1RFYA

Crystal structure of quorum-sensing antiactivator tram
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
89
structure length
89
Chain Sequence
KKVELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEMHAQMSALNTLISILGFIPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional repressor traM
publication title Quorum-sensing antiactivator TraM forms a dimer that dissociates to inhibit TraR
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transcription
total genus 33
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09228 Prok-TraM Prokaryotic Transcriptional repressor TraM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1rfyA00
1CXZB 2HJDA 1US6A 2RMKB 4DYLA 1RFYA 1URFA 1UPGA 2Q0OC 4NKGB 4NB5A 4IGGA
chains in the Genus database with same CATH superfamily
2AHYA 3L74H 1N33B 1NTKH 3WFVA 4OX9B 3KG2A 4DUZO 2OIGA 3UM7A 2JGUA 4LF9B 3U11A 3IC7A 3OAAG 3ZHSA 5JJJB 4IL6Z 1VEWA 5IYBO 2OT5A 4X1YB 5GTHZ 4CC5A 1H2KA 4J80A 1Q82W 1Q81W 2DWDC 3KCYA 4W4KA 1XHXA 1FD9A 2Z0AA 2WPDG 4KXRA 1JFFB 5KHIA 4HNAB 2BTQA 3OEHG 2E5LB 1FJGB 2W6JG 3ABTA 1QNMA 5LHHA 5LOVA 3W7WA 1Y66A 3ASNC 4TQFA 5FPOA 1N32B 3BRCA 4LBEC 5KLVH 1A32A 1G8MA 5DN6G 4IIJB 3ZMUA 1L0LH 1JX9A 1ZUQA 1OCOB 4EB6B 1NZ6A 1WPBA 3SPIA 1US6A 1RSOA 1SETA 3ZHVA 3J81N 2RQ6A 3BHPA 2YEVB 1W59A 3FFQA 1OCRB 2QA4V 4H44B 1YIJV 1OCZC 4FM0A 5J2UB 3UO2A 3B8NA 1GMGA 4UCUA 4HZ3A 5IJ0A 1VQOV 2RN9A 5FL7G 3B4SA 3KZIZ 4JYBA 4I50A 3ETEA 4J7JA 4ZHQA 2PZSA 4G27B 3U0ZA 5L3GA 3CCLV 4JAVA 3JCUZ 3WB2A 2QTOA 2JK5C 1QCEA 2P67A 2NNUA 4B3MB 5IT9N 4LR3A 4UVAA 2XAFA 4RO2A 1NVPB 1VQKV 1N36O 1H38A 4KFMA 2DYRC 5JVDB 3W7TA 4N23A 4LFCB 2BTQB 2JIZG 5A9GA 4DR1B 2QWQB 3MHHC 2ZXWC 3JALA 1K5QA 4EKWA 4JI1O 3D36C 1S76D 4DV1B 1Q6IA 1YITV 4X62O 4JI7O 4MSWC 3JYCA 2RDCA 2X7RB 4FFKA 1IBKO 2Q0AA 1RSOB 4W4LA 3P32A 2ZQMA 3ZIAG 4B3TB 3C90A 4NXNB 3DGEA 4QE7A 2H3OA 1K7DA 1GM8A 2Y4UA 2ZNIA 3K06A 4RUEA 3X2QB 4NXMO 4GLXA 4Z1VA 2QWNB 1DF4A 1TVKB 4FLWA 2EINC 3OTOB 5B5EZ 2XTAA 2E75B 5FLXN 4WFEA 2A9HA 3RN4A 4JAUA 2IJJA 1AJPA 5H6RA 2ODMA 4JI8O 4D7SA 5TISZ 2ZKOA 2HP8A 3JAKB 4UCRA 3ABKB 5IWAB 3H9VA 2EZOA 2UUAO 5EC1C 3BPZA 1PL0A 2WLLB 4JAAA 5L3BA 5E79Z 1AR1B 1JA8A 1MSDA 2A3QA 2LP7A 3RT3C 2Y69B 4LFAB 2EIMB 2OYQA 2Q73A 1R1BA 1M90W 3A0RA 3JALB 2CK3G 1NJIW 2YICA 1QHTA 2VRZA 3ZRVA 4GX2A 2Z5UA 3CMAV 2Q69A 2UUBB 1YSCA 3FB6C 1B6QA 4N21A 2A0LA 2L6LA 3QNEA 1YJNV 4TWKA 4F4LA 2AZ2A 2Q68A 3CEIA 4H33A 4NKGB 4AILC 5ITZB 5KAFZ 1S3JA 3IAYA 1PV0A 1J5EO 4CH6A 1KU9A 5KMGB 5EIBC 2H94A 3CCUV 2YI9A 1EZVH 4I0XB 1PD3A 1VF6C 1RFYA 1SZTA 4J42A 2A79B 3JASB 3G4SV 1TUBB 1K3EA 2EIKB 1K33A 1K92A 3H1HH 2P7TC 4JI3O 3L70H 3K04A 4J10A 3ABMB 1Q3EA 4DV0O 4L8JA 4PDVA 5B1BB 2WLJA 2Q0OC 4DW1A 3D3IA 4FVMA 4KHPO 4CS3A 1GH6A 1Z2GA 5GW7A 3B2EE 2V7QG 4YY3B 3FYEB 1ZX3A 3EXAA 2YXLA 2ZE5A 4JTDB 1DF5A 4ZI7A 1O9GA 4BAYA 3ASOB 1HNZB 2WA4A 3N2KA 5CBFA 1YF2A 1ZLZA 3BAAA 2XASA 3FKSG 4B3TO 5JQGB 3AG2C 2X6BA 2CH7A 4H37A 3ZHQA 1GTOA 2LQTA 3FYIB 1OCCB 3OD4A 4TQDA 4XDJA 3QO8A 1IDSA 3E22B 4GX1A 3AK2A 4TV8A 1FXHA 1WP8A 3HKDA 3W7XA 1H2LA 4PDLA 4RWUA 2XHBA 1GN2A 3AK1A 1U96A 4K0KO 2F4VO 1AI7A 3OUSA 1IBMB 4YJ3B 4FZ0A 4LP8A 3DC6A 4X65B 2DOSA 4JTAB 3G71V 1BS3A 4DR5B 4YIPA 1I94O 2YIBA 3SPGA 1R3LC 3LDCA 3CC7V 4X66B 3T1HB 4LF4O 5KHHA 1XL6A 2WWWA 1N0JA 1K34A 3FB5C 4CH3A 3C3SA 5FPRA 1GM9A 3Q4HA 1JCHA 2UUBO 4I7ZB 4MTGA 2VS0A 2EJRA 3IGAC 4JI6O 4ZI7B 1SRYA 3SJCC 3CJHA 4FLYA 1SESA 2WLHA 3G6EV 1AB3A 1YXBA 1H2NA 1XILA 4MTFA 3N2GA 1SF9A 4GKJO 3AG4B 1VQLV 3SDLA 4DR7O 3CRMA 1SA0A 4TT3G 1E1RG 1R3JC 3APOA 1S77D 2Q5ZA 2PUSA 4LFBO 1HWYA 4LF5B 3HKDB 1KMIZ 1FXKC 1OV9A 2JRIA 4DR3O 3E8FA 4YHHB 1FYJA 2UU9B 3FB7C 2XUMA 3HKCB 4X1KA 4DR2O 3HB3B 5CB4B 3AG3B 2E76B 4JYAO 3N27A 2DQ3A 4YJ2B 3EVKA 3VQXA 3VBBA 3CCEV 3QF7A 2IU3A 5EBMC 3ETDA 1Y74A 1VQ7V 2DQ0A 4DRXB 1Q6UA 3HKBB 3JAMN 3CMEV 2NN4A 4O4IB 4DUZB 4U3JB 4X20A 5J2TA 3CRCA 1FXKA 1E1QG 3ZBHA 4FPPA 4X88A 5E1AC 1Y76A 4RUFA 1FFXB 2AZ0A 1KECA 3RYIB 4OGQB 2DE0X 2UXDO 2NR5A 4FZ1A 3D3QA 3FAVA 1ZSPA 2ZE8A 1G1XB 1EN4A 5B1AC 1HP8A 1WA8B 3SYCA 3ETQA 2DYSB 4FK5C 3E2EA 1KB9F 2QE7G 2UXBO 3STLC 1M57B 2ZIOA 1WN7A 4MW8A 4MVMA 4WBNA 4AI8A 3LDDA 3T1YO 3RW0A 2QSAA 2PYLA 1P7GA 5EIBD 4DV6O 1R3IC 3IJ4A 1R3KC 1ZL8A 2LW7A 1OCOC 3ZHTA 3J7AU 4JI0O 2CE4A 1Y74B 4X1YA 1OCRC 2VWKA 1BSMA 3K5LA 4IHJB 3OMNB 2Y48A 4X20B 4X64O 3K5NA 1S5HC 1X4TA 1JFFA 3HR0A 2BSKA 4X89A 3W7SA 3WG7B 4NR1A 4J7ZA 4BIUA 4BWAA 1JR9A 1VF5B 3RVYA 2YI8A 2Q7EA 4HYOA 4ZOLB 4LF5O 2OCHA 1N36B 4J11A 3L75H 4IIJA 5L3CA 5CBGA 1XOUA 5EC2C 1VQ8V 1O9HA 2JVDA 1I7FA 5KAIZ 4DK1A 2YIBD 4EB6A 4DV4O 3KKYA 1UFIA 3LNMB 5EK0A 5JH7B 2ETNA 3SJAC 3R66A 4I9WA 3K9AA 1KP3A 2YEVA 3K0DA 4JI1B 2V4DA 4PELA 1HW7A 5FNVB 4X62B 4JI7B 4B3RO 4UVBA 3T1CA 5J2UA 4MVUA 2ADQB 1Q7YW 4E4EA 1IBKB 1XNRO 5C93A 1ENVA 1H8HG 1QU7A 3ZHRA 1YJ9V 2L35A 1KKCA 1EN5A 5CA3A 2KSDA 2OCCB 3TGUH 1AR5A 5BY1A 4RQFA 1ZL8B 2XAQA 3OGCC 1H2SB 1V9PA 4NXMB 5IYZB 4P9PA 1SQBH 3AEIA 3CXCU 3UKMA 3M7MX 3L71H 3EFFK 5JVDA 2CDYA 3QVNA 3STZC 1F23A 3X2QC 1R6TA 4JI8B 2BSKB 1XHZA 3ZRXA 2FL4A 2ZCEA 5B1OA 1OHHG 4DR6O 5KHGA 3G67A 2UUAB 1F51A 2DN9A 2X0LA 3JAWB 3RYHA 4GKKO 1Q90D 3CCJV 3O65A 4TV9B 5IDJA 3B77A 5EYPA 2ZT9B 3ABKC 1SQVH 5LMNO 2BE3A 4DV5O 2JJ2G 4C7UA 1PNLA 5L3EA 4IYIA 4LF8O 3ZRSA 2QM8A 1JJOA 1T5EA 1KUQA 1URFA 4DV3O 2Y69C 2EIMC 3JATA 2EX3A 4AHCA 4QIWF 1NR7A 2CGNA 5CA0B 1TVKA 2IBZH 2OTLV 2DW4A 5GTIZ 1K8AW 1J5EB 4MVRA 3BCCH 1SERA 3S3XA 1K9MW 2P4VA 4MT8A 3BVOA 4LWSB 4O2BB 4PI2A 2EIJB 2BOBC 3SR2C 3JAKA 5IY5B 2Q6AA 2YIAA 3JSNA 2PI4A 4JI3B 1GN3A 3QTCA 2WLLA 3CPWU 4DV0B 2O57A 4CZZA 2B5UA 4LH6A 4D7TA 2EIKC 4KHPB 4K35A 3CWBH 4D6TH 4TUYA 3ABMC 2P6JA 4F6EA 3AG1C 3C3TA 3RYHB 5B1BC 1M4UA 2QTSA 2ZNJA 2UXCO 5EYPB 2R9RB 3QO5A 1TUEB 4FM1A 2YUAA 5ITZA 4KP4A 1XREA 2JDIG 5LGNA 2B1IA 5KMGA 5H6QA 2ZD9A 2XAGA 1EBOA 3JATB 4I0XA 1JOYA 1NH2B 3JASA 1PM9A 4TSFG 1TUBA 3B09A 5D5QA 5A2QN 3VQWA 3RYFB 3SYQA 1UPGA 1OCCC 2ZDIC 2WLKA 4K0KB 2F4VB 1P4RA 1GM7A 2FB5A 2E3CA 3OT7A 3SGIA 2XAHA 1YTFB 3JARB 1XDCA 1XMQO 2KQXA 2UXNA 4BW5A 2QKCA 4K8ZA 4CS2A 1GN6A 1DK1A 4CH5A 4NTXA 4UCVA 1N8RW 1I94B 2VQEO 2CTPA 2JEUA 2N05A 4LF4B 3M99B 4B7KA 4PD4F 5CN0A 2IJHA 4RAIA 1K4CC 5KHJA 4TUYB 2G38A 1I0HA 3VQYA 4O4JB 1Q6HA 5JQGA 3F5TA 2WAMA 4JI6B 4JTCB 2ZDIA 1BCCH 4DO2A 3HPLC 2QR4A 3T4DA 4LF6B 4MTOA 2ZE7A 5BMVB 5BXZA 3E22A 1UJWB 4GKJB 5IJ9A 4DR7B 2ITCC 2DWEC 4JI4O 5BR8O 3K3WA 2CUGA 1NVPD 1N4CA 4JZ2A 2RJZA 4YJ3A 4CH4A 4I5SA 1I5XA 1PNMA 1LUVA 4LFBB 5CA1A 4P30A 3K03A 3B8MA 3LNNA 3AG4C 4BIOA 1S72V 1S5LZ 1BL8A 1WPXA 3VOUA 4ZKIA 4TOIA 1BE3H 3FD9A 3JD1A 1GAXA 1YJWV 3K5MA 1QR9A 4DR3B 5LP6B 1SQQH 1M5IA 3CCVV 4U7OA 3AG7A 5LGTA 1MOFA 4DR2B 1YEWA 3UT5B 3K58A 4JYAB 4Z2WA 4GUNA 2EJ7A 3OM3B 4E2LA 4UCOA 2F93B 4EFEA 2X6CA 4LCUC 4LNUB 3DSQA 1JVMA 1HNXO 3P3PA 3AG3C 1XNQO 2MK3A 2GBOA 2KB1A 1XBLA 3E83A 4LF7O 1IXMA 4BR6A 4GZRB 2GDSA 1MZFA 1RPOA 5LYJB 2PF4E 4ZBMA 2ZM6O 3ABLB 2B1GA 3O9OA 2QWPB 2UXDB 3ZCCA 5IJ9B 2Q67A 1KP2A 4DUYO 3HKEB 4L87A 3BEHA 4DV2O 2VWJA 2EBOA 5CA1B 2GTSA 3HKCA 5D5PA 1KC8W 2GHYA 3R65A 5AG2A 4MW3A 5CB4A 2UXBB 2F1MA 1WNSA 1Q5OA 4YJ2A 3OR6C 3WU2Z 5B66Z 2WLMA 2W6IG 1XL4A 3S3WA 3CCMV 3T1YB 4CS4A 4JV5O 4I9QA 5LMUO 2DYSC 3ZRWB 4PI0A 1RP3B 2FTKA 4DRXA 1M57C 4DV6B 3HKBA 1VF7A 1N34O 3H1KH 3FB8C 4O4IA 3MD0A 4U3JA 3OTFA 1U97A 1H8EG 3D8CA 1V54B 4JI0B 4FLZA 2PGGA 4U3FH 4LF6O 1FFXA 1B06A 1Y67A 2Z3YA 2LJ2A 4QGPA 3A2FA 2JGDB 2QM4A 3RYIA 5EBLC 3WB1A 3KCXA 2Y0PA 4KUMA 4X64B 1QLEB 3RVZA 5GONB 5H9CA 2P06A 3SPJA 3EHBB 1WA8A 5B3SC 4EFBA 4PHZA 4HAMA 4H13B 3H1LH 2R70A 2JS5A 3WG7C 3JD2A 1SQFA 3BFRA 3BA9A 4PA7A 4DV4B 1SKVA 3LSSA 3CCQV 1ZWIC 1ZTEA 2YXHA 3RGBA 1NU1H 1SZXA 3H1JH 1WJZA 2WLIB 2H8PC 1IVSA 1L8DA 4B3RB 3H1IH 1NT2B 4FFBB 3F7VC 1VARA 4WF9V 1MG1A 1XNRB 4LC1A 2E74B 4DR4O 3E35A 3DTUB 4EEQA 4IHJA 3ABUA 5L3DA 4B08A 4PV1B 4UB6Z 2P4KA 1GKFA 1D5AA 1BHAA 3L72H 2OCCC 5C8YB 3ZMSA 4WFGA 5LBQA 1F4NA 1BQ0A 3CB2A 4ZOLA 4BW9A 2AW9A 1Y4MA 4WFBV 2BCCH 1S0VA 1DGSA 1W0JG 3ML0A 2BOCC 3G80A 1XEQA 1L1FA 1F7YA 1QVGU 3SYOA 4DR6B 5JH7A 2PI5A 1COWG 2M7WA 5LHGA 4GX5A 4UUJC 4GKKB 3JCZA 5FNVA 2OWOA 1P7BA 3ZX6A 2GTAA 1K97A 5LMNB 3ZN1A 4DV5B 4HBNA 2XAJA 2P5OA 4QNHB 3GB7C 4LF8B 3MDSA 4DV3B 2LO1A 2YXYA 3FX7A 1HR0O 4UV8A 4GX0A 2HG5C 3K5OA 5IYZA 1AP6A 2M6YA 3BABA 1XMOO 1AVMA 1IBLO 1NTZH 3DXRB 1AI4A 4UVCA 2W0XA 1K5SA 5EZYB 3T4ZA 1KYOF 1KKDA 1V55B 1G4YB 2UUCO 1S5JA 1K73W 3VQVA 3CSXA 1AI6A 4ABMA 1ORQC 2IW5A 3JAWA 4CBCA 2EIJC 2Y0IA 4I55A 4BIZA 4TV9A 2RCVA 1KBHA 1WAZA 2HJDA 4O4HB 4PA9A 2LFSA 1PPJH 2LW1A 4JYCA 1I5YA 4QPJA 4ICGA 1W0KG 5LA6B 2HEPA 4QE9A 3ZHUA 3CCSV 1NQTA 3OUFA 2UXCB 1AROP 4B7EA 4JF3A 4JI5O 2RNBA 4PJ0Z 5CA0A 4UV9A 2R72A 1BGYH 1XQ8A 2UXXA 4X1IA 5K1XA 4PDRA 1RPRA 4LWSA 4O2BA 2HKOA 1ZAUA 4RQEA 5L3FA 2IH3C 3PJSK 1JJ2U 3K9SA 4DV7O 3K59A 3SJQC 1AJQA 2YIDA 3B40A 1XMQB 3K0GA 4XDKA 1BHBA 2V1DA 3RFRA 2CAZC 4JI2O 4O2AB 1YHQV 4KL1A 3K79A 3RYCB 3ZMTA 2VQEB 2D2CB 2FYUH 5B1AB 1B04A 4P9OA 3CX5F 4UXNA 4NYKA 3SYAA 4I55B 5H5NA 1FPOA 2EULA 5KUKA 2F95B 2QWRB 2ILMA 1VQ4V 1RM1B 2ADPA 5LXTA 4FLUA 1FAFA 5F2VO 2Q9LA 2QKAA 1YVWA 5DM6V 1LUWA 4PDMA 1MA1A 1JPXA 1EN6A 2VQFO 1QVFU 3CD6V 1BT8A 5H2FZ 3RYFA 4X1IB 4JI4B 3TXQA 5BR8B 4UCSA 1FKAO 1VQ9V 3ICXA 4O4LA 3JARA 1LNQA 4Q6GA 2F66C 1GK9A 2WLNA 4PA3A 1AILA 1EFRG 2Q7HA 4AQYO 1VP7A 2B9ZA 2GSMB 1M56B 4IT5A 1MMMA 2BTOA 1HNWO 1VMGA 4B3SO 2ATKC 4O4JA 1G6UA 4LH7A 2DMXA 4R50A 4OPHA 5LP6C 2LGWA 3BA8A 4FLTA 2QEXV 3I5DA 1HNXB 5KUMA 2KKWA 1R6NA 2HLDG 4IYHA 1XNQB 3A0BZ 5BMVA 1TA8A 3CRAA 1Y6XA 5LOVB 4J9ZB 5LXTB 3L9DA 1IX9A 2EILB 3I56V 2IJIA 3W7UA 2F23A 2P90A 1Z5VA 3CE2A 4JPRA 3ASOC 4LF7B 3E8BA 1QBZA 4K3AA 4DYLA 1KD1W 1WLEA 2IM9A 2ZM6B 1DLBA 1NKDA 2HVKC 5JCOC 4DUYB 1Z5WA 1N33O 2NLJC 4OX9O 2HHHB 3JSLA 5LP6A 1CXZB 4O4LB 5IJ0B 4DV2B 5IYDO 4F6RA 4LF9O 3ABLC 3LDEA 3UT5A 1R73A 1M1KW 4I50B 5LHIA 3I55V 4ZHQB 4WCEV 3JD4A 4J7KA 3RBZA 1YCIA 3ASNB 1OZ0A 2EZPA 4LNUA 4UB8Z 4JV5B 1YZBA 5LMUB 3D36A 4G28B 1AR4A 1AI5A 4K8XA 2CGOA 1GO3F 2E5LO 1NI8A 1FJGO 1N34B 1I08A 2YS8A 2ITDC 1N32O 1Q86W 3M8AA 5JCOA 2Y4TA 3K08A 2RMKB 1OCZB 3APQA 3IC9A 2P22C 4JASA 1QQCA 1WP7A 1TAEA 5LYJA 1XUQA 4JYYA 5EBWC 1Q43A 3OGIB 4WFFA 2QM7A 2ZE6A 4Q20A 3TJTA 2HVJC 5CBHA 1V54C 2N74A 2K9PA 3HKEA 2R9IA 2A06H 3CC2V 1KQSU 2Q7GA 4NB5A 5KX5A 5CMUA 4MVSA 1QLEC 1SC5B 2CTQA 1MZEA 3OR7C 3UQ8A 2IU0A 1WB7A 2MW2B 3ZRWA 4F6RB 1F4MA 2DYRB 2HR3A 1ROPA 4R6ZA 2IH1C 4B3MO 4Z1MG 4JGSA 4WFAV 2ZXWB 2QWOB 3OEEG 3UO3A 3AG1B 1THZA 4U7NA 3F5WC 4LFCO 2HJFC 4DR4B 2WA3A 4DR1O 2JGDA 1NH2D 1AP5A 3ZMZA 1GRJA 3GWKC 3JD3A 1GN4A 3ETGA 4XDLA 4DV1O 5GONA 3NR7A 2Q8VA 5LL6Y 3E86A 3QO7A 4UFZA 3J80N 4IGGA 1VF6A 3E8GA 1YTFD 1L0NH 4H0LB 1LR1A 1B3QA 1YDXA 1M9NA 4NXNO 2EINB 2YC0A 2LGQA 1PL4A 2HHHO 2AHZA 4MVZA 1VQ5V 5KX5B 2GUZA 4UCTA 1FS0G 3OMAB 2WLIA 3OTOO 2JJ1G 1D5NA 4OPAA 4FFBA 3NXSA 3LUTB 4DXWA 1VQPV 1AJNA 2ZR3A 1JMKC 2Q4PA 1X59A 5IWAO 1HR0B 4CC6A 4FM2A 3SYPA 3SPCA 3BY6A 4FLVA 1D2DA 3RWRD 1NTMH 1DTOA 4FMTA 4LFAO 1W2BU 5C8YA 1IXBA 3CC4V 3WB0A 1XMOB 3MAQA 2XOKG 5DECA 1IBLB 1VQNV 1IURA 1J95A 2W0FC 4QPKA 2LFRA 2UUCB 3LSUA 4MTXA 5K1PA 4A5UB 4X8AA 1SQPH 3ZEDA 4R7CA 2ZINA 3OMIB 3CHXA 5DEDA 3T2MA 3N2KB 3CYOA 2AXTZ 2WSSG 1SQGA 4PA4A 2CH7B 3L73H 1VIBA 1V55C 2OIEA 3U10A 3TETA 3GWOA 4JZGA 5KA6A 2FKXA 3TCUA 3UCSC 2GUZB 4YIOA 4ZIBA 1QLNA 1P49A 5B1NA 4TV8B 2YDEA 3ZJZA 1PP9H 1JQ0A 1HDJA 4JI5B 5LGUA 1PKXA 3QG5A 1FXVA 2PY5A 3ZN0A 1QR8A 3DC5A 3DXRA 2CTWA 4YY3O 2QGNA 3H01A 1VQ6V 3F7YC 5EZYA 1CP9A 3AG2B 1YI2V 4DW0A 3AK3A 4MVOA 1OJHA 4I4TA 3JD0A 3OFNG 3P3NA 1XI1A 2FMLA 1HNZO 2D3OW 4PA6A 4DV7B 3TK1A 3CRQA 4P2ZA 1H2GA 3MHSC 3SJBC 2PYJA 3IFXA 3Q4HB 1CEZA 3E89A 4JI2B 2KG7A 5HFMA 4O4HA 3CJHB 5IYCO 2ARHA 4MVQA 3THOA 2HFEC 4WFHA 5LA6A 3SPHA 2R9AA 3N2GB 3GVMA 4G2KA 4FJCC 1SA0B 1IBMO 1MSWD 1Q8IA 5JWPA 2IJKA 2PTMA 4X65O 2XNDG 3ZS8C 4NTYA 1M93A 3CRRA 5JJNB 4DR5O 2F43G 4J9YB 5KHKA 2OTJV 1P84F 4X66O 2VQFB 1RM1C 3T1HO 4OXSA 2DJVA 2ZIMA 4QJFB 2CTRA 3K57A 4GYCB 4X1KB 5J9PC 3P30A 4NTWA 4X9QA 2QDOA 1NBMG 3LSQA 4NVPA 1IZ3A 1PNKA 2JS3A 2QKSA 4ASUG 1SQXH 4O2AA 4I4TB 1MNGA 1EM1A 4MS2A 3RYCA 4AQYB 1BQZA 4GCZA 3CS5A 4J41A 1BZKA 5B3SB 5IE9A 3A8TA 2QJ1A 5JJEB 4DK0A 5KA5A 3OW2U 5IY5C 1NR1A 2JEXA 5J2TB 1EZJA 5HFLA 1FXKB 1NS1A 2KG7B 4HNAA 1HNWB 1BMFG 4GT1A 4YXWG 1Y76B 4B3SB 2N04A 3CP1A 3E8HA 2GV9A 2A7WA 1M56C 2ZR2A 1E79G 3OE7G 1TGOA 5BZBA 1WB8A 3A0HZ 4FIPC 4FLXA 2XT9A 3CXHF 1H2MA 2K1EA 3FAVB 1CPYA 4YHHO 2UU9O 2C2AA 4R8CA 1VQMV 2YSUB 3ZMVA 1R6KA 3TXSA 1K4DC 3G6BA 1FFTB 4WBNB 2X6AA 1MABG 1N0NA 2EILC 3CCRV 3PN1A 2AGAA 4XBFA 1SS3A
chains in the Genus database with same CATH topology
1CXZB 2HJDA 1US6A 2RMKB 4DYLA 1RFYA 1URFA 1UPGA 2Q0OC 4NKGB 4NB5A 4IGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CXZ B;  2HJD A;  1US6 A;  2RMK B;  4DYL A;  1RFY A;  1URF A;  1UPG A;  2Q0O C;  4NKG B;  4NB5 A;  4IGG A; 
#chains in the Genus database with same CATH topology
 2AHY A;  3L74 H;  1N33 B;  1NTK H;  3WFV A;  4OX9 B;  3KG2 A;  4DUZ O;  2OIG A;  3UM7 A;  2JGU A;  4LF9 B;  3U11 A;  3IC7 A;  3OAA G;  3ZHS A;  5JJJ B;  4IL6 Z;  1VEW A;  5IYB O;  2OT5 A;  4X1Y B;  5GTH Z;  4CC5 A;  1H2K A;  4J80 A;  1Q82 W;  1Q81 W;  2DWD C;  3KCY A;  4W4K A;  1XHX A;  1FD9 A;  2Z0A A;  2WPD G;  4KXR A;  1JFF B;  5KHI A;  4HNA B;  2BTQ A;  3OEH G;  2E5L B;  1FJG B;  2W6J G;  3ABT A;  1QNM A;  5LHH A;  5LOV A;  3W7W A;  1Y66 A;  3ASN C;  4TQF A;  5FPO A;  1N32 B;  3BRC A;  4LBE C;  5KLV H;  1A32 A;  1G8M A;  5DN6 G;  4IIJ B;  3ZMU A;  1L0L H;  1JX9 A;  1ZUQ A;  1OCO B;  4EB6 B;  1NZ6 A;  1WPB A;  3SPI A;  1US6 A;  1RSO A;  1SET A;  3ZHV A;  3J81 N;  2RQ6 A;  3BHP A;  2YEV B;  1W59 A;  3FFQ A;  1OCR B;  2QA4 V;  4H44 B;  1YIJ V;  1OCZ C;  4FM0 A;  5J2U B;  3UO2 A;  3B8N A;  1GMG A;  4UCU A;  4HZ3 A;  5IJ0 A;  1VQO V;  2RN9 A;  5FL7 G;  3B4S A;  3KZI Z;  4JYB A;  4I50 A;  3ETE A;  4J7J A;  4ZHQ A;  2PZS A;  4G27 B;  3U0Z A;  5L3G A;  3CCL V;  4JAV A;  3JCU Z;  3WB2 A;  2QTO A;  2JK5 C;  1QCE A;  2P67 A;  2NNU A;  4B3M B;  5IT9 N;  4LR3 A;  4UVA A;  2XAF A;  4RO2 A;  1NVP B;  1VQK V;  1N36 O;  1H38 A;  4KFM A;  2DYR C;  5JVD B;  3W7T A;  4N23 A;  4LFC B;  2BTQ B;  2JIZ G;  5A9G A;  4DR1 B;  2QWQ B;  3MHH C;  2ZXW C;  3JAL A;  1K5Q A;  4EKW A;  4JI1 O;  3D36 C;  1S76 D;  4DV1 B;  1Q6I A;  1YIT V;  4X62 O;  4JI7 O;  4MSW C;  3JYC A;  2RDC A;  2X7R B;  4FFK A;  1IBK O;  2Q0A A;  1RSO B;  4W4L A;  3P32 A;  2ZQM A;  3ZIA G;  4B3T B;  3C90 A;  4NXN B;  3DGE A;  4QE7 A;  2H3O A;  1K7D A;  1GM8 A;  2Y4U A;  2ZNI A;  3K06 A;  4RUE A;  3X2Q B;  4NXM O;  4GLX A;  4Z1V A;  2QWN B;  1DF4 A;  1TVK B;  4FLW A;  2EIN C;  3OTO B;  5B5E Z;  2XTA A;  2E75 B;  5FLX N;  4WFE A;  2A9H A;  3RN4 A;  4JAU A;  2IJJ A;  1AJP A;  5H6R A;  2ODM A;  4JI8 O;  4D7S A;  5TIS Z;  2ZKO A;  2HP8 A;  3JAK B;  4UCR A;  3ABK B;  5IWA B;  3H9V A;  2EZO A;  2UUA O;  5EC1 C;  3BPZ A;  1PL0 A;  2WLL B;  4JAA A;  5L3B A;  5E79 Z;  1AR1 B;  1JA8 A;  1MSD A;  2A3Q A;  2LP7 A;  3RT3 C;  2Y69 B;  4LFA B;  2EIM B;  2OYQ A;  2Q73 A;  1R1B A;  1M90 W;  3A0R A;  3JAL B;  2CK3 G;  1NJI W;  2YIC A;  1QHT A;  2VRZ A;  3ZRV A;  4GX2 A;  2Z5U A;  3CMA V;  2Q69 A;  2UUB B;  1YSC A;  3FB6 C;  1B6Q A;  4N21 A;  2A0L A;  2L6L A;  3QNE A;  1YJN V;  4TWK A;  4F4L A;  2AZ2 A;  2Q68 A;  3CEI A;  4H33 A;  4NKG B;  4AIL C;  5ITZ B;  5KAF Z;  1S3J A;  3IAY A;  1PV0 A;  1J5E O;  4CH6 A;  1KU9 A;  5KMG B;  5EIB C;  2H94 A;  3CCU V;  2YI9 A;  1EZV H;  4I0X B;  1PD3 A;  1VF6 C;  1RFY A;  1SZT A;  4J42 A;  2A79 B;  3JAS B;  3G4S V;  1TUB B;  1K3E A;  2EIK B;  1K33 A;  1K92 A;  3H1H H;  2P7T C;  4JI3 O;  3L70 H;  3K04 A;  4J10 A;  3ABM B;  1Q3E A;  4DV0 O;  4L8J A;  4PDV A;  5B1B B;  2WLJ A;  2Q0O C;  4DW1 A;  3D3I A;  4FVM A;  4KHP O;  4CS3 A;  1GH6 A;  1Z2G A;  5GW7 A;  3B2E E;  2V7Q G;  4YY3 B;  3FYE B;  1ZX3 A;  3EXA A;  2YXL A;  2ZE5 A;  4JTD B;  1DF5 A;  4ZI7 A;  1O9G A;  4BAY A;  3ASO B;  1HNZ B;  2WA4 A;  3N2K A;  5CBF A;  1YF2 A;  1ZLZ A;  3BAA A;  2XAS A;  3FKS G;  4B3T O;  5JQG B;  3AG2 C;  2X6B A;  2CH7 A;  4H37 A;  3ZHQ A;  1GTO A;  2LQT A;  3FYI B;  1OCC B;  3OD4 A;  4TQD A;  4XDJ A;  3QO8 A;  1IDS A;  3E22 B;  4GX1 A;  3AK2 A;  4TV8 A;  1FXH A;  1WP8 A;  3HKD A;  3W7X A;  1H2L A;  4PDL A;  4RWU A;  2XHB A;  1GN2 A;  3AK1 A;  1U96 A;  4K0K O;  2F4V O;  1AI7 A;  3OUS A;  1IBM B;  4YJ3 B;  4FZ0 A;  4LP8 A;  3DC6 A;  4X65 B;  2DOS A;  4JTA B;  3G71 V;  1BS3 A;  4DR5 B;  4YIP A;  1I94 O;  2YIB A;  3SPG A;  1R3L C;  3LDC A;  3CC7 V;  4X66 B;  3T1H B;  4LF4 O;  5KHH A;  1XL6 A;  2WWW A;  1N0J A;  1K34 A;  3FB5 C;  4CH3 A;  3C3S A;  5FPR A;  1GM9 A;  3Q4H A;  1JCH A;  2UUB O;  4I7Z B;  4MTG A;  2VS0 A;  2EJR A;  3IGA C;  4JI6 O;  4ZI7 B;  1SRY A;  3SJC C;  3CJH A;  4FLY A;  1SES A;  2WLH A;  3G6E V;  1AB3 A;  1YXB A;  1H2N A;  1XIL A;  4MTF A;  3N2G A;  1SF9 A;  4GKJ O;  3AG4 B;  1VQL V;  3SDL A;  4DR7 O;  3CRM A;  1SA0 A;  4TT3 G;  1E1R G;  1R3J C;  3APO A;  1S77 D;  2Q5Z A;  2PUS A;  4LFB O;  1HWY A;  4LF5 B;  3HKD B;  1KMI Z;  1FXK C;  1OV9 A;  2JRI A;  4DR3 O;  3E8F A;  4YHH B;  1FYJ A;  2UU9 B;  3FB7 C;  2XUM A;  3HKC B;  4X1K A;  4DR2 O;  3HB3 B;  5CB4 B;  3AG3 B;  2E76 B;  4JYA O;  3N27 A;  2DQ3 A;  4YJ2 B;  3EVK A;  3VQX A;  3VBB A;  3CCE V;  3QF7 A;  2IU3 A;  5EBM C;  3ETD A;  1Y74 A;  1VQ7 V;  2DQ0 A;  4DRX B;  1Q6U A;  3HKB B;  3JAM N;  3CME V;  2NN4 A;  4O4I B;  4DUZ B;  4U3J B;  4X20 A;  5J2T A;  3CRC A;  1FXK A;  1E1Q G;  3ZBH A;  4FPP A;  4X88 A;  5E1A C;  1Y76 A;  4RUF A;  1FFX B;  2AZ0 A;  1KEC A;  3RYI B;  4OGQ B;  2DE0 X;  2UXD O;  2NR5 A;  4FZ1 A;  3D3Q A;  3FAV A;  1ZSP A;  2ZE8 A;  1G1X B;  1EN4 A;  5B1A C;  1HP8 A;  1WA8 B;  3SYC A;  3ETQ A;  2DYS B;  4FK5 C;  3E2E A;  1KB9 F;  2QE7 G;  2UXB O;  3STL C;  1M57 B;  2ZIO A;  1WN7 A;  4MW8 A;  4MVM A;  4WBN A;  4AI8 A;  3LDD A;  3T1Y O;  3RW0 A;  2QSA A;  2PYL A;  1P7G A;  5EIB D;  4DV6 O;  1R3I C;  3IJ4 A;  1R3K C;  1ZL8 A;  2LW7 A;  1OCO C;  3ZHT A;  3J7A U;  4JI0 O;  2CE4 A;  1Y74 B;  4X1Y A;  1OCR C;  2VWK A;  1BSM A;  3K5L A;  4IHJ B;  3OMN B;  2Y48 A;  4X20 B;  4X64 O;  3K5N A;  1S5H C;  1X4T A;  1JFF A;  3HR0 A;  2BSK A;  4X89 A;  3W7S A;  3WG7 B;  4NR1 A;  4J7Z A;  4BIU A;  4BWA A;  1JR9 A;  1VF5 B;  3RVY A;  2YI8 A;  2Q7E A;  4HYO A;  4ZOL B;  4LF5 O;  2OCH A;  1N36 B;  4J11 A;  3L75 H;  4IIJ A;  5L3C A;  5CBG A;  1XOU A;  5EC2 C;  1VQ8 V;  1O9H A;  2JVD A;  1I7F A;  5KAI Z;  4DK1 A;  2YIB D;  4EB6 A;  4DV4 O;  3KKY A;  1UFI A;  3LNM B;  5EK0 A;  5JH7 B;  2ETN A;  3SJA C;  3R66 A;  4I9W A;  3K9A A;  1KP3 A;  2YEV A;  3K0D A;  4JI1 B;  2V4D A;  4PEL A;  1HW7 A;  5FNV B;  4X62 B;  4JI7 B;  4B3R O;  4UVB A;  3T1C A;  5J2U A;  4MVU A;  2ADQ B;  1Q7Y W;  4E4E A;  1IBK B;  1XNR O;  5C93 A;  1ENV A;  1H8H G;  1QU7 A;  3ZHR A;  1YJ9 V;  2L35 A;  1KKC A;  1EN5 A;  5CA3 A;  2KSD A;  2OCC B;  3TGU H;  1AR5 A;  5BY1 A;  4RQF A;  1ZL8 B;  2XAQ A;  3OGC C;  1H2S B;  1V9P A;  4NXM B;  5IYZ B;  4P9P A;  1SQB H;  3AEI A;  3CXC U;  3UKM A;  3M7M X;  3L71 H;  3EFF K;  5JVD A;  2CDY A;  3QVN A;  3STZ C;  1F23 A;  3X2Q C;  1R6T A;  4JI8 B;  2BSK B;  1XHZ A;  3ZRX A;  2FL4 A;  2ZCE A;  5B1O A;  1OHH G;  4DR6 O;  5KHG A;  3G67 A;  2UUA B;  1F51 A;  2DN9 A;  2X0L A;  3JAW B;  3RYH A;  4GKK O;  1Q90 D;  3CCJ V;  3O65 A;  4TV9 B;  5IDJ A;  3B77 A;  5EYP A;  2ZT9 B;  3ABK C;  1SQV H;  5LMN O;  2BE3 A;  4DV5 O;  2JJ2 G;  4C7U A;  1PNL A;  5L3E A;  4IYI A;  4LF8 O;  3ZRS A;  2QM8 A;  1JJO A;  1T5E A;  1KUQ A;  1URF A;  4DV3 O;  2Y69 C;  2EIM C;  3JAT A;  2EX3 A;  4AHC A;  4QIW F;  1NR7 A;  2CGN A;  5CA0 B;  1TVK A;  2IBZ H;  2OTL V;  2DW4 A;  5GTI Z;  1K8A W;  1J5E B;  4MVR A;  3BCC H;  1SER A;  3S3X A;  1K9M W;  2P4V A;  4MT8 A;  3BVO A;  4LWS B;  4O2B B;  4PI2 A;  2EIJ B;  2BOB C;  3SR2 C;  3JAK A;  5IY5 B;  2Q6A A;  2YIA A;  3JSN A;  2PI4 A;  4JI3 B;  1GN3 A;  3QTC A;  2WLL A;  3CPW U;  4DV0 B;  2O57 A;  4CZZ A;  2B5U A;  4LH6 A;  4D7T A;  2EIK C;  4KHP B;  4K35 A;  3CWB H;  4D6T H;  4TUY A;  3ABM C;  2P6J A;  4F6E A;  3AG1 C;  3C3T A;  3RYH B;  5B1B C;  1M4U A;  2QTS A;  2ZNJ A;  2UXC O;  5EYP B;  2R9R B;  3QO5 A;  1TUE B;  4FM1 A;  2YUA A;  5ITZ A;  4KP4 A;  1XRE A;  2JDI G;  5LGN A;  2B1I A;  5KMG A;  5H6Q A;  2ZD9 A;  2XAG A;  1EBO A;  3JAT B;  4I0X A;  1JOY A;  1NH2 B;  3JAS A;  1PM9 A;  4TSF G;  1TUB A;  3B09 A;  5D5Q A;  5A2Q N;  3VQW A;  3RYF B;  3SYQ A;  1UPG A;  1OCC C;  2ZDI C;  2WLK A;  4K0K B;  2F4V B;  1P4R A;  1GM7 A;  2FB5 A;  2E3C A;  3OT7 A;  3SGI A;  2XAH A;  1YTF B;  3JAR B;  1XDC A;  1XMQ O;  2KQX A;  2UXN A;  4BW5 A;  2QKC A;  4K8Z A;  4CS2 A;  1GN6 A;  1DK1 A;  4CH5 A;  4NTX A;  4UCV A;  1N8R W;  1I94 B;  2VQE O;  2CTP A;  2JEU A;  2N05 A;  4LF4 B;  3M99 B;  4B7K A;  4PD4 F;  5CN0 A;  2IJH A;  4RAI A;  1K4C C;  5KHJ A;  4TUY B;  2G38 A;  1I0H A;  3VQY A;  4O4J B;  1Q6H A;  5JQG A;  3F5T A;  2WAM A;  4JI6 B;  4JTC B;  2ZDI A;  1BCC H;  4DO2 A;  3HPL C;  2QR4 A;  3T4D A;  4LF6 B;  4MTO A;  2ZE7 A;  5BMV B;  5BXZ A;  3E22 A;  1UJW B;  4GKJ B;  5IJ9 A;  4DR7 B;  2ITC C;  2DWE C;  4JI4 O;  5BR8 O;  3K3W A;  2CUG A;  1NVP D;  1N4C A;  4JZ2 A;  2RJZ A;  4YJ3 A;  4CH4 A;  4I5S A;  1I5X A;  1PNM A;  1LUV A;  4LFB B;  5CA1 A;  4P30 A;  3K03 A;  3B8M A;  3LNN A;  3AG4 C;  4BIO A;  1S72 V;  1S5L Z;  1BL8 A;  1WPX A;  3VOU A;  4ZKI A;  4TOI A;  1BE3 H;  3FD9 A;  3JD1 A;  1GAX A;  1YJW V;  3K5M A;  1QR9 A;  4DR3 B;  5LP6 B;  1SQQ H;  1M5I A;  3CCV V;  4U7O A;  3AG7 A;  5LGT A;  1MOF A;  4DR2 B;  1YEW A;  3UT5 B;  3K58 A;  4JYA B;  4Z2W A;  4GUN A;  2EJ7 A;  3OM3 B;  4E2L A;  4UCO A;  2F93 B;  4EFE A;  2X6C A;  4LCU C;  4LNU B;  3DSQ A;  1JVM A;  1HNX O;  3P3P A;  3AG3 C;  1XNQ O;  2MK3 A;  2GBO A;  2KB1 A;  1XBL A;  3E83 A;  4LF7 O;  1IXM A;  4BR6 A;  4GZR B;  2GDS A;  1MZF A;  1RPO A;  5LYJ B;  2PF4 E;  4ZBM A;  2ZM6 O;  3ABL B;  2B1G A;  3O9O A;  2QWP B;  2UXD B;  3ZCC A;  5IJ9 B;  2Q67 A;  1KP2 A;  4DUY O;  3HKE B;  4L87 A;  3BEH A;  4DV2 O;  2VWJ A;  2EBO A;  5CA1 B;  2GTS A;  3HKC A;  5D5P A;  1KC8 W;  2GHY A;  3R65 A;  5AG2 A;  4MW3 A;  5CB4 A;  2UXB B;  2F1M A;  1WNS A;  1Q5O A;  4YJ2 A;  3OR6 C;  3WU2 Z;  5B66 Z;  2WLM A;  2W6I G;  1XL4 A;  3S3W A;  3CCM V;  3T1Y B;  4CS4 A;  4JV5 O;  4I9Q A;  5LMU O;  2DYS C;  3ZRW B;  4PI0 A;  1RP3 B;  2FTK A;  4DRX A;  1M57 C;  4DV6 B;  3HKB A;  1VF7 A;  1N34 O;  3H1K H;  3FB8 C;  4O4I A;  3MD0 A;  4U3J A;  3OTF A;  1U97 A;  1H8E G;  3D8C A;  1V54 B;  4JI0 B;  4FLZ A;  2PGG A;  4U3F H;  4LF6 O;  1FFX A;  1B06 A;  1Y67 A;  2Z3Y A;  2LJ2 A;  4QGP A;  3A2F A;  2JGD B;  2QM4 A;  3RYI A;  5EBL C;  3WB1 A;  3KCX A;  2Y0P A;  4KUM A;  4X64 B;  1QLE B;  3RVZ A;  5GON B;  5H9C A;  2P06 A;  3SPJ A;  3EHB B;  1WA8 A;  5B3S C;  4EFB A;  4PHZ A;  4HAM A;  4H13 B;  3H1L H;  2R70 A;  2JS5 A;  3WG7 C;  3JD2 A;  1SQF A;  3BFR A;  3BA9 A;  4PA7 A;  4DV4 B;  1SKV A;  3LSS A;  3CCQ V;  1ZWI C;  1ZTE A;  2YXH A;  3RGB A;  1NU1 H;  1SZX A;  3H1J H;  1WJZ A;  2WLI B;  2H8P C;  1IVS A;  1L8D A;  4B3R B;  3H1I H;  1NT2 B;  4FFB B;  3F7V C;  1VAR A;  4WF9 V;  1MG1 A;  1XNR B;  4LC1 A;  2E74 B;  4DR4 O;  3E35 A;  3DTU B;  4EEQ A;  4IHJ A;  3ABU A;  5L3D A;  4B08 A;  4PV1 B;  4UB6 Z;  2P4K A;  1GKF A;  1D5A A;  1BHA A;  3L72 H;  2OCC C;  5C8Y B;  3ZMS A;  4WFG A;  5LBQ A;  1F4N A;  1BQ0 A;  3CB2 A;  4ZOL A;  4BW9 A;  2AW9 A;  1Y4M A;  4WFB V;  2BCC H;  1S0V A;  1DGS A;  1W0J G;  3ML0 A;  2BOC C;  3G80 A;  1XEQ A;  1L1F A;  1F7Y A;  1QVG U;  3SYO A;  4DR6 B;  5JH7 A;  2PI5 A;  1COW G;  2M7W A;  5LHG A;  4GX5 A;  4UUJ C;  4GKK B;  3JCZ A;  5FNV A;  2OWO A;  1P7B A;  3ZX6 A;  2GTA A;  1K97 A;  5LMN B;  3ZN1 A;  4DV5 B;  4HBN A;  2XAJ A;  2P5O A;  4QNH B;  3GB7 C;  4LF8 B;  3MDS A;  4DV3 B;  2LO1 A;  2YXY A;  3FX7 A;  1HR0 O;  4UV8 A;  4GX0 A;  2HG5 C;  3K5O A;  5IYZ A;  1AP6 A;  2M6Y A;  3BAB A;  1XMO O;  1AVM A;  1IBL O;  1NTZ H;  3DXR B;  1AI4 A;  4UVC A;  2W0X A;  1K5S A;  5EZY B;  3T4Z A;  1KYO F;  1KKD A;  1V55 B;  1G4Y B;  2UUC O;  1S5J A;  1K73 W;  3VQV A;  3CSX A;  1AI6 A;  4ABM A;  1ORQ C;  2IW5 A;  3JAW A;  4CBC A;  2EIJ C;  2Y0I A;  4I55 A;  4BIZ A;  4TV9 A;  2RCV A;  1KBH A;  1WAZ A;  2HJD A;  4O4H B;  4PA9 A;  2LFS A;  1PPJ H;  2LW1 A;  4JYC A;  1I5Y A;  4QPJ A;  4ICG A;  1W0K G;  5LA6 B;  2HEP A;  4QE9 A;  3ZHU A;  3CCS V;  1NQT A;  3OUF A;  2UXC B;  1ARO P;  4B7E A;  4JF3 A;  4JI5 O;  2RNB A;  4PJ0 Z;  5CA0 A;  4UV9 A;  2R72 A;  1BGY H;  1XQ8 A;  2UXX A;  4X1I A;  5K1X A;  4PDR A;  1RPR A;  4LWS A;  4O2B A;  2HKO A;  1ZAU A;  4RQE A;  5L3F A;  2IH3 C;  3PJS K;  1JJ2 U;  3K9S A;  4DV7 O;  3K59 A;  3SJQ C;  1AJQ A;  2YID A;  3B40 A;  1XMQ B;  3K0G A;  4XDK A;  1BHB A;  2V1D A;  3RFR A;  2CAZ C;  4JI2 O;  4O2A B;  1YHQ V;  4KL1 A;  3K79 A;  3RYC B;  3ZMT A;  2VQE B;  2D2C B;  2FYU H;  5B1A B;  1B04 A;  4P9O A;  3CX5 F;  4UXN A;  4NYK A;  3SYA A;  4I55 B;  5H5N A;  1FPO A;  2EUL A;  5KUK A;  2F95 B;  2QWR B;  2ILM A;  1VQ4 V;  1RM1 B;  2ADP A;  5LXT A;  4FLU A;  1FAF A;  5F2V O;  2Q9L A;  2QKA A;  1YVW A;  5DM6 V;  1LUW A;  4PDM A;  1MA1 A;  1JPX A;  1EN6 A;  2VQF O;  1QVF U;  3CD6 V;  1BT8 A;  5H2F Z;  3RYF A;  4X1I B;  4JI4 B;  3TXQ A;  5BR8 B;  4UCS A;  1FKA O;  1VQ9 V;  3ICX A;  4O4L A;  3JAR A;  1LNQ A;  4Q6G A;  2F66 C;  1GK9 A;  2WLN A;  4PA3 A;  1AIL A;  1EFR G;  2Q7H A;  4AQY O;  1VP7 A;  2B9Z A;  2GSM B;  1M56 B;  4IT5 A;  1MMM A;  2BTO A;  1HNW O;  1VMG A;  4B3S O;  2ATK C;  4O4J A;  1G6U A;  4LH7 A;  2DMX A;  4R50 A;  4OPH A;  5LP6 C;  2LGW A;  3BA8 A;  4FLT A;  2QEX V;  3I5D A;  1HNX B;  5KUM A;  2KKW A;  1R6N A;  2HLD G;  4IYH A;  1XNQ B;  3A0B Z;  5BMV A;  1TA8 A;  3CRA A;  1Y6X A;  5LOV B;  4J9Z B;  5LXT B;  3L9D A;  1IX9 A;  2EIL B;  3I56 V;  2IJI A;  3W7U A;  2F23 A;  2P90 A;  1Z5V A;  3CE2 A;  4JPR A;  3ASO C;  4LF7 B;  3E8B A;  1QBZ A;  4K3A A;  4DYL A;  1KD1 W;  1WLE A;  2IM9 A;  2ZM6 B;  1DLB A;  1NKD A;  2HVK C;  5JCO C;  4DUY B;  1Z5W A;  1N33 O;  2NLJ C;  4OX9 O;  2HHH B;  3JSL A;  5LP6 A;  1CXZ B;  4O4L B;  5IJ0 B;  4DV2 B;  5IYD O;  4F6R A;  4LF9 O;  3ABL C;  3LDE A;  3UT5 A;  1R73 A;  1M1K W;  4I50 B;  5LHI A;  3I55 V;  4ZHQ B;  4WCE V;  3JD4 A;  4J7K A;  3RBZ A;  1YCI A;  3ASN B;  1OZ0 A;  2EZP A;  4LNU A;  4UB8 Z;  4JV5 B;  1YZB A;  5LMU B;  3D36 A;  4G28 B;  1AR4 A;  1AI5 A;  4K8X A;  2CGO A;  1GO3 F;  2E5L O;  1NI8 A;  1FJG O;  1N34 B;  1I08 A;  2YS8 A;  2ITD C;  1N32 O;  1Q86 W;  3M8A A;  5JCO A;  2Y4T A;  3K08 A;  2RMK B;  1OCZ B;  3APQ A;  3IC9 A;  2P22 C;  4JAS A;  1QQC A;  1WP7 A;  1TAE A;  5LYJ A;  1XUQ A;  4JYY A;  5EBW C;  1Q43 A;  3OGI B;  4WFF A;  2QM7 A;  2ZE6 A;  4Q20 A;  3TJT A;  2HVJ C;  5CBH A;  1V54 C;  2N74 A;  2K9P A;  3HKE A;  2R9I A;  2A06 H;  3CC2 V;  1KQS U;  2Q7G A;  4NB5 A;  5KX5 A;  5CMU A;  4MVS A;  1QLE C;  1SC5 B;  2CTQ A;  1MZE A;  3OR7 C;  3UQ8 A;  2IU0 A;  1WB7 A;  2MW2 B;  3ZRW A;  4F6R B;  1F4M A;  2DYR B;  2HR3 A;  1ROP A;  4R6Z A;  2IH1 C;  4B3M O;  4Z1M G;  4JGS A;  4WFA V;  2ZXW B;  2QWO B;  3OEE G;  3UO3 A;  3AG1 B;  1THZ A;  4U7N A;  3F5W C;  4LFC O;  2HJF C;  4DR4 B;  2WA3 A;  4DR1 O;  2JGD A;  1NH2 D;  1AP5 A;  3ZMZ A;  1GRJ A;  3GWK C;  3JD3 A;  1GN4 A;  3ETG A;  4XDL A;  4DV1 O;  5GON A;  3NR7 A;  2Q8V A;  5LL6 Y;  3E86 A;  3QO7 A;  4UFZ A;  3J80 N;  4IGG A;  1VF6 A;  3E8G A;  1YTF D;  1L0N H;  4H0L B;  1LR1 A;  1B3Q A;  1YDX A;  1M9N A;  4NXN O;  2EIN B;  2YC0 A;  2LGQ A;  1PL4 A;  2HHH O;  2AHZ A;  4MVZ A;  1VQ5 V;  5KX5 B;  2GUZ A;  4UCT A;  1FS0 G;  3OMA B;  2WLI A;  3OTO O;  2JJ1 G;  1D5N A;  4OPA A;  4FFB A;  3NXS A;  3LUT B;  4DXW A;  1VQP V;  1AJN A;  2ZR3 A;  1JMK C;  2Q4P A;  1X59 A;  5IWA O;  1HR0 B;  4CC6 A;  4FM2 A;  3SYP A;  3SPC A;  3BY6 A;  4FLV A;  1D2D A;  3RWR D;  1NTM H;  1DTO A;  4FMT A;  4LFA O;  1W2B U;  5C8Y A;  1IXB A;  3CC4 V;  3WB0 A;  1XMO B;  3MAQ A;  2XOK G;  5DEC A;  1IBL B;  1VQN V;  1IUR A;  1J95 A;  2W0F C;  4QPK A;  2LFR A;  2UUC B;  3LSU A;  4MTX A;  5K1P A;  4A5U B;  4X8A A;  1SQP H;  3ZED A;  4R7C A;  2ZIN A;  3OMI B;  3CHX A;  5DED A;  3T2M A;  3N2K B;  3CYO A;  2AXT Z;  2WSS G;  1SQG A;  4PA4 A;  2CH7 B;  3L73 H;  1VIB A;  1V55 C;  2OIE A;  3U10 A;  3TET A;  3GWO A;  4JZG A;  5KA6 A;  2FKX A;  3TCU A;  3UCS C;  2GUZ B;  4YIO A;  4ZIB A;  1QLN A;  1P49 A;  5B1N A;  4TV8 B;  2YDE A;  3ZJZ A;  1PP9 H;  1JQ0 A;  1HDJ A;  4JI5 B;  5LGU A;  1PKX A;  3QG5 A;  1FXV A;  2PY5 A;  3ZN0 A;  1QR8 A;  3DC5 A;  3DXR A;  2CTW A;  4YY3 O;  2QGN A;  3H01 A;  1VQ6 V;  3F7Y C;  5EZY A;  1CP9 A;  3AG2 B;  1YI2 V;  4DW0 A;  3AK3 A;  4MVO A;  1OJH A;  4I4T A;  3JD0 A;  3OFN G;  3P3N A;  1XI1 A;  2FML A;  1HNZ O;  2D3O W;  4PA6 A;  4DV7 B;  3TK1 A;  3CRQ A;  4P2Z A;  1H2G A;  3MHS C;  3SJB C;  2PYJ A;  3IFX A;  3Q4H B;  1CEZ A;  3E89 A;  4JI2 B;  2KG7 A;  5HFM A;  4O4H A;  3CJH B;  5IYC O;  2ARH A;  4MVQ A;  3THO A;  2HFE C;  4WFH A;  5LA6 A;  3SPH A;  2R9A A;  3N2G B;  3GVM A;  4G2K A;  4FJC C;  1SA0 B;  1IBM O;  1MSW D;  1Q8I A;  5JWP A;  2IJK A;  2PTM A;  4X65 O;  2XND G;  3ZS8 C;  4NTY A;  1M93 A;  3CRR A;  5JJN B;  4DR5 O;  2F43 G;  4J9Y B;  5KHK A;  2OTJ V;  1P84 F;  4X66 O;  2VQF B;  1RM1 C;  3T1H O;  4OXS A;  2DJV A;  2ZIM A;  4QJF B;  2CTR A;  3K57 A;  4GYC B;  4X1K B;  5J9P C;  3P30 A;  4NTW A;  4X9Q A;  2QDO A;  1NBM G;  3LSQ A;  4NVP A;  1IZ3 A;  1PNK A;  2JS3 A;  2QKS A;  4ASU G;  1SQX H;  4O2A A;  4I4T B;  1MNG A;  1EM1 A;  4MS2 A;  3RYC A;  4AQY B;  1BQZ A;  4GCZ A;  3CS5 A;  4J41 A;  1BZK A;  5B3S B;  5IE9 A;  3A8T A;  2QJ1 A;  5JJE B;  4DK0 A;  5KA5 A;  3OW2 U;  5IY5 C;  1NR1 A;  2JEX A;  5J2T B;  1EZJ A;  5HFL A;  1FXK B;  1NS1 A;  2KG7 B;  4HNA A;  1HNW B;  1BMF G;  4GT1 A;  4YXW G;  1Y76 B;  4B3S B;  2N04 A;  3CP1 A;  3E8H A;  2GV9 A;  2A7W A;  1M56 C;  2ZR2 A;  1E79 G;  3OE7 G;  1TGO A;  5BZB A;  1WB8 A;  3A0H Z;  4FIP C;  4FLX A;  2XT9 A;  3CXH F;  1H2M A;  2K1E A;  3FAV B;  1CPY A;  4YHH O;  2UU9 O;  2C2A A;  4R8C A;  1VQM V;  2YSU B;  3ZMV A;  1R6K A;  3TXS A;  1K4D C;  3G6B A;  1FFT B;  4WBN B;  2X6A A;  1MAB G;  1N0N A;  2EIL C;  3CCR V;  3PN1 A;  2AGA A;  4XBF A;  1SS3 A; 
#chains in the Genus database with same CATH homology
 1CXZ B;  2HJD A;  1US6 A;  2RMK B;  4DYL A;  1RFY A;  1URF A;  1UPG A;  2Q0O C;  4NKG B;  4NB5 A;  4IGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...