1RFYA

Crystal structure of quorum-sensing antiactivator tram
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
KKVELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEMHAQMSALNTLISILGFIPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quorum-sensing antiactivator TraM forms a dimer that dissociates to inhibit TraR
pubmed doi rcsb
molecule keywords Transcriptional repressor traM
molecule tags Transcription
source organism Agrobacterium tumefaciens
total genus 33
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09228 Prok-TraM Prokaryotic Transcriptional repressor TraM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1rfyA00
1US6A 4NKGB 4NB5A 2RMKB 1UPGA 1RFYA 1CXZB 4DYLA 4IGGA 1URFA 2Q0OC 2HJDA
chains in the Genus database with same CATH superfamily
3SPJA 1N8RW 4ZHQA 2JGDA 4IIJB 1Q3EA 1AP6A 4PJ0Z 4IHJB 1S5HC 4DK1A 1R6NA 2B1IA 3E89A 5CB4A 4BW9A 5K1PA 1D5AA 2IU3A 4WF9V 4DV5O 4O4HA 4DV3O 2F4VB 3EXAA 4DO2A 3B09A 5KHJA 1DLBA 4H13B 1JVMA 2QM7A 3ZMZA 2Y69B 1IX9A 1CP9A 4HZ3A 3TXSA 1IXBA 1NS1A 3OUFA 4LF4O 2Y0PA 1VQ9V 5TISZ 4G2KA 1AJPA 1BQZA 5B66Z 2ADQB 4GZRB 3JALB 2YIBD 2WLJA 1SC5B 4DV0O 3QG5A 5IJ9A 1K7DA 3U11A 3AG4B 5JH7A 3WB1A 4OX9B 4LF5B 1QNMA 4UV9A 3IJ4A 1FKAO 3QVNA 3CHXA 5FLXN 4DV7O 2R9RB 3JASB 4UCTA 4LR3A 5H2FZ 5GW7A 1DTOA 4XDJA 1VQOV 2A06H 3HPLC 4BIZA 2P06A 3N2KA 3AK3A 4KHPO 1BCCH 4H0LB 1DF4A 5KHKA 5IYCO 4JI5B 4DR4O 3I5DA 5CA1B 2Y0IA 1WP8A 1YZBA 1AI4A 3K5OA 3N2KB 3G4SV 1TVKB 2AXTZ 1QHTA 3K3WA 4FLUA 5A2QN 1LUVA 3UKMA 1VIBA 5EZYA 3ZMUA 2QWQB 2KQXA 4CH5A 2OCHA 4JI1O 1EN5A 5F2VO 4J11A 4IYHA 4DR3O 2VQFB 3G71V 4DUYB 1P49A 5EZYB 3Q4HA 4RO2A 3ABTA 4X1YA 4HBNA 2EIJC 1E1RG 2XOKG 1F7YA 4IYIA 1L1FA 2NNUA 3C3TA 1S5LZ 1GM9A 4JI2B 4TT3G 4NTYA 3FAVA 3JAWA 4CC5A 1M56C 2Q7HA 1WPBA 3DSQA 2KSDA 5LYJA 3ICXA 4TQFA 1I5XA 4XBFA 5LA6B 2P67A 3FAVB 4I50A 2EILC 4Q6GA 1M57B 2BTOA 2Z0AA 2PY5A 4X64O 1F4MA 2RCVA 4BIUA 5A9GA 4J9YB 3NR7A 3RBZA 3TETA 3T1HO 1K73W 4J42A 1TUEB 2ZIOA 2JJ1G 4RQEA 2IM9A 1BS3A 1SQQH 4TOIA 4DV1B 3L73H 1U96A 3C3SA 1S72V 1DK1A 1N36B 5B1AB 3LSUA 3JATA 4JYAB 1OCRC 1QLEC 5KX5B 1FFTB 4NTXA 1VQPV 5FPOA 4FZ0A 3KZIZ 3LDEA 5L3CA 2E5LB 2OT5A 4GLXA 3BEHA 3TJTA 2B9ZA 3K9AA 3JSLA 1NR1A 5KHIA 4EEQA 2W6JG 1AROP 1M56B 1EZJA 1M93A 3BRCA 4K3AA 5FPRA 4GKJB 4OPAA 1I08A 1YJWV 3GB7C 3JD2A 4LWSA 1RPOA 1XOUA 4O4IA 4LFAO 4NKGB 1LR1A 1VQKV 4QE7A 1P7BA 3ZRWB 3CE2A 1NT2B 1SQFA 3B8NA 1VF7A 1ZWIC 4LWSB 1GN6A 4X66O 1FAFA 4GT1A 2WSSG 1O9HA 1Y76B 4PA4A 1M1KW 5IYZA 2DW4A 4I5SA 2QA4V 3E8FA 2UXDB 4CH3A 1VEWA 1XUQA 4QPKA 3AG2C 4LH7A 3AK2A 4PELA 2ZXWC 4O4LB 3FYEB 1P7GA 4RAIA 4CC6A 3ZHSA 1I5YA 1YCIA 4DV2O 2H8PC 3OT7A 4EKWA 1IBMB 3FB5C 4DR1O 2AHZA 3ZHRA 5LGNA 2W0FC 3OFNG 1G6UA 2F1MA 4OGQB 3ABMC 4DR2O 4JZ2A 2ZR3A 4JAVA 1NH2B 2AW9A 1K9MW 3CC7V 4GKKO 3K5NA 2X6AA 4J9ZB 2DOSA 3ASNB 4YY3B 4MTXA 2JEXA 4TV9B 4H44B 1R3IC 4AI8A 2HJFC 4LC1A 2UXCO 3ZS8C 5J9PC 1Q8IA 4B3SB 1Q82W 4FIPC 2LFSA 3E8HA 3CEIA 3K79A 1XILA 2UXNA 4DUZB 3OGIB 3ABKC 3A2FA 5L3EA 5JCOC 4I55A 5KAFZ 3OTOO 5HFMA 4FFBB 2ZT9B 4DR6O 4HYOA 3IFXA 1P84F 5IYDO 1N33O 3W7UA 3BFRA 3H9VA 4FJCC 1Q81W 2UUAO 4JASA 5JJJB 1HR0B 4MVOA 2Q67A 1JCHA 4ZBMA 5FNVB 4YHHO 1VF6C 4F6RB 3CX5F 1RM1C 2QTSA 4JYBA 3WG7B 1FD9A 5BR8B 2ZE7A 1AR4A 1M90W 2DQ0A 2IW5A 4U3FH 3DXRB 5IT9N 3KCYA 2N04A 3ABMB 2FYUH 3B8MA 1MA1A 3OAAG 1XNQB 3OEEG 1MABG 1GN4A 3W7SA 4NXNB 3CCLV 5IJ0B 3FFQA 2EINC 2CH7A 5GONA 3CPWU 1NI8A 3VBBA 3ZJZA 5IY5C 1AILA 2YI8A 3E2EA 4QIWF 3L9DA 1R73A 1FFXB 1OCOB 2ADPA 4X20A 3RYIB 1QCEA 4QJFB 1J95A 4O2BA 2RMKB 2Z3YA 2XAFA 5H5NA 3U0ZA 1RSOB 1MZEA 3RW0A 3N2GA 4GUNA 4X20B 3AK1A 1QR8A 5KA6A 4E2LA 2PF4E 4JI3O 2FB5A 3MAQA 2YI9A 3JAKB 1GAXA 4QNHB 1SA0B 2WA4A 2G38A 2F4VO 2PYLA 4JYCA 4MVSA 1T5EA 3X2QB 1V55C 4AILC 4X62O 3ZRSA 3RYCB 1FS0G 3F7YC 1RM1B 1GKFA 3GVMA 4O4JA 1R3KC 4B3RO 1ZLZA 2DN9A 4UXNA 1OZ0A 4OXSA 3H1IH 1W0KG 3FX7A 1HWYA 1PNLA 1NU1H 1K34A 1YITV 2VRZA 5ITZB 2FL4A 1V54B 2DYRC 4TV8A 3HKEA 3G6EV 3ASOC 3M8AA 1VQNV 4Z2WA 2LP7A 2LGWA 1SETA 5JJEB 1TUBB 1AJNA 1EN4A 5IY5B 3JAMN 4UCUA 1XMOO 1K5SA 1XNRB 3HKEB 5CA0B 4XDKA 4OX9O 2BOBC 2H94A 3ZMTA 4I0XA 1NKDA 1IXMA 2EULA 3E83A 2DMXA 2XAGA 4UVCA 1VQ8V 1MMMA 3BA9A 4ZIBA 3C90A 1IBKO 3ZHVA 1KC8W 3E8GA 1BE3H 4I0XB 4K0KB 4LF6B 2PUSA 3HKBB 4DR5B 1F23A 3UT5B 3I56V 3E86A 4NB5A 2ZKOA 3BY6A 4UB8Z 3K59A 1VQMV 2EIKC 5E1AC 4DV6B 5LMNO 3DTUB 1U97A 1VQ6V 2HFEC 4U3JB 5B1BC 1V55B 2OCCB 2R9AA 4MTOA 2HHHB 3SPGA 3IAYA 1AVMA 4IIJA 4B3TB 4D7TA 4IHJA 1ZTEA 3ETGA 2EIMB 4AHCA 3QO7A 4I4TB 4JI6B 1JA8A 2GSMB 3CCSV 4WFBV 2GBOA 1FJGB 5EIBD 4JV5B 2Q7GA 2XNDG 3ASOB 3JD3A 3LSQA 4JTAB 4KFMA 1OV9A 4PI0A 3SGIA 4UB6Z 3CMAV 3APQA 2PGGA 2X6BA 2QKAA 3CS5A 4KP4A 3JALA 4JI2O 5K1XA 5LHIA 3CSXA 4PDLA 2QKSA 1QU7A 3ABLC 4I7ZB 3ZEDA 1Q5OA 1XMQB 1PL0A 1ORQC 2KKWA 4GX2A 3CXCU 3BPZA 2V1DA 1SQGA 3E35A 1XDCA 1MZFA 3JASA 5LHGA 1OCCC 1H2MA 4WCEV 4JTCB 1KP2A 4UFZA 2OIGA 1HNZO 2Y4TA 4DRXA 4MVRA 2WA3A 3L70H 1NJIW 1K92A 2ZR2A 3WB0A 2Q69A 1YDXA 3OMAB 1K97A 2UUBO 3CYOA 1H2LA 3S3XA 4DRXB 1VQLV 4JI0O 5CA1A 2F43G 4DV1O 5LP6C 1Q6IA 4QE9A 2UXXA 4NVPA 1SERA 1NVPD 3IGAC 2IBZH 1JQ0A 4JPRA 4MTGA 1TVKA 4KUMA 1EM1A 3QO8A 3SDLA 2V7QG 2XAJA 4RWUA 5CN0A 2QWNB 2R72A 4JI4B 3ZN0A 3O9OA 2QKCA 4LP8A 2CAZC 5EC2C 4JTDB 2MW2B 4D7SA 1M4UA 3JD1A 2Q68A 5D5PA 2ZCEA 3ZN1A 3CXHF 2Q5ZA 5H9CA 2K9PA 2A0LA 1Y66A 5EBWC 1R1BA 1JR9A 1Y4MA 1DF5A 1COWG 3K04A 5EYPB 4J7KA 2ARHA 1H38A 1YEWA 4E4EA 4X88A 1OCCB 3K0DA 2ZIMA 4TQDA 1FPOA 3B4SA 4GYCB 4J7ZA 3W7WA 1HNXO 2D3OW 4LFBB 2VQEO 1I7FA 5LA6A 4JAAA 2KG7B 5JQGB 4DV5B 4DV3B 4X1KB 2AGAA 1S77D 1SQXH 2CK3G 2BCCH 1L0LH 2IH1C 1NBMG 3PN1A 3O65A 4H33A 2HR3A 2IJJA 3TXQA 2YDEA 3I55V 4LF8O 1HW7A 1Y74B 3G6BA 2CTQA 5EBMC 3CMEV 4PDMA 3L72H 4X65O 3SYPA 1EBOA 3AG3C 4NXMO 4I9QA 3ZBHA 3WU2Z 2DWEC 3RYFB 1PP9H 1SF9A 4ZI7B 4PA7A 5L3BA 4DV0B 2UUCO 2R9IA 4WFFA 3DC6A 4QPJA 5L3DA 5JWPA 2LGQA 4XDLA 3LNNA 4EFBA 3CCEV 5KX5A 3BCCH 2F95B 2ZNIA 3BABA 5J2UB 1XREA 4JYYA 2EIJB 1ZL8A 4YJ3B 3CRMA 1N34B 1FXHA 4IT5A 1KKCA 3T4DA 1XI1A 1BSMA 3FB7C 5CA3A 4DUZO 4KHPB 1BMFG 2Y4UA 3FKSG 1ZL8B 3K5LA 1GH6A 4DR4B 1S0VA 2QJ1A 3ZRWA 1XEQA 2ZM6O 2BSKB 1L0NH 1N32B 5DM6V 2EILB 1K4CC 1HR0O 4K8ZA 1Y76A 2P22C 3SYCA 2JS3A 3K58A 4LF7O 1JJOA 1I94O 2X6CA 2BTQB 3AG1C 4DR3B 2E3CA 2EZOA 1I0HA 1OCZC 5DECA 5E79Z 1JPXA 4TUYB 1OJHA 4WBNB 4RQFA 3WFVA 2PYJA 3KKYA 4O4LA 3CCMV 1V9PA 3W7XA 1EN6A 1FXKC 3ETDA 1K33A 1GK9A 3CD6V 2EJRA 1PNMA 3W7TA 1YTFB 4CH4A 4WFEA 4ZOLA 4UCOA 1OCRB 1QLEB 1XBLA 5B5EZ 3T1YO 2Z5UA 5B3SC 3E22B 1MOFA 4PI2A 3OTFA 4ZOLB 2F93B 2A7WA 1E79G 2UXBO 2ITDC 2YXHA 1YIJV 2P7TC 3LDCA 4X64B 3FD9A 1PPJH 4TV9A 1X4TA 2PTMA 5IWAO 3OR7C 4U7OA 2Q73A 2W6IG 4BW5A 3LUTB 3T1HB 3MD0A 1TGOA 4IGGA 1Q86W 3ETQA 2DYSC 4LF9O 2QR4A 1HDJA 3RYHB 2QTOA 3JCZA 3KCXA 2E74B 3K0GA 4UCRA 4H37A 4FFBA 2GV9A 2WWWA 4F4LA 1PD3A 4WFGA 1HP8A 1YVWA 3DC5A 4ASUG 2MK3A 1BGYH 2YSUB 3BA8A 2CGNA 3VQVA 3U10A 4YIOA 3THOA 3D3QA 1SQVH 5LOVB 4PA6A 1DGSA 3APOA 5FNVA 5LL6Y 2FTKA 1K5QA 3AG2B 4F6RA 2YEVA 1FXKB 3CCVV 2A9HA 4FLTA 2ZXWB 4PDVA 4LFCB 5B1NA 1IBLO 1Z5VA 3K57A 3UO2A 3DXRA 3SYQA 3RN4A 4B3MB 2YEVB 2P5OA 2HVJC 1J5EO 2DQ3A 2O57A 1RPRA 2K1EA 3ZHQA 4LNUB 1EFRG 1ENVA 3JD0A 1BHAA 1BL8A 4LFAB 5BMVB 1YTFD 2ZE5A 4GX0A 2EBOA 4UUJC 5IJ0A 5KMGA 3K5MA 2ZDIA 1AR5A 1F51A 4K8XA 2QWPB 4DR5O 2HKOA 3E8BA 4X9QA 4HAMA 1FFXA 5KMGB 1GO3F 2GDSA 3ZMVA 3OUSA 2QWOB 1H8HG 2CUGA 1L8DA 3RYIA 5JCOA 2OTLV 4DYLA 1HNWO 1QLNA 2IJKA 3D36A 1NH2D 4JI8O 1RSOA 3PJSK 5LHHA 3SPHA 5J2TB 4CBCA 4DV4O 5LBQA 3ABKB 4B3TO 1MSWD 3OD4A 1B6QA 1FXVA 3JAKA 2Q9LA 1QVFU 1SA0A 2XAQA 3IC9A 1Y67A 1FJGO 4DV2B 3RYCA 4R6ZA 1A32A 2QE7G 3ZRVA 4TWKA 3ZCCA 1VQ5V 5C8YB 4DR1B 4MW8A 4G28B 1Z5WA 3ZX6A 4DR2B 1K3EA 4YIPA 4P9PA 1W0JG 1ZSPA 1UJWB 1H8EG 4FLWA 4GKKB 2B1GA 5ITZA 2NR5A 3RVZA 4L87A 2P90A 1WA8A 2IJIA 4MVQA 4B08A 3L74H 2LW1A 3CJHB 1B3QA 2UXCB 1TUBA 1WLEA 2EZPA 5FL7G 3HKCB 4F6EA 1WA8B 5CA0A 3A8TA 3STZC 3SYAA 3K9SA 2CGOA 1CEZA 1JMKC 2EINB 2Q6AA 1VF5B 2B5UA 4P2ZA 2XASA 3OTOB 2JDIG 2OIEA 3R65A 3VOUA 2RJZA 4DR6B 3OE7G 2ODMA 4LF5O 1N33B 2AHYA 3HKBA 2GUZB 3UT5A 4B7KA 4YXWG 5LXTB 3B2EE 4A5UB 3M99B 2Q8VA 1JFFA 4EFEA 1UPGA 1H2GA 4J7JA 4YHHB 1FYJA 2PZSA 2Y69C 4AQYB 5LMUB 4U3JA 1WB7A 1KB9F 3HR0A 2ZQMA 4U7NA 2X7RB 1JFFB 2QSAA 4UVAA 3CCJV 4EB6B 4FK5C 4JI5O 2XUMA 3HKDA 3B77A 4ICGA 1JJ2U 4WFHA 1ROPA 1N0NA 4I4TA 5KLVH 3VQXA 1KBHA 1D2DA 1PV0A 3JARB 3D8CA 3HKDB 4CZZA 2EJ7A 2WLNA 4GCZA 1F4NA 2E76B 3OMIB 4X8AA 3P3PA 1QVGU 2YXLA 3FB8C 1TA8A 1VQ4V 3ABUA 2DYRB 1S5JA 1QR9A 1YSCA 1NQTA 2VQFO 4BAYA 4DUYO 3OEHG 1YI2V 4FLVA 1RP3B 5EBLC 3ZMSA 4UVBA 3ZHUA 4JI3B 2N05A 3FB6C 4W4KA 1Z2GA 2JK5C 4LFBO 1K4DC 2L35A 2L6LA 3MDSA 4RUEA 4DW0A 2WLLA 3A0BZ 1P4RA 1BZKA 4ZHQB 2JGDB 4UCSA 4KXRA 4X62B 2NLJC 1KYOF 2RQ6A 2YIAA 5CB4B 2WLLB 3L71H 4O4HB 2EIKB 4PA9A 4B3RB 2D2CB 4J41A 2EX3A 5B1BB 3ZRXA 2GHYA 1BQ0A 2JJ2G 3F7VC 3TGUH 3AEIA 3B40A 4BWAA 1GMGA 2WLHA 5HFLA 4MS2A 4MVMA 2UU9B 3RFRA 2ATKC 3CRCA 4YJ2A 3JD4A 5EC1C 2ZE8A 3DGEA 1XMOB 3VQWA 2IU0A 1NZ6A 3G80A 2M7WA 2H3OA 4DK0A 1BHBA 1SZTA 1SKVA 3KG2A 1ZX3A 4YJ2B 5IJ9B 2Q0AA 1KMIZ 2ILMA 1N36O 3BHPA 5JH7B 1IBKB 4P9OA 4B7EA 4JYAO 2F23A 4I9WA 1SESA 1N34O 1XHXA 1VQ7V 1Q6UA 1KP3A 1KUQA 2E5LO 1XQ8A 5LMNB 1M57C 5CBHA 1GN2A 4LCUC 1R3LC 1O9GA 2YXYA 3J7AU 5EYPA 1AI7A 2XTAA 4JI7B 1Q6HA 1NTMH 3ABLB 4UCVA 4GKJO 2VS0A 1S3JA 1IDSA 3F5TA 2F66C 3MHSC 1N32O 3K03A 4DR7B 2QM4A 4ABMA 1G8MA 4MW3A 2VWKA 2KG7A 4O2AA 5H6QA 5JQGA 3TCUA 4X1KA 2JS5A 2CTRA 2LQTA 3P30A 1SQBH 2FKXA 3ZHTA 1IURA 1QQCA 3D3IA 4O2AB 4GX1A 5LP6A 5B1AC 3STLC 3CRQA 4HNAA 2Q7EA 5L3GA 3ETEA 1Y74A 1GM7A 1WNSA 2Q0OC 4PA3A 5IE9A 2UXDO 4MT8A 1AB3A 2QWRB 2C2AA 2P6JA 4D6TH 5LP6B 3Q4HB 1E1QG 2XAHA 1PM9A 4HNAB 4LBEC 4X1YB 4LF4B 1R6KA 3P3NA 1G1XB 1KD1W 4Z1MG 3RYFA 5GTHZ 1MSDA 4ZI7A 1SZXA 1WP7A 1THZA 4N21A 3TK1A 4DXWA 1YF2A 4J80A 2WLMA 2HLDG 2OWOA 3JAWB 1IBMO 3N27A 3JYCA 3CCRV 2AZ2A 5LYJB 5J2UA 1S76D 1W2BU 3H1HH 2OYQA 4I50B 5EK0A 5AG2A 1IVSA 1HNZB 2FMLA 4YJ3A 3UCSC 4DV7B 4YY3O 3UQ8A 3GWOA 3CCQV 2UUBB 2YUAA 5KHGA 4UV8A 3SJCC 1MG1A 2OTJV 4N23A 4B3SO 3OM3B 4JI0B 4OPHA 2JVDA 1NTZH 4FLYA 4R50A 1D5NA 4FLXA 2BSKA 3LSSA 4PHZA 3VQYA 2WLKA 3ZIAG 4Q20A 1WB8A 1VP7A 3JSNA 1JX9A 2N74A 3RWRD 3JATB 1AI5A 2BTQA 3SJQC 4LFCO 2QM8A 4TUYA 4NTWA 4JGSA 2ZE6A 2CTPA 3AG3B 4JI1B 4R7CA 4WBNA 4B3MO 5BR8O 4IL6Z 1XL4A 5LGUA 4P30A 3CRAA 1MNGA 4PD4F 1NTKH 2DE0X 3ASNC 5H6RA 4GX5A 1AP5A 2V4DA 3BAAA 3AG7A 3H01A 2WAMA 3T1CA 5DN6G 3JCUZ 2YIDA 3UO3A 1XNQO 1HNXB 3CC2V 1R3JC 1XL6A 2QEXV 1AR1B 2VQEB 4O4IB 2JEUA 2P4VA 4NXNO 3R66A 3E22A 1YXBA 4X89A 3J80N 3OMNB 1NR7A 1SS3A 1M5IA 1Y6XA 2XT9A 1YHQV 2IJHA 1GN3A 1SRYA 4MVZA 4PV1B 5GTIZ 1CXZB 4MSWC 4FM0A 4FZ1A 1KQSU 1K8AW 4JAUA 4LF8B 3RT3C 5IYZB 4CH6A 5JVDA 2GTSA 3OGCC 4X65B 3GWKC 3RYHA 4NXMB 2ZINA 3WG7C 3UM7A 3SYOA 2Q4PA 2W0XA 3SJBC 5JVDB 4KL1A 3HB3B 3M7MX 2YC0A 2UUCB 1B04A 1KU9A 2LW7A 5IDJA 5BY1A 2HVKC 3L75H 2LO1A 2IH3C 2RDCA 1N4CA 3AG1B 4TSFG 5LOVA 1KECA 1OCZB 1ZUQA 3S3WA 2ZDIC 1FXKA 2P4KA 4WFAV 4FM2A 2R70A 1US6A 2JRIA 2E75B 1WJZA 1GTOA 1ZAUA 3H1JH 2NN4A 3EHBB 4FMTA 1URFA 2HJDA 1OCOC 4R8CA 5CBGA 1VARA 3SR2C 1H2KA 3ML0A 1W59A 4CS3A 4LNUA 1H2NA 1WAZA 3D36C 1N0JA 2ZD9A 3LDDA 5BMVA 1XNRO 2KB1A 4FPPA 4ZKIA 2ZM6B 1IZ3A 5B3SB 3CCUV 3SPCA 1AI6A 4I55B 2ZNJA 1YJ9V 4FLZA 2PI4A 3H1LH 3X2QC 5LGTA 3RGBA 4LF7B 4K35A 3QTCA 1SQPH 2ITCC 4AQYO 1I94B 4LF6O 4K0KO 3A0HZ 5EIBC 5LMUO 4X66B 4MTFA 2WLIA 3F5WC 3SJAC 5KUKA 3T4ZA 2DYSB 4DV6O 5J2TA 1X59A 2BOCC 3T2MA 2WLIB 2HP8A 1XHZA 5BZBA 2M6YA 3OR6C 5KA5A 2HHHO 1V54C 1Q90D 1JOYA 1M9NA 4G27B 3CB2A 1B06A 5CBFA 2QDOA 1R6TA 3CP1A 1LNQA 5C8YA 4JI6O 5BXZA 2RNBA 1VMGA 3T1YB 1VF6A 4JV5O 2CH7B 5GONB 2LFRA 1G4YB 3OW2U 2A3QA 3QF7A 3EFFK 2UXBB 2WPDG 2QGNA 4JF3A 1UFIA 2VWJA 4BIOA 2PI5A 2YICA 4NR1A 5IWAB 1KKDA 3CJHA 4FFKA 1WPXA 2LJ2A 3MHHC 5IYBO 4JZGA 4O2BB 2RN9A 3HKCA 4LF9B 5KHHA 4FVMA 2BE3A 4PDRA 3N2GB 4CS4A 3P32A 4CS2A 4X1IA 3QO5A 2OCCC 5D5QA 2AZ0A 1XMQO 1Q7YW 3SPIA 1H2SB 4C7UA 1PKXA 5DEDA 2EIMC 2GUZA 2CDYA 4X1IB 1GRJA 3IC7A 3NXSA 5KAIZ 3CWBH 5LXTA 1LUWA 5CMUA 5JJNB 1PNKA 4O4JB 4J10A 4RUFA 4NYKA 1GM8A 3CRRA 2UUAB 4L8JA 2UU9O 1CPYA 1IBLB 2YS8A 2YIBA 2X0LA 4EB6A 2ETNA 1PL4A 1J5EB 3QNEA 4TV8B 4FM1A 2JGUA 1RFYA 4DW1A 1EZVH 4Z1VA 3K06A 5KUMA 1Q43A 1WN7A 2DWDC 2DJVA 3JARA 4W4LA 1AJQA 3WB2A 3EVKA 2JIZG 4LH6A 2HEPA 4BR6A 2CE4A 1QBZA 4JI4O 3LNMB 1TAEA 1OHHG 3J81N 2Y48A 5B1OA 3K08A 3G67A 1HNWB 3BVOA 3AG4C 3RVYA 4JI7O 4JI8B 5C93A 2GTAA 2HG5C 4MVUA 3A0RA 4DV4B 3CC4V 1NVPB 1BT8A 4DR7O 2CTWA 3H1KH 3FYIB 5L3FA 4QGPA 2A79B 2XHBA 1YJNV
chains in the Genus database with same CATH topology
1US6A 4NKGB 4NB5A 2RMKB 1UPGA 1RFYA 1CXZB 4DYLA 4IGGA 1URFA 2Q0OC 2HJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1US6 A;  4NKG B;  4NB5 A;  2RMK B;  1UPG A;  1RFY A;  1CXZ B;  4DYL A;  4IGG A;  1URF A;  2Q0O C;  2HJD A; 
#chains in the Genus database with same CATH topology
 3SPJ A;  1N8R W;  4ZHQ A;  2JGD A;  4IIJ B;  1Q3E A;  1AP6 A;  4PJ0 Z;  4IHJ B;  1S5H C;  4DK1 A;  1R6N A;  2B1I A;  3E89 A;  5CB4 A;  4BW9 A;  5K1P A;  1D5A A;  2IU3 A;  4WF9 V;  4DV5 O;  4O4H A;  4DV3 O;  2F4V B;  3EXA A;  4DO2 A;  3B09 A;  5KHJ A;  1DLB A;  4H13 B;  1JVM A;  2QM7 A;  3ZMZ A;  2Y69 B;  1IX9 A;  1CP9 A;  4HZ3 A;  3TXS A;  1IXB A;  1NS1 A;  3OUF A;  4LF4 O;  2Y0P A;  1VQ9 V;  5TIS Z;  4G2K A;  1AJP A;  1BQZ A;  5B66 Z;  2ADQ B;  4GZR B;  3JAL B;  2YIB D;  2WLJ A;  1SC5 B;  4DV0 O;  3QG5 A;  5IJ9 A;  1K7D A;  3U11 A;  3AG4 B;  5JH7 A;  3WB1 A;  4OX9 B;  4LF5 B;  1QNM A;  4UV9 A;  3IJ4 A;  1FKA O;  3QVN A;  3CHX A;  5FLX N;  4DV7 O;  2R9R B;  3JAS B;  4UCT A;  4LR3 A;  5H2F Z;  5GW7 A;  1DTO A;  4XDJ A;  1VQO V;  2A06 H;  3HPL C;  4BIZ A;  2P06 A;  3N2K A;  3AK3 A;  4KHP O;  1BCC H;  4H0L B;  1DF4 A;  5KHK A;  5IYC O;  4JI5 B;  4DR4 O;  3I5D A;  5CA1 B;  2Y0I A;  1WP8 A;  1YZB A;  1AI4 A;  3K5O A;  3N2K B;  3G4S V;  1TVK B;  2AXT Z;  1QHT A;  3K3W A;  4FLU A;  5A2Q N;  1LUV A;  3UKM A;  1VIB A;  5EZY A;  3ZMU A;  2QWQ B;  2KQX A;  4CH5 A;  2OCH A;  4JI1 O;  1EN5 A;  5F2V O;  4J11 A;  4IYH A;  4DR3 O;  2VQF B;  3G71 V;  4DUY B;  1P49 A;  5EZY B;  3Q4H A;  4RO2 A;  3ABT A;  4X1Y A;  4HBN A;  2EIJ C;  1E1R G;  2XOK G;  1F7Y A;  4IYI A;  1L1F A;  2NNU A;  3C3T A;  1S5L Z;  1GM9 A;  4JI2 B;  4TT3 G;  4NTY A;  3FAV A;  3JAW A;  4CC5 A;  1M56 C;  2Q7H A;  1WPB A;  3DSQ A;  2KSD A;  5LYJ A;  3ICX A;  4TQF A;  1I5X A;  4XBF A;  5LA6 B;  2P67 A;  3FAV B;  4I50 A;  2EIL C;  4Q6G A;  1M57 B;  2BTO A;  2Z0A A;  2PY5 A;  4X64 O;  1F4M A;  2RCV A;  4BIU A;  5A9G A;  4J9Y B;  3NR7 A;  3RBZ A;  3TET A;  3T1H O;  1K73 W;  4J42 A;  1TUE B;  2ZIO A;  2JJ1 G;  4RQE A;  2IM9 A;  1BS3 A;  1SQQ H;  4TOI A;  4DV1 B;  3L73 H;  1U96 A;  3C3S A;  1S72 V;  1DK1 A;  1N36 B;  5B1A B;  3LSU A;  3JAT A;  4JYA B;  1OCR C;  1QLE C;  5KX5 B;  1FFT B;  4NTX A;  1VQP V;  5FPO A;  4FZ0 A;  3KZI Z;  3LDE A;  5L3C A;  2E5L B;  2OT5 A;  4GLX A;  3BEH A;  3TJT A;  2B9Z A;  3K9A A;  3JSL A;  1NR1 A;  5KHI A;  4EEQ A;  2W6J G;  1ARO P;  1M56 B;  1EZJ A;  1M93 A;  3BRC A;  4K3A A;  5FPR A;  4GKJ B;  4OPA A;  1I08 A;  1YJW V;  3GB7 C;  3JD2 A;  4LWS A;  1RPO A;  1XOU A;  4O4I A;  4LFA O;  4NKG B;  1LR1 A;  1VQK V;  4QE7 A;  1P7B A;  3ZRW B;  3CE2 A;  1NT2 B;  1SQF A;  3B8N A;  1VF7 A;  1ZWI C;  4LWS B;  1GN6 A;  4X66 O;  1FAF A;  4GT1 A;  2WSS G;  1O9H A;  1Y76 B;  4PA4 A;  1M1K W;  5IYZ A;  2DW4 A;  4I5S A;  2QA4 V;  3E8F A;  2UXD B;  4CH3 A;  1VEW A;  1XUQ A;  4QPK A;  3AG2 C;  4LH7 A;  3AK2 A;  4PEL A;  2ZXW C;  4O4L B;  3FYE B;  1P7G A;  4RAI A;  4CC6 A;  3ZHS A;  1I5Y A;  1YCI A;  4DV2 O;  2H8P C;  3OT7 A;  4EKW A;  1IBM B;  3FB5 C;  4DR1 O;  2AHZ A;  3ZHR A;  5LGN A;  2W0F C;  3OFN G;  1G6U A;  2F1M A;  4OGQ B;  3ABM C;  4DR2 O;  4JZ2 A;  2ZR3 A;  4JAV A;  1NH2 B;  2AW9 A;  1K9M W;  3CC7 V;  4GKK O;  3K5N A;  2X6A A;  4J9Z B;  2DOS A;  3ASN B;  4YY3 B;  4MTX A;  2JEX A;  4TV9 B;  4H44 B;  1R3I C;  4AI8 A;  2HJF C;  4LC1 A;  2UXC O;  3ZS8 C;  5J9P C;  1Q8I A;  4B3S B;  1Q82 W;  4FIP C;  2LFS A;  3E8H A;  3CEI A;  3K79 A;  1XIL A;  2UXN A;  4DUZ B;  3OGI B;  3ABK C;  3A2F A;  5L3E A;  5JCO C;  4I55 A;  5KAF Z;  3OTO O;  5HFM A;  4FFB B;  2ZT9 B;  4DR6 O;  4HYO A;  3IFX A;  1P84 F;  5IYD O;  1N33 O;  3W7U A;  3BFR A;  3H9V A;  4FJC C;  1Q81 W;  2UUA O;  4JAS A;  5JJJ B;  1HR0 B;  4MVO A;  2Q67 A;  1JCH A;  4ZBM A;  5FNV B;  4YHH O;  1VF6 C;  4F6R B;  3CX5 F;  1RM1 C;  2QTS A;  4JYB A;  3WG7 B;  1FD9 A;  5BR8 B;  2ZE7 A;  1AR4 A;  1M90 W;  2DQ0 A;  2IW5 A;  4U3F H;  3DXR B;  5IT9 N;  3KCY A;  2N04 A;  3ABM B;  2FYU H;  3B8M A;  1MA1 A;  3OAA G;  1XNQ B;  3OEE G;  1MAB G;  1GN4 A;  3W7S A;  4NXN B;  3CCL V;  5IJ0 B;  3FFQ A;  2EIN C;  2CH7 A;  5GON A;  3CPW U;  1NI8 A;  3VBB A;  3ZJZ A;  5IY5 C;  1AIL A;  2YI8 A;  3E2E A;  4QIW F;  3L9D A;  1R73 A;  1FFX B;  1OCO B;  2ADP A;  4X20 A;  3RYI B;  1QCE A;  4QJF B;  1J95 A;  4O2B A;  2RMK B;  2Z3Y A;  2XAF A;  5H5N A;  3U0Z A;  1RSO B;  1MZE A;  3RW0 A;  3N2G A;  4GUN A;  4X20 B;  3AK1 A;  1QR8 A;  5KA6 A;  4E2L A;  2PF4 E;  4JI3 O;  2FB5 A;  3MAQ A;  2YI9 A;  3JAK B;  1GAX A;  4QNH B;  1SA0 B;  2WA4 A;  2G38 A;  2F4V O;  2PYL A;  4JYC A;  4MVS A;  1T5E A;  3X2Q B;  1V55 C;  4AIL C;  4X62 O;  3ZRS A;  3RYC B;  1FS0 G;  3F7Y C;  1RM1 B;  1GKF A;  3GVM A;  4O4J A;  1R3K C;  4B3R O;  1ZLZ A;  2DN9 A;  4UXN A;  1OZ0 A;  4OXS A;  3H1I H;  1W0K G;  3FX7 A;  1HWY A;  1PNL A;  1NU1 H;  1K34 A;  1YIT V;  2VRZ A;  5ITZ B;  2FL4 A;  1V54 B;  2DYR C;  4TV8 A;  3HKE A;  3G6E V;  3ASO C;  3M8A A;  1VQN V;  4Z2W A;  2LP7 A;  2LGW A;  1SET A;  5JJE B;  1TUB B;  1AJN A;  1EN4 A;  5IY5 B;  3JAM N;  4UCU A;  1XMO O;  1K5S A;  1XNR B;  3HKE B;  5CA0 B;  4XDK A;  4OX9 O;  2BOB C;  2H94 A;  3ZMT A;  4I0X A;  1NKD A;  1IXM A;  2EUL A;  3E83 A;  2DMX A;  2XAG A;  4UVC A;  1VQ8 V;  1MMM A;  3BA9 A;  4ZIB A;  3C90 A;  1IBK O;  3ZHV A;  1KC8 W;  3E8G A;  1BE3 H;  4I0X B;  4K0K B;  4LF6 B;  2PUS A;  3HKB B;  4DR5 B;  1F23 A;  3UT5 B;  3I56 V;  3E86 A;  4NB5 A;  2ZKO A;  3BY6 A;  4UB8 Z;  3K59 A;  1VQM V;  2EIK C;  5E1A C;  4DV6 B;  5LMN O;  3DTU B;  1U97 A;  1VQ6 V;  2HFE C;  4U3J B;  5B1B C;  1V55 B;  2OCC B;  2R9A A;  4MTO A;  2HHH B;  3SPG A;  3IAY A;  1AVM A;  4IIJ A;  4B3T B;  4D7T A;  4IHJ A;  1ZTE A;  3ETG A;  2EIM B;  4AHC A;  3QO7 A;  4I4T B;  4JI6 B;  1JA8 A;  2GSM B;  3CCS V;  4WFB V;  2GBO A;  1FJG B;  5EIB D;  4JV5 B;  2Q7G A;  2XND G;  3ASO B;  3JD3 A;  3LSQ A;  4JTA B;  4KFM A;  1OV9 A;  4PI0 A;  3SGI A;  4UB6 Z;  3CMA V;  3APQ A;  2PGG A;  2X6B A;  2QKA A;  3CS5 A;  4KP4 A;  3JAL A;  4JI2 O;  5K1X A;  5LHI A;  3CSX A;  4PDL A;  2QKS A;  1QU7 A;  3ABL C;  4I7Z B;  3ZED A;  1Q5O A;  1XMQ B;  1PL0 A;  1ORQ C;  2KKW A;  4GX2 A;  3CXC U;  3BPZ A;  2V1D A;  1SQG A;  3E35 A;  1XDC A;  1MZF A;  3JAS A;  5LHG A;  1OCC C;  1H2M A;  4WCE V;  4JTC B;  1KP2 A;  4UFZ A;  2OIG A;  1HNZ O;  2Y4T A;  4DRX A;  4MVR A;  2WA3 A;  3L70 H;  1NJI W;  1K92 A;  2ZR2 A;  3WB0 A;  2Q69 A;  1YDX A;  3OMA B;  1K97 A;  2UUB O;  3CYO A;  1H2L A;  3S3X A;  4DRX B;  1VQL V;  4JI0 O;  5CA1 A;  2F43 G;  4DV1 O;  5LP6 C;  1Q6I A;  4QE9 A;  2UXX A;  4NVP A;  1SER A;  1NVP D;  3IGA C;  2IBZ H;  1JQ0 A;  4JPR A;  4MTG A;  1TVK A;  4KUM A;  1EM1 A;  3QO8 A;  3SDL A;  2V7Q G;  2XAJ A;  4RWU A;  5CN0 A;  2QWN B;  2R72 A;  4JI4 B;  3ZN0 A;  3O9O A;  2QKC A;  4LP8 A;  2CAZ C;  5EC2 C;  4JTD B;  2MW2 B;  4D7S A;  1M4U A;  3JD1 A;  2Q68 A;  5D5P A;  2ZCE A;  3ZN1 A;  3CXH F;  2Q5Z A;  5H9C A;  2K9P A;  2A0L A;  1Y66 A;  5EBW C;  1R1B A;  1JR9 A;  1Y4M A;  1DF5 A;  1COW G;  3K04 A;  5EYP B;  4J7K A;  2ARH A;  1H38 A;  1YEW A;  4E4E A;  4X88 A;  1OCC B;  3K0D A;  2ZIM A;  4TQD A;  1FPO A;  3B4S A;  4GYC B;  4J7Z A;  3W7W A;  1HNX O;  2D3O W;  4LFB B;  2VQE O;  1I7F A;  5LA6 A;  4JAA A;  2KG7 B;  5JQG B;  4DV5 B;  4DV3 B;  4X1K B;  2AGA A;  1S77 D;  1SQX H;  2CK3 G;  2BCC H;  1L0L H;  2IH1 C;  1NBM G;  3PN1 A;  3O65 A;  4H33 A;  2HR3 A;  2IJJ A;  3TXQ A;  2YDE A;  3I55 V;  4LF8 O;  1HW7 A;  1Y74 B;  3G6B A;  2CTQ A;  5EBM C;  3CME V;  4PDM A;  3L72 H;  4X65 O;  3SYP A;  1EBO A;  3AG3 C;  4NXM O;  4I9Q A;  3ZBH A;  3WU2 Z;  2DWE C;  3RYF B;  1PP9 H;  1SF9 A;  4ZI7 B;  4PA7 A;  5L3B A;  4DV0 B;  2UUC O;  2R9I A;  4WFF A;  3DC6 A;  4QPJ A;  5L3D A;  5JWP A;  2LGQ A;  4XDL A;  3LNN A;  4EFB A;  3CCE V;  5KX5 A;  3BCC H;  2F95 B;  2ZNI A;  3BAB A;  5J2U B;  1XRE A;  4JYY A;  2EIJ B;  1ZL8 A;  4YJ3 B;  3CRM A;  1N34 B;  1FXH A;  4IT5 A;  1KKC A;  3T4D A;  1XI1 A;  1BSM A;  3FB7 C;  5CA3 A;  4DUZ O;  4KHP B;  1BMF G;  2Y4U A;  3FKS G;  1ZL8 B;  3K5L A;  1GH6 A;  4DR4 B;  1S0V A;  2QJ1 A;  3ZRW A;  1XEQ A;  2ZM6 O;  2BSK B;  1L0N H;  1N32 B;  5DM6 V;  2EIL B;  1K4C C;  1HR0 O;  4K8Z A;  1Y76 A;  2P22 C;  3SYC A;  2JS3 A;  3K58 A;  4LF7 O;  1JJO A;  1I94 O;  2X6C A;  2BTQ B;  3AG1 C;  4DR3 B;  2E3C A;  2EZO A;  1I0H A;  1OCZ C;  5DEC A;  5E79 Z;  1JPX A;  4TUY B;  1OJH A;  4WBN B;  4RQF A;  3WFV A;  2PYJ A;  3KKY A;  4O4L A;  3CCM V;  1V9P A;  3W7X A;  1EN6 A;  1FXK C;  3ETD A;  1K33 A;  1GK9 A;  3CD6 V;  2EJR A;  1PNM A;  3W7T A;  1YTF B;  4CH4 A;  4WFE A;  4ZOL A;  4UCO A;  1OCR B;  1QLE B;  1XBL A;  5B5E Z;  3T1Y O;  2Z5U A;  5B3S C;  3E22 B;  1MOF A;  4PI2 A;  3OTF A;  4ZOL B;  2F93 B;  2A7W A;  1E79 G;  2UXB O;  2ITD C;  2YXH A;  1YIJ V;  2P7T C;  3LDC A;  4X64 B;  3FD9 A;  1PPJ H;  4TV9 A;  1X4T A;  2PTM A;  5IWA O;  3OR7 C;  4U7O A;  2Q73 A;  2W6I G;  4BW5 A;  3LUT B;  3T1H B;  3MD0 A;  1TGO A;  4IGG A;  1Q86 W;  3ETQ A;  2DYS C;  4LF9 O;  2QR4 A;  1HDJ A;  3RYH B;  2QTO A;  3JCZ A;  3KCX A;  2E74 B;  3K0G A;  4UCR A;  4H37 A;  4FFB A;  2GV9 A;  2WWW A;  4F4L A;  1PD3 A;  4WFG A;  1HP8 A;  1YVW A;  3DC5 A;  4ASU G;  2MK3 A;  1BGY H;  2YSU B;  3BA8 A;  2CGN A;  3VQV A;  3U10 A;  4YIO A;  3THO A;  3D3Q A;  1SQV H;  5LOV B;  4PA6 A;  1DGS A;  3APO A;  5FNV A;  5LL6 Y;  2FTK A;  1K5Q A;  3AG2 B;  4F6R A;  2YEV A;  1FXK B;  3CCV V;  2A9H A;  4FLT A;  2ZXW B;  4PDV A;  4LFC B;  5B1N A;  1IBL O;  1Z5V A;  3K57 A;  3UO2 A;  3DXR A;  3SYQ A;  3RN4 A;  4B3M B;  2YEV B;  2P5O A;  2HVJ C;  1J5E O;  2DQ3 A;  2O57 A;  1RPR A;  2K1E A;  3ZHQ A;  4LNU B;  1EFR G;  1ENV A;  3JD0 A;  1BHA A;  1BL8 A;  4LFA B;  5BMV B;  1YTF D;  2ZE5 A;  4GX0 A;  2EBO A;  4UUJ C;  5IJ0 A;  5KMG A;  3K5M A;  2ZDI A;  1AR5 A;  1F51 A;  4K8X A;  2QWP B;  4DR5 O;  2HKO A;  3E8B A;  4X9Q A;  4HAM A;  1FFX A;  5KMG B;  1GO3 F;  2GDS A;  3ZMV A;  3OUS A;  2QWO B;  1H8H G;  2CUG A;  1L8D A;  3RYI A;  5JCO A;  2OTL V;  4DYL A;  1HNW O;  1QLN A;  2IJK A;  3D36 A;  1NH2 D;  4JI8 O;  1RSO A;  3PJS K;  5LHH A;  3SPH A;  5J2T B;  4CBC A;  4DV4 O;  5LBQ A;  3ABK B;  4B3T O;  1MSW D;  3OD4 A;  1B6Q A;  1FXV A;  3JAK A;  2Q9L A;  1QVF U;  1SA0 A;  2XAQ A;  3IC9 A;  1Y67 A;  1FJG O;  4DV2 B;  3RYC A;  4R6Z A;  1A32 A;  2QE7 G;  3ZRV A;  4TWK A;  3ZCC A;  1VQ5 V;  5C8Y B;  4DR1 B;  4MW8 A;  4G28 B;  1Z5W A;  3ZX6 A;  4DR2 B;  1K3E A;  4YIP A;  4P9P A;  1W0J G;  1ZSP A;  1UJW B;  1H8E G;  4FLW A;  4GKK B;  2B1G A;  5ITZ A;  2NR5 A;  3RVZ A;  4L87 A;  2P90 A;  1WA8 A;  2IJI A;  4MVQ A;  4B08 A;  3L74 H;  2LW1 A;  3CJH B;  1B3Q A;  2UXC B;  1TUB A;  1WLE A;  2EZP A;  5FL7 G;  3HKC B;  4F6E A;  1WA8 B;  5CA0 A;  3A8T A;  3STZ C;  3SYA A;  3K9S A;  2CGO A;  1CEZ A;  1JMK C;  2EIN B;  2Q6A A;  1VF5 B;  2B5U A;  4P2Z A;  2XAS A;  3OTO B;  2JDI G;  2OIE A;  3R65 A;  3VOU A;  2RJZ A;  4DR6 B;  3OE7 G;  2ODM A;  4LF5 O;  1N33 B;  2AHY A;  3HKB A;  2GUZ B;  3UT5 A;  4B7K A;  4YXW G;  5LXT B;  3B2E E;  4A5U B;  3M99 B;  2Q8V A;  1JFF A;  4EFE A;  1UPG A;  1H2G A;  4J7J A;  4YHH B;  1FYJ A;  2PZS A;  2Y69 C;  4AQY B;  5LMU B;  4U3J A;  1WB7 A;  1KB9 F;  3HR0 A;  2ZQM A;  4U7N A;  2X7R B;  1JFF B;  2QSA A;  4UVA A;  3CCJ V;  4EB6 B;  4FK5 C;  4JI5 O;  2XUM A;  3HKD A;  3B77 A;  4ICG A;  1JJ2 U;  4WFH A;  1ROP A;  1N0N A;  4I4T A;  5KLV H;  3VQX A;  1KBH A;  1D2D A;  1PV0 A;  3JAR B;  3D8C A;  3HKD B;  4CZZ A;  2EJ7 A;  2WLN A;  4GCZ A;  1F4N A;  2E76 B;  3OMI B;  4X8A A;  3P3P A;  1QVG U;  2YXL A;  3FB8 C;  1TA8 A;  1VQ4 V;  3ABU A;  2DYR B;  1S5J A;  1QR9 A;  1YSC A;  1NQT A;  2VQF O;  4BAY A;  4DUY O;  3OEH G;  1YI2 V;  4FLV A;  1RP3 B;  5EBL C;  3ZMS A;  4UVB A;  3ZHU A;  4JI3 B;  2N05 A;  3FB6 C;  4W4K A;  1Z2G A;  2JK5 C;  4LFB O;  1K4D C;  2L35 A;  2L6L A;  3MDS A;  4RUE A;  4DW0 A;  2WLL A;  3A0B Z;  1P4R A;  1BZK A;  4ZHQ B;  2JGD B;  4UCS A;  4KXR A;  4X62 B;  2NLJ C;  1KYO F;  2RQ6 A;  2YIA A;  5CB4 B;  2WLL B;  3L71 H;  4O4H B;  2EIK B;  4PA9 A;  4B3R B;  2D2C B;  4J41 A;  2EX3 A;  5B1B B;  3ZRX A;  2GHY A;  1BQ0 A;  2JJ2 G;  3F7V C;  3TGU H;  3AEI A;  3B40 A;  4BWA A;  1GMG A;  2WLH A;  5HFL A;  4MS2 A;  4MVM A;  2UU9 B;  3RFR A;  2ATK C;  3CRC A;  4YJ2 A;  3JD4 A;  5EC1 C;  2ZE8 A;  3DGE A;  1XMO B;  3VQW A;  2IU0 A;  1NZ6 A;  3G80 A;  2M7W A;  2H3O A;  4DK0 A;  1BHB A;  1SZT A;  1SKV A;  3KG2 A;  1ZX3 A;  4YJ2 B;  5IJ9 B;  2Q0A A;  1KMI Z;  2ILM A;  1N36 O;  3BHP A;  5JH7 B;  1IBK B;  4P9O A;  4B7E A;  4JYA O;  2F23 A;  4I9W A;  1SES A;  1N34 O;  1XHX A;  1VQ7 V;  1Q6U A;  1KP3 A;  1KUQ A;  2E5L O;  1XQ8 A;  5LMN B;  1M57 C;  5CBH A;  1GN2 A;  4LCU C;  1R3L C;  1O9G A;  2YXY A;  3J7A U;  5EYP A;  1AI7 A;  2XTA A;  4JI7 B;  1Q6H A;  1NTM H;  3ABL B;  4UCV A;  4GKJ O;  2VS0 A;  1S3J A;  1IDS A;  3F5T A;  2F66 C;  3MHS C;  1N32 O;  3K03 A;  4DR7 B;  2QM4 A;  4ABM A;  1G8M A;  4MW3 A;  2VWK A;  2KG7 A;  4O2A A;  5H6Q A;  5JQG A;  3TCU A;  4X1K A;  2JS5 A;  2CTR A;  2LQT A;  3P30 A;  1SQB H;  2FKX A;  3ZHT A;  1IUR A;  1QQC A;  3D3I A;  4O2A B;  4GX1 A;  5LP6 A;  5B1A C;  3STL C;  3CRQ A;  4HNA A;  2Q7E A;  5L3G A;  3ETE A;  1Y74 A;  1GM7 A;  1WNS A;  2Q0O C;  4PA3 A;  5IE9 A;  2UXD O;  4MT8 A;  1AB3 A;  2QWR B;  2C2A A;  2P6J A;  4D6T H;  5LP6 B;  3Q4H B;  1E1Q G;  2XAH A;  1PM9 A;  4HNA B;  4LBE C;  4X1Y B;  4LF4 B;  1R6K A;  3P3N A;  1G1X B;  1KD1 W;  4Z1M G;  3RYF A;  5GTH Z;  1MSD A;  4ZI7 A;  1SZX A;  1WP7 A;  1THZ A;  4N21 A;  3TK1 A;  4DXW A;  1YF2 A;  4J80 A;  2WLM A;  2HLD G;  2OWO A;  3JAW B;  1IBM O;  3N27 A;  3JYC A;  3CCR V;  2AZ2 A;  5LYJ B;  5J2U A;  1S76 D;  1W2B U;  3H1H H;  2OYQ A;  4I50 B;  5EK0 A;  5AG2 A;  1IVS A;  1HNZ B;  2FML A;  4YJ3 A;  3UCS C;  4DV7 B;  4YY3 O;  3UQ8 A;  3GWO A;  3CCQ V;  2UUB B;  2YUA A;  5KHG A;  4UV8 A;  3SJC C;  1MG1 A;  2OTJ V;  4N23 A;  4B3S O;  3OM3 B;  4JI0 B;  4OPH A;  2JVD A;  1NTZ H;  4FLY A;  4R50 A;  1D5N A;  4FLX A;  2BSK A;  3LSS A;  4PHZ A;  3VQY A;  2WLK A;  3ZIA G;  4Q20 A;  1WB8 A;  1VP7 A;  3JSN A;  1JX9 A;  2N74 A;  3RWR D;  3JAT B;  1AI5 A;  2BTQ A;  3SJQ C;  4LFC O;  2QM8 A;  4TUY A;  4NTW A;  4JGS A;  2ZE6 A;  2CTP A;  3AG3 B;  4JI1 B;  4R7C A;  4WBN A;  4B3M O;  5BR8 O;  4IL6 Z;  1XL4 A;  5LGU A;  4P30 A;  3CRA A;  1MNG A;  4PD4 F;  1NTK H;  2DE0 X;  3ASN C;  5H6R A;  4GX5 A;  1AP5 A;  2V4D A;  3BAA A;  3AG7 A;  3H01 A;  2WAM A;  3T1C A;  5DN6 G;  3JCU Z;  2YID A;  3UO3 A;  1XNQ O;  1HNX B;  3CC2 V;  1R3J C;  1XL6 A;  2QEX V;  1AR1 B;  2VQE B;  4O4I B;  2JEU A;  2P4V A;  4NXN O;  3R66 A;  3E22 A;  1YXB A;  4X89 A;  3J80 N;  3OMN B;  1NR7 A;  1SS3 A;  1M5I A;  1Y6X A;  2XT9 A;  1YHQ V;  2IJH A;  1GN3 A;  1SRY A;  4MVZ A;  4PV1 B;  5GTI Z;  1CXZ B;  4MSW C;  4FM0 A;  4FZ1 A;  1KQS U;  1K8A W;  4JAU A;  4LF8 B;  3RT3 C;  5IYZ B;  4CH6 A;  5JVD A;  2GTS A;  3OGC C;  4X65 B;  3GWK C;  3RYH A;  4NXM B;  2ZIN A;  3WG7 C;  3UM7 A;  3SYO A;  2Q4P A;  2W0X A;  3SJB C;  5JVD B;  4KL1 A;  3HB3 B;  3M7M X;  2YC0 A;  2UUC B;  1B04 A;  1KU9 A;  2LW7 A;  5IDJ A;  5BY1 A;  2HVK C;  3L75 H;  2LO1 A;  2IH3 C;  2RDC A;  1N4C A;  3AG1 B;  4TSF G;  5LOV A;  1KEC A;  1OCZ B;  1ZUQ A;  3S3W A;  2ZDI C;  1FXK A;  2P4K A;  4WFA V;  4FM2 A;  2R70 A;  1US6 A;  2JRI A;  2E75 B;  1WJZ A;  1GTO A;  1ZAU A;  3H1J H;  2NN4 A;  3EHB B;  4FMT A;  1URF A;  2HJD A;  1OCO C;  4R8C A;  5CBG A;  1VAR A;  3SR2 C;  1H2K A;  3ML0 A;  1W59 A;  4CS3 A;  4LNU A;  1H2N A;  1WAZ A;  3D36 C;  1N0J A;  2ZD9 A;  3LDD A;  5BMV A;  1XNR O;  2KB1 A;  4FPP A;  4ZKI A;  2ZM6 B;  1IZ3 A;  5B3S B;  3CCU V;  3SPC A;  1AI6 A;  4I55 B;  2ZNJ A;  1YJ9 V;  4FLZ A;  2PI4 A;  3H1L H;  3X2Q C;  5LGT A;  3RGB A;  4LF7 B;  4K35 A;  3QTC A;  1SQP H;  2ITC C;  4AQY O;  1I94 B;  4LF6 O;  4K0K O;  3A0H Z;  5EIB C;  5LMU O;  4X66 B;  4MTF A;  2WLI A;  3F5W C;  3SJA C;  5KUK A;  3T4Z A;  2DYS B;  4DV6 O;  5J2T A;  1X59 A;  2BOC C;  3T2M A;  2WLI B;  2HP8 A;  1XHZ A;  5BZB A;  2M6Y A;  3OR6 C;  5KA5 A;  2HHH O;  1V54 C;  1Q90 D;  1JOY A;  1M9N A;  4G27 B;  3CB2 A;  1B06 A;  5CBF A;  2QDO A;  1R6T A;  3CP1 A;  1LNQ A;  5C8Y A;  4JI6 O;  5BXZ A;  2RNB A;  1VMG A;  3T1Y B;  1VF6 A;  4JV5 O;  2CH7 B;  5GON B;  2LFR A;  1G4Y B;  3OW2 U;  2A3Q A;  3QF7 A;  3EFF K;  2UXB B;  2WPD G;  2QGN A;  4JF3 A;  1UFI A;  2VWJ A;  4BIO A;  2PI5 A;  2YIC A;  4NR1 A;  5IWA B;  1KKD A;  3CJH A;  4FFK A;  1WPX A;  2LJ2 A;  3MHH C;  5IYB O;  4JZG A;  4O2B B;  2RN9 A;  3HKC A;  4LF9 B;  5KHH A;  4FVM A;  2BE3 A;  4PDR A;  3N2G B;  4CS4 A;  3P32 A;  4CS2 A;  4X1I A;  3QO5 A;  2OCC C;  5D5Q A;  2AZ0 A;  1XMQ O;  1Q7Y W;  3SPI A;  1H2S B;  4C7U A;  1PKX A;  5DED A;  2EIM C;  2GUZ A;  2CDY A;  4X1I B;  1GRJ A;  3IC7 A;  3NXS A;  5KAI Z;  3CWB H;  5LXT A;  1LUW A;  5CMU A;  5JJN B;  1PNK A;  4O4J B;  4J10 A;  4RUF A;  4NYK A;  1GM8 A;  3CRR A;  2UUA B;  4L8J A;  2UU9 O;  1CPY A;  1IBL B;  2YS8 A;  2YIB A;  2X0L A;  4EB6 A;  2ETN A;  1PL4 A;  1J5E B;  3QNE A;  4TV8 B;  4FM1 A;  2JGU A;  1RFY A;  4DW1 A;  1EZV H;  4Z1V A;  3K06 A;  5KUM A;  1Q43 A;  1WN7 A;  2DWD C;  2DJV A;  3JAR A;  4W4L A;  1AJQ A;  3WB2 A;  3EVK A;  2JIZ G;  4LH6 A;  2HEP A;  4BR6 A;  2CE4 A;  1QBZ A;  4JI4 O;  3LNM B;  1TAE A;  1OHH G;  3J81 N;  2Y48 A;  5B1O A;  3K08 A;  3G67 A;  1HNW B;  3BVO A;  3AG4 C;  3RVY A;  4JI7 O;  4JI8 B;  5C93 A;  2GTA A;  2HG5 C;  4MVU A;  3A0R A;  4DV4 B;  3CC4 V;  1NVP B;  1BT8 A;  4DR7 O;  2CTW A;  3H1K H;  3FYI B;  5L3F A;  4QGP A;  2A79 B;  2XHB A;  1YJN V; 
#chains in the Genus database with same CATH homology
 1US6 A;  4NKG B;  4NB5 A;  2RMK B;  1UPG A;  1RFY A;  1CXZ B;  4DYL A;  4IGG A;  1URF A;  2Q0O C;  2HJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...