1RGHA

Hydrolase, guanyloribonuclease
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE
publication title Ribonuclease from Streptomyces aureofaciens at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase (guanyloribonuclease)
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1995-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rghA00
1RGHA 1YNVX 2SARA 3AHSA 1RCKA 1IYYA 1RN1A 3KCHA 1BAOA 1BNIA 2KAAA 1RGCA 1UCKA 1BNRA 2ZA4A 1I3FA 1UCJA 3WHOA 1RGKA 1R4YA 1DETA 3AGOA 1FUSA 1I8VA 2KF3A 7RNTA 1BU4A 1LOVA 3D5GA 1LOYA 2C4BA 1BRNL 1BGSA 1GSPA 3AGNA 1I3IA 1LRAA 1BNFA 5GSPA 1UCLA 1I0VA 1I2EA 1JBRA 1BRIA 1RGEA 1RNBA 1BSCA 3SYUA 1RDSA 1T2HA 1PYLA 1BSEA 1RLSA 1BNEA 1TRPA 2KF5A 1PY3A 1BSAA 1BRHA 1RGAA 1ZGXA 1GMQA 1LOWA 2AAEA 2GSPA 5BU4A 3GSPA 1FUTA 1CH0A 3BIRA 3BU4A 4GSPA 4HAAA 1X1XA 2F56A 1RHLA 3AHWA 1MGRA 1BRSA 4GHOA 1HZ1A 1B2MA 6GSPA 1BNJA 1BRGA 1T2IA 1FZUA 3Q3FA 4BIRA 1FW7A 3D5IA 1BOXA 2KF6A 1B20A 1BNSA 3DH2A 1B27A 1AY7A 4RNTA 1B21A 2HOHA 3HOHA 1RGGA 2RNTA 1B2XA 1X1WA 1GMRA 1SARA 9RNTA 3D4AA 2F5MA 1GMPA 1BUJA 1X1YA 4BU4A 8RNTA 1JBSA 1GOVA 1RNTA 1BNGA 1RSNA 1BANA 1BSBA 1UCIA 1BSDA 2AADA 1GOYA 1X1UA 1B2ZA 1BRKA 1I2FA 1BRJA 3RNTA 5RNTA 1B2SA 1G02A 1I70A 1RGLA 4HOHA 1C54A 1DE3A 1I2GA 3A5EA 2BIRA 2BU4A 1B3SA 1RN4A 1LNIA 1AQZA 3URPA 1B2UA 3DGYA 1FYSA 1MGWA 1RMSA 1RTUA 1BVIA 1YVSA 1JBTA 2F5WA 1RCLA 2F4YA 1TRQA 1RGFA 1Q9EA 5BIRA 1BIRA 6RNTA 5HOHA 1YGWA 1A2PA 7GSPA 1GOUA 1TTOA 3WR2A 2KF4A 2RBIA 4J5KA 1HYFA 4J5GA 1I0XA
chains in the Genus database with same CATH superfamily
4LMIA 4L8OA 1RGHA 1YNVX 1KD14 2SARA 3M8CA 4HZBB 3G16A 3NV0B 1V74A 1L5GB 1GY5A 3KCHA 1JZDA 3DMCA 1BNIA 1CYUA 1C7HA 1OH0A 5I97A 2RSXA 1VQL3 4R4KA 2CHCA 1R4CA 2W9QA 4XDVA 3S28A 3G6E3 3ZFZA 3KKGA 4R9LA 1FUSA 3D9RA 1BU4A 1YI23 2CK3H 3DXOA 1GD4A 3ER7A 4N6MA 1GY6A 4MMXB 1BRNL 1EQKA 4HZ9B 2Z76A 1I3IA 4HM3B 1NO3A 1OUNA 1WMPA 2PZVA 3EN8A 1BNFA 1TJDA 1SJWA 1TFKA 5IEOA 1I0VA 1Q40B 1LVNA 7STDA 3RGRA 1BRIA 1N8R4 1NJI4 3UB1A 3Q90A 1TUHA 4HJLB 1Q824 1BNEA 1TRPA 4WFOA 1BSAA 2CG1A 1EKMA 4XBXA 1U8CB 1ZGXA 1DYUA 5EQLA 3F8XA 3NXJA 3G713 4CCVA 1S723 5IW9A 3BNEA 5ELUA 1HKXA 3UL6A 3F9SA 5IG4A 4GSPA 3ROBA 2F56A 4LGQA 1IT8A 3L0RA 1JKGB 2LYXA 2L1SA 3EQQB 1OHOA 1T2IA 1FGMA 2CFGA 1EEJA 3D5IA 1FW7A 5AIGA 1Q42A 5M18A 1OHSA 1Q864 1MWUA 1W4NA 2B1XB 3U1WA 1BNSA 2OTJ3 1A90A 2OCTA 3MG1A 3ALAA 1M1K4 3G0KA 5EEOA 3I553 3H3HA 2Y74A 1W01A 4HVNA 3VSYA 1RRLA 3RGAA 1OCVA 4EC6A 2CFKA 4BL3A 2W0QA 3CPW2 1EUIC 1G96A 2Q07A 4FMBA 2CFDA 5IG0A 4EXRA 3A76A 1LQGC 1S5AA 4HYZA 5LC7A 1VQK3 1FGRA 2AADA 1DMQA 3F14A 1GOYA 1N5PA 4HM4B 1Q7HA 4N6UA 3ZG0A 1OPYA 1V58A 3DY5A 3NHXA 4N6OB 3UJMA 1YHQ3 1I2FA 1WNHA 1BRJA 3FG3A 1OGZA 2IMJA 2M7OA 5RNTA 1IQ8A 1BUQA 5CK6A 2HMLB 4OVMA 3FKAA 2CX0A 2RGQA 3FLJA 2INXA 5BVBA 2R41A 3NQZA 3NV0A 1DE3A 2GEXA 3SVAA 1LQMB 3F40A 3DM8A 2I9WA 3B7CA 1CEWI 2BIRA 3F8HA 1B3SA 3NM7A 1LOXA 1UDII 2E2VA 3EX9A 3F7XA 1GY7A 3DGYA 1FYSA 1YVSA 4HM1B 4FCMA 5AYRB 2F5WA 1O7GB 2BO9B 1RCLA 3BNDA 3OWYA 2F4YA 3PS8A 1TU5A 4AKZA 4EBGA 2WGOA 1Q9EA 1BIRA 2IUJA 3MHEA 3V92A 3CC73 1A2PA 5FGOA 2OQEA 2CWUA 3FZWA 3EHCA 1A2KA 4IIAA 3EB8A 3EC9A 4LEHA 4J5KA 1FUWA 1IVUA 5AEUB 3NUVA 4XBYA 5M1AA 1ISKA 1I0XA 2Z7AA 2XEPA 2ZA4A 1W00A 1EG9B 3AHSA 3EF8A 3EN1B 1KQS2 1QJGA 3DGLA 1IYYA 1RN1A 3S5CA 1YJ93 1IDPA 2KXGA 2WOFA 3CC23 3BNCA 1T5YA 1RGCA 1UCKA 3T0UA 2MF7A 1BNRA 2BHMA 1UI7A 1YIJ3 2F98A 4MMZB 1DETA 3BLZA 3GZXB 1I8VA 2KF3A 3SOYA 7RNTA 5TGNA 3CCQ3 3GZYB 1LOVA 3D5GA 3CCS3 4KT3B 1QVF2 1QMAA 1JRQA 2W03A 3PXMA 4RZMA 3CCL3 1KC84 1GSPA 5IENA 3WDGB 2H0HA 2Z77A 3NBRA 2P0XA 1DVCA 1UCLA 2GBWB 2HMMB 3OV4A 3OWSA 1JBRA 4LZIA 3WA2X 1RNBA 1RGEA 3JUMA 3PCRA 4Q53A 1W2ZA 1VQQA 4HM0B 3DGNA 2JQ5A 3KSED 3NBBA 2Z6BA 2QA43 1PFPA 3KSPA 1W7CA 2WGQA 4MJDA 1LOWA 1IVWA 1OF5B 4EW5A 2XH9A 3MG3A 1WMOA 3HI7A 2UUGC 3X3ZA 1CH0A 3BIRA 4HAAA 4STDA 1OACA 1MWRA 1Y4KA 3FG4A 2HMOB 4R9KA 4BTWA 5JPPA 4GHOA 6GSPA 2W56B 2XSHB 4OK0A 4WWUC 1BRGA 4K90B 5IEPA 1CYVA 4BIRA 3Q3FA 3D3LA 3UL5A 1DVDA 1W02A 1QALA 3CPOA 4CJNA 2CIUA 1B20A 1UUVB 3WOFB 3OWUA 3H51A 5EVHA 3X3YA 1AY7A 2GXFA 1SIIA 3OW22 1FA3A 1FGTA 2HOHA 3STDA 1RGGA 2RNTA 4CPKA 2YFIB 1X1WA 3FF0A 1SARA 2BNGA 3KFQC 3B8LA 5IF6A 3D4AA 2F5MA 4N3VA 1YVBI 3NX0A 2CKFB 4N6LA 5DRVA 5IG5A 4FCJA 1LNHA 3WODG 3CCU3 3DGMA 4BU4A 4XBTA 4TX4A 1NB5I 1M904 1JBSA 2HMKB 5ELJA 4JRFA 1ZS7A 2E2TA 1RSNA 4LSOA 2XFSA 3MYTA 3EJVA 3DZLA 3UNLA 4HM5B 4NHFA 1ZO2A 2L4VA 3RNTA 1RGLA 1I70A 1D6UA 1C54A 3CNXA 1WMNA 4N6V0 2WO0A 4N6TA 1N5HA 2GU3A 1K734 3SX1A 3B4OA 3K63A 3IPTA 1O7NB 3KE7A 1LNIA 1AQZA 1W6YA 1F8NA 1B2UA 1UI8A 1RTUA 3LTBA 2XRXB 4PEJA 1BVIA 1T3BA 1VQM3 3FG1A 1TRQA 4ORLA 2K54A 1RGFA 2WOHA 3LOYA 1ROAA 5A0OB 2CFWA 4EV5A 1GD3A 2BT3A 2STDA 3X40A 5AIIA 5FW5A 1TTOA 3QRDA 1O7HB 2RCDA 5KP3A 2RBIA 1OGXA 2YX9A 1M1XB 1YJN3 3CC43 1O7MB 2E2UA 2F86B 3JUPA 1G0TA 2Y73A 2O3OA 4FMDA 1RCKA 4MMYB 4CDLA 3SXXA 1SQWA 1QAFA 3CCE3 2QEX3 1W2B2 1A67A 3MWZA 2KAAA 1AVLA 1TIJA 3SEDA 1ULJB 4HM6B 1J2BA 1UW1A 1STDA 1I3FA 1UCJA 3WHOA 2K0MA 5D83A 1K28A 1OF5A 1R4YA 2K3DA 4JF8A 3V99A 3CU3A 3S67A 4WP5A 3FH1A 1LOYA 4QWTA 4XM4A 1JZOA 5STDA 3AGNA 4J8TA 3X41A 2W56A 5IG3A 3DGOA 3WMDA 1FGQA 5GSPA 4H61A 1IV7A 1W5ZA 3N54B 1HU9A 4KFDA 3KIIA 1VQP3 2OWPA 3JUOA 2XGNA 1NDOB 4X2HA 4H3UA 1RLSA 1BSEA 3AMOA 2IUKA 2O9UX 2OTL3 1RGAA 3HX8A 1US1A 4I5QA 2P09A 2JDIH 2P38A 1JB2A 3CMA3 1N9EA 1NB3I 1NWWA 2CW9A 3O8YA 6STDA 4L7KA 3BU4A 1Q7Y4 1N8QA 2HMNB 8CHOA 4EV2A 1A2VA 1IVVA 3LTAA 1BRSA 4NREA 3X42A 3CCJ3 2GU1A 3CCM3 1VQ43 2V1LA 4IPBA 3GAXA 1UUWB 2KF6A 1K9M4 4R1KA 1KWIA 2IY2A 3DH2A 1B27A 2BMOB 1B21A 1JB4A 2A15A 3LTCA 1JNQA 3B4PA 3PZWA 3HOHA 3RDEA 3PYJA 5G2GA 1RN7A 1D6YA 1B2XA 1AR0A 2FGTA 3OX9A 1GMRA 4ZM8A 9RNTA 3ECFA 2FXTA 4OUQA 1GMPA 4MEIA 3DUKA 1NNVA 1ASKA 1X1YA 4XB5A 4DKIA 5KP1A 3N8BA 3BNBA 2LQVA 8RNTA 3LTDA 1K8A4 4X2OA 5LC6A 5CF2A 4RNYA 2ZDJA 2W6JH 4O3VA 1BANA 1BSBA 1UCIA 2HMJB 3S29A 3LH4A 2YFJB 2OOVA 1ULIB 3T8UA 1VZZA 2W2CA 4HKVB 1B2ZA 1IQXA 1BRKA 3EBTA 5AIFA 3IMAB 2CWVA 3LZAA 1TFOA 1JN5B 2CG0A 2ZHXB 4FMCA 1O7PB 3AMOB 4KZ1A 1LXEA 3T8NA 4WYKA 3I0YA 3GWRA 1I2GA 3VGNA 2OQEC 5KP4A 3A5EA 1RKYA 2D42A 1VQ83 2GEYA 2KCDA 5DREA 4KVHA 3J7Yd 3CME3 1MGWA 1RMSA 2QGUA 1VQ53 2CFLA 1GS3A 1VQ63 3SLUA 1AVKA 1CQSA 2CX1A 2H0IA 5BIRA 3TDGA 6RNTA 5HOHA 1YGWA 4NPBA 2CC3A 7GSPA 1GOUA 3K7CA 4L8PA 2PNCA 2W9PA 3Q1CA 2C11A 2W04A 1K41A 1KSIA 4BL2A 1UGIA 4J5GA 3OXAA 3LT9A 4FMAA 3K9MC 4K1VA 1MOLA 4R80A 1O7WB 1UGHI 1Z1SA 4EYCA 1EA2A 5JPUA 2FNQA 1QVG2 3EBYA 4GB5A 1RJOA 2XSOB 3CNMA 1BAOA 4HBRA 5D82A 2B24B 1STFI 3GZRA 4BTYA 1E97A 2ML6A 3LT8A 5CF1A 1IK3A 4RNZA 5JBSA 1RGKA 1WTHA 3AGOA 2QIYA 5CLKA 5M19A 3JUQA 3MPHA 3GZBA 4GL6A 2C4BA 1NU3A 1BGSA 4BTXA 3JUNA 4FCZA 3FSDA 4O8SA 1D6ZA 3G4S3 1LRAA 1E3VA 1U5OA 3D79A 1W6CA 3PCSA 3N9HA 2P05A 4AEQA 1I2EA 1MWTA 3S27A 5HGRA 4KFFA 1BSCA 3SYUA 4G1MB 1RDSA 3Q2PA 1T2HA 1PYLA 1IQYA 2KF5A 5BXQA 1VQN3 1PY3A 3GRDA 1BRHA 1V57A 4WYKB 3LYGA 2MC8A 3HIGA 2H0GA 4LYLB 1YGEA 2OOVC 2BMRB 1GMQA 3HK4A 3ZG5A 4U13A 1JV2B 3WOEB 2AAEA 2GSPA 2XF3A 5BU4A 1IT7A 1E3RA 1FUTA 3GSPA 4AKYA 4K1UA 3I563 5AI1A 3BB9A 2RFRA 1X1XA 3MSOA 1RHLA 1QAKA 1MGRA 2D1WA 3AHWA 3EE1A 5CXOA 1PU4A 1HZ1A 2IA7A 1DMMA 2ZL8A 1BNJA 5G1LA 2XR8B 4WHAA 1B2MA 1FZUA 2CH9A 2J8XB 3VF1A 1BOXA 1RRHA 2KRTA 1JB5A 1M9GA 2SBLA 3X3XA 5AEWB 1N9JA 1FGOA 4RNTA 2R4IA 1JN5A 1VQ73 2ML5A 2XGLA 2BMQB 4RBNA 2UX0A 3K0ZA 5AYSC 1YIT3 1VQO3 1ROVA 3QK9A 1TP6A 3SOAA 3NQYA 4XDWA 4HM7B 3K5TA 3CD63 3MKIA 1BUJA 2XFTA 3CCR3 1MWSA 3LXUX 4HM8B 5G1KA 1GOVA 1GYBA 3JVCA 1RNTA 1BNGA 1JJ22 4J9AA 1BSDA 3CCV3 4KFEA 3FGYA 1X1UA 3LMLA 3V98A 3E99A 3KN4A 1SIHA 5D81A 5AIHA 1YJW3 1Q40A 1B2SA 1G02A 4HOHA 1WQLB 3HZPA 4ILFA 1OHPA 2C10A 2F99A 3CXC2 3PGBA 4IT7A 1SPUA 3F7SA 1IV9A 2BU4A 4K61A 3G8ZA 1RN4A 2YFLB 1AV4A 4N6NB 3URPA 4FR9A 3FCSB 1JBTA 4HM2B 2CWTA 2P0MA 1Q814 5IERA 1VQ93 3HIIA 1IU7A 3FF2A 3WA3A 3U97A 3MG2A 4I4KA 3KZTA 2IYJA 1IVXA 1W6GA 1DMNA 1JKGA 3NBJA 1ZX2A 3NM2A 1UUGB 2UGIA 4O02B 3WR2A 1MNLA 2KF4A 2GBXB 1HYFA 4O2HA 3IJEB
chains in the Genus database with same CATH topology
1RGHA 1YNVX 2SARA 3AHSA 1RCKA 1IYYA 1RN1A 3KCHA 1BAOA 1BNIA 2KAAA 1RGCA 1UCKA 1BNRA 2ZA4A 1I3FA 1UCJA 3WHOA 1RGKA 1R4YA 1DETA 3AGOA 1FUSA 1I8VA 2KF3A 7RNTA 1BU4A 1LOVA 3D5GA 1LOYA 2C4BA 1BRNL 1BGSA 1GSPA 3AGNA 1I3IA 1LRAA 1BNFA 5GSPA 1UCLA 1I0VA 1I2EA 1JBRA 1BRIA 1RGEA 1RNBA 1BSCA 3SYUA 1RDSA 1T2HA 1PYLA 1BSEA 1RLSA 1BNEA 1TRPA 2KF5A 1PY3A 1BSAA 1BRHA 1RGAA 1ZGXA 1GMQA 1LOWA 2AAEA 2GSPA 5BU4A 3GSPA 1FUTA 1CH0A 3BIRA 3BU4A 4GSPA 4HAAA 1X1XA 2F56A 1RHLA 3AHWA 1MGRA 1BRSA 4GHOA 1HZ1A 1B2MA 6GSPA 1BNJA 1BRGA 1T2IA 1FZUA 3Q3FA 4BIRA 1FW7A 3D5IA 1BOXA 2KF6A 1B20A 1BNSA 3DH2A 1B27A 1AY7A 4RNTA 1B21A 2HOHA 3HOHA 1RGGA 2RNTA 1B2XA 1X1WA 1GMRA 1SARA 9RNTA 3D4AA 2F5MA 1GMPA 1BUJA 1X1YA 4BU4A 8RNTA 1JBSA 1GOVA 1RNTA 1BNGA 1RSNA 1BANA 1BSBA 1UCIA 1BSDA 2AADA 1GOYA 1X1UA 1B2ZA 1BRKA 1I2FA 1BRJA 3RNTA 5RNTA 1B2SA 1G02A 1I70A 1RGLA 4HOHA 1C54A 1DE3A 1I2GA 3A5EA 2BIRA 2BU4A 1B3SA 1RN4A 1LNIA 1AQZA 3URPA 1B2UA 3DGYA 1FYSA 1MGWA 1RMSA 1RTUA 1BVIA 1YVSA 1JBTA 2F5WA 1RCLA 2F4YA 1TRQA 1RGFA 1Q9EA 5BIRA 1BIRA 6RNTA 5HOHA 1YGWA 1A2PA 7GSPA 1GOUA 1TTOA 3WR2A 2KF4A 2RBIA 4J5KA 1HYFA 4J5GA 1I0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGH A;  1YNV X;  2SAR A;  3AHS A;  1RCK A;  1IYY A;  1RN1 A;  3KCH A;  1BAO A;  1BNI A;  2KAA A;  1RGC A;  1UCK A;  1BNR A;  2ZA4 A;  1I3F A;  1UCJ A;  3WHO A;  1RGK A;  1R4Y A;  1DET A;  3AGO A;  1FUS A;  1I8V A;  2KF3 A;  7RNT A;  1BU4 A;  1LOV A;  3D5G A;  1LOY A;  2C4B A;  1BRN L;  1BGS A;  1GSP A;  3AGN A;  1I3I A;  1LRA A;  1BNF A;  5GSP A;  1UCL A;  1I0V A;  1I2E A;  1JBR A;  1BRI A;  1RGE A;  1RNB A;  1BSC A;  3SYU A;  1RDS A;  1T2H A;  1PYL A;  1BSE A;  1RLS A;  1BNE A;  1TRP A;  2KF5 A;  1PY3 A;  1BSA A;  1BRH A;  1RGA A;  1ZGX A;  1GMQ A;  1LOW A;  2AAE A;  2GSP A;  5BU4 A;  3GSP A;  1FUT A;  1CH0 A;  3BIR A;  3BU4 A;  4GSP A;  4HAA A;  1X1X A;  2F56 A;  1RHL A;  3AHW A;  1MGR A;  1BRS A;  4GHO A;  1HZ1 A;  1B2M A;  6GSP A;  1BNJ A;  1BRG A;  1T2I A;  1FZU A;  3Q3F A;  4BIR A;  1FW7 A;  3D5I A;  1BOX A;  2KF6 A;  1B20 A;  1BNS A;  3DH2 A;  1B27 A;  1AY7 A;  4RNT A;  1B21 A;  2HOH A;  3HOH A;  1RGG A;  2RNT A;  1B2X A;  1X1W A;  1GMR A;  1SAR A;  9RNT A;  3D4A A;  2F5M A;  1GMP A;  1BUJ A;  1X1Y A;  4BU4 A;  8RNT A;  1JBS A;  1GOV A;  1RNT A;  1BNG A;  1RSN A;  1BAN A;  1BSB A;  1UCI A;  1BSD A;  2AAD A;  1GOY A;  1X1U A;  1B2Z A;  1BRK A;  1I2F A;  1BRJ A;  3RNT A;  5RNT A;  1B2S A;  1G02 A;  1I70 A;  1RGL A;  4HOH A;  1C54 A;  1DE3 A;  1I2G A;  3A5E A;  2BIR A;  2BU4 A;  1B3S A;  1RN4 A;  1LNI A;  1AQZ A;  3URP A;  1B2U A;  3DGY A;  1FYS A;  1MGW A;  1RMS A;  1RTU A;  1BVI A;  1YVS A;  1JBT A;  2F5W A;  1RCL A;  2F4Y A;  1TRQ A;  1RGF A;  1Q9E A;  5BIR A;  1BIR A;  6RNT A;  5HOH A;  1YGW A;  1A2P A;  7GSP A;  1GOU A;  1TTO A;  3WR2 A;  2KF4 A;  2RBI A;  4J5K A;  1HYF A;  4J5G A;  1I0X A; 
#chains in the Genus database with same CATH topology
 4LMI A;  4L8O A;  1RGH A;  1YNV X;  1KD1 4;  2SAR A;  3M8C A;  4HZB B;  3G16 A;  3NV0 B;  1V74 A;  1L5G B;  1GY5 A;  3KCH A;  1JZD A;  3DMC A;  1BNI A;  1CYU A;  1C7H A;  1OH0 A;  5I97 A;  2RSX A;  1VQL 3;  4R4K A;  2CHC A;  1R4C A;  2W9Q A;  4XDV A;  3S28 A;  3G6E 3;  3ZFZ A;  3KKG A;  4R9L A;  1FUS A;  3D9R A;  1BU4 A;  1YI2 3;  2CK3 H;  3DXO A;  1GD4 A;  3ER7 A;  4N6M A;  1GY6 A;  4MMX B;  1BRN L;  1EQK A;  4HZ9 B;  2Z76 A;  1I3I A;  4HM3 B;  1NO3 A;  1OUN A;  1WMP A;  2PZV A;  3EN8 A;  1BNF A;  1TJD A;  1SJW A;  1TFK A;  5IEO A;  1I0V A;  1Q40 B;  1LVN A;  7STD A;  3RGR A;  1BRI A;  1N8R 4;  1NJI 4;  3UB1 A;  3Q90 A;  1TUH A;  4HJL B;  1Q82 4;  1BNE A;  1TRP A;  4WFO A;  1BSA A;  2CG1 A;  1EKM A;  4XBX A;  1U8C B;  1ZGX A;  1DYU A;  5EQL A;  3F8X A;  3NXJ A;  3G71 3;  4CCV A;  1S72 3;  5IW9 A;  3BNE A;  5ELU A;  1HKX A;  3UL6 A;  3F9S A;  5IG4 A;  4GSP A;  3ROB A;  2F56 A;  4LGQ A;  1IT8 A;  3L0R A;  1JKG B;  2LYX A;  2L1S A;  3EQQ B;  1OHO A;  1T2I A;  1FGM A;  2CFG A;  1EEJ A;  3D5I A;  1FW7 A;  5AIG A;  1Q42 A;  5M18 A;  1OHS A;  1Q86 4;  1MWU A;  1W4N A;  2B1X B;  3U1W A;  1BNS A;  2OTJ 3;  1A90 A;  2OCT A;  3MG1 A;  3ALA A;  1M1K 4;  3G0K A;  5EEO A;  3I55 3;  3H3H A;  2Y74 A;  1W01 A;  4HVN A;  3VSY A;  1RRL A;  3RGA A;  1OCV A;  4EC6 A;  2CFK A;  4BL3 A;  2W0Q A;  3CPW 2;  1EUI C;  1G96 A;  2Q07 A;  4FMB A;  2CFD A;  5IG0 A;  4EXR A;  3A76 A;  1LQG C;  1S5A A;  4HYZ A;  5LC7 A;  1VQK 3;  1FGR A;  2AAD A;  1DMQ A;  3F14 A;  1GOY A;  1N5P A;  4HM4 B;  1Q7H A;  4N6U A;  3ZG0 A;  1OPY A;  1V58 A;  3DY5 A;  3NHX A;  4N6O B;  3UJM A;  1YHQ 3;  1I2F A;  1WNH A;  1BRJ A;  3FG3 A;  1OGZ A;  2IMJ A;  2M7O A;  5RNT A;  1IQ8 A;  1BUQ A;  5CK6 A;  2HML B;  4OVM A;  3FKA A;  2CX0 A;  2RGQ A;  3FLJ A;  2INX A;  5BVB A;  2R41 A;  3NQZ A;  3NV0 A;  1DE3 A;  2GEX A;  3SVA A;  1LQM B;  3F40 A;  3DM8 A;  2I9W A;  3B7C A;  1CEW I;  2BIR A;  3F8H A;  1B3S A;  3NM7 A;  1LOX A;  1UDI I;  2E2V A;  3EX9 A;  3F7X A;  1GY7 A;  3DGY A;  1FYS A;  1YVS A;  4HM1 B;  4FCM A;  5AYR B;  2F5W A;  1O7G B;  2BO9 B;  1RCL A;  3BND A;  3OWY A;  2F4Y A;  3PS8 A;  1TU5 A;  4AKZ A;  4EBG A;  2WGO A;  1Q9E A;  1BIR A;  2IUJ A;  3MHE A;  3V92 A;  3CC7 3;  1A2P A;  5FGO A;  2OQE A;  2CWU A;  3FZW A;  3EHC A;  1A2K A;  4IIA A;  3EB8 A;  3EC9 A;  4LEH A;  4J5K A;  1FUW A;  1IVU A;  5AEU B;  3NUV A;  4XBY A;  5M1A A;  1ISK A;  1I0X A;  2Z7A A;  2XEP A;  2ZA4 A;  1W00 A;  1EG9 B;  3AHS A;  3EF8 A;  3EN1 B;  1KQS 2;  1QJG A;  3DGL A;  1IYY A;  1RN1 A;  3S5C A;  1YJ9 3;  1IDP A;  2KXG A;  2WOF A;  3CC2 3;  3BNC A;  1T5Y A;  1RGC A;  1UCK A;  3T0U A;  2MF7 A;  1BNR A;  2BHM A;  1UI7 A;  1YIJ 3;  2F98 A;  4MMZ B;  1DET A;  3BLZ A;  3GZX B;  1I8V A;  2KF3 A;  3SOY A;  7RNT A;  5TGN A;  3CCQ 3;  3GZY B;  1LOV A;  3D5G A;  3CCS 3;  4KT3 B;  1QVF 2;  1QMA A;  1JRQ A;  2W03 A;  3PXM A;  4RZM A;  3CCL 3;  1KC8 4;  1GSP A;  5IEN A;  3WDG B;  2H0H A;  2Z77 A;  3NBR A;  2P0X A;  1DVC A;  1UCL A;  2GBW B;  2HMM B;  3OV4 A;  3OWS A;  1JBR A;  4LZI A;  3WA2 X;  1RNB A;  1RGE A;  3JUM A;  3PCR A;  4Q53 A;  1W2Z A;  1VQQ A;  4HM0 B;  3DGN A;  2JQ5 A;  3KSE D;  3NBB A;  2Z6B A;  2QA4 3;  1PFP A;  3KSP A;  1W7C A;  2WGQ A;  4MJD A;  1LOW A;  1IVW A;  1OF5 B;  4EW5 A;  2XH9 A;  3MG3 A;  1WMO A;  3HI7 A;  2UUG C;  3X3Z A;  1CH0 A;  3BIR A;  4HAA A;  4STD A;  1OAC A;  1MWR A;  1Y4K A;  3FG4 A;  2HMO B;  4R9K A;  4BTW A;  5JPP A;  4GHO A;  6GSP A;  2W56 B;  2XSH B;  4OK0 A;  4WWU C;  1BRG A;  4K90 B;  5IEP A;  1CYV A;  4BIR A;  3Q3F A;  3D3L A;  3UL5 A;  1DVD A;  1W02 A;  1QAL A;  3CPO A;  4CJN A;  2CIU A;  1B20 A;  1UUV B;  3WOF B;  3OWU A;  3H51 A;  5EVH A;  3X3Y A;  1AY7 A;  2GXF A;  1SII A;  3OW2 2;  1FA3 A;  1FGT A;  2HOH A;  3STD A;  1RGG A;  2RNT A;  4CPK A;  2YFI B;  1X1W A;  3FF0 A;  1SAR A;  2BNG A;  3KFQ C;  3B8L A;  5IF6 A;  3D4A A;  2F5M A;  4N3V A;  1YVB I;  3NX0 A;  2CKF B;  4N6L A;  5DRV A;  5IG5 A;  4FCJ A;  1LNH A;  3WOD G;  3CCU 3;  3DGM A;  4BU4 A;  4XBT A;  4TX4 A;  1NB5 I;  1M90 4;  1JBS A;  2HMK B;  5ELJ A;  4JRF A;  1ZS7 A;  2E2T A;  1RSN A;  4LSO A;  2XFS A;  3MYT A;  3EJV A;  3DZL A;  3UNL A;  4HM5 B;  4NHF A;  1ZO2 A;  2L4V A;  3RNT A;  1RGL A;  1I70 A;  1D6U A;  1C54 A;  3CNX A;  1WMN A;  4N6V 0;  2WO0 A;  4N6T A;  1N5H A;  2GU3 A;  1K73 4;  3SX1 A;  3B4O A;  3K63 A;  3IPT A;  1O7N B;  3KE7 A;  1LNI A;  1AQZ A;  1W6Y A;  1F8N A;  1B2U A;  1UI8 A;  1RTU A;  3LTB A;  2XRX B;  4PEJ A;  1BVI A;  1T3B A;  1VQM 3;  3FG1 A;  1TRQ A;  4ORL A;  2K54 A;  1RGF A;  2WOH A;  3LOY A;  1ROA A;  5A0O B;  2CFW A;  4EV5 A;  1GD3 A;  2BT3 A;  2STD A;  3X40 A;  5AII A;  5FW5 A;  1TTO A;  3QRD A;  1O7H B;  2RCD A;  5KP3 A;  2RBI A;  1OGX A;  2YX9 A;  1M1X B;  1YJN 3;  3CC4 3;  1O7M B;  2E2U A;  2F86 B;  3JUP A;  1G0T A;  2Y73 A;  2O3O A;  4FMD A;  1RCK A;  4MMY B;  4CDL A;  3SXX A;  1SQW A;  1QAF A;  3CCE 3;  2QEX 3;  1W2B 2;  1A67 A;  3MWZ A;  2KAA A;  1AVL A;  1TIJ A;  3SED A;  1ULJ B;  4HM6 B;  1J2B A;  1UW1 A;  1STD A;  1I3F A;  1UCJ A;  3WHO A;  2K0M A;  5D83 A;  1K28 A;  1OF5 A;  1R4Y A;  2K3D A;  4JF8 A;  3V99 A;  3CU3 A;  3S67 A;  4WP5 A;  3FH1 A;  1LOY A;  4QWT A;  4XM4 A;  1JZO A;  5STD A;  3AGN A;  4J8T A;  3X41 A;  2W56 A;  5IG3 A;  3DGO A;  3WMD A;  1FGQ A;  5GSP A;  4H61 A;  1IV7 A;  1W5Z A;  3N54 B;  1HU9 A;  4KFD A;  3KII A;  1VQP 3;  2OWP A;  3JUO A;  2XGN A;  1NDO B;  4X2H A;  4H3U A;  1RLS A;  1BSE A;  3AMO A;  2IUK A;  2O9U X;  2OTL 3;  1RGA A;  3HX8 A;  1US1 A;  4I5Q A;  2P09 A;  2JDI H;  2P38 A;  1JB2 A;  3CMA 3;  1N9E A;  1NB3 I;  1NWW A;  2CW9 A;  3O8Y A;  6STD A;  4L7K A;  3BU4 A;  1Q7Y 4;  1N8Q A;  2HMN B;  8CHO A;  4EV2 A;  1A2V A;  1IVV A;  3LTA A;  1BRS A;  4NRE A;  3X42 A;  3CCJ 3;  2GU1 A;  3CCM 3;  1VQ4 3;  2V1L A;  4IPB A;  3GAX A;  1UUW B;  2KF6 A;  1K9M 4;  4R1K A;  1KWI A;  2IY2 A;  3DH2 A;  1B27 A;  2BMO B;  1B21 A;  1JB4 A;  2A15 A;  3LTC A;  1JNQ A;  3B4P A;  3PZW A;  3HOH A;  3RDE A;  3PYJ A;  5G2G A;  1RN7 A;  1D6Y A;  1B2X A;  1AR0 A;  2FGT A;  3OX9 A;  1GMR A;  4ZM8 A;  9RNT A;  3ECF A;  2FXT A;  4OUQ A;  1GMP A;  4MEI A;  3DUK A;  1NNV A;  1ASK A;  1X1Y A;  4XB5 A;  4DKI A;  5KP1 A;  3N8B A;  3BNB A;  2LQV A;  8RNT A;  3LTD A;  1K8A 4;  4X2O A;  5LC6 A;  5CF2 A;  4RNY A;  2ZDJ A;  2W6J H;  4O3V A;  1BAN A;  1BSB A;  1UCI A;  2HMJ B;  3S29 A;  3LH4 A;  2YFJ B;  2OOV A;  1ULI B;  3T8U A;  1VZZ A;  2W2C A;  4HKV B;  1B2Z A;  1IQX A;  1BRK A;  3EBT A;  5AIF A;  3IMA B;  2CWV A;  3LZA A;  1TFO A;  1JN5 B;  2CG0 A;  2ZHX B;  4FMC A;  1O7P B;  3AMO B;  4KZ1 A;  1LXE A;  3T8N A;  4WYK A;  3I0Y A;  3GWR A;  1I2G A;  3VGN A;  2OQE C;  5KP4 A;  3A5E A;  1RKY A;  2D42 A;  1VQ8 3;  2GEY A;  2KCD A;  5DRE A;  4KVH A;  3J7Y d;  3CME 3;  1MGW A;  1RMS A;  2QGU A;  1VQ5 3;  2CFL A;  1GS3 A;  1VQ6 3;  3SLU A;  1AVK A;  1CQS A;  2CX1 A;  2H0I A;  5BIR A;  3TDG A;  6RNT A;  5HOH A;  1YGW A;  4NPB A;  2CC3 A;  7GSP A;  1GOU A;  3K7C A;  4L8P A;  2PNC A;  2W9P A;  3Q1C A;  2C11 A;  2W04 A;  1K41 A;  1KSI A;  4BL2 A;  1UGI A;  4J5G A;  3OXA A;  3LT9 A;  4FMA A;  3K9M C;  4K1V A;  1MOL A;  4R80 A;  1O7W B;  1UGH I;  1Z1S A;  4EYC A;  1EA2 A;  5JPU A;  2FNQ A;  1QVG 2;  3EBY A;  4GB5 A;  1RJO A;  2XSO B;  3CNM A;  1BAO A;  4HBR A;  5D82 A;  2B24 B;  1STF I;  3GZR A;  4BTY A;  1E97 A;  2ML6 A;  3LT8 A;  5CF1 A;  1IK3 A;  4RNZ A;  5JBS A;  1RGK A;  1WTH A;  3AGO A;  2QIY A;  5CLK A;  5M19 A;  3JUQ A;  3MPH A;  3GZB A;  4GL6 A;  2C4B A;  1NU3 A;  1BGS A;  4BTX A;  3JUN A;  4FCZ A;  3FSD A;  4O8S A;  1D6Z A;  3G4S 3;  1LRA A;  1E3V A;  1U5O A;  3D79 A;  1W6C A;  3PCS A;  3N9H A;  2P05 A;  4AEQ A;  1I2E A;  1MWT A;  3S27 A;  5HGR A;  4KFF A;  1BSC A;  3SYU A;  4G1M B;  1RDS A;  3Q2P A;  1T2H A;  1PYL A;  1IQY A;  2KF5 A;  5BXQ A;  1VQN 3;  1PY3 A;  3GRD A;  1BRH A;  1V57 A;  4WYK B;  3LYG A;  2MC8 A;  3HIG A;  2H0G A;  4LYL B;  1YGE A;  2OOV C;  2BMR B;  1GMQ A;  3HK4 A;  3ZG5 A;  4U13 A;  1JV2 B;  3WOE B;  2AAE A;  2GSP A;  2XF3 A;  5BU4 A;  1IT7 A;  1E3R A;  1FUT A;  3GSP A;  4AKY A;  4K1U A;  3I56 3;  5AI1 A;  3BB9 A;  2RFR A;  1X1X A;  3MSO A;  1RHL A;  1QAK A;  1MGR A;  2D1W A;  3AHW A;  3EE1 A;  5CXO A;  1PU4 A;  1HZ1 A;  2IA7 A;  1DMM A;  2ZL8 A;  1BNJ A;  5G1L A;  2XR8 B;  4WHA A;  1B2M A;  1FZU A;  2CH9 A;  2J8X B;  3VF1 A;  1BOX A;  1RRH A;  2KRT A;  1JB5 A;  1M9G A;  2SBL A;  3X3X A;  5AEW B;  1N9J A;  1FGO A;  4RNT A;  2R4I A;  1JN5 A;  1VQ7 3;  2ML5 A;  2XGL A;  2BMQ B;  4RBN A;  2UX0 A;  3K0Z A;  5AYS C;  1YIT 3;  1VQO 3;  1ROV A;  3QK9 A;  1TP6 A;  3SOA A;  3NQY A;  4XDW A;  4HM7 B;  3K5T A;  3CD6 3;  3MKI A;  1BUJ A;  2XFT A;  3CCR 3;  1MWS A;  3LXU X;  4HM8 B;  5G1K A;  1GOV A;  1GYB A;  3JVC A;  1RNT A;  1BNG A;  1JJ2 2;  4J9A A;  1BSD A;  3CCV 3;  4KFE A;  3FGY A;  1X1U A;  3LML A;  3V98 A;  3E99 A;  3KN4 A;  1SIH A;  5D81 A;  5AIH A;  1YJW 3;  1Q40 A;  1B2S A;  1G02 A;  4HOH A;  1WQL B;  3HZP A;  4ILF A;  1OHP A;  2C10 A;  2F99 A;  3CXC 2;  3PGB A;  4IT7 A;  1SPU A;  3F7S A;  1IV9 A;  2BU4 A;  4K61 A;  3G8Z A;  1RN4 A;  2YFL B;  1AV4 A;  4N6N B;  3URP A;  4FR9 A;  3FCS B;  1JBT A;  4HM2 B;  2CWT A;  2P0M A;  1Q81 4;  5IER A;  1VQ9 3;  3HII A;  1IU7 A;  3FF2 A;  3WA3 A;  3U97 A;  3MG2 A;  4I4K A;  3KZT A;  2IYJ A;  1IVX A;  1W6G A;  1DMN A;  1JKG A;  3NBJ A;  1ZX2 A;  3NM2 A;  1UUG B;  2UGI A;  4O02 B;  3WR2 A;  1MNL A;  2KF4 A;  2GBX B;  1HYF A;  4O2H A;  3IJE B; 
#chains in the Genus database with same CATH homology
 1RGH A;  1YNV X;  2SAR A;  3AHS A;  1RCK A;  1IYY A;  1RN1 A;  3KCH A;  1BAO A;  1BNI A;  2KAA A;  1RGC A;  1UCK A;  1BNR A;  2ZA4 A;  1I3F A;  1UCJ A;  3WHO A;  1RGK A;  1R4Y A;  1DET A;  3AGO A;  1FUS A;  1I8V A;  2KF3 A;  7RNT A;  1BU4 A;  1LOV A;  3D5G A;  1LOY A;  2C4B A;  1BRN L;  1BGS A;  1GSP A;  3AGN A;  1I3I A;  1LRA A;  1BNF A;  5GSP A;  1UCL A;  1I0V A;  1I2E A;  1JBR A;  1BRI A;  1RGE A;  1RNB A;  1BSC A;  3SYU A;  1RDS A;  1T2H A;  1PYL A;  1BSE A;  1RLS A;  1BNE A;  1TRP A;  2KF5 A;  1PY3 A;  1BSA A;  1BRH A;  1RGA A;  1ZGX A;  1GMQ A;  1LOW A;  2AAE A;  2GSP A;  5BU4 A;  3GSP A;  1FUT A;  1CH0 A;  3BIR A;  3BU4 A;  4GSP A;  4HAA A;  1X1X A;  2F56 A;  1RHL A;  3AHW A;  1MGR A;  1BRS A;  4GHO A;  1HZ1 A;  1B2M A;  6GSP A;  1BNJ A;  1BRG A;  1T2I A;  1FZU A;  3Q3F A;  4BIR A;  1FW7 A;  3D5I A;  1BOX A;  2KF6 A;  1B20 A;  1BNS A;  3DH2 A;  1B27 A;  1AY7 A;  4RNT A;  1B21 A;  2HOH A;  3HOH A;  1RGG A;  2RNT A;  1B2X A;  1X1W A;  1GMR A;  1SAR A;  9RNT A;  3D4A A;  2F5M A;  1GMP A;  1BUJ A;  1X1Y A;  4BU4 A;  8RNT A;  1JBS A;  1GOV A;  1RNT A;  1BNG A;  1RSN A;  1BAN A;  1BSB A;  1UCI A;  1BSD A;  2AAD A;  1GOY A;  1X1U A;  1B2Z A;  1BRK A;  1I2F A;  1BRJ A;  3RNT A;  5RNT A;  1B2S A;  1G02 A;  1I70 A;  1RGL A;  4HOH A;  1C54 A;  1DE3 A;  1I2G A;  3A5E A;  2BIR A;  2BU4 A;  1B3S A;  1RN4 A;  1LNI A;  1AQZ A;  3URP A;  1B2U A;  3DGY A;  1FYS A;  1MGW A;  1RMS A;  1RTU A;  1BVI A;  1YVS A;  1JBT A;  2F5W A;  1RCL A;  2F4Y A;  1TRQ A;  1RGF A;  1Q9E A;  5BIR A;  1BIR A;  6RNT A;  5HOH A;  1YGW A;  1A2P A;  7GSP A;  1GOU A;  1TTO A;  3WR2 A;  2KF4 A;  2RBI A;  4J5K A;  1HYF A;  4J5G A;  1I0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...