1RFYA

Crystal structure of quorum-sensing antiactivator tram
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
b'KKVELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEMHAQMSALNTLISILGFIPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional repressor traM
molecule tags Transcription
source organism Agrobacterium tumefaciens
publication title Quorum-sensing antiactivator TraM forms a dimer that dissociates to inhibit TraR
pubmed doi rcsb
total genus 33
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09228 Prok-TraM Prokaryotic Transcriptional repressor TraM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1rfyA00
2RMKB 1RFYA 1URFA 4IGGA 2Q0OC 1US6A 4DYLA 1UPGA 4NB5A 1CXZB 2HJDA 4NKGB
chains in the Genus database with same CATH superfamily
4JZGA 4B3TB 3SYPA 2RQ6A 4O2BA 1VF6C 3I56V 1G4YB 3JD4A 2JDIG 1QLNA 4CH6A 4F6RB 3HKBA 5LBQA 4LNUB 4DYLA 5BR8O 3N2KA 4LF7O 1NT2B 4FMTA 2DN9A 4NXMO 2R70A 2Q0AA 4FFKA 3E22A 2FL4A 1KU9A 4JYYA 1QU7A 1SQFA 1K73W 4K8XA 1P4RA 4XDJA 2UXCB 4U7OA 5EBMC 3CC2V 4UUJC 5FPOA 1Q7YW 1VQ5V 3RBZA 1XMQB 3H1LH 1TUBA 3D36A 2JJ2G 3WFVA 4QE9A 1FD9A 3AG2C 1O9HA 2PI4A 3K03A 3B09A 3ZHVA 4Z2WA 1KYOF 2E76B 1SZXA 2QTSA 4MVSA 4HAMA 1WA8B 3K5NA 3JAMN 2YI8A 4B3RO 2X6BA 3NXSA 2EIKB 3RT3C 2UXDB 2QWQB 3G80A 2Q68A 3L71H 2P4KA 2C2AA 4TQFA 2Q7GA 3GB7C 4FM0A 3F7YC 3SYOA 3E8BA 1YZBA 4UB6Z 1T5EA 4JAUA 5LA6A 3C3TA 3QNEA 3JAWB 4LH7A 1AJNA 5IYCO 1FXVA 2W6JG 3I5DA 3OAAG 4DR1O 1MOFA 1J5EO 3ETGA 4XDLA 2OIGA 3STZC 5JVDA 4GKKB 5CMUA 3GWOA 4O2BB 3GVMA 1LNQA 3VQXA 5IYZB 4X64B 4FLTA 3RVZA 3E83A 1NKDA 2CTPA 4JI6O 2EIMB 2XAFA 3QF7A 4O4HB 4JI2O 1N34B 2KB1A 2R72A 3OUFA 3FYEB 1XOUA 1R6KA 3LDDA 4DR2B 3VBBA 5KA5A 2PYJA 3UCSC 2UXDO 2YSUB 1HNZO 3JYCA 3ZMTA 2Z3YA 5EC2C 1KQSU 5DECA 1XNRO 2JGUA 3RYIB 4FK5C 4PDRA 2ZR2A 4CC5A 2EIMC 2EULA 2YEVB 4FFBB 1Y6XA 2EILB 2F1MA 4JTDB 5FNVA 4B3SO 1P7BA 2GTAA 1OV9A 3KZIZ 4R50A 4MVZA 4BIZA 1EN4A 5GTHZ 1QLEC 5H9CA 4D7TA 4CH3A 1EN5A 1KKDA 4FFBA 4GCZA 2DQ0A 3TXSA 2YUAA 2E5LO 1OCZC 1M90W 4P30A 5LMNO 3L70H 4JI6B 5LGNA 1VQPV 3AK1A 1GN6A 1JQ0A 1WNSA 1QLEB 1XREA 2DE0X 1FFXA 1SQXH 4JGSA 2ZM6B 3SPGA 4I4TB 4GYCB 2Q69A 5TISZ 1WP8A 3O9OA 4LF4B 1IXMA 2HHHO 2DWDC 3ZRWA 3ETQA 2N05A 5L3FA 1DLBA 3DC6A 3ABKB 3ABLC 4JI8O 4I9WA 1OCOB 1ZTEA 1M56B 1N32B 2JGDB 1DF4A 1NS1A 1SESA 2ZD9A 4KHPB 3BEHA 4K3AA 3E8FA 1SERA 4UV9A 4B3SB 2HFEC 5ITZA 3GWKC 1VQOV 3K9AA 5EK0A 2PUSA 1XMOO 1H2KA 1EBOA 4EFBA 1HNWB 2DYRB 4DV2O 5GW7A 2LGWA 3BRCA 2LQTA 3RN4A 3L9DA 4JPRA 1DTOA 2ADPA 1S0VA 3JAWA 4MW8A 3E86A 2EZOA 4DR6B 4NKGB 3OEEG 3JCZA 2R9IA 4E2LA 1FYJA 2XASA 1WB8A 2NN4A 2QWOB 2KKWA 2P4VA 3ZMVA 1ZAUA 4WF9V 3CPWU 5K1XA 3NR7A 1QHTA 4GX5A 3VQWA 1BCCH 1I0HA 3IC9A 1AI4A 4J7JA 1VQMV 3TJTA 2HLDG 4X88A 2OIEA 3UO3A 3FFQA 1NZ6A 2Q7HA 2WWWA 1L0LH 3ML0A 4O4LA 5KHKA 5J9PC 2OTLV 1B6QA 4O4IA 2W0XA 1SZTA 4WFAV 1H2MA 3IGAC 2AZ0A 1GO3F 4DK1A 2WLIA 3ZHRA 4DV2B 2HG5C 5C93A 4YXWG 4JF3A 2NNUA 3ZMUA 5B3SC 1FFTB 4XBFA 4B3MO 1WA8A 4O4LB 2F43G 2DQ3A 5LOVA 1BMFG 3OT7A 2RCVA 1S5HC 1ZUQA 3CC4V 1UPGA 2V4DA 5KMGB 2BOCC 4DR4O 2LO1A 2E3CA 4QIWF 1EFRG 1YVWA 4IL6Z 1TGOA 4HNAA 4YIOA 4B3RB 4RUFA 5A2QN 2XOKG 1E79G 3U0ZA 1M1KW 2VS0A 2HP8A 3BABA 2GUZA 1KUQA 1W0JG 1K33A 3W7TA 5IYZA 1VQ4V 4JI1B 3WU2Z 3K08A 2KSDA 4J7ZA 4X62O 1MZFA 2YIDA 1PNLA 5KLVH 3KCXA 1N8RW 5LXTA 3JARB 3AG7A 4O2AA 3N2GA 5L3BA 1YITV 3ZHQA 1QQCA 2AGAA 3BFRA 4X66O 2NLJC 4W4LA 5EIBC 3SPIA 3IC7A 4PA7A 4DR3B 2Y4UA 4B08A 2ZKOA 1Y67A 5KAIZ 4EB6A 1WLEA 4X1IA 4JI5B 4LP8A 2PTMA 1SS3A 1FPOA 3S3WA 2UXBO 2WA4A 1AR4A 3CYOA 4JV5B 2JGDA 3T1YO 5EYPA 3K5MA 1TVKA 1H8HG 4PA6A 4NR1A 4MW3A 1EZVH 2ZM6O 4ASUG 1NQTA 2ZCEA 4MT8A 1G1XB 4LF4O 1TUBB 3O65A 4TUYA 3K06A 3ZRVA 4LF6O 2X6CA 3B4SA 4UVBA 2GTSA 4MSWC 2F95B 2D2CB 2ZT9B 4DV4B 1S3JA 4DV1O 2YIAA 1WP7A 4LR3A 3CCEV 2X0LA 2ODMA 5LP6B 3G4SV 5EC1C 3F5TA 1RSOA 4FPPA 2BSKB 1XHXA 1YJ9V 3ZIAG 4LNUA 2P7TC 4PA4A 1TA8A 1JJOA 3HKBB 1NR7A 1Q6HA 4RQFA 2PY5A 1E1RG 4JZ2A 1OHHG 3F7VC 4QGPA 2UXBB 3TXQA 4DV7B 3H1KH 4UB8Z 3DSQA 3RFRA 2IJJA 4WFBV 4CBCA 1Y74A 2EIKC 4FLZA 1NR1A 3CSXA 3BA9A 1GN3A 3CXCU 2GHYA 3U10A 3HKCA 4DRXB 1K5SA 2Y69B 2OCCB 2QWPB 3AK2A 4LC1A 3ZRSA 1AI5A 3E35A 2A06H 3P3NA 5DM6V 2XHBA 4LWSA 3T1YB 2A0LA 3FAVB 2ZQMA 5LGTA 1XUQA 1BL8A 2E75B 3CXHF 3E2EA 4BW9A 4DV6O 1NU1H 1VMGA 3SDLA 1W0KG 2WLLB 1IBMB 2QJ1A 3CMAV 1FJGO 5LA6B 1OCRC 1M93A 5KHGA 4UCVA 1G6UA 5B1AC 2ZE8A 3ASNB 4UVCA 5KUMA 2Q4PA 4X1KA 3ZBHA 4UVAA 2QSAA 3MAQA 1K9MW 4H37A 5LXTB 1XBLA 4WFGA 1LUWA 2QKCA 3TETA 1GM7A 1H2SB 3ASOC 1Q6UA 4YHHO 3T2MA 4F6EA 2Q0OC 5BY1A 2YXHA 5B1AB 1YF2A 4AHCA 2QDOA 2ATKC 5JJJB 1DGSA 3BCCH 3OTOO 4JI1O 3J81N 4OPAA 1ENVA 3WG7B 1XI1A 1IVSA 2RMKB 5LOVB 1PKXA 3W7XA 1OZ0A 3AG1C 2EZPA 3DXRA 4U3JB 4LBEC 4CS2A 2ZR3A 4BR6A 2V7QG 1OCCB 3E89A 2KQXA 3APOA 3RVYA 3HR0A 5K1PA 4HZ3A 3C90A 3ABMC 3RWRD 4DW0A 1RP3B 3SPCA 4GKJO 1SQBH 1WB7A 1L0NH 4DV3B 2Z0AA 3OGIB 4LFBO 5IJ9B 4LF5O 2HVJC 3TK1A 1XQ8A 4ICGA 4K35A 1V9PA 3CMEV 1Y66A 1AVMA 3OEHG 2EINC 3SR2C 2ZE6A 4JI7O 5CA3A 1Y76A 1J5EB 4NXNO 4GZRB 4TV8B 2YXYA 1M4UA 4UCRA 4FVMA 3G6EV 3K57A 5IE9A 2LGQA 2GSMB 4JI3O 2LW1A 4MS2A 2JS3A 4K8ZA 2A3QA 2ZE5A 3ZN0A 2UU9O 4PI0A 1EZJA 4RUEA 5B66Z 5J2TA 1QVGU 4TUYB 4X64O 3ZHUA 3D36C 4LF7B 1QNMA 4K0KB 4MTGA 3UQ8A 1L8DA 2CH7B 3JAKB 4L87A 3G71V 5ITZB 4MVUA 1XNRB 2Q67A 2H3OA 4DV0B 1VQ9V 1J95A 4Q20A 2QGNA 3CE2A 2RJZA 3B8MA 2F4VO 4JI7B 2KG7B 2MW2B 1AI6A 2W6IG 4CH4A 3M8AA 1IXBA 1CEZA 1JOYA 4BAYA 1HR0O 2JS5A 4FLUA 4PDLA 3ZMSA 1KBHA 3RYFA 2YC0A 4H0LB 3CC7V 4KHPO 5JQGA 2Q5ZA 4R6ZA 2JEXA 3OMAB 3FB5C 4PJ0Z 4LF9O 1LUVA 3RYHB 1JPXA 3QO8A 4MTFA 4YJ2A 1Y74B 4N21A 2IH3C 1JA8A 1R1BA 3AG4C 1IURA 3FB8C 4PHZA 1VQ7V 1OCRB 2MK3A 3ABUA 4ZBMA 4DR5B 4WFHA 4TT3G 4J9ZB 1GTOA 5DN6G 4J9YB 1WPBA 5LHGA 3OUSA 1BT8A 2CDYA 2M7WA 2VRZA 2ARHA 2YEVA 1MSWD 1GN4A 5KHJA 2PI5A 5FNVB 3B40A 3FAVA 1XILA 1FJGB 1N36O 1P49A 4F4LA 3CP1A 3BA8A 2BOBC 2HJDA 4AQYB 2B1GA 1V54B 4FZ1A 1F51A 3EVKA 2X6AA 2Q6AA 2VQFB 5LL6Y 4CH5A 4G27B 4DV7O 5L3DA 3UO2A 3HKCB 1SQPH 1ZWIC 5LHHA 4I50B 2IM9A 3UM7A 4I7ZB 1JX9A 3VQVA 3OD4A 3OR7C 5D5PA 1AR5A 1SRYA 1H2LA 5EYPB 2XAQA 4TV8A 1PP9H 5HFMA 1SQVH 1VF7A 1KB9F 1I5YA 5CBHA 1CPYA 1B3QA 3ETDA 5JJEB 4X89A 4DUZB 3DTUB 1DK1A 4FM1A 5LHIA 3RW0A 4R7CA 2XAGA 2K1EA 3CHXA 2CK3G 1BHAA 1GM8A 3M7MX 2DJVA 3I55V 1FXKC 4GKKO 1VP7A 1RSOB 1I94B 1KP3A 3KKYA 4I50A 1CP9A 3L75H 4J41A 2ZXWC 2OCHA 2WLHA 1IZ3A 4PDVA 3B77A 4NXNB 2V1DA 2YIBA 4DUYB 3D3QA 2L35A 4HBNA 2L6LA 1VQKV 1ROPA 4MVRA 3ZHTA 1JJ2U 1B04A 5CA1B 2H94A 4EKWA 4DO2A 2UU9B 4PDMA 5KMGA 3CCVV 4XDKA 4A5UB 5H5NA 1H2GA 1PPJH 1OCOC 2B9ZA 2JRIA 4KXRA 2EILC 1RM1C 3Q4HB 1F7YA 4EFEA 2CAZC 3CRMA 1P84F 2WPDG 3N27A 4WFFA 4JI2B 1HNXB 4IIJB 4QPJA 1YCIA 2WLNA 3CCLV 2B5UA 1VIBA 3RYHA 4WFEA 3JSLA 4DR2O 1BS3A 2IJIA 4YJ3A 2CE4A 1Z5VA 3SYCA 2HEPA 4DUYO 3U11A 5CBFA 1ZL8A 5D5QA 1PL0A 4F6RA 5GTIZ 1NBMG 2AW9A 2UUBO 5A9GA 4DR7B 4ZI7A 2WLLA 4OPHA 1AP5A 2ZIMA 4Q6GA 5J2UA 3OFNG 3P32A 3OM3B 1HP8A 4HNAB 3SYQA 2ITCC 4GUNA 1THZA 1V54C 1LR1A 5H6RA 1YJNV 4BWAA 1YTFB 1PM9A 3OE7G 2XT9A 4UCSA 3OTOB 5LMNB 2EX3A 3MDSA 3E8GA 3RYCA 3EHBB 1MNGA 1HNWO 2QKSA 4JYBA 3PJSK 3APQA 2WLMA 3TGUH 3A0HZ 4BIOA 2GV9A 5JCOC 1W2BU 3TCUA 4CS3A 3LSSA 2Q8VA 4DR5O 3KG2A 1Q5OA 4Z1MG 1AB3A 3R65A 3JALA 1N32O 2EBOA 3JD2A 3AG2B 4KP4A 5E1AC 4TOIA 2K9PA 1N34O 5IJ9A 2P22C 5B1NA 2ZE7A 4FLWA 1PNMA 3L73H 1BZKA 4EEQA 1QR9A 1XMOB 4DV6B 4OXSA 2EINB 2XAJA 1HNZB 4IIJA 3K04A 4IGGA 3J7AU 1US6A 5KHHA 2BE3A 2HVKC 1JMKC 4WBNB 1R3LC 1YXBA 4JI0B 5B5EZ 3LUTB 1JVMA 3FB6C 2WLJA 4LF9B 5IDJA 4MTOA 5B3SB 4KUMA 4U3FH 4L8JA 3SJQC 2YI9A 1SA0B 1IBLO 4LFAB 2EJRA 2OCCC 4EB6B 2ZNIA 2P5OA 4DV5B 2IU0A 2ADQB 1BGYH 1IBMO 4P9OA 1GMGA 3VQYA 4D7SA 2AZ2A 2AXTZ 2DYSB 5AG2A 5EZYB 4J7KA 4FIPC 2FYUH 5JCOA 4LF8O 3AG4B 2F4VB 2RDCA 2CTQA 1QCEA 4PD4F 4JI8B 5LMUO 4DRXA 2F66C 3JATA 4G2KA 1OCZB 5GONA 2OYQA 4FLYA 3CCRV 4JI0O 4NYKA 3P3PA 1AJPA 1BSMA 3CRAA 1ZLZA 2IW5A 2ZIOA 4TSFG 4DV4O 1FAFA 5IJ0A 3G6BA 2NR5A 1N0NA 3DGEA 2A9HA 2JIZG 2X7RB 2VWJA 1XNQO 2WA3A 1VARA 4BIUA 1AILA 1F4NA 3WB0A 1HW7A 1S76D 2CUGA 4G28B 2RN9A 3K0GA 5H6QA 2RNBA 3CB2A 4J11A 4NB5A 1VQNV 4WBNA 5F2VO 4ZKIA 1G8MA 1VF5B 2OT5A 2ZINA 5LGUA 4ABMA 2BTOA 4LFCO 3SPHA 5L3GA 3CCUV 3W7SA 3C3SA 4JTCB 3EFFK 3WG7C 3ABLB 2LFSA 4YY3B 3AG3C 4O4JA 4X66B 1Z5WA 1VEWA 2R9RB 3THOA 1XHZA 2PF4E 1K4CC 3BY6A 3LDEA 1D2DA 2IJKA 2W0FC 3CRQA 2JK5C 5CA1A 4LCUC 3CRCA 1S5LZ 2YS8A 4ZOLB 4RWUA 3AG3B 2DYRC 4CC6A 4ZI7B 1B06A 4OX9O 1UJWB 2QA4V 3K79A 2QR4A 4RO2A 3JD3A 3S3XA 5CA0B 1ZL8B 1EM1A 1I7FA 4H13B 3JATB 2LJ2A 4IYIA 5JWPA 2BCCH 4GX0A 2CTWA 2Y4TA 4HYOA 3Q4HA 1R3JC 1K5QA 1NI8A 5C8YA 5E79Z 4Z1VA 1YI2V 4LFCB 1RM1B 4DUZO 1QR8A 1E1QG 3JASB 1D5NA 4PELA 1KD1W 2BTQB 5KX5A 1VF6A 2UUCO 2IU3A 2WSSG 3KCYA 3WB1A 1KC8W 2QTOA 2N74A 4JTAB 5IT9N 1BHBA 2ITDC 4LWSB 3T1CA 2Y0PA 1Z2GA 2JVDA 1Q3EA 2BTQA 2Z5UA 1S5JA 3ASNC 1IDSA 2FMLA 2QM8A 1RPRA 1IBKB 4I55A 1XDCA 1V55C 5B1OA 2B1IA 1XEQA 5BZBA 1HR0B 2ETNA 3ICXA 2HJFC 4O4HA 3ZHSA 4QJFB 1M9NA 3A2FA 1N33O 1Q82W 1PL4A 1IBLB 4U7NA 4FJCC 4I5SA 2Q9LA 4FZ0A 2LP7A 1Y76B 1R6NA 1YDXA 2WAMA 4MVQA 2EJ7A 3FD9A 4DR4B 1UFIA 1NH2B 2UUAB 1AJQA 5KHIA 4NTWA 2PYLA 3SYAA 3ABKC 1R3IC 3G67A 4LFAO 4J80A 4DV5O 3JALB 1Q8IA 2ZDIA 3HPLC 4MTXA 3ZRXA 3ZMZA 4BW5A 2ILMA 1XMQO 2VWKA 3OMIB 3FYIB 4O4JB 4U3JA 3DXRB 5LYJA 4DV3O 2HHHB 4RAIA 1Q90D 1W59A 5FLXN 1HWYA 2QM4A 5BMVB 3K3WA 1Q6IA 4DR3O 1P7GA 3CJHB 2WLKA 5BR8B 4E4EA 1L1FA 3X2QC 4DW1A 4JAVA 1KECA 5IWAO 4GKJB 5KX5B 4ZHQA 2VQFO 3AEIA 4LFBB 1TVKB 4NXMB 4JAAA 2XTAA 1WJZA 1GN2A 2JJ1G 1IBKO 4LF8B 4I0XB 1KMIZ 4UCTA 3T1HB 4WCEV 2IBZH 1GM9A 3H9VA 3STLC 3ZX6A 4YJ3B 1O9GA 1MMMA 3OR6C 3EXAA 1N33B 3UKMA 2GDSA 3CS5A 2Y69C 4OGQB 2CGOA 3N2KB 1H38A 5C8YB 5JJNB 5CN0A 2QM7A 3ZRWB 1GK9A 1K92A 4MVOA 1RFYA 3T4ZA 4DK0A 4JI5O 2GUZB 3QO7A 3ZJZA 1SQQH 2N04A 3LDCA 5JQGB 1XL6A 2QEXV 3QTCA 2GBOA 3SGIA 2JEUA 1X4TA 3HKEB 1M57B 1URFA 4X62B 3SJAC 4X65O 5IYDO 4ZOLA 1I5XA 3K5LA 5IWAB 2VQEB 1SKVA 5KAFZ 3PN1A 3SPJA 5CBGA 1ZSPA 2H8PC 3T4DA 5LYJB 4CS4A 5IY5C 5L3EA 4NTXA 5IY5B 4LF6B 3DC5A 2UUBB 3VOUA 1FFXB 4IYHA 1TUEB 3W7WA 3K59A 4YY3O 1I08A 4X1YA 4DR1B 5CA0A 4DV1B 1M57C 3BPZA 2CH7A 3JAKA 4PV1B 4JI4B 1SC5B 1JFFB 3H01A 1V55B 1VQ8V 4AQYO 1OJHA 1K34A 2LFRA 1NTZH 3W7UA 3K5OA 5CB4A 2UXXA 2Q73A 3HKDA 3K0DA 4LF5B 5HFLA 3LSUA 3ZS8C 2Y48A 2BSKA 4I0XA 2IH1C 2AHZA 5EIBD 2A79B 3AK3A 4P9PA 5GONB 2UXCO 1K97A 5LP6A 3M99B 1M5IA 5IJ0B 2M6YA 1U96A 4UV8A 5H2FZ 4B3MB 3FKSG 3BAAA 4YJ2B 1A32A 1COWG 4YIPA 5JH7A 5KA6A 2P67A 4TV9B 1X59A 3MD0A 1WN7A 5BXZA 1YIJV 1K4DC 4UCOA 1H8EG 2DW4A 3CCSV 2OTJV 1F23A 3QO5A 1OCCC 5JH7B 4YHHB 2YIBD 2HR3A 1QVFU 3UT5B 2OWOA 1K8AW 1U97A 3AG1B 3H1JH 1AR1B 3WB2A 1M56C 1PV0A 1SA0A 1CXZB 3K58A 3CD6V 3OGCC 1TAEA 3CWBH 1AI7A 4C7UA 4JV5O 2DMXA 2F93B 4D6TH 1D5AA 3FX7A 4P2ZA 1PNKA 5JVDB 2FTKA 3ZCCA 1PD3A 2FB5A 3BVOA 4B3TO 1AP6A 4O2AB 1BQ0A 4NTYA 4W4KA 2D3OW 3CCJV 1GKFA 5J2TB 3L72H 3ABMB 2YDEA 1FXKA 2EIJB 4NVPA 2EIJC 2A7WA 3ABTA 3R66A 2P90A 3IFXA 5IYBO 5B1BC 4IHJB 3H1HH 3ZEDA 3LNMB 1NVPD 1JR9A 4I55B 5LP6C 5FPRA 1K3EA 3ZN1A 2ZXWB 1YJWV 4X9QA 2HKOA 3CX5F 1Q81W 3OMNB 3D8CA 3CJHA 1XL4A 3J80N 2KG7A 5KUKA 3X2QB 4QNHB 4MVMA 5DEDA 3SJCC 1EN6A 2CGNA 4JYAO 4JYCA 2DWEC 3E8HA 3BHPA 5B1BB 1H2NA 2AHYA 4KL1A 5EBLC 3JSNA 5FL7G 3D3IA 4IT5A 4UCUA 1YHQV 3ASOB 3JASA 1JFFA 3RYIA 3IAYA 1N36B 1IX9A 3A8TA 1MG1A 3LNNA 4X1YB 2XUMA 2UUCB 4O4IB 1I94O 5EBWC 1WPXA 4X1KB 4X20B 2P06A 2Y0IA 2VQEO 2E74B 2QKAA 3HB3B 3H1IH 4B7EA 3OW2U 4H44B 4UXNA 2P6JA 3RGBA 4ZHQB 3IJ4A 1QBZA 2ZNJA 2XAHA 2F23A 4X65B 3L74H 1XNQB 3RYCB 5LMUB 2O57A 1N4CA 2FKXA 2QWRB 2YICA 2DOSA 1F4MA 3B8NA 5L3CA 2QE7G 1FXHA 1YTFD 1SETA 4KFMA 3ETEA 2ZDIC 3CRRA 3MHSC 1RPOA 4FLVA 3LSQA 1NH2D 3N2GB 1GAXA 4JI4O 1Q43A 5EZYA 3JARA 3A0RA 1FS0G 3QVNA 4AI8A 4CZZA 1GH6A 2UUAO 5J2UB 1KKCA 4X8AA 2UXNA 1NTMH 3FB7C 3P30A 1R73A 1SQGA 4DR6O 3OTFA 1DF5A 4JYAB 4TQDA 4R8CA 4LH6A 1MA1A 3B2EE 2IJHA 4GLXA 4I9QA 3HKEA 3K9SA 2LW7A 1BQZA 1NVPB 4RQEA 1N0JA 4DR7O 4GX1A 1MABG 4JASA 4OX9B 1VQLV 1GRJA 4J10A 2G38A 1FXKB 4TV9A 4FM2A 2R9AA 4IHJA 1YEWA 4QE7A 1MSDA 3CCMV 3E22B 2QWNB 3F5WC 3RYFB 4AILC 3JD1A 1BE3H 2PGGA 4JI3B 3T1HO 1Q86W 4GX2A 4PA3A 3QG5A 1S77D 2YXLA 4UFZA 4GT1A 1NJIW 1R6TA 1WAZA 1VQ6V 3HKDB 1SF9A 5CB4B 4FLXA 1NTKH 3UT5A 1Y4MA 3MHHC 2E5LB 1JCHA 4X1IB 4K0KO 2XNDG 4H33A 1HDJA 1HNXO 1FKAO 4ZIBA 1AROP 1ORQC 2PZSA 3CEIA 3JCUZ 4DV0O 5BMVA 4DXWA 4X20A 2CTRA 4N23A 1S72V 4I4TA 2Q7EA 4J42A 4PI2A 4B7KA 3SJBC 4TWKA 3A0BZ 1MZEA 2DYSC 1K7DA 3JD0A 4QPKA 3CCQV 2WLIB 1KP2A 1R3KC 1YSCA 1ZX3A 4PA9A
chains in the Genus database with same CATH topology
2RMKB 1RFYA 1URFA 4IGGA 2Q0OC 1US6A 4DYLA 1UPGA 4NB5A 1CXZB 2HJDA 4NKGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RMK B;  1RFY A;  1URF A;  4IGG A;  2Q0O C;  1US6 A;  4DYL A;  1UPG A;  4NB5 A;  1CXZ B;  2HJD A;  4NKG B; 
#chains in the Genus database with same CATH topology
 4JZG A;  4B3T B;  3SYP A;  2RQ6 A;  4O2B A;  1VF6 C;  3I56 V;  1G4Y B;  3JD4 A;  2JDI G;  1QLN A;  4CH6 A;  4F6R B;  3HKB A;  5LBQ A;  4LNU B;  4DYL A;  5BR8 O;  3N2K A;  4LF7 O;  1NT2 B;  4FMT A;  2DN9 A;  4NXM O;  2R70 A;  2Q0A A;  4FFK A;  3E22 A;  2FL4 A;  1KU9 A;  4JYY A;  1QU7 A;  1SQF A;  1K73 W;  4K8X A;  1P4R A;  4XDJ A;  2UXC B;  4U7O A;  5EBM C;  3CC2 V;  4UUJ C;  5FPO A;  1Q7Y W;  1VQ5 V;  3RBZ A;  1XMQ B;  3H1L H;  1TUB A;  3D36 A;  2JJ2 G;  3WFV A;  4QE9 A;  1FD9 A;  3AG2 C;  1O9H A;  2PI4 A;  3K03 A;  3B09 A;  3ZHV A;  4Z2W A;  1KYO F;  2E76 B;  1SZX A;  2QTS A;  4MVS A;  4HAM A;  1WA8 B;  3K5N A;  3JAM N;  2YI8 A;  4B3R O;  2X6B A;  3NXS A;  2EIK B;  3RT3 C;  2UXD B;  2QWQ B;  3G80 A;  2Q68 A;  3L71 H;  2P4K A;  2C2A A;  4TQF A;  2Q7G A;  3GB7 C;  4FM0 A;  3F7Y C;  3SYO A;  3E8B A;  1YZB A;  4UB6 Z;  1T5E A;  4JAU A;  5LA6 A;  3C3T A;  3QNE A;  3JAW B;  4LH7 A;  1AJN A;  5IYC O;  1FXV A;  2W6J G;  3I5D A;  3OAA G;  4DR1 O;  1MOF A;  1J5E O;  3ETG A;  4XDL A;  2OIG A;  3STZ C;  5JVD A;  4GKK B;  5CMU A;  3GWO A;  4O2B B;  3GVM A;  1LNQ A;  3VQX A;  5IYZ B;  4X64 B;  4FLT A;  3RVZ A;  3E83 A;  1NKD A;  2CTP A;  4JI6 O;  2EIM B;  2XAF A;  3QF7 A;  4O4H B;  4JI2 O;  1N34 B;  2KB1 A;  2R72 A;  3OUF A;  3FYE B;  1XOU A;  1R6K A;  3LDD A;  4DR2 B;  3VBB A;  5KA5 A;  2PYJ A;  3UCS C;  2UXD O;  2YSU B;  1HNZ O;  3JYC A;  3ZMT A;  2Z3Y A;  5EC2 C;  1KQS U;  5DEC A;  1XNR O;  2JGU A;  3RYI B;  4FK5 C;  4PDR A;  2ZR2 A;  4CC5 A;  2EIM C;  2EUL A;  2YEV B;  4FFB B;  1Y6X A;  2EIL B;  2F1M A;  4JTD B;  5FNV A;  4B3S O;  1P7B A;  2GTA A;  1OV9 A;  3KZI Z;  4R50 A;  4MVZ A;  4BIZ A;  1EN4 A;  5GTH Z;  1QLE C;  5H9C A;  4D7T A;  4CH3 A;  1EN5 A;  1KKD A;  4FFB A;  4GCZ A;  2DQ0 A;  3TXS A;  2YUA A;  2E5L O;  1OCZ C;  1M90 W;  4P30 A;  5LMN O;  3L70 H;  4JI6 B;  5LGN A;  1VQP V;  3AK1 A;  1GN6 A;  1JQ0 A;  1WNS A;  1QLE B;  1XRE A;  2DE0 X;  1FFX A;  1SQX H;  4JGS A;  2ZM6 B;  3SPG A;  4I4T B;  4GYC B;  2Q69 A;  5TIS Z;  1WP8 A;  3O9O A;  4LF4 B;  1IXM A;  2HHH O;  2DWD C;  3ZRW A;  3ETQ A;  2N05 A;  5L3F A;  1DLB A;  3DC6 A;  3ABK B;  3ABL C;  4JI8 O;  4I9W A;  1OCO B;  1ZTE A;  1M56 B;  1N32 B;  2JGD B;  1DF4 A;  1NS1 A;  1SES A;  2ZD9 A;  4KHP B;  3BEH A;  4K3A A;  3E8F A;  1SER A;  4UV9 A;  4B3S B;  2HFE C;  5ITZ A;  3GWK C;  1VQO V;  3K9A A;  5EK0 A;  2PUS A;  1XMO O;  1H2K A;  1EBO A;  4EFB A;  1HNW B;  2DYR B;  4DV2 O;  5GW7 A;  2LGW A;  3BRC A;  2LQT A;  3RN4 A;  3L9D A;  4JPR A;  1DTO A;  2ADP A;  1S0V A;  3JAW A;  4MW8 A;  3E86 A;  2EZO A;  4DR6 B;  4NKG B;  3OEE G;  3JCZ A;  2R9I A;  4E2L A;  1FYJ A;  2XAS A;  1WB8 A;  2NN4 A;  2QWO B;  2KKW A;  2P4V A;  3ZMV A;  1ZAU A;  4WF9 V;  3CPW U;  5K1X A;  3NR7 A;  1QHT A;  4GX5 A;  3VQW A;  1BCC H;  1I0H A;  3IC9 A;  1AI4 A;  4J7J A;  1VQM V;  3TJT A;  2HLD G;  4X88 A;  2OIE A;  3UO3 A;  3FFQ A;  1NZ6 A;  2Q7H A;  2WWW A;  1L0L H;  3ML0 A;  4O4L A;  5KHK A;  5J9P C;  2OTL V;  1B6Q A;  4O4I A;  2W0X A;  1SZT A;  4WFA V;  1H2M A;  3IGA C;  2AZ0 A;  1GO3 F;  4DK1 A;  2WLI A;  3ZHR A;  4DV2 B;  2HG5 C;  5C93 A;  4YXW G;  4JF3 A;  2NNU A;  3ZMU A;  5B3S C;  1FFT B;  4XBF A;  4B3M O;  1WA8 A;  4O4L B;  2F43 G;  2DQ3 A;  5LOV A;  1BMF G;  3OT7 A;  2RCV A;  1S5H C;  1ZUQ A;  3CC4 V;  1UPG A;  2V4D A;  5KMG B;  2BOC C;  4DR4 O;  2LO1 A;  2E3C A;  4QIW F;  1EFR G;  1YVW A;  4IL6 Z;  1TGO A;  4HNA A;  4YIO A;  4B3R B;  4RUF A;  5A2Q N;  2XOK G;  1E79 G;  3U0Z A;  1M1K W;  2VS0 A;  2HP8 A;  3BAB A;  2GUZ A;  1KUQ A;  1W0J G;  1K33 A;  3W7T A;  5IYZ A;  1VQ4 V;  4JI1 B;  3WU2 Z;  3K08 A;  2KSD A;  4J7Z A;  4X62 O;  1MZF A;  2YID A;  1PNL A;  5KLV H;  3KCX A;  1N8R W;  5LXT A;  3JAR B;  3AG7 A;  4O2A A;  3N2G A;  5L3B A;  1YIT V;  3ZHQ A;  1QQC A;  2AGA A;  3BFR A;  4X66 O;  2NLJ C;  4W4L A;  5EIB C;  3SPI A;  3IC7 A;  4PA7 A;  4DR3 B;  2Y4U A;  4B08 A;  2ZKO A;  1Y67 A;  5KAI Z;  4EB6 A;  1WLE A;  4X1I A;  4JI5 B;  4LP8 A;  2PTM A;  1SS3 A;  1FPO A;  3S3W A;  2UXB O;  2WA4 A;  1AR4 A;  3CYO A;  4JV5 B;  2JGD A;  3T1Y O;  5EYP A;  3K5M A;  1TVK A;  1H8H G;  4PA6 A;  4NR1 A;  4MW3 A;  1EZV H;  2ZM6 O;  4ASU G;  1NQT A;  2ZCE A;  4MT8 A;  1G1X B;  4LF4 O;  1TUB B;  3O65 A;  4TUY A;  3K06 A;  3ZRV A;  4LF6 O;  2X6C A;  3B4S A;  4UVB A;  2GTS A;  4MSW C;  2F95 B;  2D2C B;  2ZT9 B;  4DV4 B;  1S3J A;  4DV1 O;  2YIA A;  1WP7 A;  4LR3 A;  3CCE V;  2X0L A;  2ODM A;  5LP6 B;  3G4S V;  5EC1 C;  3F5T A;  1RSO A;  4FPP A;  2BSK B;  1XHX A;  1YJ9 V;  3ZIA G;  4LNU A;  2P7T C;  4PA4 A;  1TA8 A;  1JJO A;  3HKB B;  1NR7 A;  1Q6H A;  4RQF A;  2PY5 A;  1E1R G;  4JZ2 A;  1OHH G;  3F7V C;  4QGP A;  2UXB B;  3TXQ A;  4DV7 B;  3H1K H;  4UB8 Z;  3DSQ A;  3RFR A;  2IJJ A;  4WFB V;  4CBC A;  1Y74 A;  2EIK C;  4FLZ A;  1NR1 A;  3CSX A;  3BA9 A;  1GN3 A;  3CXC U;  2GHY A;  3U10 A;  3HKC A;  4DRX B;  1K5S A;  2Y69 B;  2OCC B;  2QWP B;  3AK2 A;  4LC1 A;  3ZRS A;  1AI5 A;  3E35 A;  2A06 H;  3P3N A;  5DM6 V;  2XHB A;  4LWS A;  3T1Y B;  2A0L A;  3FAV B;  2ZQM A;  5LGT A;  1XUQ A;  1BL8 A;  2E75 B;  3CXH F;  3E2E A;  4BW9 A;  4DV6 O;  1NU1 H;  1VMG A;  3SDL A;  1W0K G;  2WLL B;  1IBM B;  2QJ1 A;  3CMA V;  1FJG O;  5LA6 B;  1OCR C;  1M93 A;  5KHG A;  4UCV A;  1G6U A;  5B1A C;  2ZE8 A;  3ASN B;  4UVC A;  5KUM A;  2Q4P A;  4X1K A;  3ZBH A;  4UVA A;  2QSA A;  3MAQ A;  1K9M W;  4H37 A;  5LXT B;  1XBL A;  4WFG A;  1LUW A;  2QKC A;  3TET A;  1GM7 A;  1H2S B;  3ASO C;  1Q6U A;  4YHH O;  3T2M A;  4F6E A;  2Q0O C;  5BY1 A;  2YXH A;  5B1A B;  1YF2 A;  4AHC A;  2QDO A;  2ATK C;  5JJJ B;  1DGS A;  3BCC H;  3OTO O;  4JI1 O;  3J81 N;  4OPA A;  1ENV A;  3WG7 B;  1XI1 A;  1IVS A;  2RMK B;  5LOV B;  1PKX A;  3W7X A;  1OZ0 A;  3AG1 C;  2EZP A;  3DXR A;  4U3J B;  4LBE C;  4CS2 A;  2ZR3 A;  4BR6 A;  2V7Q G;  1OCC B;  3E89 A;  2KQX A;  3APO A;  3RVY A;  3HR0 A;  5K1P A;  4HZ3 A;  3C90 A;  3ABM C;  3RWR D;  4DW0 A;  1RP3 B;  3SPC A;  4GKJ O;  1SQB H;  1WB7 A;  1L0N H;  4DV3 B;  2Z0A A;  3OGI B;  4LFB O;  5IJ9 B;  4LF5 O;  2HVJ C;  3TK1 A;  1XQ8 A;  4ICG A;  4K35 A;  1V9P A;  3CME V;  1Y66 A;  1AVM A;  3OEH G;  2EIN C;  3SR2 C;  2ZE6 A;  4JI7 O;  5CA3 A;  1Y76 A;  1J5E B;  4NXN O;  4GZR B;  4TV8 B;  2YXY A;  1M4U A;  4UCR A;  4FVM A;  3G6E V;  3K57 A;  5IE9 A;  2LGQ A;  2GSM B;  4JI3 O;  2LW1 A;  4MS2 A;  2JS3 A;  4K8Z A;  2A3Q A;  2ZE5 A;  3ZN0 A;  2UU9 O;  4PI0 A;  1EZJ A;  4RUE A;  5B66 Z;  5J2T A;  1QVG U;  4TUY B;  4X64 O;  3ZHU A;  3D36 C;  4LF7 B;  1QNM A;  4K0K B;  4MTG A;  3UQ8 A;  1L8D A;  2CH7 B;  3JAK B;  4L87 A;  3G71 V;  5ITZ B;  4MVU A;  1XNR B;  2Q67 A;  2H3O A;  4DV0 B;  1VQ9 V;  1J95 A;  4Q20 A;  2QGN A;  3CE2 A;  2RJZ A;  3B8M A;  2F4V O;  4JI7 B;  2KG7 B;  2MW2 B;  1AI6 A;  2W6I G;  4CH4 A;  3M8A A;  1IXB A;  1CEZ A;  1JOY A;  4BAY A;  1HR0 O;  2JS5 A;  4FLU A;  4PDL A;  3ZMS A;  1KBH A;  3RYF A;  2YC0 A;  4H0L B;  3CC7 V;  4KHP O;  5JQG A;  2Q5Z A;  4R6Z A;  2JEX A;  3OMA B;  3FB5 C;  4PJ0 Z;  4LF9 O;  1LUV A;  3RYH B;  1JPX A;  3QO8 A;  4MTF A;  4YJ2 A;  1Y74 B;  4N21 A;  2IH3 C;  1JA8 A;  1R1B A;  3AG4 C;  1IUR A;  3FB8 C;  4PHZ A;  1VQ7 V;  1OCR B;  2MK3 A;  3ABU A;  4ZBM A;  4DR5 B;  4WFH A;  4TT3 G;  4J9Z B;  1GTO A;  5DN6 G;  4J9Y B;  1WPB A;  5LHG A;  3OUS A;  1BT8 A;  2CDY A;  2M7W A;  2VRZ A;  2ARH A;  2YEV A;  1MSW D;  1GN4 A;  5KHJ A;  2PI5 A;  5FNV B;  3B40 A;  3FAV A;  1XIL A;  1FJG B;  1N36 O;  1P49 A;  4F4L A;  3CP1 A;  3BA8 A;  2BOB C;  2HJD A;  4AQY B;  2B1G A;  1V54 B;  4FZ1 A;  1F51 A;  3EVK A;  2X6A A;  2Q6A A;  2VQF B;  5LL6 Y;  4CH5 A;  4G27 B;  4DV7 O;  5L3D A;  3UO2 A;  3HKC B;  1SQP H;  1ZWI C;  5LHH A;  4I50 B;  2IM9 A;  3UM7 A;  4I7Z B;  1JX9 A;  3VQV A;  3OD4 A;  3OR7 C;  5D5P A;  1AR5 A;  1SRY A;  1H2L A;  5EYP B;  2XAQ A;  4TV8 A;  1PP9 H;  5HFM A;  1SQV H;  1VF7 A;  1KB9 F;  1I5Y A;  5CBH A;  1CPY A;  1B3Q A;  3ETD A;  5JJE B;  4X89 A;  4DUZ B;  3DTU B;  1DK1 A;  4FM1 A;  5LHI A;  3RW0 A;  4R7C A;  2XAG A;  2K1E A;  3CHX A;  2CK3 G;  1BHA A;  1GM8 A;  3M7M X;  2DJV A;  3I55 V;  1FXK C;  4GKK O;  1VP7 A;  1RSO B;  1I94 B;  1KP3 A;  3KKY A;  4I50 A;  1CP9 A;  3L75 H;  4J41 A;  2ZXW C;  2OCH A;  2WLH A;  1IZ3 A;  4PDV A;  3B77 A;  4NXN B;  2V1D A;  2YIB A;  4DUY B;  3D3Q A;  2L35 A;  4HBN A;  2L6L A;  1VQK V;  1ROP A;  4MVR A;  3ZHT A;  1JJ2 U;  1B04 A;  5CA1 B;  2H94 A;  4EKW A;  4DO2 A;  2UU9 B;  4PDM A;  5KMG A;  3CCV V;  4XDK A;  4A5U B;  5H5N A;  1H2G A;  1PPJ H;  1OCO C;  2B9Z A;  2JRI A;  4KXR A;  2EIL C;  1RM1 C;  3Q4H B;  1F7Y A;  4EFE A;  2CAZ C;  3CRM A;  1P84 F;  2WPD G;  3N27 A;  4WFF A;  4JI2 B;  1HNX B;  4IIJ B;  4QPJ A;  1YCI A;  2WLN A;  3CCL V;  2B5U A;  1VIB A;  3RYH A;  4WFE A;  3JSL A;  4DR2 O;  1BS3 A;  2IJI A;  4YJ3 A;  2CE4 A;  1Z5V A;  3SYC A;  2HEP A;  4DUY O;  3U11 A;  5CBF A;  1ZL8 A;  5D5Q A;  1PL0 A;  4F6R A;  5GTI Z;  1NBM G;  2AW9 A;  2UUB O;  5A9G A;  4DR7 B;  4ZI7 A;  2WLL A;  4OPH A;  1AP5 A;  2ZIM A;  4Q6G A;  5J2U A;  3OFN G;  3P32 A;  3OM3 B;  1HP8 A;  4HNA B;  3SYQ A;  2ITC C;  4GUN A;  1THZ A;  1V54 C;  1LR1 A;  5H6R A;  1YJN V;  4BWA A;  1YTF B;  1PM9 A;  3OE7 G;  2XT9 A;  4UCS A;  3OTO B;  5LMN B;  2EX3 A;  3MDS A;  3E8G A;  3RYC A;  3EHB B;  1MNG A;  1HNW O;  2QKS A;  4JYB A;  3PJS K;  3APQ A;  2WLM A;  3TGU H;  3A0H Z;  4BIO A;  2GV9 A;  5JCO C;  1W2B U;  3TCU A;  4CS3 A;  3LSS A;  2Q8V A;  4DR5 O;  3KG2 A;  1Q5O A;  4Z1M G;  1AB3 A;  3R65 A;  3JAL A;  1N32 O;  2EBO A;  3JD2 A;  3AG2 B;  4KP4 A;  5E1A C;  4TOI A;  2K9P A;  1N34 O;  5IJ9 A;  2P22 C;  5B1N A;  2ZE7 A;  4FLW A;  1PNM A;  3L73 H;  1BZK A;  4EEQ A;  1QR9 A;  1XMO B;  4DV6 B;  4OXS A;  2EIN B;  2XAJ A;  1HNZ B;  4IIJ A;  3K04 A;  4IGG A;  3J7A U;  1US6 A;  5KHH A;  2BE3 A;  2HVK C;  1JMK C;  4WBN B;  1R3L C;  1YXB A;  4JI0 B;  5B5E Z;  3LUT B;  1JVM A;  3FB6 C;  2WLJ A;  4LF9 B;  5IDJ A;  4MTO A;  5B3S B;  4KUM A;  4U3F H;  4L8J A;  3SJQ C;  2YI9 A;  1SA0 B;  1IBL O;  4LFA B;  2EJR A;  2OCC C;  4EB6 B;  2ZNI A;  2P5O A;  4DV5 B;  2IU0 A;  2ADQ B;  1BGY H;  1IBM O;  4P9O A;  1GMG A;  3VQY A;  4D7S A;  2AZ2 A;  2AXT Z;  2DYS B;  5AG2 A;  5EZY B;  4J7K A;  4FIP C;  2FYU H;  5JCO A;  4LF8 O;  3AG4 B;  2F4V B;  2RDC A;  2CTQ A;  1QCE A;  4PD4 F;  4JI8 B;  5LMU O;  4DRX A;  2F66 C;  3JAT A;  4G2K A;  1OCZ B;  5GON A;  2OYQ A;  4FLY A;  3CCR V;  4JI0 O;  4NYK A;  3P3P A;  1AJP A;  1BSM A;  3CRA A;  1ZLZ A;  2IW5 A;  2ZIO A;  4TSF G;  4DV4 O;  1FAF A;  5IJ0 A;  3G6B A;  2NR5 A;  1N0N A;  3DGE A;  2A9H A;  2JIZ G;  2X7R B;  2VWJ A;  1XNQ O;  2WA3 A;  1VAR A;  4BIU A;  1AIL A;  1F4N A;  3WB0 A;  1HW7 A;  1S76 D;  2CUG A;  4G28 B;  2RN9 A;  3K0G A;  5H6Q A;  2RNB A;  3CB2 A;  4J11 A;  4NB5 A;  1VQN V;  4WBN A;  5F2V O;  4ZKI A;  1G8M A;  1VF5 B;  2OT5 A;  2ZIN A;  5LGU A;  4ABM A;  2BTO A;  4LFC O;  3SPH A;  5L3G A;  3CCU V;  3W7S A;  3C3S A;  4JTC B;  3EFF K;  3WG7 C;  3ABL B;  2LFS A;  4YY3 B;  3AG3 C;  4O4J A;  4X66 B;  1Z5W A;  1VEW A;  2R9R B;  3THO A;  1XHZ A;  2PF4 E;  1K4C C;  3BY6 A;  3LDE A;  1D2D A;  2IJK A;  2W0F C;  3CRQ A;  2JK5 C;  5CA1 A;  4LCU C;  3CRC A;  1S5L Z;  2YS8 A;  4ZOL B;  4RWU A;  3AG3 B;  2DYR C;  4CC6 A;  4ZI7 B;  1B06 A;  4OX9 O;  1UJW B;  2QA4 V;  3K79 A;  2QR4 A;  4RO2 A;  3JD3 A;  3S3X A;  5CA0 B;  1ZL8 B;  1EM1 A;  1I7F A;  4H13 B;  3JAT B;  2LJ2 A;  4IYI A;  5JWP A;  2BCC H;  4GX0 A;  2CTW A;  2Y4T A;  4HYO A;  3Q4H A;  1R3J C;  1K5Q A;  1NI8 A;  5C8Y A;  5E79 Z;  4Z1V A;  1YI2 V;  4LFC B;  1RM1 B;  4DUZ O;  1QR8 A;  1E1Q G;  3JAS B;  1D5N A;  4PEL A;  1KD1 W;  2BTQ B;  5KX5 A;  1VF6 A;  2UUC O;  2IU3 A;  2WSS G;  3KCY A;  3WB1 A;  1KC8 W;  2QTO A;  2N74 A;  4JTA B;  5IT9 N;  1BHB A;  2ITD C;  4LWS B;  3T1C A;  2Y0P A;  1Z2G A;  2JVD A;  1Q3E A;  2BTQ A;  2Z5U A;  1S5J A;  3ASN C;  1IDS A;  2FML A;  2QM8 A;  1RPR A;  1IBK B;  4I55 A;  1XDC A;  1V55 C;  5B1O A;  2B1I A;  1XEQ A;  5BZB A;  1HR0 B;  2ETN A;  3ICX A;  2HJF C;  4O4H A;  3ZHS A;  4QJF B;  1M9N A;  3A2F A;  1N33 O;  1Q82 W;  1PL4 A;  1IBL B;  4U7N A;  4FJC C;  4I5S A;  2Q9L A;  4FZ0 A;  2LP7 A;  1Y76 B;  1R6N A;  1YDX A;  2WAM A;  4MVQ A;  2EJ7 A;  3FD9 A;  4DR4 B;  1UFI A;  1NH2 B;  2UUA B;  1AJQ A;  5KHI A;  4NTW A;  2PYL A;  3SYA A;  3ABK C;  1R3I C;  3G67 A;  4LFA O;  4J80 A;  4DV5 O;  3JAL B;  1Q8I A;  2ZDI A;  3HPL C;  4MTX A;  3ZRX A;  3ZMZ A;  4BW5 A;  2ILM A;  1XMQ O;  2VWK A;  3OMI B;  3FYI B;  4O4J B;  4U3J A;  3DXR B;  5LYJ A;  4DV3 O;  2HHH B;  4RAI A;  1Q90 D;  1W59 A;  5FLX N;  1HWY A;  2QM4 A;  5BMV B;  3K3W A;  1Q6I A;  4DR3 O;  1P7G A;  3CJH B;  2WLK A;  5BR8 B;  4E4E A;  1L1F A;  3X2Q C;  4DW1 A;  4JAV A;  1KEC A;  5IWA O;  4GKJ B;  5KX5 B;  4ZHQ A;  2VQF O;  3AEI A;  4LFB B;  1TVK B;  4NXM B;  4JAA A;  2XTA A;  1WJZ A;  1GN2 A;  2JJ1 G;  1IBK O;  4LF8 B;  4I0X B;  1KMI Z;  4UCT A;  3T1H B;  4WCE V;  2IBZ H;  1GM9 A;  3H9V A;  3STL C;  3ZX6 A;  4YJ3 B;  1O9G A;  1MMM A;  3OR6 C;  3EXA A;  1N33 B;  3UKM A;  2GDS A;  3CS5 A;  2Y69 C;  4OGQ B;  2CGO A;  3N2K B;  1H38 A;  5C8Y B;  5JJN B;  5CN0 A;  2QM7 A;  3ZRW B;  1GK9 A;  1K92 A;  4MVO A;  1RFY A;  3T4Z A;  4DK0 A;  4JI5 O;  2GUZ B;  3QO7 A;  3ZJZ A;  1SQQ H;  2N04 A;  3LDC A;  5JQG B;  1XL6 A;  2QEX V;  3QTC A;  2GBO A;  3SGI A;  2JEU A;  1X4T A;  3HKE B;  1M57 B;  1URF A;  4X62 B;  3SJA C;  4X65 O;  5IYD O;  4ZOL A;  1I5X A;  3K5L A;  5IWA B;  2VQE B;  1SKV A;  5KAF Z;  3PN1 A;  3SPJ A;  5CBG A;  1ZSP A;  2H8P C;  3T4D A;  5LYJ B;  4CS4 A;  5IY5 C;  5L3E A;  4NTX A;  5IY5 B;  4LF6 B;  3DC5 A;  2UUB B;  3VOU A;  1FFX B;  4IYH A;  1TUE B;  3W7W A;  3K59 A;  4YY3 O;  1I08 A;  4X1Y A;  4DR1 B;  5CA0 A;  4DV1 B;  1M57 C;  3BPZ A;  2CH7 A;  3JAK A;  4PV1 B;  4JI4 B;  1SC5 B;  1JFF B;  3H01 A;  1V55 B;  1VQ8 V;  4AQY O;  1OJH A;  1K34 A;  2LFR A;  1NTZ H;  3W7U A;  3K5O A;  5CB4 A;  2UXX A;  2Q73 A;  3HKD A;  3K0D A;  4LF5 B;  5HFL A;  3LSU A;  3ZS8 C;  2Y48 A;  2BSK A;  4I0X A;  2IH1 C;  2AHZ A;  5EIB D;  2A79 B;  3AK3 A;  4P9P A;  5GON B;  2UXC O;  1K97 A;  5LP6 A;  3M99 B;  1M5I A;  5IJ0 B;  2M6Y A;  1U96 A;  4UV8 A;  5H2F Z;  4B3M B;  3FKS G;  3BAA A;  4YJ2 B;  1A32 A;  1COW G;  4YIP A;  5JH7 A;  5KA6 A;  2P67 A;  4TV9 B;  1X59 A;  3MD0 A;  1WN7 A;  5BXZ A;  1YIJ V;  1K4D C;  4UCO A;  1H8E G;  2DW4 A;  3CCS V;  2OTJ V;  1F23 A;  3QO5 A;  1OCC C;  5JH7 B;  4YHH B;  2YIB D;  2HR3 A;  1QVF U;  3UT5 B;  2OWO A;  1K8A W;  1U97 A;  3AG1 B;  3H1J H;  1AR1 B;  3WB2 A;  1M56 C;  1PV0 A;  1SA0 A;  1CXZ B;  3K58 A;  3CD6 V;  3OGC C;  1TAE A;  3CWB H;  1AI7 A;  4C7U A;  4JV5 O;  2DMX A;  2F93 B;  4D6T H;  1D5A A;  3FX7 A;  4P2Z A;  1PNK A;  5JVD B;  2FTK A;  3ZCC A;  1PD3 A;  2FB5 A;  3BVO A;  4B3T O;  1AP6 A;  4O2A B;  1BQ0 A;  4NTY A;  4W4K A;  2D3O W;  3CCJ V;  1GKF A;  5J2T B;  3L72 H;  3ABM B;  2YDE A;  1FXK A;  2EIJ B;  4NVP A;  2EIJ C;  2A7W A;  3ABT A;  3R66 A;  2P90 A;  3IFX A;  5IYB O;  5B1B C;  4IHJ B;  3H1H H;  3ZED A;  3LNM B;  1NVP D;  1JR9 A;  4I55 B;  5LP6 C;  5FPR A;  1K3E A;  3ZN1 A;  2ZXW B;  1YJW V;  4X9Q A;  2HKO A;  3CX5 F;  1Q81 W;  3OMN B;  3D8C A;  3CJH A;  1XL4 A;  3J80 N;  2KG7 A;  5KUK A;  3X2Q B;  4QNH B;  4MVM A;  5DED A;  3SJC C;  1EN6 A;  2CGN A;  4JYA O;  4JYC A;  2DWE C;  3E8H A;  3BHP A;  5B1B B;  1H2N A;  2AHY A;  4KL1 A;  5EBL C;  3JSN A;  5FL7 G;  3D3I A;  4IT5 A;  4UCU A;  1YHQ V;  3ASO B;  3JAS A;  1JFF A;  3RYI A;  3IAY A;  1N36 B;  1IX9 A;  3A8T A;  1MG1 A;  3LNN A;  4X1Y B;  2XUM A;  2UUC B;  4O4I B;  1I94 O;  5EBW C;  1WPX A;  4X1K B;  4X20 B;  2P06 A;  2Y0I A;  2VQE O;  2E74 B;  2QKA A;  3HB3 B;  3H1I H;  4B7E A;  3OW2 U;  4H44 B;  4UXN A;  2P6J A;  3RGB A;  4ZHQ B;  3IJ4 A;  1QBZ A;  2ZNJ A;  2XAH A;  2F23 A;  4X65 B;  3L74 H;  1XNQ B;  3RYC B;  5LMU B;  2O57 A;  1N4C A;  2FKX A;  2QWR B;  2YIC A;  2DOS A;  1F4M A;  3B8N A;  5L3C A;  2QE7 G;  1FXH A;  1YTF D;  1SET A;  4KFM A;  3ETE A;  2ZDI C;  3CRR A;  3MHS C;  1RPO A;  4FLV A;  3LSQ A;  1NH2 D;  3N2G B;  1GAX A;  4JI4 O;  1Q43 A;  5EZY A;  3JAR A;  3A0R A;  1FS0 G;  3QVN A;  4AI8 A;  4CZZ A;  1GH6 A;  2UUA O;  5J2U B;  1KKC A;  4X8A A;  2UXN A;  1NTM H;  3FB7 C;  3P30 A;  1R73 A;  1SQG A;  4DR6 O;  3OTF A;  1DF5 A;  4JYA B;  4TQD A;  4R8C A;  4LH6 A;  1MA1 A;  3B2E E;  2IJH A;  4GLX A;  4I9Q A;  3HKE A;  3K9S A;  2LW7 A;  1BQZ A;  1NVP B;  4RQE A;  1N0J A;  4DR7 O;  4GX1 A;  1MAB G;  4JAS A;  4OX9 B;  1VQL V;  1GRJ A;  4J10 A;  2G38 A;  1FXK B;  4TV9 A;  4FM2 A;  2R9A A;  4IHJ A;  1YEW A;  4QE7 A;  1MSD A;  3CCM V;  3E22 B;  2QWN B;  3F5W C;  3RYF B;  4AIL C;  3JD1 A;  1BE3 H;  2PGG A;  4JI3 B;  3T1H O;  1Q86 W;  4GX2 A;  4PA3 A;  3QG5 A;  1S77 D;  2YXL A;  4UFZ A;  4GT1 A;  1NJI W;  1R6T A;  1WAZ A;  1VQ6 V;  3HKD B;  1SF9 A;  5CB4 B;  4FLX A;  1NTK H;  3UT5 A;  1Y4M A;  3MHH C;  2E5L B;  1JCH A;  4X1I B;  4K0K O;  2XND G;  4H33 A;  1HDJ A;  1HNX O;  1FKA O;  4ZIB A;  1ARO P;  1ORQ C;  2PZS A;  3CEI A;  3JCU Z;  4DV0 O;  5BMV A;  4DXW A;  4X20 A;  2CTR A;  4N23 A;  1S72 V;  4I4T A;  2Q7E A;  4J42 A;  4PI2 A;  4B7K A;  3SJB C;  4TWK A;  3A0B Z;  1MZE A;  2DYS C;  1K7D A;  3JD0 A;  4QPK A;  3CCQ V;  2WLI B;  1KP2 A;  1R3K C;  1YSC A;  1ZX3 A;  4PA9 A; 
#chains in the Genus database with same CATH homology
 2RMK B;  1RFY A;  1URF A;  4IGG A;  2Q0O C;  1US6 A;  4DYL A;  1UPG A;  4NB5 A;  1CXZ B;  2HJD A;  4NKG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...