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transcription
molecule keywords Transcriptional repressor traM
total genus 33
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09228 Prok-TraM Prokaryotic Transcriptional repressor TraM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1rfyA00
2RMKB 1RFYA 4DYLA 4NB5A 2Q0OC 1URFA 4IGGA 1UPGA 2HJDA 4NKGB 1CXZB 1US6A
chains in the Genus database with same CATH superfamily
3M99B 1Z5WA 2ITCC 1IBLB 1N32O 4LF7O 5C93A 2HR3A 4YJ3A 4FLVA 1G8MA 2Q7HA 5GONB 1TVKB 3B77A 5EZYA 2YXYA 3KKYA 3PN1A 1XL6A 2D2CB 3MD0A 4JYBA 1P7BA 2AHZA 1BGYH 4K0KO 3H1JH 4DV6O 2A7WA 2Q8VA 1Q86W 4KUMA 3HKBA 3ICXA 1H2GA 3P3PA 1J5EB 2QWOB 4JI5O 1QVFU 1EZVH 2W6IG 4ZHQA 1I7FA 3L74H 2DWDC 4BWAA 4GKJO 4P9PA 4RO2A 3UKMA 2PI5A 1ZX3A 2RCVA 3D36C 1AROP 5LMUB 3CXHF 1XMQB 2ZM6B 1Y74B 3ZHQA 2PY5A 5IY5C 3CYOA 3LNMB 1JFFB 1KQSU 4B3MB 1KMIZ 1YZBA 3KZIZ 1BS3A 3OUFA 3M7MX 4O2AB 4JAAA 1R1BA 5CBHA 2ZD9A 2QWNB 2GHYA 3W7UA 4UCUA 1VARA 1QHTA 3CC7V 2MK3A 3UT5B 4YIOA 2KQXA 3QO7A 4PDVA 2XNDG 2RJZA 4MVMA 3FAVA 1AB3A 3T1HB 2F93B 5CA0B 3SDLA 3BA8A 2PUSA 2FYUH 3B4SA 1NVPB 5J2UB 1JCHA 1Y6XA 5C8YA 1Y4MA 1N36B 2AZ2A 1OCZC 2UU9O 5LOVB 5BXZA 1M57C 3MHSC 4PA9A 1IBMO 4UCVA 1WNSA 2JJ2G 3WB2A 5IJ9B 4B7EA 4JASA 1IX9A 1M57B 2OWOA 1TVKA 4X8AA 3R65A 5GONA 4DUYO 4YJ3B 4O4HA 4JF3A 5J9PC 4Z2WA 4X1KA 4LF5O 4I4TA 4LCUC 1O9GA 1NZ6A 4TWKA 3CS5A 4UVBA 3CWBH 3SPCA 4DV0B 1TUBA 2CE4A 4O4JB 4LF4B 2P90A 2BSKA 3K04A 1ZLZA 4QPKA 4UCSA 4JZ2A 5KX5A 4HNAB 2IJIA 3JD2A 3R66A 2ZQMA 4WFBV 1IURA 3N27A 2QKSA 3NXSA 1XMOO 4MVQA 5B1AC 2DOSA 3BFRA 3CMAV 3FB6C 3P30A 1VQ7V 3CB2A 5B1AB 5GTHZ 2Z3YA 5JJNB 2L35A 4WFGA 1RP3B 3ZEDA 1M56C 1V55B 4DV1O 2GV9A 2EJ7A 3F5WC 2GTAA 1K9MW 3TCUA 4BW9A 1YSCA 1DF5A 1JX9A 2ZE5A 3A0RA 3ASNB 3CCEV 3EVKA 3LSSA 2UU9B 4NYKA 2P6JA 2EZPA 3HKDA 3U10A 3W7WA 4JTDB 4I9WA 2Q4PA 4RUEA 5JQGB 3OEEG 1HR0O 1L1FA 5IYBO 1N36O 4PA4A 3UCSC 3E8FA 2B5UA 4JI2B 2PI4A 3HKCA 4I50A 1V9PA 5JQGA 2GSMB 3FFQA 5LHHA 4I5SA 1S76D 3OMNB 5A2QN 4HYOA 4X89A 4GZRB 2FB5A 4MVRA 4U7NA 3SJQC 1RM1C 3JD0A 4JI8B 3X2QC 4X1IA 1BL8A 2FTKA 3AG4B 3JALA 3H1IH 4FLXA 2ARHA 3ABLC 3AK3A 2QTSA 2FKXA 2EILB 3D8CA 5D5PA 1K4CC 2QSAA 5EBWC 3UO2A 3A8TA 1Q6IA 4X1IB 2EIJB 3B8MA 4LC1A 4JV5B 4IYHA 4ICGA 3UO3A 2UXCB 1PL4A 1F4NA 1JA8A 4LFAO 1GN3A 2N74A 3MDSA 2CAZC 4DV0O 5JWPA 4TQFA 5CN0A 5KHGA 1GN6A 5EBMC 1PNKA 3SJCC 1Q43A 3IFXA 1XQ8A 3MHHC 1F7YA 4DV4B 4OXSA 2R9IA 1JPXA 2C2AA 3RYFA 4TUYB 4FFBA 1MABG 2YDEA 2R70A 1GM7A 1I94O 2YI8A 1L8DA 4GLXA 2H3OA 5IT9N 4PI2A 1ZL8A 4GX2A 2E75B 3JCUZ 4P9OA 3LUTB 3SYQA 1H2NA 1GK9A 1OCOB 4FLYA 5EIBD 1LUVA 1N33O 1MSWD 1H2LA 1G1XB 1GO3F 2GDSA 2QM7A 1R6TA 4UCTA 2PGGA 5LP6A 3STZC 3CRCA 2K9PA 1XOUA 1R3IC 1VQKV 2QE7G 1HNWB 2JGDA 3GVMA 3THOA 4O4LA 4GKKB 5IYDO 4RWUA 3UT5A 1FJGB 2IU3A 1EN4A 4U7OA 3CRAA 4D7SA 1AR1B 3RYHB 2ZE7A 4JV5O 2EX3A 1F51A 3BVOA 1NBMG 2W6JG 3L73H 3JASB 4X66O 4B3RO 3ASOB 4O4JA 2YEVA 3OE7G 4UB8Z 4ZIBA 5KLVH 3CXCU 3FB5C 4XBFA 1FXKA 1PD3A 2Y0IA 2DQ0A 1QLEC 2IU0A 3IC9A 1M90W 1F23A 1W0KG 3QO8A 1EM1A 2WSSG 3GWOA 2KSDA 2P7TC 3RWRD 3E8GA 5JVDB 2JEUA 2XAQA 1KYOF 4IL6Z 2G38A 2LJ2A 4FFKA 1BCCH 1RPRA 2QKCA 4JGSA 4ZHQB 1N0JA 3RYHA 1KBHA 1NR7A 4DV3O 2YIAA 1X59A 2E5LB 1N33B 3K59A 3ZMZA 2P22C 4WBNA 4X65O 2EIKC 4EFEA 1BHBA 3UQ8A 2VRZA 3FAVB 4AILC 1B6QA 2QWPB 1QQCA 4LP8A 3BA9A 3ZN1A 2Q0AA 1M9NA 2ZCEA 2WWWA 3I56V 1UJWB 5IYCO 4X62O 4RAIA 3VQXA 5KHJA 4F4LA 1CXZB 4OX9B 1H8HG 1MA1A 3AG2C 1VQ9V 3ZS8C 4R8CA 3ZRWB 1NQTA 1MZFA 1R6KA 4DV7B 3TETA 1EBOA 1NR1A 3E22B 1F4MA 2HP8A 4WFHA 5KAIZ 1TGOA 1MOFA 1YITV 3ETDA 4K0KB 3O65A 2JS3A 2WPDG 1SERA 1OCRC 1EFRG 1LNQA 4B3SB 3ABKC 2Q73A 3FD9A 1YF2A 1ZAUA 5AG2A 1R3JC 1VF5B 3JATB 1S3JA 3K5OA 1FD9A 1I5XA 3K06A 5LMNO 2ITDC 1OCCB 3ZJZA 2EIMC 4P2ZA 2ADPA 4DR1O 2HHHO 4LF4O 1QR8A 4GX5A 3OT7A 2YIBA 5D5QA 4R7CA 4QPJA 5BY1A 4U3JA 3OTOB 3CMEV 2RNBA 2ZKOA 1SQBH 4DK0A 1KP3A 5L3FA 2IH3C 5L3BA 3DSQA 3TGUH 2ZR2A 5IDJA 4JI4B 4FZ0A 4HAMA 2QA4V 4E4EA 3AK1A 1XEQA 3SYCA 1BE3H 2KG7B 1AJQA 2Q67A 3A0BZ 2ILMA 5J2TB 3OW2U 3JALB 1RM1B 4LFBO 2ZDIA 5IYZA 4DR5B 4NR1A 2UXBO 3DXRA 4PDRA 4J11A 1NTMH 4X64B 4TV8B 4Z1MG 3SPJA 3CCRV 1OV9A 1SZTA 4X64O 4LNUB 3JARA 4G28B 2UXNA 2HJDA 4LFBB 4X20B 1GAXA 4HZ3A 2QM4A 5JH7B 1JOYA 3BHPA 4LF9O 1G4YB 1V54B 2EINB 5EC2C 4NB5A 2DYRB 2IH1C 5CB4A 1NTKH 2ZR3A 1K34A 1NS1A 4GCZA 4IT5A 2MW2B 2DE0X 2QEXV 1QU7A 3OAAG 2DMXA 2AZ0A 1K4DC 4IYIA 2F95B 5BR8B 1PV0A 1VQNV 2UXDO 4LNUA 4MVZA 2B9ZA 2RMKB 2Q68A 4I9QA 2VQFO 3F7VC 2QKAA 3DXRB 1COWG 3E8HA 1KKCA 1HWYA 3VQWA 5IYZB 3DC5A 4BW5A 1B04A 4X66B 2BOCC 5CA1B 2DWEC 4KP4A 1URFA 4B3SO 1S0VA 2FMLA 3CSXA 1I5YA 4LFCO 1FJGO 1AP5A 1KUQA 1YJ9V 1PPJH 1NJIW 3ABKB 3CCLV 2WLNA 4L8JA 2B1IA 4U3JB 1AI5A 2Y48A 1HDJA 3ZHTA 1D5NA 4NTXA 4MTXA 4MSWC 3ZRXA 3HKEA 4LFAB 4DR3B 1FXHA 1JVMA 1P49A 3S3WA 3JATA 1V54C 2EINC 2KG7A 1K7DA 5B5EZ 1MZEA 3CRQA 4AQYO 1Y67A 1Y66A 3ZIAG 4F6RB 4O2BA 1K8AW 1WPBA 5IJ9A 3LSQA 4ZOLB 2EIKB 3E8BA 4JI6O 3QTCA 4WF9V 1VMGA 3H1KH 4LF8O 4FZ1A 5HFMA 1RSOA 1M1KW 1M93A 2X0LA 4DUYB 3H9VA 1KU9A 4H13B 5K1PA 1WPXA 2XASA 4D7TA 3BPZA 2UUBO 2WA4A 4RQEA 2H94A 2YUAA 3N2KA 4LWSB 4XDJA 4GKJB 4GKKO 4J9ZB 3BCCH 5IWAO 3E22A 2Y69C 3LDEA 1Q90D 2UUBB 4U3FH 1OCCC 1SA0B 4JYYA 1H2SB 4NXMO 2ATKC 2YSUB 5B1NA 2HEPA 2RDCA 5KA5A 1M4UA 1K73W 2UUCB 4X1YA 3RBZA 1TUEB 1AI7A 2E3CA 4DV5O 1XI1A 2OYQA 4JI8O 4CZZA 3B2EE 3OMAB 5E1AC 1K92A 1W59A 1YTFB 2CTRA 3TXQA 4I55A 4ZKIA 3T1CA 1AVMA 2VQEB 3EHBB 1UPGA 1HNXO 4UFZA 1FXKB 4QGPA 1PKXA 2YXHA 1FPOA 1VF6C 4MS2A 1UFIA 3WU2Z 2DQ3A 2GUZB 4R50A 2ZE8A 4NXNO 5L3EA 1XUQA 5EYPA 3ABTA 2GUZA 3MAQA 4FM2A 3HPLC 3ABUA 1VQ5V 3APQA 1BQZA 1A32A 2QWQB 4KHPO 3RYCB 1ZWIC 3ABMB 4DV4O 1FXKC 3CPWU 1XNRB 4GT1A 3T4ZA 4MVUA 3T1YB 3IGAC 4FIPC 1S77D 4RUFA 3FB7C 4O4IB 1SESA 4DV6B 2L6LA 2YEVB 1SZXA 2AHYA 3JASA 4CS4A 4IIJA 2HG5C 1O9HA 2DW4A 1JJ2U 4ZI7A 5LP6C 4JI3B 4DR7B 1VQPV 3JAWA 3K9SA 2ZE6A 3A2FA 3E2EA 2HLDG 2Y69B 2N05A 3KCXA 5LXTB 1Y76A 2XTAA 4LWSA 3K5MA 3N2KB 3AEIA 2ZINA 1VQOV 4NXMB 5LP6B 1SQFA 1CEZA 2P06A 2QR4A 1RFYA 2P4KA 4WCEV 3JYCA 2VWKA 2LO1A 4XDLA 4DV2O 3E89A 4JZGA 1DF4A 3X2QB 5L3CA 2ZT9B 3AK2A 1Q6HA 3B09A 1ZL8B 4R6ZA 4DR3O 1L0LH 1B06A 1BMFG 2QTOA 4FFBB 5TISZ 4L87A 3CCVV 2YI9A 5EBLC 1QCEA 1ZUQA 4B3TO 2EULA 4A5UB 3CCQV 3OR6C 2F1MA 1P4RA 4JI5B 4G2KA 2JGUA 2WA3A 2HVJC 1VQMV 5E79Z 3ETEA 5GTIZ 1JR9A 4OX9O 1OCOC 2ETNA 2UUAO 4LFCB 3FYEB 1W2BU 5EK0A 3GWKC 2HJFC 2F23A 1R3LC 4UV8A 5CA3A 1EN5A 2CK3G 3CX5F 1GRJA 1K5QA 3JSNA 3OGCC 3G80A 1AI6A 3AG3B 3JCZA 1NH2B 2PYJA 1LUWA 3F7YC 4DR2B 3CCMV 3AG7A 1THZA 2GBOA 2IM9A 1SQXH 3JD3A 5JCOC 2JDIG 3ZRSA 5A9GA 1M56B 1V55C 2BTQB 3FB8C 4UV9A 1VEWA 3IJ4A 5CA1A 3HKDB 4X88A 2NNUA 3OEHG 4JI0B 2CUGA 1KECA 3K0DA 1QR9A 2CDYA 4MTGA 3G6EV 2CTPA 4CC5A 1LR1A 4MTOA 3RVZA 5DECA 3C3TA 1YJWV 4DRXB 1VF6A 3SPHA 1ROPA 3ABLB 3W7SA 2BTQA 2BCCH 5LBQA 4H0LB 4PA6A 4I50B 2EJRA 5LGUA 4CH6A 4CH4A 5EIBC 1J95A 1NVPD 4TV9A 4W4KA 2YIBD 1WB7A 5LXTA 2DN9A 4I0XA 4JI1B 5FPOA 2UXDB 4FLWA 3JAWB 2DYRC 4DV2B 4CH5A 3T1HO 4HNAA 2P5OA 4CBCA 3QG5A 3UM7A 3STLC 2BSKB 1Q81W 2V7QG 3RYIA 4CS3A 3CD6V 1KKDA 4DV5B 2NLJC 1MSDA 5H2FZ 3CCUV 1WB8A 1YTFD 1TUBB 2A79B 1AI4A 3OTOO 1SS3A 3CCSV 5FLXN 4DW1A 4JI7O 3I5DA 5IE9A 3W7TA 2RN9A 1W0JG 1WA8B 1H2MA 5B1OA 2M6YA 4H44B 1U96A 5KX5B 4FPPA 3VQYA 4LH6A 1XL4A 3J7AU 5LOVA 3S3XA 4EB6A 3ZMVA 2ZM6O 1BZKA 1R3KC 4G27B 5J2UA 3OR7C 1J5EO 1Q8IA 4I7ZB 1Y76B 1ORQC 4J9YB 3U11A 5H6RA 5KMGA 1SQQH 1R73A 2K1EA 3B40A 1CP9A 1AR5A 1OCRB 2A9HA 2XAHA 1IBLO 1N32B 1P7GA 2YC0A 1YIJV 1YDXA 2IJKA 4CS2A 3F5TA 1SA0A 1E79G 2EZOA 4IHJB 1FXVA 5FNVB 3JAMN 3CJHB 5HFLA 4PI0A 1AP6A 2DYSB 3CCJV 3RVYA 5BR8O 5LHGA 1XDCA 1XMOB 1Q82W 4DW0A 3VBBA 5KAFZ 1Y74A 3G71V 3FX7A 4AQYB 4J10A 3E83A 2PZSA 4FM1A 4JAUA 3T1YO 3RYCA 3EFFK 3ZX6A 1S72V 1B3QA 4J7JA 1JJOA 1K3EA 1RSOB 2LQTA 2LGWA 1ZTEA 1WAZA 3L75H 3H1HH 4IHJA 5FNVA 1QLNA 5LL6Y 3K57A 4N21A 3QF7A 4CH3A 2Q7EA 1XNRO 1GM8A 2LFRA 2NN4A 4FK5C 3BY6A 3JAKA 1Z2GA 4EFBA 5LGNA 2A06H 2Z5UA 3NR7A 5EZYB 3K79A 5LA6B 2JK5C 4O2BB 5DM6V 1KP2A 4K8XA 3RFRA 2AGAA 2F4VB 4YHHO 2OIGA 3HR0A 5DEDA 3HB3B 4MTFA 2FL4A 1BT8A 1GM9A 4FLUA 1YI2V 2NR5A 3C3SA 3K03A 4K3AA 2JEXA 4DR4B 3HKEB 5F2VO 1QLEB 1OHHG 2WLLB 3U0ZA 3HKBB 3TXSA 1WJZA 1AR4A 3L9DA 4DO2A 2UXXA 2UUAB 3ASOC 2BOBC 4EKWA 2HVKC 5LYJB 4LBEC 2O57A 1SQGA 2QJ1A 4O4LB 1N8RW 2ZXWC 2JGDB 4JI3O 1ZSPA 2N04A 1QVGU 3CE2A 3N2GA 1FFTB 3ZHVA 4LF9B 4YHHB 3LSUA 4WFFA 5FL7G 5H9CA 3ZRVA 3ZMTA 4TSFG 4JTAB 4UCRA 3ZHRA 3ABMC 3LDCA 4UVCA 2IJJA 3P32A 3K3WA 1GTOA 3TJTA 1YCIA 2ODMA 1XMQO 4W4LA 4UUJC 1L0NH 1N34B 2HKOA 3K08A 5B1BC 3RN4A 3WG7C 4WFEA 3AG1C 1SRYA 4C7UA 4B08A 5JCOA 4J80A 3ML0A 3RGBA 1SQPH 3J81N 3FKSG 3IAYA 3CHXA 4LF7B 2YIDA 1NH2D 2E74B 2WLHA 4JYAO 1XILA 4PJ0Z 1GH6A 4ZBMA 1GN2A 1Z5VA 4PDMA 1NI8A 4QIWF 2XHBA 3CEIA 4B7KA 2R9RB 2E5LO 4OPAA 3T2MA 4NKGB 5B3SB 5LMNB 3L72H 3G67A 1BHAA 3BAAA 4LF5B 5J2TA 1WA8A 4HBNA 4UXNA 2EIJC 3KG2A 3SPGA 2BTOA 4Z1VA 3BEHA 3SYOA 1FFXB 4KHPB 1H8EG 4YJ2B 1AJNA 2EILC 2V4DA 2AW9A 1K5SA 3D3IA 3G4SV 2UXCO 2WLKA 4CC6A 2OT5A 2X7RB 4JAVA 4FJCC 4JPRA 1I08A 3RYIB 1VQ8V 3DGEA 2X6BA 3AG4C 1K33A 3CP1A 3OM3B 1K97A 1OZ0A 1IZ3A 4E2LA 3K5LA 1QBZA 1XHZA 3EXAA 4I0XB 4J7KA 2VWJA 2XOKG 2PF4E 3CC4V 4TV9B 3AG1B 3WG7B 1DGSA 1SKVA 1JQ0A 2CH7A 5B1BB 4J42A 4AI8A 4EEQA 3QNEA 2OTLV 4QE7A 1HNXB 5JH7A 4DR2O 3WB1A 4X20A 4FMTA 2Q9LA 2YXLA 1FS0G 2R72A 4DYLA 2JJ1G 2E76B 2IW5A 3Q4HA 1NKDA 4DR1B 2HHHB 1IDSA 2F43G 2DYSC 2CTQA 1T5EA 2XUMA 4K8ZA 4B3RB 1NTZH 2GTSA 2ZXWB 1WP7A 3ASNC 4DR5O 4FM0A 3ZCCA 3OD4A 2RQ6A 1N34O 2YS8A 3CC2V 1OJHA 1YHQV 3SJBC 2WLMA 4WBNB 3D36A 1S5JA 2Q6AA 1Q7YW 2OCCB 5IJ0B 1HNWO 2OCHA 1JMKC 2ZIMA 5JJEB 1N4CA 3PJSK 4NTWA 1DK1A 3ZBHA 4KL1A 2WLLA 1KC8W 3RW0A 3OTFA 2XAGA 4TQDA 1VQLV 2LW7A 2ZNJA 2X6CA 5JVDA 2A0LA 5K1XA 1YVWA 1HW7A 5ITZA 5KHKA 4X1KB 2ZIOA 3ZHUA 1E1QG 5LA6A 1YXBA 1H38A 4J41A 1SETA 4YY3O 4LF6B 4DR4O 4DR6B 3CRMA 4FVMA 5L3GA 5CBGA 2LW1A 3JAKB 4K35A 1KD1W 4DV3B 3OUSA 4DR7O 1DLBA 3LDDA 4H37A 1IXBA 2OIEA 4DXWA 3ZRWA 2Z0AA 4DV7O 5KA6A 3TK1A 4YY3B 4LF6O 4DR6O 3J80N 3BABA 3ETGA 4UCOA 1TA8A 4LH7A 3CRRA 5C8YB 3H1LH 5GW7A 1OCZB 4TT3G 1RPOA 1WP8A 3OMIB 4X9QA 2ADQB 1S5HC 1P84F 4I55B 4B3MO 1AILA 1BSMA 5BMVB 2WAMA 2X6AA 1US6A 3P3NA 4PA7A 2Y4TA 5CMUA 1MG1A 3KCYA 3CJHA 4X1YB 2UXBB 2A3QA 1VQ6V 5LGTA 4ZI7B 3JD4A 3JSLA 2CGNA 4KXRA 1YEWA 1SF9A 5KUMA 2LFSA 2IBZH 4ABMA 3IC7A 1FAFA 4D6TH 2W0FC 3SYAA 5KMGB 1GMGA 2VQFB 5LHIA 2XAJA 1JFFA 3SR2C 1DTOA 4Q6GA 4IGGA 4TUYA 5BMVA 2Y4UA 1XNQB 3FYIB 2IJHA 3SPIA 4J7ZA 5ITZB 1D5AA 3OFNG 4BIUA 4DV1B 1E1RG 2M7WA 2B1GA 4GYCB 4PELA 4EB6B 1XNQO 2H8PC 5KUKA 4JI7B 2WLJA 1BQ0A 4H33A 2Q69A 3M8AA 4MT8A 1PL0A 1HR0B 5EYPB 3AG3C 4GX0A 2ZNIA 4UB6Z 1XHXA 1U97A 4NTYA 5DN6G 1HNZO 5KHHA 2F4VO 5EC1C 1GN4A 4N23A 2KB1A 3ZN0A 4ZOLA 2VS0A 1D2DA 3L71H 4B3TB 4F6RA 1SC5B 1WN7A 2CTWA 1IBKB 5JJJB 1AJPA 1VP7A 4JI1O 3G6BA 3BRCA 2LP7A 1WLEA 5FPRA 1R6NA 4BR6A 1ENVA 1PNLA 2Q7GA 3QVNA 4LF8B 4OGQB 4JI0O 4QJFB 1IBKO 3T4DA 3WFVA 2JS5A 2XAFA 5IJ0A 4JI6B 1IXMA 2PTMA 1PNMA 3B8NA 3RYFB 4QNHB 5BZBA 4MVOA 3K0GA 1PM9A 1HNZB 4MVSA 2PYLA 4MW8A 3QO5A 4X65B 4TOIA 4ASUG 1S5LZ 4WFAV 1XBLA 3K5NA 2QM8A 4DRXA 2F66C 2P4VA 4AHCA 5L3DA 2EIMB 2OCCC 3DC6A 1G6UA 2V1DA 3Q4HB 2Q0OC 5IY5B 4JYAB 1VF7A 1Q6UA 5B3SC 4PHZA 4LR3A 2JVDA 5IWAB 3K58A 2WLIB 2UUCO 4DK1A 4PD4F 2CH7B 1FFXA 3K9AA 4FLTA 1FKAO 2D3OW 1CPYA 4GUNA 4PV1B 5LMUO 5CB4B 1VIBA 2XT9A 1XREA 3SGIA 4Q20A 3C90A 3E35A 1QNMA 2HFEC 3VQVA 3ZMSA 1YJNV 1IBMB 1HP8A 3AG2B 4NXNB 2LGQA 2JIZG 3D3QA 3JARB 4JI4O 3RT3C 4OPHA 1H2KA 4JYCA 4JTCB 2YICA 4PDLA 1FYJA 3HKCB 2AXTZ 3WB0A 3LNNA 4P30A 4YJ2A 1Q3EA 2CGOA 1TAEA 2DJVA 4JI2O 3DTUB 4GX1A 5H5NA 2QGNA 4O4HB 1NU1H 1EN6A 2WLIA 3ZHSA 4PA3A 1M5IA 3OGIB 4BAYA 4RQFA 3VOUA 3JD1A 4BIOA 2R9AA 2BE3A 3ZMUA 1I94B 1X4TA 2W0XA 4FLZA 1IVSA 1NT2B 3GB7C 3E86A 4BIZA 3SJAC 1Q5OA 3SYPA 5B66Z 2QWRB 3APOA 4XDKA 1I0HA 4KFMA 5CBFA 5CA0A 4DUZB 4YXWG 2Q5ZA 3N2GB 2ZDIC 5KHIA 3I55V 3A0HZ 4X62B 2JRIA 2QDOA 1SQVH 1MMMA 5LYJA 2EBOA 4DUZO 1MNGA 2Y0PA 4NVPA 3H01A 3L70H 4F6EA 4IIJB 4O2AA 1VQ4V 4MW3A 4QE9A 4UVAA 1PP9H 3O9OA 1EZJA 2KKWA 4TV8A 1KB9F 4O4IA 3W7XA 3ETQA 5H6QA 2VQEO 4YIPA 1GKFA 4I4TB 2OTJV 2P67A 1N0NA
chains in the Genus database with same CATH topology
2RMKB 1RFYA 4DYLA 4NB5A 2Q0OC 1URFA 4IGGA 1UPGA 2HJDA 4NKGB 1CXZB 1US6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RMK B;  1RFY A;  4DYL A;  4NB5 A;  2Q0O C;  1URF A;  4IGG A;  1UPG A;  2HJD A;  4NKG B;  1CXZ B;  1US6 A; 
#chains in the Genus database with same CATH topology
 3M99 B;  1Z5W A;  2ITC C;  1IBL B;  1N32 O;  4LF7 O;  5C93 A;  2HR3 A;  4YJ3 A;  4FLV A;  1G8M A;  2Q7H A;  5GON B;  1TVK B;  3B77 A;  5EZY A;  2YXY A;  3KKY A;  3PN1 A;  1XL6 A;  2D2C B;  3MD0 A;  4JYB A;  1P7B A;  2AHZ A;  1BGY H;  4K0K O;  3H1J H;  4DV6 O;  2A7W A;  2Q8V A;  1Q86 W;  4KUM A;  3HKB A;  3ICX A;  1H2G A;  3P3P A;  1J5E B;  2QWO B;  4JI5 O;  1QVF U;  1EZV H;  2W6I G;  4ZHQ A;  1I7F A;  3L74 H;  2DWD C;  4BWA A;  4GKJ O;  4P9P A;  4RO2 A;  3UKM A;  2PI5 A;  1ZX3 A;  2RCV A;  3D36 C;  1ARO P;  5LMU B;  3CXH F;  1XMQ B;  2ZM6 B;  1Y74 B;  3ZHQ A;  2PY5 A;  5IY5 C;  3CYO A;  3LNM B;  1JFF B;  1KQS U;  4B3M B;  1KMI Z;  1YZB A;  3KZI Z;  1BS3 A;  3OUF A;  3M7M X;  4O2A B;  4JAA A;  1R1B A;  5CBH A;  2ZD9 A;  2QWN B;  2GHY A;  3W7U A;  4UCU A;  1VAR A;  1QHT A;  3CC7 V;  2MK3 A;  3UT5 B;  4YIO A;  2KQX A;  3QO7 A;  4PDV A;  2XND G;  2RJZ A;  4MVM A;  3FAV A;  1AB3 A;  3T1H B;  2F93 B;  5CA0 B;  3SDL A;  3BA8 A;  2PUS A;  2FYU H;  3B4S A;  1NVP B;  5J2U B;  1JCH A;  1Y6X A;  5C8Y A;  1Y4M A;  1N36 B;  2AZ2 A;  1OCZ C;  2UU9 O;  5LOV B;  5BXZ A;  1M57 C;  3MHS C;  4PA9 A;  1IBM O;  4UCV A;  1WNS A;  2JJ2 G;  3WB2 A;  5IJ9 B;  4B7E A;  4JAS A;  1IX9 A;  1M57 B;  2OWO A;  1TVK A;  4X8A A;  3R65 A;  5GON A;  4DUY O;  4YJ3 B;  4O4H A;  4JF3 A;  5J9P C;  4Z2W A;  4X1K A;  4LF5 O;  4I4T A;  4LCU C;  1O9G A;  1NZ6 A;  4TWK A;  3CS5 A;  4UVB A;  3CWB H;  3SPC A;  4DV0 B;  1TUB A;  2CE4 A;  4O4J B;  4LF4 B;  2P90 A;  2BSK A;  3K04 A;  1ZLZ A;  4QPK A;  4UCS A;  4JZ2 A;  5KX5 A;  4HNA B;  2IJI A;  3JD2 A;  3R66 A;  2ZQM A;  4WFB V;  1IUR A;  3N27 A;  2QKS A;  3NXS A;  1XMO O;  4MVQ A;  5B1A C;  2DOS A;  3BFR A;  3CMA V;  3FB6 C;  3P30 A;  1VQ7 V;  3CB2 A;  5B1A B;  5GTH Z;  2Z3Y A;  5JJN B;  2L35 A;  4WFG A;  1RP3 B;  3ZED A;  1M56 C;  1V55 B;  4DV1 O;  2GV9 A;  2EJ7 A;  3F5W C;  2GTA A;  1K9M W;  3TCU A;  4BW9 A;  1YSC A;  1DF5 A;  1JX9 A;  2ZE5 A;  3A0R A;  3ASN B;  3CCE V;  3EVK A;  3LSS A;  2UU9 B;  4NYK A;  2P6J A;  2EZP A;  3HKD A;  3U10 A;  3W7W A;  4JTD B;  4I9W A;  2Q4P A;  4RUE A;  5JQG B;  3OEE G;  1HR0 O;  1L1F A;  5IYB O;  1N36 O;  4PA4 A;  3UCS C;  3E8F A;  2B5U A;  4JI2 B;  2PI4 A;  3HKC A;  4I50 A;  1V9P A;  5JQG A;  2GSM B;  3FFQ A;  5LHH A;  4I5S A;  1S76 D;  3OMN B;  5A2Q N;  4HYO A;  4X89 A;  4GZR B;  2FB5 A;  4MVR A;  4U7N A;  3SJQ C;  1RM1 C;  3JD0 A;  4JI8 B;  3X2Q C;  4X1I A;  1BL8 A;  2FTK A;  3AG4 B;  3JAL A;  3H1I H;  4FLX A;  2ARH A;  3ABL C;  3AK3 A;  2QTS A;  2FKX A;  2EIL B;  3D8C A;  5D5P A;  1K4C C;  2QSA A;  5EBW C;  3UO2 A;  3A8T A;  1Q6I A;  4X1I B;  2EIJ B;  3B8M A;  4LC1 A;  4JV5 B;  4IYH A;  4ICG A;  3UO3 A;  2UXC B;  1PL4 A;  1F4N A;  1JA8 A;  4LFA O;  1GN3 A;  2N74 A;  3MDS A;  2CAZ C;  4DV0 O;  5JWP A;  4TQF A;  5CN0 A;  5KHG A;  1GN6 A;  5EBM C;  1PNK A;  3SJC C;  1Q43 A;  3IFX A;  1XQ8 A;  3MHH C;  1F7Y A;  4DV4 B;  4OXS A;  2R9I A;  1JPX A;  2C2A A;  3RYF A;  4TUY B;  4FFB A;  1MAB G;  2YDE A;  2R70 A;  1GM7 A;  1I94 O;  2YI8 A;  1L8D A;  4GLX A;  2H3O A;  5IT9 N;  4PI2 A;  1ZL8 A;  4GX2 A;  2E75 B;  3JCU Z;  4P9O A;  3LUT B;  3SYQ A;  1H2N A;  1GK9 A;  1OCO B;  4FLY A;  5EIB D;  1LUV A;  1N33 O;  1MSW D;  1H2L A;  1G1X B;  1GO3 F;  2GDS A;  2QM7 A;  1R6T A;  4UCT A;  2PGG A;  5LP6 A;  3STZ C;  3CRC A;  2K9P A;  1XOU A;  1R3I C;  1VQK V;  2QE7 G;  1HNW B;  2JGD A;  3GVM A;  3THO A;  4O4L A;  4GKK B;  5IYD O;  4RWU A;  3UT5 A;  1FJG B;  2IU3 A;  1EN4 A;  4U7O A;  3CRA A;  4D7S A;  1AR1 B;  3RYH B;  2ZE7 A;  4JV5 O;  2EX3 A;  1F51 A;  3BVO A;  1NBM G;  2W6J G;  3L73 H;  3JAS B;  4X66 O;  4B3R O;  3ASO B;  4O4J A;  2YEV A;  3OE7 G;  4UB8 Z;  4ZIB A;  5KLV H;  3CXC U;  3FB5 C;  4XBF A;  1FXK A;  1PD3 A;  2Y0I A;  2DQ0 A;  1QLE C;  2IU0 A;  3IC9 A;  1M90 W;  1F23 A;  1W0K G;  3QO8 A;  1EM1 A;  2WSS G;  3GWO A;  2KSD A;  2P7T C;  3RWR D;  3E8G A;  5JVD B;  2JEU A;  2XAQ A;  1KYO F;  4IL6 Z;  2G38 A;  2LJ2 A;  4FFK A;  1BCC H;  1RPR A;  2QKC A;  4JGS A;  4ZHQ B;  1N0J A;  3RYH A;  1KBH A;  1NR7 A;  4DV3 O;  2YIA A;  1X59 A;  2E5L B;  1N33 B;  3K59 A;  3ZMZ A;  2P22 C;  4WBN A;  4X65 O;  2EIK C;  4EFE A;  1BHB A;  3UQ8 A;  2VRZ A;  3FAV B;  4AIL C;  1B6Q A;  2QWP B;  1QQC A;  4LP8 A;  3BA9 A;  3ZN1 A;  2Q0A A;  1M9N A;  2ZCE A;  2WWW A;  3I56 V;  1UJW B;  5IYC O;  4X62 O;  4RAI A;  3VQX A;  5KHJ A;  4F4L A;  1CXZ B;  4OX9 B;  1H8H G;  1MA1 A;  3AG2 C;  1VQ9 V;  3ZS8 C;  4R8C A;  3ZRW B;  1NQT A;  1MZF A;  1R6K A;  4DV7 B;  3TET A;  1EBO A;  1NR1 A;  3E22 B;  1F4M A;  2HP8 A;  4WFH A;  5KAI Z;  1TGO A;  1MOF A;  1YIT V;  3ETD A;  4K0K B;  3O65 A;  2JS3 A;  2WPD G;  1SER A;  1OCR C;  1EFR G;  1LNQ A;  4B3S B;  3ABK C;  2Q73 A;  3FD9 A;  1YF2 A;  1ZAU A;  5AG2 A;  1R3J C;  1VF5 B;  3JAT B;  1S3J A;  3K5O A;  1FD9 A;  1I5X A;  3K06 A;  5LMN O;  2ITD C;  1OCC B;  3ZJZ A;  2EIM C;  4P2Z A;  2ADP A;  4DR1 O;  2HHH O;  4LF4 O;  1QR8 A;  4GX5 A;  3OT7 A;  2YIB A;  5D5Q A;  4R7C A;  4QPJ A;  5BY1 A;  4U3J A;  3OTO B;  3CME V;  2RNB A;  2ZKO A;  1SQB H;  4DK0 A;  1KP3 A;  5L3F A;  2IH3 C;  5L3B A;  3DSQ A;  3TGU H;  2ZR2 A;  5IDJ A;  4JI4 B;  4FZ0 A;  4HAM A;  2QA4 V;  4E4E A;  3AK1 A;  1XEQ A;  3SYC A;  1BE3 H;  2KG7 B;  1AJQ A;  2Q67 A;  3A0B Z;  2ILM A;  5J2T B;  3OW2 U;  3JAL B;  1RM1 B;  4LFB O;  2ZDI A;  5IYZ A;  4DR5 B;  4NR1 A;  2UXB O;  3DXR A;  4PDR A;  4J11 A;  1NTM H;  4X64 B;  4TV8 B;  4Z1M G;  3SPJ A;  3CCR V;  1OV9 A;  1SZT A;  4X64 O;  4LNU B;  3JAR A;  4G28 B;  2UXN A;  2HJD A;  4LFB B;  4X20 B;  1GAX A;  4HZ3 A;  2QM4 A;  5JH7 B;  1JOY A;  3BHP A;  4LF9 O;  1G4Y B;  1V54 B;  2EIN B;  5EC2 C;  4NB5 A;  2DYR B;  2IH1 C;  5CB4 A;  1NTK H;  2ZR3 A;  1K34 A;  1NS1 A;  4GCZ A;  4IT5 A;  2MW2 B;  2DE0 X;  2QEX V;  1QU7 A;  3OAA G;  2DMX A;  2AZ0 A;  1K4D C;  4IYI A;  2F95 B;  5BR8 B;  1PV0 A;  1VQN V;  2UXD O;  4LNU A;  4MVZ A;  2B9Z A;  2RMK B;  2Q68 A;  4I9Q A;  2VQF O;  3F7V C;  2QKA A;  3DXR B;  1COW G;  3E8H A;  1KKC A;  1HWY A;  3VQW A;  5IYZ B;  3DC5 A;  4BW5 A;  1B04 A;  4X66 B;  2BOC C;  5CA1 B;  2DWE C;  4KP4 A;  1URF A;  4B3S O;  1S0V A;  2FML A;  3CSX A;  1I5Y A;  4LFC O;  1FJG O;  1AP5 A;  1KUQ A;  1YJ9 V;  1PPJ H;  1NJI W;  3ABK B;  3CCL V;  2WLN A;  4L8J A;  2B1I A;  4U3J B;  1AI5 A;  2Y48 A;  1HDJ A;  3ZHT A;  1D5N A;  4NTX A;  4MTX A;  4MSW C;  3ZRX A;  3HKE A;  4LFA B;  4DR3 B;  1FXH A;  1JVM A;  1P49 A;  3S3W A;  3JAT A;  1V54 C;  2EIN C;  2KG7 A;  1K7D A;  5B5E Z;  1MZE A;  3CRQ A;  4AQY O;  1Y67 A;  1Y66 A;  3ZIA G;  4F6R B;  4O2B A;  1K8A W;  1WPB A;  5IJ9 A;  3LSQ A;  4ZOL B;  2EIK B;  3E8B A;  4JI6 O;  3QTC A;  4WF9 V;  1VMG A;  3H1K H;  4LF8 O;  4FZ1 A;  5HFM A;  1RSO A;  1M1K W;  1M93 A;  2X0L A;  4DUY B;  3H9V A;  1KU9 A;  4H13 B;  5K1P A;  1WPX A;  2XAS A;  4D7T A;  3BPZ A;  2UUB O;  2WA4 A;  4RQE A;  2H94 A;  2YUA A;  3N2K A;  4LWS B;  4XDJ A;  4GKJ B;  4GKK O;  4J9Z B;  3BCC H;  5IWA O;  3E22 A;  2Y69 C;  3LDE A;  1Q90 D;  2UUB B;  4U3F H;  1OCC C;  1SA0 B;  4JYY A;  1H2S B;  4NXM O;  2ATK C;  2YSU B;  5B1N A;  2HEP A;  2RDC A;  5KA5 A;  1M4U A;  1K73 W;  2UUC B;  4X1Y A;  3RBZ A;  1TUE B;  1AI7 A;  2E3C A;  4DV5 O;  1XI1 A;  2OYQ A;  4JI8 O;  4CZZ A;  3B2E E;  3OMA B;  5E1A C;  1K92 A;  1W59 A;  1YTF B;  2CTR A;  3TXQ A;  4I55 A;  4ZKI A;  3T1C A;  1AVM A;  2VQE B;  3EHB B;  1UPG A;  1HNX O;  4UFZ A;  1FXK B;  4QGP A;  1PKX A;  2YXH A;  1FPO A;  1VF6 C;  4MS2 A;  1UFI A;  3WU2 Z;  2DQ3 A;  2GUZ B;  4R50 A;  2ZE8 A;  4NXN O;  5L3E A;  1XUQ A;  5EYP A;  3ABT A;  2GUZ A;  3MAQ A;  4FM2 A;  3HPL C;  3ABU A;  1VQ5 V;  3APQ A;  1BQZ A;  1A32 A;  2QWQ B;  4KHP O;  3RYC B;  1ZWI C;  3ABM B;  4DV4 O;  1FXK C;  3CPW U;  1XNR B;  4GT1 A;  3T4Z A;  4MVU A;  3T1Y B;  3IGA C;  4FIP C;  1S77 D;  4RUF A;  3FB7 C;  4O4I B;  1SES A;  4DV6 B;  2L6L A;  2YEV B;  1SZX A;  2AHY A;  3JAS A;  4CS4 A;  4IIJ A;  2HG5 C;  1O9H A;  2DW4 A;  1JJ2 U;  4ZI7 A;  5LP6 C;  4JI3 B;  4DR7 B;  1VQP V;  3JAW A;  3K9S A;  2ZE6 A;  3A2F A;  3E2E A;  2HLD G;  2Y69 B;  2N05 A;  3KCX A;  5LXT B;  1Y76 A;  2XTA A;  4LWS A;  3K5M A;  3N2K B;  3AEI A;  2ZIN A;  1VQO V;  4NXM B;  5LP6 B;  1SQF A;  1CEZ A;  2P06 A;  2QR4 A;  1RFY A;  2P4K A;  4WCE V;  3JYC A;  2VWK A;  2LO1 A;  4XDL A;  4DV2 O;  3E89 A;  4JZG A;  1DF4 A;  3X2Q B;  5L3C A;  2ZT9 B;  3AK2 A;  1Q6H A;  3B09 A;  1ZL8 B;  4R6Z A;  4DR3 O;  1L0L H;  1B06 A;  1BMF G;  2QTO A;  4FFB B;  5TIS Z;  4L87 A;  3CCV V;  2YI9 A;  5EBL C;  1QCE A;  1ZUQ A;  4B3T O;  2EUL A;  4A5U B;  3CCQ V;  3OR6 C;  2F1M A;  1P4R A;  4JI5 B;  4G2K A;  2JGU A;  2WA3 A;  2HVJ C;  1VQM V;  5E79 Z;  3ETE A;  5GTI Z;  1JR9 A;  4OX9 O;  1OCO C;  2ETN A;  2UUA O;  4LFC B;  3FYE B;  1W2B U;  5EK0 A;  3GWK C;  2HJF C;  2F23 A;  1R3L C;  4UV8 A;  5CA3 A;  1EN5 A;  2CK3 G;  3CX5 F;  1GRJ A;  1K5Q A;  3JSN A;  3OGC C;  3G80 A;  1AI6 A;  3AG3 B;  3JCZ A;  1NH2 B;  2PYJ A;  1LUW A;  3F7Y C;  4DR2 B;  3CCM V;  3AG7 A;  1THZ A;  2GBO A;  2IM9 A;  1SQX H;  3JD3 A;  5JCO C;  2JDI G;  3ZRS A;  5A9G A;  1M56 B;  1V55 C;  2BTQ B;  3FB8 C;  4UV9 A;  1VEW A;  3IJ4 A;  5CA1 A;  3HKD B;  4X88 A;  2NNU A;  3OEH G;  4JI0 B;  2CUG A;  1KEC A;  3K0D A;  1QR9 A;  2CDY A;  4MTG A;  3G6E V;  2CTP A;  4CC5 A;  1LR1 A;  4MTO A;  3RVZ A;  5DEC A;  3C3T A;  1YJW V;  4DRX B;  1VF6 A;  3SPH A;  1ROP A;  3ABL B;  3W7S A;  2BTQ A;  2BCC H;  5LBQ A;  4H0L B;  4PA6 A;  4I50 B;  2EJR A;  5LGU A;  4CH6 A;  4CH4 A;  5EIB C;  1J95 A;  1NVP D;  4TV9 A;  4W4K A;  2YIB D;  1WB7 A;  5LXT A;  2DN9 A;  4I0X A;  4JI1 B;  5FPO A;  2UXD B;  4FLW A;  3JAW B;  2DYR C;  4DV2 B;  4CH5 A;  3T1H O;  4HNA A;  2P5O A;  4CBC A;  3QG5 A;  3UM7 A;  3STL C;  2BSK B;  1Q81 W;  2V7Q G;  3RYI A;  4CS3 A;  3CD6 V;  1KKD A;  4DV5 B;  2NLJ C;  1MSD A;  5H2F Z;  3CCU V;  1WB8 A;  1YTF D;  1TUB B;  2A79 B;  1AI4 A;  3OTO O;  1SS3 A;  3CCS V;  5FLX N;  4DW1 A;  4JI7 O;  3I5D A;  5IE9 A;  3W7T A;  2RN9 A;  1W0J G;  1WA8 B;  1H2M A;  5B1O A;  2M6Y A;  4H44 B;  1U96 A;  5KX5 B;  4FPP A;  3VQY A;  4LH6 A;  1XL4 A;  3J7A U;  5LOV A;  3S3X A;  4EB6 A;  3ZMV A;  2ZM6 O;  1BZK A;  1R3K C;  4G27 B;  5J2U A;  3OR7 C;  1J5E O;  1Q8I A;  4I7Z B;  1Y76 B;  1ORQ C;  4J9Y B;  3U11 A;  5H6R A;  5KMG A;  1SQQ H;  1R73 A;  2K1E A;  3B40 A;  1CP9 A;  1AR5 A;  1OCR B;  2A9H A;  2XAH A;  1IBL O;  1N32 B;  1P7G A;  2YC0 A;  1YIJ V;  1YDX A;  2IJK A;  4CS2 A;  3F5T A;  1SA0 A;  1E79 G;  2EZO A;  4IHJ B;  1FXV A;  5FNV B;  3JAM N;  3CJH B;  5HFL A;  4PI0 A;  1AP6 A;  2DYS B;  3CCJ V;  3RVY A;  5BR8 O;  5LHG A;  1XDC A;  1XMO B;  1Q82 W;  4DW0 A;  3VBB A;  5KAF Z;  1Y74 A;  3G71 V;  3FX7 A;  4AQY B;  4J10 A;  3E83 A;  2PZS A;  4FM1 A;  4JAU A;  3T1Y O;  3RYC A;  3EFF K;  3ZX6 A;  1S72 V;  1B3Q A;  4J7J A;  1JJO A;  1K3E A;  1RSO B;  2LQT A;  2LGW A;  1ZTE A;  1WAZ A;  3L75 H;  3H1H H;  4IHJ A;  5FNV A;  1QLN A;  5LL6 Y;  3K57 A;  4N21 A;  3QF7 A;  4CH3 A;  2Q7E A;  1XNR O;  1GM8 A;  2LFR A;  2NN4 A;  4FK5 C;  3BY6 A;  3JAK A;  1Z2G A;  4EFB A;  5LGN A;  2A06 H;  2Z5U A;  3NR7 A;  5EZY B;  3K79 A;  5LA6 B;  2JK5 C;  4O2B B;  5DM6 V;  1KP2 A;  4K8X A;  3RFR A;  2AGA A;  2F4V B;  4YHH O;  2OIG A;  3HR0 A;  5DED A;  3HB3 B;  4MTF A;  2FL4 A;  1BT8 A;  1GM9 A;  4FLU A;  1YI2 V;  2NR5 A;  3C3S A;  3K03 A;  4K3A A;  2JEX A;  4DR4 B;  3HKE B;  5F2V O;  1QLE B;  1OHH G;  2WLL B;  3U0Z A;  3HKB B;  3TXS A;  1WJZ A;  1AR4 A;  3L9D A;  4DO2 A;  2UXX A;  2UUA B;  3ASO C;  2BOB C;  4EKW A;  2HVK C;  5LYJ B;  4LBE C;  2O57 A;  1SQG A;  2QJ1 A;  4O4L B;  1N8R W;  2ZXW C;  2JGD B;  4JI3 O;  1ZSP A;  2N04 A;  1QVG U;  3CE2 A;  3N2G A;  1FFT B;  3ZHV A;  4LF9 B;  4YHH B;  3LSU A;  4WFF A;  5FL7 G;  5H9C A;  3ZRV A;  3ZMT A;  4TSF G;  4JTA B;  4UCR A;  3ZHR A;  3ABM C;  3LDC A;  4UVC A;  2IJJ A;  3P32 A;  3K3W A;  1GTO A;  3TJT A;  1YCI A;  2ODM A;  1XMQ O;  4W4L A;  4UUJ C;  1L0N H;  1N34 B;  2HKO A;  3K08 A;  5B1B C;  3RN4 A;  3WG7 C;  4WFE A;  3AG1 C;  1SRY A;  4C7U A;  4B08 A;  5JCO A;  4J80 A;  3ML0 A;  3RGB A;  1SQP H;  3J81 N;  3FKS G;  3IAY A;  3CHX A;  4LF7 B;  2YID A;  1NH2 D;  2E74 B;  2WLH A;  4JYA O;  1XIL A;  4PJ0 Z;  1GH6 A;  4ZBM A;  1GN2 A;  1Z5V A;  4PDM A;  1NI8 A;  4QIW F;  2XHB A;  3CEI A;  4B7K A;  2R9R B;  2E5L O;  4OPA A;  3T2M A;  4NKG B;  5B3S B;  5LMN B;  3L72 H;  3G67 A;  1BHA A;  3BAA A;  4LF5 B;  5J2T A;  1WA8 A;  4HBN A;  4UXN A;  2EIJ C;  3KG2 A;  3SPG A;  2BTO A;  4Z1V A;  3BEH A;  3SYO A;  1FFX B;  4KHP B;  1H8E G;  4YJ2 B;  1AJN A;  2EIL C;  2V4D A;  2AW9 A;  1K5S A;  3D3I A;  3G4S V;  2UXC O;  2WLK A;  4CC6 A;  2OT5 A;  2X7R B;  4JAV A;  4FJC C;  4JPR A;  1I08 A;  3RYI B;  1VQ8 V;  3DGE A;  2X6B A;  3AG4 C;  1K33 A;  3CP1 A;  3OM3 B;  1K97 A;  1OZ0 A;  1IZ3 A;  4E2L A;  3K5L A;  1QBZ A;  1XHZ A;  3EXA A;  4I0X B;  4J7K A;  2VWJ A;  2XOK G;  2PF4 E;  3CC4 V;  4TV9 B;  3AG1 B;  3WG7 B;  1DGS A;  1SKV A;  1JQ0 A;  2CH7 A;  5B1B B;  4J42 A;  4AI8 A;  4EEQ A;  3QNE A;  2OTL V;  4QE7 A;  1HNX B;  5JH7 A;  4DR2 O;  3WB1 A;  4X20 A;  4FMT A;  2Q9L A;  2YXL A;  1FS0 G;  2R72 A;  4DYL A;  2JJ1 G;  2E76 B;  2IW5 A;  3Q4H A;  1NKD A;  4DR1 B;  2HHH B;  1IDS A;  2F43 G;  2DYS C;  2CTQ A;  1T5E A;  2XUM A;  4K8Z A;  4B3R B;  1NTZ H;  2GTS A;  2ZXW B;  1WP7 A;  3ASN C;  4DR5 O;  4FM0 A;  3ZCC A;  3OD4 A;  2RQ6 A;  1N34 O;  2YS8 A;  3CC2 V;  1OJH A;  1YHQ V;  3SJB C;  2WLM A;  4WBN B;  3D36 A;  1S5J A;  2Q6A A;  1Q7Y W;  2OCC B;  5IJ0 B;  1HNW O;  2OCH A;  1JMK C;  2ZIM A;  5JJE B;  1N4C A;  3PJS K;  4NTW A;  1DK1 A;  3ZBH A;  4KL1 A;  2WLL A;  1KC8 W;  3RW0 A;  3OTF A;  2XAG A;  4TQD A;  1VQL V;  2LW7 A;  2ZNJ A;  2X6C A;  5JVD A;  2A0L A;  5K1X A;  1YVW A;  1HW7 A;  5ITZ A;  5KHK A;  4X1K B;  2ZIO A;  3ZHU A;  1E1Q G;  5LA6 A;  1YXB A;  1H38 A;  4J41 A;  1SET A;  4YY3 O;  4LF6 B;  4DR4 O;  4DR6 B;  3CRM A;  4FVM A;  5L3G A;  5CBG A;  2LW1 A;  3JAK B;  4K35 A;  1KD1 W;  4DV3 B;  3OUS A;  4DR7 O;  1DLB A;  3LDD A;  4H37 A;  1IXB A;  2OIE A;  4DXW A;  3ZRW A;  2Z0A A;  4DV7 O;  5KA6 A;  3TK1 A;  4YY3 B;  4LF6 O;  4DR6 O;  3J80 N;  3BAB A;  3ETG A;  4UCO A;  1TA8 A;  4LH7 A;  3CRR A;  5C8Y B;  3H1L H;  5GW7 A;  1OCZ B;  4TT3 G;  1RPO A;  1WP8 A;  3OMI B;  4X9Q A;  2ADQ B;  1S5H C;  1P84 F;  4I55 B;  4B3M O;  1AIL A;  1BSM A;  5BMV B;  2WAM A;  2X6A A;  1US6 A;  3P3N A;  4PA7 A;  2Y4T A;  5CMU A;  1MG1 A;  3KCY A;  3CJH A;  4X1Y B;  2UXB B;  2A3Q A;  1VQ6 V;  5LGT A;  4ZI7 B;  3JD4 A;  3JSL A;  2CGN A;  4KXR A;  1YEW A;  1SF9 A;  5KUM A;  2LFS A;  2IBZ H;  4ABM A;  3IC7 A;  1FAF A;  4D6T H;  2W0F C;  3SYA A;  5KMG B;  1GMG A;  2VQF B;  5LHI A;  2XAJ A;  1JFF A;  3SR2 C;  1DTO A;  4Q6G A;  4IGG A;  4TUY A;  5BMV A;  2Y4U A;  1XNQ B;  3FYI B;  2IJH A;  3SPI A;  4J7Z A;  5ITZ B;  1D5A A;  3OFN G;  4BIU A;  4DV1 B;  1E1R G;  2M7W A;  2B1G A;  4GYC B;  4PEL A;  4EB6 B;  1XNQ O;  2H8P C;  5KUK A;  4JI7 B;  2WLJ A;  1BQ0 A;  4H33 A;  2Q69 A;  3M8A A;  4MT8 A;  1PL0 A;  1HR0 B;  5EYP B;  3AG3 C;  4GX0 A;  2ZNI A;  4UB6 Z;  1XHX A;  1U97 A;  4NTY A;  5DN6 G;  1HNZ O;  5KHH A;  2F4V O;  5EC1 C;  1GN4 A;  4N23 A;  2KB1 A;  3ZN0 A;  4ZOL A;  2VS0 A;  1D2D A;  3L71 H;  4B3T B;  4F6R A;  1SC5 B;  1WN7 A;  2CTW A;  1IBK B;  5JJJ B;  1AJP A;  1VP7 A;  4JI1 O;  3G6B A;  3BRC A;  2LP7 A;  1WLE A;  5FPR A;  1R6N A;  4BR6 A;  1ENV A;  1PNL A;  2Q7G A;  3QVN A;  4LF8 B;  4OGQ B;  4JI0 O;  4QJF B;  1IBK O;  3T4D A;  3WFV A;  2JS5 A;  2XAF A;  5IJ0 A;  4JI6 B;  1IXM A;  2PTM A;  1PNM A;  3B8N A;  3RYF B;  4QNH B;  5BZB A;  4MVO A;  3K0G A;  1PM9 A;  1HNZ B;  4MVS A;  2PYL A;  4MW8 A;  3QO5 A;  4X65 B;  4TOI A;  4ASU G;  1S5L Z;  4WFA V;  1XBL A;  3K5N A;  2QM8 A;  4DRX A;  2F66 C;  2P4V A;  4AHC A;  5L3D A;  2EIM B;  2OCC C;  3DC6 A;  1G6U A;  2V1D A;  3Q4H B;  2Q0O C;  5IY5 B;  4JYA B;  1VF7 A;  1Q6U A;  5B3S C;  4PHZ A;  4LR3 A;  2JVD A;  5IWA B;  3K58 A;  2WLI B;  2UUC O;  4DK1 A;  4PD4 F;  2CH7 B;  1FFX A;  3K9A A;  4FLT A;  1FKA O;  2D3O W;  1CPY A;  4GUN A;  4PV1 B;  5LMU O;  5CB4 B;  1VIB A;  2XT9 A;  1XRE A;  3SGI A;  4Q20 A;  3C90 A;  3E35 A;  1QNM A;  2HFE C;  3VQV A;  3ZMS A;  1YJN V;  1IBM B;  1HP8 A;  3AG2 B;  4NXN B;  2LGQ A;  2JIZ G;  3D3Q A;  3JAR B;  4JI4 O;  3RT3 C;  4OPH A;  1H2K A;  4JYC A;  4JTC B;  2YIC A;  4PDL A;  1FYJ A;  3HKC B;  2AXT Z;  3WB0 A;  3LNN A;  4P30 A;  4YJ2 A;  1Q3E A;  2CGO A;  1TAE A;  2DJV A;  4JI2 O;  3DTU B;  4GX1 A;  5H5N A;  2QGN A;  4O4H B;  1NU1 H;  1EN6 A;  2WLI A;  3ZHS A;  4PA3 A;  1M5I A;  3OGI B;  4BAY A;  4RQF A;  3VOU A;  3JD1 A;  4BIO A;  2R9A A;  2BE3 A;  3ZMU A;  1I94 B;  1X4T A;  2W0X A;  4FLZ A;  1IVS A;  1NT2 B;  3GB7 C;  3E86 A;  4BIZ A;  3SJA C;  1Q5O A;  3SYP A;  5B66 Z;  2QWR B;  3APO A;  4XDK A;  1I0H A;  4KFM A;  5CBF A;  5CA0 A;  4DUZ B;  4YXW G;  2Q5Z A;  3N2G B;  2ZDI C;  5KHI A;  3I55 V;  3A0H Z;  4X62 B;  2JRI A;  2QDO A;  1SQV H;  1MMM A;  5LYJ A;  2EBO A;  4DUZ O;  1MNG A;  2Y0P A;  4NVP A;  3H01 A;  3L70 H;  4F6E A;  4IIJ B;  4O2A A;  1VQ4 V;  4MW3 A;  4QE9 A;  4UVA A;  1PP9 H;  3O9O A;  1EZJ A;  2KKW A;  4TV8 A;  1KB9 F;  4O4I A;  3W7X A;  3ETQ A;  5H6Q A;  2VQE O;  4YIP A;  1GKF A;  4I4T B;  2OTJ V;  2P67 A;  1N0N A; 
#chains in the Genus database with same CATH homology
 2RMK B;  1RFY A;  4DYL A;  4NB5 A;  2Q0O C;  1URF A;  4IGG A;  1UPG A;  2HJD A;  4NKG B;  1CXZ B;  1US6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...