1RFYA

Crystal structure of quorum-sensing antiactivator tram
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
b'KKVELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEMHAQMSALNTLISILGFIPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional repressor traM
publication title Quorum-sensing antiactivator TraM forms a dimer that dissociates to inhibit TraR
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transcription
total genus 33
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09228 Prok-TraM Prokaryotic Transcriptional repressor TraM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1rfyA00
4NKGB 4DYLA 1US6A 2HJDA 1RFYA 1CXZB 4IGGA 1UPGA 2RMKB 1URFA 2Q0OC 4NB5A
chains in the Genus database with same CATH superfamily
2RQ6A 4WFBV 3BABA 2QM7A 3K9SA 2Z5UA 4Q20A 3ASOC 2GUZA 4JYYA 4ZKIA 4TQDA 4MVMA 2AZ2A 3S3WA 3Q4HB 4TT3G 1JOYA 3GB7C 2VRZA 2RDCA 4W4LA 3JD2A 4L8JA 4DW1A 1T5EA 3OGIB 3ZMZA 1Q82W 5LOVA 1FPOA 5BMVA 5IJ0B 4B7EA 5LXTA 1SQXH 2EBOA 5CA1A 3CJHB 2ZQMA 2QM4A 4P30A 3JALB 1R6KA 2N05A 1NTKH 5H9CA 3TXSA 2JDIG 3STLC 2P6JA 2HVKC 4LP8A 1MG1A 4IL6Z 1SQVH 3N2KB 1VQ9V 1Z2GA 1R3KC 3JASB 3G4SV 4EFBA 3P3NA 5FNVB 3U11A 1HWYA 1Y66A 2Y0PA 3UM7A 2W0FC 3WB0A 5EC2C 1R73A 3K08A 3KZIZ 1Q7YW 3JAWA 4GYCB 1YHQV 1BQ0A 3IGAC 2LO1A 2ZR2A 4FJCC 2JEUA 4IGGA 1LUWA 1M1KW 3AK1A 3G67A 1XBLA 3F5WC 3LNMB 2YIDA 4DUYB 1OCOC 3AG4C 1G4YB 1P49A 4DUZB 1KKDA 2ZIOA 4RUEA 3APOA 4DUYO 4W4KA 2VQEO 1AI5A 5EBLC 3RYFB 1G8MA 2G38A 4DUZO 1M4UA 2GV9A 2ATKC 5K1PA 4KL1A 1I08A 1M56B 4JI2B 1ZWIC 3A0HZ 2DE0X 4JI2O 2UXDO 3SJAC 4ZBMA 1AILA 5IY5C 1D5NA 1PV0A 4HNAB 2WLLB 4B3SO 2WAMA 2AZ0A 2DMXA 4LF5B 5GONA 2YI9A 1RM1B 4JI6B 1IBKB 3B2EE 1XDCA 3VQVA 4JI6O 1IBKO 1VQ6V 1QLEB 2F1MA 2HHHO 2L6LA 4GX1A 3FD9A 1WJZA 4MS2A 1HNWO 4UB6Z 1KKCA 1JA8A 2CH7A 2X6CA 5L3EA 4H33A 2YIBD 3AG3B 1WAZA 3O65A 4I9QA 2LFSA 4PI0A 1SETA 4NXNO 2JS3A 5CB4A 4UCRA 1R3JC 1K9MW 1ZTEA 1K7DA 3FAVA 4D6TH 4FM1A 2NLJC 3ZCCA 2Q7EA 3LDEA 2BTQA 1URFA 5BR8O 3IAYA 3RYHA 2F4VB 1BHBA 3JASA 1S72V 5FL7G 5BXZA 2H3OA 2Q0OC 4X1IA 3LDDA 4GKKB 2UUCB 3EHBB 5DECA 3FFQA 2QTSA 4GKKO 1XMOB 1AROP 2DYRB 1QR8A 3ABUA 4DR4B 5KA6A 4KHPB 1XMOO 4DR4O 5IT9N 3OTOO 1Q8IA 4PA6A 5B3SC 1GN2A 1SESA 1L0LH 1BGYH 2P5OA 2XAHA 4KXRA 1IX9A 2CTWA 3OMNB 3D36C 2M6YA 3MAQA 1KD1W 1JJOA 4D7TA 1FXKB 2XAGA 2KKWA 3ABTA 1E79G 2EZPA 4O4IA 1KECA 3G6BA 2Q73A 2WLIA 1WP7A 2JS5A 3PJSK 3RGBA 4IIJA 2YICA 4J9YB 3LSQA 3AK3A 1DTOA 2XAFA 3FX7A 1JR9A 5AG2A 4FFBB 1VARA 4UVBA 1WA8B 4LF6O 3CCSV 4X1YB 4OX9B 4DK0A 4OXSA 4PHZA 2VQFB 5B1AC 4GX5A 4MVRA 4DR5O 4TWKA 5EIBC 4ZHQB 2VQFO 4J80A 3KKYA 2ZCEA 4U3JA 1L1FA 1FXHA 5FPRA 3D3QA 4DV6B 4PDVA 1SA0A 3JAKA 1MZEA 1DGSA 1BE3H 3HKEA 4DV6O 1Y76B 4LF9B 3DC6A 4GX2A 3HB3B 5DM6V 5JH7B 5JQGA 3I56V 5IE9A 1DK1A 1Q86W 3DGEA 1KP3A 1HNZO 1TA8A 1AI7A 3CEIA 4JI0B 3P32A 4J42A 1OCCB 1IVSA 1ZLZA 4JI0O 2Q68A 5L3DA 3H1IH 5LL6Y 3ZMUA 4RQEA 1P4RA 1H2GA 4MTXA 4JAAA 4B3MO 3FYEB 2WWWA 4NB5A 2UXNA 4NTWA 3JARB 1R3LC 4CZZA 4ABMA 3CXCU 1XI1A 4DRXA 4ZIBA 3SJQC 4UCVA 3ABLB 1J5EB 3H1KH 5L3FA 1PKXA 4CS4A 3T2MA 4MTFA 5LBQA 3NXSA 1J5EO 2P06A 1SKVA 1PNMA 2IH3C 2Q69A 3FB7C 4H44B 5J2TB 5LYJA 3CWBH 1AI4A 3F5TA 5EBWC 4DXWA 1TUEB 4FM2A 2Q7HA 3ZX6A 1F23A 2H8PC 4UV8A 3JATA 4LFAB 3VBBA 5HFLA 5EK0A 4I50A 3VOUA 2ADPA 1LR1A 4QJFB 4PA7A 1FJGB 2LW7A 4LR3A 3RW0A 4PV1B 1UPGA 4BWAA 1FJGO 1QHTA 3CCRV 1WA8A 4UCTA 2EINB 3SPJA 2C2AA 3E8FA 1N33B 1XREA 5B5EZ 2ARHA 1PPJH 2Q6AA 1VQPV 2AHZA 3CCEV 2CAZC 4OPHA 3VQYA 5IJ9B 2KG7A 1HR0B 3ZIAG 2EIJC 5GTHZ 5LGTA 2DYSC 4I55B 4LFBO 4WFAV 2B5UA 3SJBC 4HAMA 1XEQA 2QE7G 3B8MA 2UU9B 3DTUB 2CE4A 3ETQA 3G6EV 4JGSA 3RWRD 4Z1MG 5CA0B 4XDJA 2UU9O 2HJDA 3QVNA 4TV9A 4XBFA 3WG7C 4JI7B 2X6AA 2V4DA 3C90A 3HKBB 1K97A 4HYOA 1J95A 2F43G 4J9ZB 1YIJV 4FMTA 1IZ3A 5L3BA 4IT5A 2QEXV 4QPKA 2F95B 2WA3A 2ZD9A 1YSCA 3ZRWA 3JAMN 1NTMH 5IWAO 4GUNA 3H01A 3ZRXA 4HBNA 4I5SA 4DK1A 2GUZB 1N0NA 5KX5A 1N34B 4ASUG 5KHGA 4FLZA 3ZMTA 4DV3B 3K3WA 3CCVV 1G6UA 1V55B 1V9PA 1HW7A 3A8TA 4GT1A 1E1RG 3SGIA 4N23A 3EFFK 5LGNA 1KB9F 3K0GA 3W7SA 1QU7A 4CC6A 5HFMA 5LOVB 3SPIA 1WLEA 3OGCC 1M9NA 4WFFA 4UFZA 5BMVB 1YEWA 2LFRA 4BW9A 3ZN0A 3DXRA 5LXTB 2K1EA 2QJ1A 1NT2B 5CA1B 2EILC 2F66C 2A3QA 1K34A 4F6EA 1WPXA 2YIBA 3CCJV 1M93A 3ABKC 1JVMA 3P30A 1YF2A 3RFRA 2JIZG 1G1XB 1OV9A 3OTFA 2EJRA 1XUQA 4MTGA 2Y69C 5BZBA 4YHHO 1ORQC 3SPGA 1SQQH 2ZE5A 5DEDA 1M57C 3JD1A 2IW5A 3OM3B 1IBLB 1GK9A 4FLVA 2IU3A 5EIBD 2R72A 4O2BB 3ICXA 5CBGA 1IXMA 3JAWB 4JZ2A 5FPOA 1S0VA 1GH6A 3ASNC 2N04A 5JJNB 1XL6A 3CRRA 3RT3C 2AGAA 2QWQB 4X62B 1Q6IA 1YJNV 4UVCA 4O4LA 4LC1A 4TOIA 4U7NA 5KHKA 5KAIZ 4X62O 2EULA 4MVQA 5B1BC 2E75B 3UKMA 2E74B 1RP3B 2GDSA 3SYCA 3APQA 1OCOB 3AG4B 2JVDA 3HKCA 4JI4B 1JQ0A 3OUSA 4XDLA 3TETA 4QE7A 5JJJB 4YJ3A 3CC4V 4FIPC 3UO2A 2R9AA 1GM9A 3AEIA 5A2QN 3LNNA 5GONB 3E35A 1DF4A 1QBZA 1Y6XA 2CGOA 2HKOA 4Z1VA 4K8XA 1NVPB 1ZAUA 4IYHA 4FK5C 5IY5B 3T4ZA 1IXBA 2CDYA 5LHHA 2VS0A 1QQCA 1YTFB 4J41A 2UXBO 4I0XA 3S3XA 3UO3A 2CH7B 2CK3G 3U0ZA 1EN4A 1L0NH 1CEZA 2QDOA 2WA4A 1K4CC 5KAFZ 4LF8B 3H9VA 4ZOLA 4DV2B 4F4LA 5CB4B 4LF8O 3RYIA 4Z2WA 4DV0O 4I4TA 1AJPA 4DV2O 5EBMC 3FAVB 1GM8A 3MDSA 3OMIB 5KMGA 3W7UA 1F4NA 2BTQB 1NR7A 4PA3A 3ZS8C 2Z0AA 3RYHB 1F51A 3HPLC 4YXWG 5GW7A 2BTOA 4CH4A 1JFFA 1JMKC 1CPYA 4X1IB 3LSUA 4O2BA 4X1KA 4MVOA 3ZJZA 1W2BU 3BEHA 4UCOA 4IHJA 3SYOA 4PDMA 1VQ5V 2BCCH 2WLKA 1KUQA 4DO2A 1YI2V 4LF4O 1O9HA 1MNGA 4LWSA 2VQEB 1NTZH 5GTIZ 4KUMA 4F6RA 2IJIA 1AI6A 4B3RO 5B3SB 1F7YA 4O4IB 4EB6A 2X0LA 2UXDB 4PD4F 2WSSG 2WLIB 2IJHA 3P3PA 2ETNA 4IIJB 5IYCO 3WFVA 1VEWA 2QWNB 1AB3A 2E76B 4B3SB 1Q3EA 4U3FH 1FAFA 3OFNG 3K5OA 3ZRSA 1WP8A 2X6BA 1XQ8A 2HHHB 4BIOA 1WNSA 3K03A 4JTAB 3T1YB 2ADQB 1HNWB 1BL8A 4U3JB 4DR1O 2OCHA 3T1YO 1R6NA 5H6QA 4Q6GA 1SQPH 1SA0B 2O57A 1W0KG 3JAKB 3L75H 4CS2A 1JCHA 2XT9A 5B1AB 4BW5A 4LFCB 2UUBO 3HKEB 2XOKG 5H5NA 1LUVA 1GN4A 4LFCO 3GWOA 4NXNB 5JQGB 1WN7A 4J7ZA 3THOA 1IBMB 2YIAA 2KB1A 1IBMO 5BR8B 2R9RB 1W59A 1CP9A 4BAYA 2RNBA 3JSLA 4X65B 2FB5A 2R9IA 1BT8A 4FLWA 4X65O 4P2ZA 2BSKA 1XOUA 3SPHA 2QGNA 1I5XA 1S77D 2ZXWB 5LA6A 2UXXA 3N2GA 4DRXB 2D3OW 1H38A 2UXCO 2GTAA 2QWRB 3CRQA 4CBCA 4JAVA 3OTOB 1N32B 2IJKA 3SJCC 1N36B 2OCCC 1M90W 3K57A 3J80N 1N32O 3OMAB 3T1CA 5LYJB 1N36O 1I94O 3ZRVA 2PYLA 1KU9A 3ZEDA 4H0LB 4X66B 3WB1A 5CA3A 3JD4A 1GN6A 3IFXA 1S5JA 3OEHG 4I9WA 4X66O 3JATB 1QNMA 5KHJA 3OT7A 1NH2D 2UUAB 3CRAA 4I50B 1VF7A 4O4HA 2JRIA 3D36A 2UUAO 4YIOA 1VQ7V 4JAUA 3A2FA 5LHGA 5LMNO 4LF6B 3ZHUA 1AJQA 2Y48A 3L70H 4GX0A 4DR5B 1OCZC 1RSOA 2GHYA 2NR5A 1K73W 3DC5A 4RQFA 2YDEA 4GKJO 3G71V 1N0JA 1XHXA 4YIPA 1RM1C 2Q4PA 4JI1B 1VQ8V 2LGQA 2KG7B 2QWOB 4JI3O 4R8CA 1VQNV 2Y0IA 3T1HO 4JI1O 1XNRO 3CXHF 2RCVA 3I55V 4I7ZB 1H8EG 5DN6G 3ZHVA 5LGUA 3KCXA 1Y74A 1U96A 2PF4E 4R6ZA 5B1OA 1HNZB 1PNLA 4RWUA 1XL4A 2EIJB 4TV9B 2DYSB 1K33A 5LP6C 3C3TA 1L8DA 3K5NA 1IURA 2V7QG 1UJWB 3A0RA 5H2FZ 4K8ZA 3ZRWB 4B3MB 3JD0A 4JV5O 1I0HA 2XAJA 1TUBA 3ZMSA 1U97A 5KX5B 1B3QA 5LP6A 2HP8A 2MW2B 1O9GA 1YXBA 2JGDA 5TISZ 4X88A 3NR7A 2Q7GA 1BZKA 3ETGA 1DF5A 4UVAA 3FB5C 3JSNA 3E8BA 1VQKV 1GO3F 3QG5A 1EBOA 2QKSA 2YSUB 1YDXA 4K35A 1Q90D 4TUYA 1D2DA 4CC5A 3FB6C 4LH7A 4QGPA 3DXRB 4X8AA 5LHIA 1H2KA 4BIZA 3AG1B 2ZINA 3L71H 3SYAA 2DOSA 3K0DA 4QNHB 4MVSA 1AVMA 3ETDA 2YS8A 4YJ2A 4AQYB 4JASA 1OHHG 3OD4A 2W0XA 1AR4A 1D5AA 3GVMA 4FLYA 4AQYO 1AJNA 1TVKA 2EILB 2EIMC 2HG5C 1TAEA 1THZA 3ZHQA 1ZL8A 2EZOA 4O2AA 5FLXN 3ABKB 2E5LO 1NZ6A 3J81N 3TXQA 1MABG 5C93A 2Y69B 4LFBB 1W0JG 3J7AU 2ITDC 3EXAA 1XILA 1M57B 2JGUA 2QKAA 4MW8A 5K1XA 4JYBA 3BHPA 2OIGA 3M7MX 1ROPA 4DV4B 1JPXA 1BSMA 4O4LB 4P9PA 5C8YA 3ASNB 4DV4O 5EYPA 3CCUV 2A7WA 2BOBC 2CGNA 5JCOC 4KFMA 2FKXA 1N8RW 1WB7A 3HKCB 3D8CA 3R65A 2YEVA 3K5MA 4RUFA 5CN0A 1SZXA 3FB8C 5B1BB 3W7XA 4YJ3B 2YXYA 5IWAB 4GLXA 4PI2A 3MHSC 4OPAA 4QPJA 5KA5A 5JCOA 1AR1B 3CP1A 4TSFG 4MVZA 1MA1A 3K79A 2R70A 2K9PA 1BHAA 3MD0A 3E2EA 1EN5A 3CB2A 3ASOB 4NVPA 4L87A 2A9HA 2BE3A 4I0XB 2QM8A 4NXMB 1VIBA 2IJJA 4AI8A 1EZVH 2YI8A 3ABLC 2QR4A 2OT5A 4K3AA 4NXMO 4MW3A 2IBZH 5CBHA 3UT5A 1S76D 5IYZA 4ZOLB 3E86A 3RYIB 4I4TB 2HJFC 2JEXA 2MK3A 4JI5O 1EM1A 4DR7O 1A32A 2PGGA 4FZ0A 5KMGB 4FLXA 2H94A 5JVDA 1ZX3A 3BY6A 4JI8B 2PY5A 4BIUA 4FLUA 4YHHB 3SR2C 1XMQO 3B4SA 4JI8O 1VF5B 1JFFB 1FFXA 3K5LA 2OTJV 4U7OA 4JPRA 2CUGA 2EIKC 4X1KB 4DV5O 3L73H 1K3EA 2AW9A 4EKWA 4LNUA 2ZE8A 2LQTA 4IHJB 3JYCA 4PELA 3CMEV 4X20A 1JJ2U 2F93B 4B7KA 2Q0AA 5ITZA 3HKDA 3TGUH 1VF6C 3FKSG 5IYBO 5D5QA 2Q67A 4LWSB 1B06A 3HR0A 1GKFA 4F6RB 2E3CA 3CYOA 3AG2C 1VF6A 2ZR3A 1F4MA 2P90A 2PI4A 2WLHA 3SPCA 1RPOA 4EB6B 3MHHC 1X59A 1DLBA 4PDLA 2Y4TA 3E83A 4DR3O 3ABMC 2AHYA 3F7VC 1RPRA 4J7JA 4NKGB 1TGOA 3ML0A 1K92A 3ZHRA 2WLNA 1MSDA 4DV7B 2Q8VA 1SC5B 4FLTA 2DQ3A 1MOFA 2P7TC 4DV7O 2CTRA 4NTYA 4AHCA 3CCQV 4IYIA 3T4DA 5LMUB 4EFEA 1RFYA 2UXBB 5LMUO 2HVJC 2JK5C 1V55C 1KYOF 1Q6UA 4GZRB 2F23A 1VMGA 2RJZA 5BY1A 1NBMG 3RYCB 1MSWD 2IM9A 4ICGA 4DV0B 3QNEA 1XNQB 1KMIZ 3E22A 2IH1C 4UUJC 2P67A 1SQBH 3CRMA 3A0BZ 4O4JA 2DWEC 1XNQO 3OEEG 4DR2B 3FYIB 3RVYA 5B1NA 4WCEV 2NNUA 3E8HA 4EEQA 4DR2O 3CX5F 1FFTB 1H2NA 3ETEA 4TV8A 1ZSPA 3QF7A 1M5IA 2ZIMA 2D2CB 4J11A 3X2QC 2PYJA 2BSKB 2DN9A 1HNXB 2YXLA 5LA6B 2A79B 3N2GB 3AK2A 2BOCC 1HNXO 4H13B 2LW1A 1GRJA 1IDSA 1X4TA 4WFHA 2EJ7A 3BRCA 4LF4B 4JYAB 4UXNA 2VWKA 5A9GA 1PM9A 1OJHA 4B3TB 4JYAO 1PD3A 1BQZA 3TJTA 2FTKA 4RAIA 3OR7C 1XHZA 4B3TO 5KLVH 1FD9A 2QKCA 4OGQB 2LP7A 3K06A 4G27B 2XAQA 1Z5VA 1AP6A 2OCCB 4B3RB 1Q5OA 1FYJA 5CMUA 5L3CA 1P7BA 1OCRC 2A0LA 3QO7A 1E1QG 1GM7A 5IDJA 4O4HB 2RN9A 2FMLA 3B09A 3ZHSA 5EC1C 3STZC 3M8AA 1V54C 2LJ2A 1I5YA 1K4DC 4G2KA 2P4KA 2WLJA 1RSOB 3QO5A 3JCZA 2P4VA 4DR1B 4ZI7A 1SF9A 3CD6V 2WPDG 1COWG 3BA8A 1K5SA 1H2LA 2UUBB 5J9PC 1OCZB 3L72H 1PL4A 3BPZA 3BAAA 2HFEC 2M7WA 1SQFA 1Y74B 4JZGA 3VQWA 3IC9A 3OR6C 1S5LZ 2CTPA 3RYCA 4LF5O 2HEPA 3Q4HA 2PTMA 5E79Z 3SYQA 2QSAA 1AP5A 4DV1B 1YVWA 5KHIA 1GN3A 2JJ1G 2HR3A 4DV1O 2W6JG 1BS3A 2NN4A 1OZ0A 3L74H 3TK1A 3WB2A 1EN6A 1PP9H 3K58A 1Y67A 3CSXA 4JTCB 5F2VO 1Q81W 5IJ0A 1TUBB 1ENVA 5LP6B 2EX3A 1HP8A 2JGDB 3CJHA 2OWOA 3JALA 2UXCB 4X9QA 1GMGA 2XUMA 3KCYA 1Z5WA 4AILC 1Q43A 1R6TA 2ZE6A 1LNQA 4DW0A 1SERA 1YCIA 4WFGA 2ZE7A 3N2KA 4PA4A 4CH3A 2FL4A 1I94B 4TUYB 2VWJA 3D3IA 3N27A 3QO8A 5FNVA 2F4VO 3B8NA 3K04A 2ZDIC 3I5DA 5B66Z 1P7GA 2B1IA 2DW4A 4JTDB 3H1HH 4G28B 2JJ2G 2UUCO 1SZTA 2WLMA 1KBHA 2ZDIA 4YJ2B 1EFRG 1UFIA 4KHPO 1I7FA 4DR6B 1M56C 1TVKB 4XDKA 2ILMA 5LMNB 1S3JA 1MMMA 4FM0A 1SQGA 3DSQA 4DR6O 1JX9A 3JCUZ 3RYFA 1P84F 5E1AC 2Q5ZA 3KG2A 4UCUA 1AR5A 1MZFA 1ZL8B 4O2AB 4GKJB 4R7CA 1YJ9V 4PA9A 1VQ4V 2EIMB 5L3GA 4MVUA 4JI3B 1NS1A 2ZM6B 3T1HB 1XNRB 3BCCH 4WBNB 2KSDA 1QLEC 4CH6A 1VQLV 2ZM6O 4HNAA 2WLLA 3IJ4A 3QTCA 5C8YB 1YZBA 4H37A 5EYPB 4OX9O 3E8GA 2Y4UA 5J2UB 1PL0A 3AG3C 5KUMA 1VP7A 2YEVB 3H1LH 1H8HG 4JV5B 2DQ0A 3SYPA 2CTQA 3H1JH 3GWKC 2PUSA 3WG7B 4LF9O 2OTLV 3O9OA 2XHBA 3ZN1A 2IU0A 1VQOV 4E4EA 3CS5A 3U10A 3F7YC 4X89A 3OUFA 1QLNA 4JYCA 2ZXWC 4FZ1A 2ITCC 3B77A 4CS3A 4MT8A 1R1BA 1KQSU 2DYRC 4PDRA 3UT5B 2L35A 4MSWC 5IYZB 1Q6HA 1QCEA 1R3IC 4D7SA 1K5QA 2DJVA 4UB8Z 3W7TA 3ZMVA 2KQXA 3OAAG 3LDCA 3UCSC 1SS3A 1FXKC 1FXVA 5D5PA 5JVDB 3TCUA 2QA4V 5H6RA 1NI8A 2B1GA 1YJWV 3LUTB 3VQXA 5IYDO 1FS0G 1SRYA 5JJEB 1FFXB 3EVKA 2GBOA 2E5LB 1FXKA 3K59A 2PZSA 4LNUB 4LFAO 1NVPD 3ZHTA 4YY3B 4GCZA 1QR9A 3CC2V 3UQ8A 4X20B 3CRCA 4WBNA 4YY3O 5ITZB 3HKDB 1YTFD 2AXTZ 2EIKB 4QE9A 4KP4A 4FFBA 2Q9LA 2A06H 4TQFA 4X1YA 3WU2Z 1N4CA 4B08A 1YITV 3G80A 4JF3A 2YXHA 2ZKOA 3CCMV 1WPBA 4FPPA 4ZHQA 1N33O 2FYUH 4LBEC 1CXZB 2P22C 1B04A 5J2UA 2Z3YA 4E2LA 4WF9V 2N74A 3BFRA 2ZT9B 3AG7A 3ZBHA 1HR0O 1Y76A 1H2MA 1OCCC 1VQMV 3AG2B 3M99B 2DWDC 2XNDG 5JH7A 4K0KB 3OW2U 5JWPA 3ABMB 2X7RB 1EZJA 5EZYB 4K0KO 1NH2B 2V1DA 4JI7O 4UV9A 3SDLA 4FFKA 3CPWU 4J7KA 3C3SA 1NU1H 5KHHA 3B40A 1FKAO 1H2SB 3OE7G 3E89A 2ODMA 1N34O 3JARA 2OIEA 4HZ3A 4RO2A 1PNKA 4LF7B 4NTXA 4DYLA 2XTAA 4JI5B 2LGWA 4DR7B 3E22B 4NYKA 2PI5A 4LF7O 1NKDA 4DV3O 3JD3A 3AG1C 4O4JB 4LH6A 4QIWF 1WB8A 2GTSA 3W7WA 2B9ZA 5J2TA 4WFEA 2HLDG 1KC8W 3RVZA 1GTOA 3PN1A 1XMQB 1NJIW 1QVFU 5CBFA 4TV8B 5KUKA 2GSMB 2W6IG 4DV5B 3R66A 4N21A 1BMFG 1K8AW 4FVMA 3CCLV 3X2QB 2EINC 4BR6A 2OYQA 1Y4MA 4X64B 4PJ0Z 2XASA 4UCSA 2QWPB 4P9OA 3IC7A 4X64O 4R50A 3L9DA 4MTOA 4NR1A 1NQTA 1IBLO 2ZNIA 2ZNJA 2YUAA 4LCUC 3LSSA 2QTOA 1B6QA 3BVOA 3BA9A 4J10A 1US6A 4DR3B 4CH5A 5IJ9A 1S5HC 1BCCH 4I55A 3CE2A 3CHXA 1NR1A 3RN4A 1GAXA 1KP2A 1HDJA 5CA0A 3RBZA 1OCRB 1ZUQA 1QVGU 3HKBA 5EZYA 4A5UB 3K9AA 1V54B 3CMAV 4ZI7B 3CC7V 2YC0A 4C7UA 4JI4O 2RMKB
chains in the Genus database with same CATH topology
4NKGB 4DYLA 1US6A 2HJDA 1RFYA 1CXZB 4IGGA 1UPGA 2RMKB 1URFA 2Q0OC 4NB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKG B;  4DYL A;  1US6 A;  2HJD A;  1RFY A;  1CXZ B;  4IGG A;  1UPG A;  2RMK B;  1URF A;  2Q0O C;  4NB5 A; 
#chains in the Genus database with same CATH topology
 2RQ6 A;  4WFB V;  3BAB A;  2QM7 A;  3K9S A;  2Z5U A;  4Q20 A;  3ASO C;  2GUZ A;  4JYY A;  4ZKI A;  4TQD A;  4MVM A;  2AZ2 A;  3S3W A;  3Q4H B;  4TT3 G;  1JOY A;  3GB7 C;  2VRZ A;  2RDC A;  4W4L A;  3JD2 A;  4L8J A;  4DW1 A;  1T5E A;  3OGI B;  3ZMZ A;  1Q82 W;  5LOV A;  1FPO A;  5BMV A;  5IJ0 B;  4B7E A;  5LXT A;  1SQX H;  2EBO A;  5CA1 A;  3CJH B;  2ZQM A;  2QM4 A;  4P30 A;  3JAL B;  1R6K A;  2N05 A;  1NTK H;  5H9C A;  3TXS A;  2JDI G;  3STL C;  2P6J A;  2HVK C;  4LP8 A;  1MG1 A;  4IL6 Z;  1SQV H;  3N2K B;  1VQ9 V;  1Z2G A;  1R3K C;  3JAS B;  3G4S V;  4EFB A;  3P3N A;  5FNV B;  3U11 A;  1HWY A;  1Y66 A;  2Y0P A;  3UM7 A;  2W0F C;  3WB0 A;  5EC2 C;  1R73 A;  3K08 A;  3KZI Z;  1Q7Y W;  3JAW A;  4GYC B;  1YHQ V;  1BQ0 A;  3IGA C;  2LO1 A;  2ZR2 A;  4FJC C;  2JEU A;  4IGG A;  1LUW A;  1M1K W;  3AK1 A;  3G67 A;  1XBL A;  3F5W C;  3LNM B;  2YID A;  4DUY B;  1OCO C;  3AG4 C;  1G4Y B;  1P49 A;  4DUZ B;  1KKD A;  2ZIO A;  4RUE A;  3APO A;  4DUY O;  4W4K A;  2VQE O;  1AI5 A;  5EBL C;  3RYF B;  1G8M A;  2G38 A;  4DUZ O;  1M4U A;  2GV9 A;  2ATK C;  5K1P A;  4KL1 A;  1I08 A;  1M56 B;  4JI2 B;  1ZWI C;  3A0H Z;  2DE0 X;  4JI2 O;  2UXD O;  3SJA C;  4ZBM A;  1AIL A;  5IY5 C;  1D5N A;  1PV0 A;  4HNA B;  2WLL B;  4B3S O;  2WAM A;  2AZ0 A;  2DMX A;  4LF5 B;  5GON A;  2YI9 A;  1RM1 B;  4JI6 B;  1IBK B;  3B2E E;  1XDC A;  3VQV A;  4JI6 O;  1IBK O;  1VQ6 V;  1QLE B;  2F1M A;  2HHH O;  2L6L A;  4GX1 A;  3FD9 A;  1WJZ A;  4MS2 A;  1HNW O;  4UB6 Z;  1KKC A;  1JA8 A;  2CH7 A;  2X6C A;  5L3E A;  4H33 A;  2YIB D;  3AG3 B;  1WAZ A;  3O65 A;  4I9Q A;  2LFS A;  4PI0 A;  1SET A;  4NXN O;  2JS3 A;  5CB4 A;  4UCR A;  1R3J C;  1K9M W;  1ZTE A;  1K7D A;  3FAV A;  4D6T H;  4FM1 A;  2NLJ C;  3ZCC A;  2Q7E A;  3LDE A;  2BTQ A;  1URF A;  5BR8 O;  3IAY A;  3RYH A;  2F4V B;  1BHB A;  3JAS A;  1S72 V;  5FL7 G;  5BXZ A;  2H3O A;  2Q0O C;  4X1I A;  3LDD A;  4GKK B;  2UUC B;  3EHB B;  5DEC A;  3FFQ A;  2QTS A;  4GKK O;  1XMO B;  1ARO P;  2DYR B;  1QR8 A;  3ABU A;  4DR4 B;  5KA6 A;  4KHP B;  1XMO O;  4DR4 O;  5IT9 N;  3OTO O;  1Q8I A;  4PA6 A;  5B3S C;  1GN2 A;  1SES A;  1L0L H;  1BGY H;  2P5O A;  2XAH A;  4KXR A;  1IX9 A;  2CTW A;  3OMN B;  3D36 C;  2M6Y A;  3MAQ A;  1KD1 W;  1JJO A;  4D7T A;  1FXK B;  2XAG A;  2KKW A;  3ABT A;  1E79 G;  2EZP A;  4O4I A;  1KEC A;  3G6B A;  2Q73 A;  2WLI A;  1WP7 A;  2JS5 A;  3PJS K;  3RGB A;  4IIJ A;  2YIC A;  4J9Y B;  3LSQ A;  3AK3 A;  1DTO A;  2XAF A;  3FX7 A;  1JR9 A;  5AG2 A;  4FFB B;  1VAR A;  4UVB A;  1WA8 B;  4LF6 O;  3CCS V;  4X1Y B;  4OX9 B;  4DK0 A;  4OXS A;  4PHZ A;  2VQF B;  5B1A C;  4GX5 A;  4MVR A;  4DR5 O;  4TWK A;  5EIB C;  4ZHQ B;  2VQF O;  4J80 A;  3KKY A;  2ZCE A;  4U3J A;  1L1F A;  1FXH A;  5FPR A;  3D3Q A;  4DV6 B;  4PDV A;  1SA0 A;  3JAK A;  1MZE A;  1DGS A;  1BE3 H;  3HKE A;  4DV6 O;  1Y76 B;  4LF9 B;  3DC6 A;  4GX2 A;  3HB3 B;  5DM6 V;  5JH7 B;  5JQG A;  3I56 V;  5IE9 A;  1DK1 A;  1Q86 W;  3DGE A;  1KP3 A;  1HNZ O;  1TA8 A;  1AI7 A;  3CEI A;  4JI0 B;  3P32 A;  4J42 A;  1OCC B;  1IVS A;  1ZLZ A;  4JI0 O;  2Q68 A;  5L3D A;  3H1I H;  5LL6 Y;  3ZMU A;  4RQE A;  1P4R A;  1H2G A;  4MTX A;  4JAA A;  4B3M O;  3FYE B;  2WWW A;  4NB5 A;  2UXN A;  4NTW A;  3JAR B;  1R3L C;  4CZZ A;  4ABM A;  3CXC U;  1XI1 A;  4DRX A;  4ZIB A;  3SJQ C;  4UCV A;  3ABL B;  1J5E B;  3H1K H;  5L3F A;  1PKX A;  4CS4 A;  3T2M A;  4MTF A;  5LBQ A;  3NXS A;  1J5E O;  2P06 A;  1SKV A;  1PNM A;  2IH3 C;  2Q69 A;  3FB7 C;  4H44 B;  5J2T B;  5LYJ A;  3CWB H;  1AI4 A;  3F5T A;  5EBW C;  4DXW A;  1TUE B;  4FM2 A;  2Q7H A;  3ZX6 A;  1F23 A;  2H8P C;  4UV8 A;  3JAT A;  4LFA B;  3VBB A;  5HFL A;  5EK0 A;  4I50 A;  3VOU A;  2ADP A;  1LR1 A;  4QJF B;  4PA7 A;  1FJG B;  2LW7 A;  4LR3 A;  3RW0 A;  4PV1 B;  1UPG A;  4BWA A;  1FJG O;  1QHT A;  3CCR V;  1WA8 A;  4UCT A;  2EIN B;  3SPJ A;  2C2A A;  3E8F A;  1N33 B;  1XRE A;  5B5E Z;  2ARH A;  1PPJ H;  2Q6A A;  1VQP V;  2AHZ A;  3CCE V;  2CAZ C;  4OPH A;  3VQY A;  5IJ9 B;  2KG7 A;  1HR0 B;  3ZIA G;  2EIJ C;  5GTH Z;  5LGT A;  2DYS C;  4I55 B;  4LFB O;  4WFA V;  2B5U A;  3SJB C;  4HAM A;  1XEQ A;  2QE7 G;  3B8M A;  2UU9 B;  3DTU B;  2CE4 A;  3ETQ A;  3G6E V;  4JGS A;  3RWR D;  4Z1M G;  5CA0 B;  4XDJ A;  2UU9 O;  2HJD A;  3QVN A;  4TV9 A;  4XBF A;  3WG7 C;  4JI7 B;  2X6A A;  2V4D A;  3C90 A;  3HKB B;  1K97 A;  4HYO A;  1J95 A;  2F43 G;  4J9Z B;  1YIJ V;  4FMT A;  1IZ3 A;  5L3B A;  4IT5 A;  2QEX V;  4QPK A;  2F95 B;  2WA3 A;  2ZD9 A;  1YSC A;  3ZRW A;  3JAM N;  1NTM H;  5IWA O;  4GUN A;  3H01 A;  3ZRX A;  4HBN A;  4I5S A;  4DK1 A;  2GUZ B;  1N0N A;  5KX5 A;  1N34 B;  4ASU G;  5KHG A;  4FLZ A;  3ZMT A;  4DV3 B;  3K3W A;  3CCV V;  1G6U A;  1V55 B;  1V9P A;  1HW7 A;  3A8T A;  4GT1 A;  1E1R G;  3SGI A;  4N23 A;  3EFF K;  5LGN A;  1KB9 F;  3K0G A;  3W7S A;  1QU7 A;  4CC6 A;  5HFM A;  5LOV B;  3SPI A;  1WLE A;  3OGC C;  1M9N A;  4WFF A;  4UFZ A;  5BMV B;  1YEW A;  2LFR A;  4BW9 A;  3ZN0 A;  3DXR A;  5LXT B;  2K1E A;  2QJ1 A;  1NT2 B;  5CA1 B;  2EIL C;  2F66 C;  2A3Q A;  1K34 A;  4F6E A;  1WPX A;  2YIB A;  3CCJ V;  1M93 A;  3ABK C;  1JVM A;  3P30 A;  1YF2 A;  3RFR A;  2JIZ G;  1G1X B;  1OV9 A;  3OTF A;  2EJR A;  1XUQ A;  4MTG A;  2Y69 C;  5BZB A;  4YHH O;  1ORQ C;  3SPG A;  1SQQ H;  2ZE5 A;  5DED A;  1M57 C;  3JD1 A;  2IW5 A;  3OM3 B;  1IBL B;  1GK9 A;  4FLV A;  2IU3 A;  5EIB D;  2R72 A;  4O2B B;  3ICX A;  5CBG A;  1IXM A;  3JAW B;  4JZ2 A;  5FPO A;  1S0V A;  1GH6 A;  3ASN C;  2N04 A;  5JJN B;  1XL6 A;  3CRR A;  3RT3 C;  2AGA A;  2QWQ B;  4X62 B;  1Q6I A;  1YJN V;  4UVC A;  4O4L A;  4LC1 A;  4TOI A;  4U7N A;  5KHK A;  5KAI Z;  4X62 O;  2EUL A;  4MVQ A;  5B1B C;  2E75 B;  3UKM A;  2E74 B;  1RP3 B;  2GDS A;  3SYC A;  3APQ A;  1OCO B;  3AG4 B;  2JVD A;  3HKC A;  4JI4 B;  1JQ0 A;  3OUS A;  4XDL A;  3TET A;  4QE7 A;  5JJJ B;  4YJ3 A;  3CC4 V;  4FIP C;  3UO2 A;  2R9A A;  1GM9 A;  3AEI A;  5A2Q N;  3LNN A;  5GON B;  3E35 A;  1DF4 A;  1QBZ A;  1Y6X A;  2CGO A;  2HKO A;  4Z1V A;  4K8X A;  1NVP B;  1ZAU A;  4IYH A;  4FK5 C;  5IY5 B;  3T4Z A;  1IXB A;  2CDY A;  5LHH A;  2VS0 A;  1QQC A;  1YTF B;  4J41 A;  2UXB O;  4I0X A;  3S3X A;  3UO3 A;  2CH7 B;  2CK3 G;  3U0Z A;  1EN4 A;  1L0N H;  1CEZ A;  2QDO A;  2WA4 A;  1K4C C;  5KAF Z;  4LF8 B;  3H9V A;  4ZOL A;  4DV2 B;  4F4L A;  5CB4 B;  4LF8 O;  3RYI A;  4Z2W A;  4DV0 O;  4I4T A;  1AJP A;  4DV2 O;  5EBM C;  3FAV B;  1GM8 A;  3MDS A;  3OMI B;  5KMG A;  3W7U A;  1F4N A;  2BTQ B;  1NR7 A;  4PA3 A;  3ZS8 C;  2Z0A A;  3RYH B;  1F51 A;  3HPL C;  4YXW G;  5GW7 A;  2BTO A;  4CH4 A;  1JFF A;  1JMK C;  1CPY A;  4X1I B;  3LSU A;  4O2B A;  4X1K A;  4MVO A;  3ZJZ A;  1W2B U;  3BEH A;  4UCO A;  4IHJ A;  3SYO A;  4PDM A;  1VQ5 V;  2BCC H;  2WLK A;  1KUQ A;  4DO2 A;  1YI2 V;  4LF4 O;  1O9H A;  1MNG A;  4LWS A;  2VQE B;  1NTZ H;  5GTI Z;  4KUM A;  4F6R A;  2IJI A;  1AI6 A;  4B3R O;  5B3S B;  1F7Y A;  4O4I B;  4EB6 A;  2X0L A;  2UXD B;  4PD4 F;  2WSS G;  2WLI B;  2IJH A;  3P3P A;  2ETN A;  4IIJ B;  5IYC O;  3WFV A;  1VEW A;  2QWN B;  1AB3 A;  2E76 B;  4B3S B;  1Q3E A;  4U3F H;  1FAF A;  3OFN G;  3K5O A;  3ZRS A;  1WP8 A;  2X6B A;  1XQ8 A;  2HHH B;  4BIO A;  1WNS A;  3K03 A;  4JTA B;  3T1Y B;  2ADQ B;  1HNW B;  1BL8 A;  4U3J B;  4DR1 O;  2OCH A;  3T1Y O;  1R6N A;  5H6Q A;  4Q6G A;  1SQP H;  1SA0 B;  2O57 A;  1W0K G;  3JAK B;  3L75 H;  4CS2 A;  1JCH A;  2XT9 A;  5B1A B;  4BW5 A;  4LFC B;  2UUB O;  3HKE B;  2XOK G;  5H5N A;  1LUV A;  1GN4 A;  4LFC O;  3GWO A;  4NXN B;  5JQG B;  1WN7 A;  4J7Z A;  3THO A;  1IBM B;  2YIA A;  2KB1 A;  1IBM O;  5BR8 B;  2R9R B;  1W59 A;  1CP9 A;  4BAY A;  2RNB A;  3JSL A;  4X65 B;  2FB5 A;  2R9I A;  1BT8 A;  4FLW A;  4X65 O;  4P2Z A;  2BSK A;  1XOU A;  3SPH A;  2QGN A;  1I5X A;  1S77 D;  2ZXW B;  5LA6 A;  2UXX A;  3N2G A;  4DRX B;  2D3O W;  1H38 A;  2UXC O;  2GTA A;  2QWR B;  3CRQ A;  4CBC A;  4JAV A;  3OTO B;  1N32 B;  2IJK A;  3SJC C;  1N36 B;  2OCC C;  1M90 W;  3K57 A;  3J80 N;  1N32 O;  3OMA B;  3T1C A;  5LYJ B;  1N36 O;  1I94 O;  3ZRV A;  2PYL A;  1KU9 A;  3ZED A;  4H0L B;  4X66 B;  3WB1 A;  5CA3 A;  3JD4 A;  1GN6 A;  3IFX A;  1S5J A;  3OEH G;  4I9W A;  4X66 O;  3JAT B;  1QNM A;  5KHJ A;  3OT7 A;  1NH2 D;  2UUA B;  3CRA A;  4I50 B;  1VF7 A;  4O4H A;  2JRI A;  3D36 A;  2UUA O;  4YIO A;  1VQ7 V;  4JAU A;  3A2F A;  5LHG A;  5LMN O;  4LF6 B;  3ZHU A;  1AJQ A;  2Y48 A;  3L70 H;  4GX0 A;  4DR5 B;  1OCZ C;  1RSO A;  2GHY A;  2NR5 A;  1K73 W;  3DC5 A;  4RQF A;  2YDE A;  4GKJ O;  3G71 V;  1N0J A;  1XHX A;  4YIP A;  1RM1 C;  2Q4P A;  4JI1 B;  1VQ8 V;  2LGQ A;  2KG7 B;  2QWO B;  4JI3 O;  4R8C A;  1VQN V;  2Y0I A;  3T1H O;  4JI1 O;  1XNR O;  3CXH F;  2RCV A;  3I55 V;  4I7Z B;  1H8E G;  5DN6 G;  3ZHV A;  5LGU A;  3KCX A;  1Y74 A;  1U96 A;  2PF4 E;  4R6Z A;  5B1O A;  1HNZ B;  1PNL A;  4RWU A;  1XL4 A;  2EIJ B;  4TV9 B;  2DYS B;  1K33 A;  5LP6 C;  3C3T A;  1L8D A;  3K5N A;  1IUR A;  2V7Q G;  1UJW B;  3A0R A;  5H2F Z;  4K8Z A;  3ZRW B;  4B3M B;  3JD0 A;  4JV5 O;  1I0H A;  2XAJ A;  1TUB A;  3ZMS A;  1U97 A;  5KX5 B;  1B3Q A;  5LP6 A;  2HP8 A;  2MW2 B;  1O9G A;  1YXB A;  2JGD A;  5TIS Z;  4X88 A;  3NR7 A;  2Q7G A;  1BZK A;  3ETG A;  1DF5 A;  4UVA A;  3FB5 C;  3JSN A;  3E8B A;  1VQK V;  1GO3 F;  3QG5 A;  1EBO A;  2QKS A;  2YSU B;  1YDX A;  4K35 A;  1Q90 D;  4TUY A;  1D2D A;  4CC5 A;  3FB6 C;  4LH7 A;  4QGP A;  3DXR B;  4X8A A;  5LHI A;  1H2K A;  4BIZ A;  3AG1 B;  2ZIN A;  3L71 H;  3SYA A;  2DOS A;  3K0D A;  4QNH B;  4MVS A;  1AVM A;  3ETD A;  2YS8 A;  4YJ2 A;  4AQY B;  4JAS A;  1OHH G;  3OD4 A;  2W0X A;  1AR4 A;  1D5A A;  3GVM A;  4FLY A;  4AQY O;  1AJN A;  1TVK A;  2EIL B;  2EIM C;  2HG5 C;  1TAE A;  1THZ A;  3ZHQ A;  1ZL8 A;  2EZO A;  4O2A A;  5FLX N;  3ABK B;  2E5L O;  1NZ6 A;  3J81 N;  3TXQ A;  1MAB G;  5C93 A;  2Y69 B;  4LFB B;  1W0J G;  3J7A U;  2ITD C;  3EXA A;  1XIL A;  1M57 B;  2JGU A;  2QKA A;  4MW8 A;  5K1X A;  4JYB A;  3BHP A;  2OIG A;  3M7M X;  1ROP A;  4DV4 B;  1JPX A;  1BSM A;  4O4L B;  4P9P A;  5C8Y A;  3ASN B;  4DV4 O;  5EYP A;  3CCU V;  2A7W A;  2BOB C;  2CGN A;  5JCO C;  4KFM A;  2FKX A;  1N8R W;  1WB7 A;  3HKC B;  3D8C A;  3R65 A;  2YEV A;  3K5M A;  4RUF A;  5CN0 A;  1SZX A;  3FB8 C;  5B1B B;  3W7X A;  4YJ3 B;  2YXY A;  5IWA B;  4GLX A;  4PI2 A;  3MHS C;  4OPA A;  4QPJ A;  5KA5 A;  5JCO A;  1AR1 B;  3CP1 A;  4TSF G;  4MVZ A;  1MA1 A;  3K79 A;  2R70 A;  2K9P A;  1BHA A;  3MD0 A;  3E2E A;  1EN5 A;  3CB2 A;  3ASO B;  4NVP A;  4L87 A;  2A9H A;  2BE3 A;  4I0X B;  2QM8 A;  4NXM B;  1VIB A;  2IJJ A;  4AI8 A;  1EZV H;  2YI8 A;  3ABL C;  2QR4 A;  2OT5 A;  4K3A A;  4NXM O;  4MW3 A;  2IBZ H;  5CBH A;  3UT5 A;  1S76 D;  5IYZ A;  4ZOL B;  3E86 A;  3RYI B;  4I4T B;  2HJF C;  2JEX A;  2MK3 A;  4JI5 O;  1EM1 A;  4DR7 O;  1A32 A;  2PGG A;  4FZ0 A;  5KMG B;  4FLX A;  2H94 A;  5JVD A;  1ZX3 A;  3BY6 A;  4JI8 B;  2PY5 A;  4BIU A;  4FLU A;  4YHH B;  3SR2 C;  1XMQ O;  3B4S A;  4JI8 O;  1VF5 B;  1JFF B;  1FFX A;  3K5L A;  2OTJ V;  4U7O A;  4JPR A;  2CUG A;  2EIK C;  4X1K B;  4DV5 O;  3L73 H;  1K3E A;  2AW9 A;  4EKW A;  4LNU A;  2ZE8 A;  2LQT A;  4IHJ B;  3JYC A;  4PEL A;  3CME V;  4X20 A;  1JJ2 U;  2F93 B;  4B7K A;  2Q0A A;  5ITZ A;  3HKD A;  3TGU H;  1VF6 C;  3FKS G;  5IYB O;  5D5Q A;  2Q67 A;  4LWS B;  1B06 A;  3HR0 A;  1GKF A;  4F6R B;  2E3C A;  3CYO A;  3AG2 C;  1VF6 A;  2ZR3 A;  1F4M A;  2P90 A;  2PI4 A;  2WLH A;  3SPC A;  1RPO A;  4EB6 B;  3MHH C;  1X59 A;  1DLB A;  4PDL A;  2Y4T A;  3E83 A;  4DR3 O;  3ABM C;  2AHY A;  3F7V C;  1RPR A;  4J7J A;  4NKG B;  1TGO A;  3ML0 A;  1K92 A;  3ZHR A;  2WLN A;  1MSD A;  4DV7 B;  2Q8V A;  1SC5 B;  4FLT A;  2DQ3 A;  1MOF A;  2P7T C;  4DV7 O;  2CTR A;  4NTY A;  4AHC A;  3CCQ V;  4IYI A;  3T4D A;  5LMU B;  4EFE A;  1RFY A;  2UXB B;  5LMU O;  2HVJ C;  2JK5 C;  1V55 C;  1KYO F;  1Q6U A;  4GZR B;  2F23 A;  1VMG A;  2RJZ A;  5BY1 A;  1NBM G;  3RYC B;  1MSW D;  2IM9 A;  4ICG A;  4DV0 B;  3QNE A;  1XNQ B;  1KMI Z;  3E22 A;  2IH1 C;  4UUJ C;  2P67 A;  1SQB H;  3CRM A;  3A0B Z;  4O4J A;  2DWE C;  1XNQ O;  3OEE G;  4DR2 B;  3FYI B;  3RVY A;  5B1N A;  4WCE V;  2NNU A;  3E8H A;  4EEQ A;  4DR2 O;  3CX5 F;  1FFT B;  1H2N A;  3ETE A;  4TV8 A;  1ZSP A;  3QF7 A;  1M5I A;  2ZIM A;  2D2C B;  4J11 A;  3X2Q C;  2PYJ A;  2BSK B;  2DN9 A;  1HNX B;  2YXL A;  5LA6 B;  2A79 B;  3N2G B;  3AK2 A;  2BOC C;  1HNX O;  4H13 B;  2LW1 A;  1GRJ A;  1IDS A;  1X4T A;  4WFH A;  2EJ7 A;  3BRC A;  4LF4 B;  4JYA B;  4UXN A;  2VWK A;  5A9G A;  1PM9 A;  1OJH A;  4B3T B;  4JYA O;  1PD3 A;  1BQZ A;  3TJT A;  2FTK A;  4RAI A;  3OR7 C;  1XHZ A;  4B3T O;  5KLV H;  1FD9 A;  2QKC A;  4OGQ B;  2LP7 A;  3K06 A;  4G27 B;  2XAQ A;  1Z5V A;  1AP6 A;  2OCC B;  4B3R B;  1Q5O A;  1FYJ A;  5CMU A;  5L3C A;  1P7B A;  1OCR C;  2A0L A;  3QO7 A;  1E1Q G;  1GM7 A;  5IDJ A;  4O4H B;  2RN9 A;  2FML A;  3B09 A;  3ZHS A;  5EC1 C;  3STZ C;  3M8A A;  1V54 C;  2LJ2 A;  1I5Y A;  1K4D C;  4G2K A;  2P4K A;  2WLJ A;  1RSO B;  3QO5 A;  3JCZ A;  2P4V A;  4DR1 B;  4ZI7 A;  1SF9 A;  3CD6 V;  2WPD G;  1COW G;  3BA8 A;  1K5S A;  1H2L A;  2UUB B;  5J9P C;  1OCZ B;  3L72 H;  1PL4 A;  3BPZ A;  3BAA A;  2HFE C;  2M7W A;  1SQF A;  1Y74 B;  4JZG A;  3VQW A;  3IC9 A;  3OR6 C;  1S5L Z;  2CTP A;  3RYC A;  4LF5 O;  2HEP A;  3Q4H A;  2PTM A;  5E79 Z;  3SYQ A;  2QSA A;  1AP5 A;  4DV1 B;  1YVW A;  5KHI A;  1GN3 A;  2JJ1 G;  2HR3 A;  4DV1 O;  2W6J G;  1BS3 A;  2NN4 A;  1OZ0 A;  3L74 H;  3TK1 A;  3WB2 A;  1EN6 A;  1PP9 H;  3K58 A;  1Y67 A;  3CSX A;  4JTC B;  5F2V O;  1Q81 W;  5IJ0 A;  1TUB B;  1ENV A;  5LP6 B;  2EX3 A;  1HP8 A;  2JGD B;  3CJH A;  2OWO A;  3JAL A;  2UXC B;  4X9Q A;  1GMG A;  2XUM A;  3KCY A;  1Z5W A;  4AIL C;  1Q43 A;  1R6T A;  2ZE6 A;  1LNQ A;  4DW0 A;  1SER A;  1YCI A;  4WFG A;  2ZE7 A;  3N2K A;  4PA4 A;  4CH3 A;  2FL4 A;  1I94 B;  4TUY B;  2VWJ A;  3D3I A;  3N27 A;  3QO8 A;  5FNV A;  2F4V O;  3B8N A;  3K04 A;  2ZDI C;  3I5D A;  5B66 Z;  1P7G A;  2B1I A;  2DW4 A;  4JTD B;  3H1H H;  4G28 B;  2JJ2 G;  2UUC O;  1SZT A;  2WLM A;  1KBH A;  2ZDI A;  4YJ2 B;  1EFR G;  1UFI A;  4KHP O;  1I7F A;  4DR6 B;  1M56 C;  1TVK B;  4XDK A;  2ILM A;  5LMN B;  1S3J A;  1MMM A;  4FM0 A;  1SQG A;  3DSQ A;  4DR6 O;  1JX9 A;  3JCU Z;  3RYF A;  1P84 F;  5E1A C;  2Q5Z A;  3KG2 A;  4UCU A;  1AR5 A;  1MZF A;  1ZL8 B;  4O2A B;  4GKJ B;  4R7C A;  1YJ9 V;  4PA9 A;  1VQ4 V;  2EIM B;  5L3G A;  4MVU A;  4JI3 B;  1NS1 A;  2ZM6 B;  3T1H B;  1XNR B;  3BCC H;  4WBN B;  2KSD A;  1QLE C;  4CH6 A;  1VQL V;  2ZM6 O;  4HNA A;  2WLL A;  3IJ4 A;  3QTC A;  5C8Y B;  1YZB A;  4H37 A;  5EYP B;  4OX9 O;  3E8G A;  2Y4U A;  5J2U B;  1PL0 A;  3AG3 C;  5KUM A;  1VP7 A;  2YEV B;  3H1L H;  1H8H G;  4JV5 B;  2DQ0 A;  3SYP A;  2CTQ A;  3H1J H;  3GWK C;  2PUS A;  3WG7 B;  4LF9 O;  2OTL V;  3O9O A;  2XHB A;  3ZN1 A;  2IU0 A;  1VQO V;  4E4E A;  3CS5 A;  3U10 A;  3F7Y C;  4X89 A;  3OUF A;  1QLN A;  4JYC A;  2ZXW C;  4FZ1 A;  2ITC C;  3B77 A;  4CS3 A;  4MT8 A;  1R1B A;  1KQS U;  2DYR C;  4PDR A;  3UT5 B;  2L35 A;  4MSW C;  5IYZ B;  1Q6H A;  1QCE A;  1R3I C;  4D7S A;  1K5Q A;  2DJV A;  4UB8 Z;  3W7T A;  3ZMV A;  2KQX A;  3OAA G;  3LDC A;  3UCS C;  1SS3 A;  1FXK C;  1FXV A;  5D5P A;  5JVD B;  3TCU A;  2QA4 V;  5H6R A;  1NI8 A;  2B1G A;  1YJW V;  3LUT B;  3VQX A;  5IYD O;  1FS0 G;  1SRY A;  5JJE B;  1FFX B;  3EVK A;  2GBO A;  2E5L B;  1FXK A;  3K59 A;  2PZS A;  4LNU B;  4LFA O;  1NVP D;  3ZHT A;  4YY3 B;  4GCZ A;  1QR9 A;  3CC2 V;  3UQ8 A;  4X20 B;  3CRC A;  4WBN A;  4YY3 O;  5ITZ B;  3HKD B;  1YTF D;  2AXT Z;  2EIK B;  4QE9 A;  4KP4 A;  4FFB A;  2Q9L A;  2A06 H;  4TQF A;  4X1Y A;  3WU2 Z;  1N4C A;  4B08 A;  1YIT V;  3G80 A;  4JF3 A;  2YXH A;  2ZKO A;  3CCM V;  1WPB A;  4FPP A;  4ZHQ A;  1N33 O;  2FYU H;  4LBE C;  1CXZ B;  2P22 C;  1B04 A;  5J2U A;  2Z3Y A;  4E2L A;  4WF9 V;  2N74 A;  3BFR A;  2ZT9 B;  3AG7 A;  3ZBH A;  1HR0 O;  1Y76 A;  1H2M A;  1OCC C;  1VQM V;  3AG2 B;  3M99 B;  2DWD C;  2XND G;  5JH7 A;  4K0K B;  3OW2 U;  5JWP A;  3ABM B;  2X7R B;  1EZJ A;  5EZY B;  4K0K O;  1NH2 B;  2V1D A;  4JI7 O;  4UV9 A;  3SDL A;  4FFK A;  3CPW U;  4J7K A;  3C3S A;  1NU1 H;  5KHH A;  3B40 A;  1FKA O;  1H2S B;  3OE7 G;  3E89 A;  2ODM A;  1N34 O;  3JAR A;  2OIE A;  4HZ3 A;  4RO2 A;  1PNK A;  4LF7 B;  4NTX A;  4DYL A;  2XTA A;  4JI5 B;  2LGW A;  4DR7 B;  3E22 B;  4NYK A;  2PI5 A;  4LF7 O;  1NKD A;  4DV3 O;  3JD3 A;  3AG1 C;  4O4J B;  4LH6 A;  4QIW F;  1WB8 A;  2GTS A;  3W7W A;  2B9Z A;  5J2T A;  4WFE A;  2HLD G;  1KC8 W;  3RVZ A;  1GTO A;  3PN1 A;  1XMQ B;  1NJI W;  1QVF U;  5CBF A;  4TV8 B;  5KUK A;  2GSM B;  2W6I G;  4DV5 B;  3R66 A;  4N21 A;  1BMF G;  1K8A W;  4FVM A;  3CCL V;  3X2Q B;  2EIN C;  4BR6 A;  2OYQ A;  1Y4M A;  4X64 B;  4PJ0 Z;  2XAS A;  4UCS A;  2QWP B;  4P9O A;  3IC7 A;  4X64 O;  4R50 A;  3L9D A;  4MTO A;  4NR1 A;  1NQT A;  1IBL O;  2ZNI A;  2ZNJ A;  2YUA A;  4LCU C;  3LSS A;  2QTO A;  1B6Q A;  3BVO A;  3BA9 A;  4J10 A;  1US6 A;  4DR3 B;  4CH5 A;  5IJ9 A;  1S5H C;  1BCC H;  4I55 A;  3CE2 A;  3CHX A;  1NR1 A;  3RN4 A;  1GAX A;  1KP2 A;  1HDJ A;  5CA0 A;  3RBZ A;  1OCR B;  1ZUQ A;  1QVG U;  3HKB A;  5EZY A;  4A5U B;  3K9A A;  1V54 B;  3CMA V;  4ZI7 B;  3CC7 V;  2YC0 A;  4C7U A;  4JI4 O;  2RMK B; 
#chains in the Genus database with same CATH homology
 4NKG B;  4DYL A;  1US6 A;  2HJD A;  1RFY A;  1CXZ B;  4IGG A;  1UPG A;  2RMK B;  1URF A;  2Q0O C;  4NB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...