1RGHA

Hydrolase, guanyloribonuclease
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ribonuclease from Streptomyces aureofaciens at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase (guanyloribonuclease)
molecule keywords RIBONUCLEASE
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1995-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rghA00
1BRJA 1B2SA 1I8VA 1B3SA 2GSPA 2ZA4A 1B2ZA 1I0XA 9RNTA 1BIRA 1I2FA 1UCIA 1HYFA 2F4YA 3D4AA 1IYYA 2F56A 1LNIA 1UCJA 1RN4A 3DGYA 1BRGA 3GSPA 1MGRA 1RNBA 1B2XA 2KF6A 6GSPA 3AHWA 1JBRA 1LOWA 2KF3A 1GOYA 1AY7A 1PY3A 1R4YA 1BNFA 2AADA 1BRIA 3AGOA 1MGWA 1C54A 3Q3FA 1X1YA 1B21A 3SYUA 3AGNA 1BANA 4HAAA 1FYSA 1HZ1A 1BNSA 1JBSA 1GSPA 2SARA 1BNIA 1FZUA 1GOUA 1BSCA 1RGHA 1BVIA 2BU4A 1I2GA 5HOHA 3A5EA 2KF5A 2RNTA 5RNTA 1B2MA 1RGKA 1BRNL 1B20A 8RNTA 3BIRA 1FUSA 3D5GA 3WR2A 1GOVA 1FUTA 1I2EA 1BNEA 1I3IA 1BSEA 3RNTA 1LRAA 1UCLA 2HOHA 1RSNA 1B2UA 1BSAA 1BSBA 1FW7A 1UCKA 2BIRA 4GHOA 3D5IA 7RNTA 2AAEA 1BOXA 1X1UA 1X1WA 1AQZA 4J5GA 1DETA 1T2IA 4HOHA 1GMQA 5GSPA 3URPA 1X1XA 1SARA 1RGGA 1RLSA 1A2PA 1BAOA 1TRPA 1BUJA 1GMRA 2F5WA 2C4BA 5BIRA 1BSDA 6RNTA 1BRHA 2RBIA 4RNTA 1G02A 1RGAA 4BIRA 1TRQA 1RGFA 2F5MA 3KCHA 1I0VA 7GSPA 1YGWA 1BNJA 3WHOA 1JBTA 1ZGXA 4GSPA 1RCLA 1RCKA 1RHLA 1DE3A 3HOHA 1BRSA 1LOVA 3DH2A 2KAAA 1BNGA 1BU4A 1I70A 2KF4A 1TTOA 1YVSA 1RGLA 1RDSA 1CH0A 1Q9EA 1BNRA 1RGCA 1YNVX 3AHSA 1RGEA 1LOYA 3BU4A 5BU4A 1I3FA 1B27A 1GMPA 1RTUA 4J5KA 1PYLA 1RNTA 1BRKA 1BGSA 1T2HA 4BU4A 1RN1A 1RMSA
chains in the Genus database with same CATH superfamily
5AIGA 1BRJA 5G2GA 1PFPA 3OWSA 2P09A 1C7HA 1A2VA 4K1UA 1JKGB 1K41A 1VQO3 2P38A 1EA2A 1GY6A 2F56A 2ZHXB 1UCJA 3HIGA 1OPYA 3F40A 4R4KA 1RNBA 1IVWA 1DMNA 2MF7A 3DGOA 3NBRA 4FR9A 4XM4A 3AHWA 3VF1A 1Q7HA 4BTXA 2GU3A 1PY3A 2AADA 1BNFA 3CC43 3OW22 3T8NA 4KFDA 4FMAA 2CC3A 4NREA 2W0QA 3Q3FA 1X1YA 1B21A 2A15A 1KSIA 3N9HA 3JUQA 3X3YA 3LOYA 1YJN3 1JZDA 1IT7A 1RJOA 1GY5A 3MSOA 1FYSA 1AR0A 4R9LA 1GSPA 1JBSA 3PCRA 1GD3A 2Z7AA 1HKXA 1SJWA 1S723 1Q40B 1I2GA 1OGZA 1PU4A 3DM8A 5G1KA 2XR8B 1Q824 1MWRA 5RNTA 3D79A 3G8ZA 1STFI 3TDGA 1RGKA 2CFLA 4WFOA 1ROAA 4HYZA 8RNTA 2CG0A 3ER7A 3D5GA 2CFWA 1UI8A 4EC6A 1VQN3 3AMOA 4FMCA 4K90B 2XFTA 3CU3A 1VQQA 3EQQB 3FF2A 2CHCA 2HMLB 1KWIA 6STDA 1W01A 1US1A 4RNZA 1BSAA 3EBTA 3NX0A 1G96A 2CWTA 4EW5A 1OF5B 2L4VA 7RNTA 2AAEA 1BOXA 3BLZA 3CCR3 2F98A 1IVXA 3NQYA 4HOHA 1LXEA 5M19A 4CPKA 1RLSA 5STDA 5I97A 4MMZB 1TFKA 2XEPA 3FF0A 2KRTA 4N6V0 4XDVA 4LYLB 1M904 3STDA 2F5WA 3T8UA 1OHPA 1HU9A 6RNTA 1BRHA 3LXUX 1K734 3V99A 3S67A 1IK3A 3HK4A 2LQVA 1D6UA 2W04A 4N6UA 3PYJA 1CYVA 2YX9A 3ECFA 3PCSA 3BNBA 4FCMA 3KCHA 1I0VA 3LTBA 3ROBA 4EYCA 3HIIA 3CC73 3EF8A 3WHOA 1ZGXA 2ZDJA 3SVAA 1QMAA 1SIHA 3SX1A 3OWUA 3U1WA 1J2BA 5HGRA 1QALA 3FH1A 4G1MB 2BMOB 1FGOA 3OV4A 2KAAA 2HMJB 2W56A 4JRFA 3MG3A 4HM4B 3D3LA 3GZBA 1NB5I 4WP5A 3WMDA 1CH0A 1Q9EA 1WMPA 5AEWB 3FKAA 1BNRA 5EQLA 3F14A 4ORLA 5BU4A 3EN8A 4FMBA 3WODG 3S29A 5IG5A 2E2TA 3EJVA 3CCV3 1DMQA 1RTUA 4J5KA 2QA43 3EC9A 2E2UA 2F99A 4H61A 3KFQC 3UNLA 4BU4A 5BVBA 1U5OA 5DRVA 2Y73A 2CX0A 4HM8B 2UGIA 2HMKB 1I8VA 2CFDA 2ZA4A 5M18A 1I0XA 2UUGC 4HVNA 5D83A 2K0MA 2F86B 4MMYB 5CF2A 1VQ93 2I9WA 1WNHA 3NM2A 4HZBB 1N8R4 2M7OA 4GL6A 3GSPA 4HKVB 3KE7A 4R9KA 1Q7Y4 3A76A 1NDOB 1RKYA 2GBWB 4HM6B 1JBRA 3U97A 1GOYA 2QEX3 3AGOA 4HM5B 3F8HA 1MGWA 3JUMA 2D1WA 3OXAA 3X40A 1YJW3 1JKGA 1LOXA 2GXFA 4XDWA 4RNYA 2HMOB 5IG0A 2WGQA 5D81A 3SYUA 2O9UX 4IPBA 4AKZA 3CCS3 1KD14 4MJDA 3AGNA 1BANA 2YFLB 3NV0A 1D6ZA 1HZ1A 3X3ZA 2GEXA 5AYRB 1QVG2 1GOUA 3RGRA 1JB5A 2UX0A 1F8NA 2BU4A 3WDGB 1MWTA 1Q814 5HOHA 2ZL8A 1O7WB 3S5CA 4WYKA 4BTYA 1NJI4 2RNTA 3F8XA 1EG9B 1NB3I 1W6CA 2W03A 5CF1A 1LVNA 5LC6A 1BRNL 4K1VA 5IENA 1YVBI 2JDIH 3V92A 3SXXA 5BXQA 1JNQA 5AYSC 3VGNA 3WR2A 1IQYA 2OOVA 1BNEA 1BSEA 5IW9A 1S5AA 5KP4A 4NHFA 1GS3A 3CCE3 1YJ93 1UCLA 3FCSB 5FGOA 1VQ83 1FUWA 4GHOA 5EEOA 4RZMA 4J9AA 3EBYA 4EXRA 3GZXB 1IDPA 1VZZA 1EUIC 1DETA 1FGRA 2PNCA 3ZG5A 3URPA 1X1XA 2STDA 3DUKA 4N6MA 2QIYA 4K61A 1QVF2 4HM7B 1BAOA 1BUJA 3CCM3 1JB2A 4AKYA 3K0ZA 3PZWA 3F7XA 4O3VA 5IF6A 2XFSA 2J8XB 2Z6BA 3DGMA 2RBIA 1JZOA 2BMRB 2H0IA 4O2HA 1G02A 4RNTA 2RGQA 1UGHI 5ELUA 4LZIA 3WA2X 1TRQA 1V58A 3ZFZA 3SEDA 3CC23 1SQWA 3KSED 4AEQA 1CQSA 3CCU3 1RGFA 2ML6A 3JVCA 4HM0B 2CFGA 1AVKA 1VQ73 1FA3A 1VQ53 1OACA 4HJLB 1LQGC 3M8CA 1RCLA 1RCKA 2GEYA 2WO0A 1DE3A 1T3BA 4H3UA 3G713 3FSDA 1RRHA 3B4OA 1LOVA 3LYGA 4EV5A 1IVUA 1I70A 2GU1A 2KF4A 1YVSA 2H0HA 3DGLA 4LSOA 4MMXB 1Q42A 1RGLA 4WWUC 1N8QA 1ASKA 3MG2A 4L8OA 1MWUA 1RGCA 2INXA 1YNVX 3X3XA 3NQZA 3AHSA 4TX4A 1DMMA 3OWYA 1I3FA 3ALAA 1OF5A 3J7Yd 4PEJA 2E2VA 5AIIA 3HI7A 2OTL3 1RNTA 2CWUA 1BGSA 1NO3A 2P05A 3B4PA 4BL3A 1RN1A 1W5ZA 1RMSA 3EN1B 1NNVA 1K28A 4J8TA 1UDII 2MC8A 1GYBA 4BTWA 1QAFA 2GSPA 1B2ZA 2RSXA 9RNTA 1BIRA 3L0RA 1I2FA 3DGNA 1IV9A 4N3VA 1IYYA 1VQP3 1L5GB 3K5TA 2YFJB 1OGXA 1DYUA 1SIIA 3DGYA 1BRGA 1NU3A 1MGRA 3G0KA 4N6LA 2KF6A 2CFKA 3CMA3 1IV7A 3MG1A 1W02A 2W6JH 4FCZA 2OTJ3 1LOWA 3RGAA 3N8BA 5AEUB 2KF3A 3RDEA 1R4YA 1K9M4 1C54A 1UUGB 4N6TA 2QGUA 1E97A 3B7CA 3MKIA 3X41A 3JUNA 2Z76A 3CPOA 2RFRA 3LT9A 1UUVB 4KVHA 4GB5A 2W2CA 2K54A 5IEPA 5D82A 2CK3H 3CCJ3 1ULJB 2BNGA 1T5YA 3LTCA 3MYTA 4HAAA 5DREA 3LMLA 3UL6A 1VQ43 1U8CB 1BNSA 3ZG0A 2WOFA 1FZUA 1QAKA 2CX1A 1RGHA 4WHAA 1BVIA 3O8YA 2CG1A 5JBSA 2KXGA 2V1LA 4HM2B 3N54B 4RBNA 1QJGA 2RCDA 4FCJA 4HM1B 1VQK3 1YI23 5LC7A 1B2MA 1LQMB 1YIJ3 1TFOA 1B20A 1ULIB 2IUJA 2XSOB 1N5PA 3BIRA 1BUQA 1FUSA 2H0GA 2L1SA 1GOVA 1V74A 3HX8A 1W7CA 3LZAA 1I2EA 2CIUA 4LGQA 1I3IA 3GZRA 3LTDA 2FGTA 4XB5A 1TJDA 1LRAA 2SBLA 4N6NB 2HOHA 1RSNA 3IMAB 3BNDA 4KFFA 2P0MA 1GD4A 2OCTA 1BSBA 1IT8A 3MPHA 1UCKA 4KZ1A 2HMNB 2BIRA 1TUHA 8CHOA 1X1UA 4NPBA 1AQZA 1WMNA 4HBRA 4J5GA 1ROVA 3UL5A 1RGGA 1A2PA 1ISKA 1JV2B 2IYJA 1Y4KA 1LNHA 4XBXA 3FG1A 4KFEA 1EKMA 4KT3B 5BIRA 2OQEC 3G6E3 3PS8A 1IQXA 1DVDA 4R1KA 3Q2PA 5CK6A 1Z1SA 7STDA 2BHMA 3FG4A 3LTAA 3CNMA 1JN5A 3NBBA 3K9MC 2JQ5A 2LYXA 2F5MA 3T0UA 4LEHA 7GSPA 1YGWA 1JB4A 1BNJA 3I0YA 1MNLA 1UI7A 5AIFA 4GSPA 3GAXA 4HM3B 3IPTA 1JBTA 1KQS2 3MWZA 5IG3A 2W9PA 3AMOB 2D42A 2P0XA 3BNCA 1ZS7A 3KN4A 3KZTA 4BL2A 1VQ63 4O8SA 3HOHA 1BRSA 3NV0B 3DH2A 1N9EA 5KP1A 1BU4A 1TTOA 4OUQA 2Q07A 5CLKA 1RDSA 3OX9A 2CKFB 4R80A 2IY2A 2BMQB 3FZWA 3NBJA 3BNEA 1LOYA 1YGEA 1Q40A 1OHSA 3BU4A 5EVHA 2IUKA 1UGIA 1R4CA 1A67A 1VQM3 1GMPA 5M1AA 1UW1A 1E3VA 3PGBA 1OHOA 3GZYB 1AVLA 3EB8A 3KIIA 5KP3A 3E99A 4MEIA 4OK0A 1B2SA 3DXOA 3I553 1B3SA 1YHQ3 1EQKA 1JRQA 1W6GA 2F4YA 1UCIA 1HYFA 1SPUA 3D4AA 4O02B 2Y74A 2BT3A 3FGYA 3UJMA 1WTHA 1LNIA 3G16A 2GBXB 5ELJA 1CYUA 4N6OB 1RN4A 1MOLA 1VQL3 3X42A 2B1XB 2XF3A 1OUNA 3LH4A 3UB1A 3BB9A 3NHXA 3EE1A 1O7GB 1B2XA 6GSPA 3FLJA 3QRDA 2XGLA 4DKIA 2FXTA 1AY7A 1BRIA 3PXMA 1W00A 4STDA 1WQLB 3KKGA 3V98A 1G0TA 3GWRA 3CPW2 1JJ22 4ZM8A 2BO9B 1FGMA 3H3HA 3K7CA 3NUVA 4HZ9B 1Q864 4ILFA 1KC84 2SARA 4CDLA 4CJNA 1BNIA 1ZX2A 5JPPA 4FMDA 1BSCA 4QWTA 3CCL3 4LMIA 4X2HA 5A0OB 1M1XB 3WOEB 1IU7A 3A5EA 1O7PB 1AV4A 2KF5A 3HZPA 2HMMB 3IJEB 3F7SA 4I5QA 1IQ8A 3CD63 1MWSA 4CCVA 3WA3A 2WOHA 3KSPA 3I563 2CH9A 1GY7A 3CNXA 1N9JA 3JUPA 5G1LA 1W2B2 1FUTA 2C11A 2C10A 3Q1CA 1NWWA 2OOVC 5IEOA 1FGQA 3RNTA 1UUWB 5AIHA 3K63A 1W2ZA 1V57A 1RRLA 3DZLA 1B2UA 1W4NA 4WYKB 1FW7A 3MHEA 1K8A4 1M1K4 3NM7A 2OWPA 3H51A 3D5IA 4I4KA 5FW5A 3S28A 2W9QA 3Q90A 1X1WA 2R4IA 3JUOA 3QK9A 1T2IA 5GSPA 1GMQA 4L7KA 1WMOA 4EBGA 1SARA 2IA7A 5AI1A 3FG3A 2WGOA 3DMCA 1TRPA 1M9GA 1GMRA 3NXJA 2XH9A 2IMJA 2K3DA 2W56B 2C4BA 2KCDA 1BSDA 1N5HA 5IERA 3EHCA 2CWVA 1RGAA 4BIRA 1A2KA 1OH0A 1O7MB 4IT7A 1O7HB 1O7NB 2XSHB 2XGNA 3SLUA 1ZO2A 3DY5A 3VSYA 1W6YA 3S27A 3SOAA 1TP6A 3SOYA 2XRXB 1JN5B 4L8PA 1RHLA 2O3OA 1E3RA 3GRDA 4XBTA 4EV2A 2OQEA 1D6YA 1TU5A 3CXC2 2YFIB 5JPUA 1BNGA 4U13A 3F9SA 1FGTA 3G4S3 2PZVA 4X2OA 3CME3 1A90A 1IVVA 3B8LA 1DVCA 2R41A 1STDA 5IG4A 4XBYA 1RN7A 1EEJA 1TIJA 1OCVA 4OVMA 1RGEA 2Z77A 4Q53A 3LT8A 1B27A 1CEWI 2ML5A 4IIAA 1YIT3 3EX9A 4JF8A 1PYLA 3CCQ3 5TGNA 1BRKA 2B24B 2FNQA 1T2HA 3WOFB 3D9RA 2CW9A 5CXOA
chains in the Genus database with same CATH topology
1BRJA 1B2SA 1I8VA 1B3SA 2GSPA 2ZA4A 1B2ZA 1I0XA 9RNTA 1BIRA 1I2FA 1UCIA 1HYFA 2F4YA 3D4AA 1IYYA 2F56A 1LNIA 1UCJA 1RN4A 3DGYA 1BRGA 3GSPA 1MGRA 1RNBA 1B2XA 2KF6A 6GSPA 3AHWA 1JBRA 1LOWA 2KF3A 1GOYA 1AY7A 1PY3A 1R4YA 1BNFA 2AADA 1BRIA 3AGOA 1MGWA 1C54A 3Q3FA 1X1YA 1B21A 3SYUA 3AGNA 1BANA 4HAAA 1FYSA 1HZ1A 1BNSA 1JBSA 1GSPA 2SARA 1BNIA 1FZUA 1GOUA 1BSCA 1RGHA 1BVIA 2BU4A 1I2GA 5HOHA 3A5EA 2KF5A 2RNTA 5RNTA 1B2MA 1RGKA 1BRNL 1B20A 8RNTA 3BIRA 1FUSA 3D5GA 3WR2A 1GOVA 1FUTA 1I2EA 1BNEA 1I3IA 1BSEA 3RNTA 1LRAA 1UCLA 2HOHA 1RSNA 1B2UA 1BSAA 1BSBA 1FW7A 1UCKA 2BIRA 4GHOA 3D5IA 7RNTA 2AAEA 1BOXA 1X1UA 1X1WA 1AQZA 4J5GA 1DETA 1T2IA 4HOHA 1GMQA 5GSPA 3URPA 1X1XA 1SARA 1RGGA 1RLSA 1A2PA 1BAOA 1TRPA 1BUJA 1GMRA 2F5WA 2C4BA 5BIRA 1BSDA 6RNTA 1BRHA 2RBIA 4RNTA 1G02A 1RGAA 4BIRA 1TRQA 1RGFA 2F5MA 3KCHA 1I0VA 7GSPA 1YGWA 1BNJA 3WHOA 1JBTA 1ZGXA 4GSPA 1RCLA 1RCKA 1RHLA 1DE3A 3HOHA 1BRSA 1LOVA 3DH2A 2KAAA 1BNGA 1BU4A 1I70A 2KF4A 1TTOA 1YVSA 1RGLA 1RDSA 1CH0A 1Q9EA 1BNRA 1RGCA 1YNVX 3AHSA 1RGEA 1LOYA 3BU4A 5BU4A 1I3FA 1B27A 1GMPA 1RTUA 4J5KA 1PYLA 1RNTA 1BRKA 1BGSA 1T2HA 4BU4A 1RN1A 1RMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRJ A;  1B2S A;  1I8V A;  1B3S A;  2GSP A;  2ZA4 A;  1B2Z A;  1I0X A;  9RNT A;  1BIR A;  1I2F A;  1UCI A;  1HYF A;  2F4Y A;  3D4A A;  1IYY A;  2F56 A;  1LNI A;  1UCJ A;  1RN4 A;  3DGY A;  1BRG A;  3GSP A;  1MGR A;  1RNB A;  1B2X A;  2KF6 A;  6GSP A;  3AHW A;  1JBR A;  1LOW A;  2KF3 A;  1GOY A;  1AY7 A;  1PY3 A;  1R4Y A;  1BNF A;  2AAD A;  1BRI A;  3AGO A;  1MGW A;  1C54 A;  3Q3F A;  1X1Y A;  1B21 A;  3SYU A;  3AGN A;  1BAN A;  4HAA A;  1FYS A;  1HZ1 A;  1BNS A;  1JBS A;  1GSP A;  2SAR A;  1BNI A;  1FZU A;  1GOU A;  1BSC A;  1RGH A;  1BVI A;  2BU4 A;  1I2G A;  5HOH A;  3A5E A;  2KF5 A;  2RNT A;  5RNT A;  1B2M A;  1RGK A;  1BRN L;  1B20 A;  8RNT A;  3BIR A;  1FUS A;  3D5G A;  3WR2 A;  1GOV A;  1FUT A;  1I2E A;  1BNE A;  1I3I A;  1BSE A;  3RNT A;  1LRA A;  1UCL A;  2HOH A;  1RSN A;  1B2U A;  1BSA A;  1BSB A;  1FW7 A;  1UCK A;  2BIR A;  4GHO A;  3D5I A;  7RNT A;  2AAE A;  1BOX A;  1X1U A;  1X1W A;  1AQZ A;  4J5G A;  1DET A;  1T2I A;  4HOH A;  1GMQ A;  5GSP A;  3URP A;  1X1X A;  1SAR A;  1RGG A;  1RLS A;  1A2P A;  1BAO A;  1TRP A;  1BUJ A;  1GMR A;  2F5W A;  2C4B A;  5BIR A;  1BSD A;  6RNT A;  1BRH A;  2RBI A;  4RNT A;  1G02 A;  1RGA A;  4BIR A;  1TRQ A;  1RGF A;  2F5M A;  3KCH A;  1I0V A;  7GSP A;  1YGW A;  1BNJ A;  3WHO A;  1JBT A;  1ZGX A;  4GSP A;  1RCL A;  1RCK A;  1RHL A;  1DE3 A;  3HOH A;  1BRS A;  1LOV A;  3DH2 A;  2KAA A;  1BNG A;  1BU4 A;  1I70 A;  2KF4 A;  1TTO A;  1YVS A;  1RGL A;  1RDS A;  1CH0 A;  1Q9E A;  1BNR A;  1RGC A;  1YNV X;  3AHS A;  1RGE A;  1LOY A;  3BU4 A;  5BU4 A;  1I3F A;  1B27 A;  1GMP A;  1RTU A;  4J5K A;  1PYL A;  1RNT A;  1BRK A;  1BGS A;  1T2H A;  4BU4 A;  1RN1 A;  1RMS A; 
#chains in the Genus database with same CATH topology
 5AIG A;  1BRJ A;  5G2G A;  1PFP A;  3OWS A;  2P09 A;  1C7H A;  1A2V A;  4K1U A;  1JKG B;  1K41 A;  1VQO 3;  2P38 A;  1EA2 A;  1GY6 A;  2F56 A;  2ZHX B;  1UCJ A;  3HIG A;  1OPY A;  3F40 A;  4R4K A;  1RNB A;  1IVW A;  1DMN A;  2MF7 A;  3DGO A;  3NBR A;  4FR9 A;  4XM4 A;  3AHW A;  3VF1 A;  1Q7H A;  4BTX A;  2GU3 A;  1PY3 A;  2AAD A;  1BNF A;  3CC4 3;  3OW2 2;  3T8N A;  4KFD A;  4FMA A;  2CC3 A;  4NRE A;  2W0Q A;  3Q3F A;  1X1Y A;  1B21 A;  2A15 A;  1KSI A;  3N9H A;  3JUQ A;  3X3Y A;  3LOY A;  1YJN 3;  1JZD A;  1IT7 A;  1RJO A;  1GY5 A;  3MSO A;  1FYS A;  1AR0 A;  4R9L A;  1GSP A;  1JBS A;  3PCR A;  1GD3 A;  2Z7A A;  1HKX A;  1SJW A;  1S72 3;  1Q40 B;  1I2G A;  1OGZ A;  1PU4 A;  3DM8 A;  5G1K A;  2XR8 B;  1Q82 4;  1MWR A;  5RNT A;  3D79 A;  3G8Z A;  1STF I;  3TDG A;  1RGK A;  2CFL A;  4WFO A;  1ROA A;  4HYZ A;  8RNT A;  2CG0 A;  3ER7 A;  3D5G A;  2CFW A;  1UI8 A;  4EC6 A;  1VQN 3;  3AMO A;  4FMC A;  4K90 B;  2XFT A;  3CU3 A;  1VQQ A;  3EQQ B;  3FF2 A;  2CHC A;  2HML B;  1KWI A;  6STD A;  1W01 A;  1US1 A;  4RNZ A;  1BSA A;  3EBT A;  3NX0 A;  1G96 A;  2CWT A;  4EW5 A;  1OF5 B;  2L4V A;  7RNT A;  2AAE A;  1BOX A;  3BLZ A;  3CCR 3;  2F98 A;  1IVX A;  3NQY A;  4HOH A;  1LXE A;  5M19 A;  4CPK A;  1RLS A;  5STD A;  5I97 A;  4MMZ B;  1TFK A;  2XEP A;  3FF0 A;  2KRT A;  4N6V 0;  4XDV A;  4LYL B;  1M90 4;  3STD A;  2F5W A;  3T8U A;  1OHP A;  1HU9 A;  6RNT A;  1BRH A;  3LXU X;  1K73 4;  3V99 A;  3S67 A;  1IK3 A;  3HK4 A;  2LQV A;  1D6U A;  2W04 A;  4N6U A;  3PYJ A;  1CYV A;  2YX9 A;  3ECF A;  3PCS A;  3BNB A;  4FCM A;  3KCH A;  1I0V A;  3LTB A;  3ROB A;  4EYC A;  3HII A;  3CC7 3;  3EF8 A;  3WHO A;  1ZGX A;  2ZDJ A;  3SVA A;  1QMA A;  1SIH A;  3SX1 A;  3OWU A;  3U1W A;  1J2B A;  5HGR A;  1QAL A;  3FH1 A;  4G1M B;  2BMO B;  1FGO A;  3OV4 A;  2KAA A;  2HMJ B;  2W56 A;  4JRF A;  3MG3 A;  4HM4 B;  3D3L A;  3GZB A;  1NB5 I;  4WP5 A;  3WMD A;  1CH0 A;  1Q9E A;  1WMP A;  5AEW B;  3FKA A;  1BNR A;  5EQL A;  3F14 A;  4ORL A;  5BU4 A;  3EN8 A;  4FMB A;  3WOD G;  3S29 A;  5IG5 A;  2E2T A;  3EJV A;  3CCV 3;  1DMQ A;  1RTU A;  4J5K A;  2QA4 3;  3EC9 A;  2E2U A;  2F99 A;  4H61 A;  3KFQ C;  3UNL A;  4BU4 A;  5BVB A;  1U5O A;  5DRV A;  2Y73 A;  2CX0 A;  4HM8 B;  2UGI A;  2HMK B;  1I8V A;  2CFD A;  2ZA4 A;  5M18 A;  1I0X A;  2UUG C;  4HVN A;  5D83 A;  2K0M A;  2F86 B;  4MMY B;  5CF2 A;  1VQ9 3;  2I9W A;  1WNH A;  3NM2 A;  4HZB B;  1N8R 4;  2M7O A;  4GL6 A;  3GSP A;  4HKV B;  3KE7 A;  4R9K A;  1Q7Y 4;  3A76 A;  1NDO B;  1RKY A;  2GBW B;  4HM6 B;  1JBR A;  3U97 A;  1GOY A;  2QEX 3;  3AGO A;  4HM5 B;  3F8H A;  1MGW A;  3JUM A;  2D1W A;  3OXA A;  3X40 A;  1YJW 3;  1JKG A;  1LOX A;  2GXF A;  4XDW A;  4RNY A;  2HMO B;  5IG0 A;  2WGQ A;  5D81 A;  3SYU A;  2O9U X;  4IPB A;  4AKZ A;  3CCS 3;  1KD1 4;  4MJD A;  3AGN A;  1BAN A;  2YFL B;  3NV0 A;  1D6Z A;  1HZ1 A;  3X3Z A;  2GEX A;  5AYR B;  1QVG 2;  1GOU A;  3RGR A;  1JB5 A;  2UX0 A;  1F8N A;  2BU4 A;  3WDG B;  1MWT A;  1Q81 4;  5HOH A;  2ZL8 A;  1O7W B;  3S5C A;  4WYK A;  4BTY A;  1NJI 4;  2RNT A;  3F8X A;  1EG9 B;  1NB3 I;  1W6C A;  2W03 A;  5CF1 A;  1LVN A;  5LC6 A;  1BRN L;  4K1V A;  5IEN A;  1YVB I;  2JDI H;  3V92 A;  3SXX A;  5BXQ A;  1JNQ A;  5AYS C;  3VGN A;  3WR2 A;  1IQY A;  2OOV A;  1BNE A;  1BSE A;  5IW9 A;  1S5A A;  5KP4 A;  4NHF A;  1GS3 A;  3CCE 3;  1YJ9 3;  1UCL A;  3FCS B;  5FGO A;  1VQ8 3;  1FUW A;  4GHO A;  5EEO A;  4RZM A;  4J9A A;  3EBY A;  4EXR A;  3GZX B;  1IDP A;  1VZZ A;  1EUI C;  1DET A;  1FGR A;  2PNC A;  3ZG5 A;  3URP A;  1X1X A;  2STD A;  3DUK A;  4N6M A;  2QIY A;  4K61 A;  1QVF 2;  4HM7 B;  1BAO A;  1BUJ A;  3CCM 3;  1JB2 A;  4AKY A;  3K0Z A;  3PZW A;  3F7X A;  4O3V A;  5IF6 A;  2XFS A;  2J8X B;  2Z6B A;  3DGM A;  2RBI A;  1JZO A;  2BMR B;  2H0I A;  4O2H A;  1G02 A;  4RNT A;  2RGQ A;  1UGH I;  5ELU A;  4LZI A;  3WA2 X;  1TRQ A;  1V58 A;  3ZFZ A;  3SED A;  3CC2 3;  1SQW A;  3KSE D;  4AEQ A;  1CQS A;  3CCU 3;  1RGF A;  2ML6 A;  3JVC A;  4HM0 B;  2CFG A;  1AVK A;  1VQ7 3;  1FA3 A;  1VQ5 3;  1OAC A;  4HJL B;  1LQG C;  3M8C A;  1RCL A;  1RCK A;  2GEY A;  2WO0 A;  1DE3 A;  1T3B A;  4H3U A;  3G71 3;  3FSD A;  1RRH A;  3B4O A;  1LOV A;  3LYG A;  4EV5 A;  1IVU A;  1I70 A;  2GU1 A;  2KF4 A;  1YVS A;  2H0H A;  3DGL A;  4LSO A;  4MMX B;  1Q42 A;  1RGL A;  4WWU C;  1N8Q A;  1ASK A;  3MG2 A;  4L8O A;  1MWU A;  1RGC A;  2INX A;  1YNV X;  3X3X A;  3NQZ A;  3AHS A;  4TX4 A;  1DMM A;  3OWY A;  1I3F A;  3ALA A;  1OF5 A;  3J7Y d;  4PEJ A;  2E2V A;  5AII A;  3HI7 A;  2OTL 3;  1RNT A;  2CWU A;  1BGS A;  1NO3 A;  2P05 A;  3B4P A;  4BL3 A;  1RN1 A;  1W5Z A;  1RMS A;  3EN1 B;  1NNV A;  1K28 A;  4J8T A;  1UDI I;  2MC8 A;  1GYB A;  4BTW A;  1QAF A;  2GSP A;  1B2Z A;  2RSX A;  9RNT A;  1BIR A;  3L0R A;  1I2F A;  3DGN A;  1IV9 A;  4N3V A;  1IYY A;  1VQP 3;  1L5G B;  3K5T A;  2YFJ B;  1OGX A;  1DYU A;  1SII A;  3DGY A;  1BRG A;  1NU3 A;  1MGR A;  3G0K A;  4N6L A;  2KF6 A;  2CFK A;  3CMA 3;  1IV7 A;  3MG1 A;  1W02 A;  2W6J H;  4FCZ A;  2OTJ 3;  1LOW A;  3RGA A;  3N8B A;  5AEU B;  2KF3 A;  3RDE A;  1R4Y A;  1K9M 4;  1C54 A;  1UUG B;  4N6T A;  2QGU A;  1E97 A;  3B7C A;  3MKI A;  3X41 A;  3JUN A;  2Z76 A;  3CPO A;  2RFR A;  3LT9 A;  1UUV B;  4KVH A;  4GB5 A;  2W2C A;  2K54 A;  5IEP A;  5D82 A;  2CK3 H;  3CCJ 3;  1ULJ B;  2BNG A;  1T5Y A;  3LTC A;  3MYT A;  4HAA A;  5DRE A;  3LML A;  3UL6 A;  1VQ4 3;  1U8C B;  1BNS A;  3ZG0 A;  2WOF A;  1FZU A;  1QAK A;  2CX1 A;  1RGH A;  4WHA A;  1BVI A;  3O8Y A;  2CG1 A;  5JBS A;  2KXG A;  2V1L A;  4HM2 B;  3N54 B;  4RBN A;  1QJG A;  2RCD A;  4FCJ A;  4HM1 B;  1VQK 3;  1YI2 3;  5LC7 A;  1B2M A;  1LQM B;  1YIJ 3;  1TFO A;  1B20 A;  1ULI B;  2IUJ A;  2XSO B;  1N5P A;  3BIR A;  1BUQ A;  1FUS A;  2H0G A;  2L1S A;  1GOV A;  1V74 A;  3HX8 A;  1W7C A;  3LZA A;  1I2E A;  2CIU A;  4LGQ A;  1I3I A;  3GZR A;  3LTD A;  2FGT A;  4XB5 A;  1TJD A;  1LRA A;  2SBL A;  4N6N B;  2HOH A;  1RSN A;  3IMA B;  3BND A;  4KFF A;  2P0M A;  1GD4 A;  2OCT A;  1BSB A;  1IT8 A;  3MPH A;  1UCK A;  4KZ1 A;  2HMN B;  2BIR A;  1TUH A;  8CHO A;  1X1U A;  4NPB A;  1AQZ A;  1WMN A;  4HBR A;  4J5G A;  1ROV A;  3UL5 A;  1RGG A;  1A2P A;  1ISK A;  1JV2 B;  2IYJ A;  1Y4K A;  1LNH A;  4XBX A;  3FG1 A;  4KFE A;  1EKM A;  4KT3 B;  5BIR A;  2OQE C;  3G6E 3;  3PS8 A;  1IQX A;  1DVD A;  4R1K A;  3Q2P A;  5CK6 A;  1Z1S A;  7STD A;  2BHM A;  3FG4 A;  3LTA A;  3CNM A;  1JN5 A;  3NBB A;  3K9M C;  2JQ5 A;  2LYX A;  2F5M A;  3T0U A;  4LEH A;  7GSP A;  1YGW A;  1JB4 A;  1BNJ A;  3I0Y A;  1MNL A;  1UI7 A;  5AIF A;  4GSP A;  3GAX A;  4HM3 B;  3IPT A;  1JBT A;  1KQS 2;  3MWZ A;  5IG3 A;  2W9P A;  3AMO B;  2D42 A;  2P0X A;  3BNC A;  1ZS7 A;  3KN4 A;  3KZT A;  4BL2 A;  1VQ6 3;  4O8S A;  3HOH A;  1BRS A;  3NV0 B;  3DH2 A;  1N9E A;  5KP1 A;  1BU4 A;  1TTO A;  4OUQ A;  2Q07 A;  5CLK A;  1RDS A;  3OX9 A;  2CKF B;  4R80 A;  2IY2 A;  2BMQ B;  3FZW A;  3NBJ A;  3BNE A;  1LOY A;  1YGE A;  1Q40 A;  1OHS A;  3BU4 A;  5EVH A;  2IUK A;  1UGI A;  1R4C A;  1A67 A;  1VQM 3;  1GMP A;  5M1A A;  1UW1 A;  1E3V A;  3PGB A;  1OHO A;  3GZY B;  1AVL A;  3EB8 A;  3KII A;  5KP3 A;  3E99 A;  4MEI A;  4OK0 A;  1B2S A;  3DXO A;  3I55 3;  1B3S A;  1YHQ 3;  1EQK A;  1JRQ A;  1W6G A;  2F4Y A;  1UCI A;  1HYF A;  1SPU A;  3D4A A;  4O02 B;  2Y74 A;  2BT3 A;  3FGY A;  3UJM A;  1WTH A;  1LNI A;  3G16 A;  2GBX B;  5ELJ A;  1CYU A;  4N6O B;  1RN4 A;  1MOL A;  1VQL 3;  3X42 A;  2B1X B;  2XF3 A;  1OUN A;  3LH4 A;  3UB1 A;  3BB9 A;  3NHX A;  3EE1 A;  1O7G B;  1B2X A;  6GSP A;  3FLJ A;  3QRD A;  2XGL A;  4DKI A;  2FXT A;  1AY7 A;  1BRI A;  3PXM A;  1W00 A;  4STD A;  1WQL B;  3KKG A;  3V98 A;  1G0T A;  3GWR A;  3CPW 2;  1JJ2 2;  4ZM8 A;  2BO9 B;  1FGM A;  3H3H A;  3K7C A;  3NUV A;  4HZ9 B;  1Q86 4;  4ILF A;  1KC8 4;  2SAR A;  4CDL A;  4CJN A;  1BNI A;  1ZX2 A;  5JPP A;  4FMD A;  1BSC A;  4QWT A;  3CCL 3;  4LMI A;  4X2H A;  5A0O B;  1M1X B;  3WOE B;  1IU7 A;  3A5E A;  1O7P B;  1AV4 A;  2KF5 A;  3HZP A;  2HMM B;  3IJE B;  3F7S A;  4I5Q A;  1IQ8 A;  3CD6 3;  1MWS A;  4CCV A;  3WA3 A;  2WOH A;  3KSP A;  3I56 3;  2CH9 A;  1GY7 A;  3CNX A;  1N9J A;  3JUP A;  5G1L A;  1W2B 2;  1FUT A;  2C11 A;  2C10 A;  3Q1C A;  1NWW A;  2OOV C;  5IEO A;  1FGQ A;  3RNT A;  1UUW B;  5AIH A;  3K63 A;  1W2Z A;  1V57 A;  1RRL A;  3DZL A;  1B2U A;  1W4N A;  4WYK B;  1FW7 A;  3MHE A;  1K8A 4;  1M1K 4;  3NM7 A;  2OWP A;  3H51 A;  3D5I A;  4I4K A;  5FW5 A;  3S28 A;  2W9Q A;  3Q90 A;  1X1W A;  2R4I A;  3JUO A;  3QK9 A;  1T2I A;  5GSP A;  1GMQ A;  4L7K A;  1WMO A;  4EBG A;  1SAR A;  2IA7 A;  5AI1 A;  3FG3 A;  2WGO A;  3DMC A;  1TRP A;  1M9G A;  1GMR A;  3NXJ A;  2XH9 A;  2IMJ A;  2K3D A;  2W56 B;  2C4B A;  2KCD A;  1BSD A;  1N5H A;  5IER A;  3EHC A;  2CWV A;  1RGA A;  4BIR A;  1A2K A;  1OH0 A;  1O7M B;  4IT7 A;  1O7H B;  1O7N B;  2XSH B;  2XGN A;  3SLU A;  1ZO2 A;  3DY5 A;  3VSY A;  1W6Y A;  3S27 A;  3SOA A;  1TP6 A;  3SOY A;  2XRX B;  1JN5 B;  4L8P A;  1RHL A;  2O3O A;  1E3R A;  3GRD A;  4XBT A;  4EV2 A;  2OQE A;  1D6Y A;  1TU5 A;  3CXC 2;  2YFI B;  5JPU A;  1BNG A;  4U13 A;  3F9S A;  1FGT A;  3G4S 3;  2PZV A;  4X2O A;  3CME 3;  1A90 A;  1IVV A;  3B8L A;  1DVC A;  2R41 A;  1STD A;  5IG4 A;  4XBY A;  1RN7 A;  1EEJ A;  1TIJ A;  1OCV A;  4OVM A;  1RGE A;  2Z77 A;  4Q53 A;  3LT8 A;  1B27 A;  1CEW I;  2ML5 A;  4IIA A;  1YIT 3;  3EX9 A;  4JF8 A;  1PYL A;  3CCQ 3;  5TGN A;  1BRK A;  2B24 B;  2FNQ A;  1T2H A;  3WOF B;  3D9R A;  2CW9 A;  5CXO A; 
#chains in the Genus database with same CATH homology
 1BRJ A;  1B2S A;  1I8V A;  1B3S A;  2GSP A;  2ZA4 A;  1B2Z A;  1I0X A;  9RNT A;  1BIR A;  1I2F A;  1UCI A;  1HYF A;  2F4Y A;  3D4A A;  1IYY A;  2F56 A;  1LNI A;  1UCJ A;  1RN4 A;  3DGY A;  1BRG A;  3GSP A;  1MGR A;  1RNB A;  1B2X A;  2KF6 A;  6GSP A;  3AHW A;  1JBR A;  1LOW A;  2KF3 A;  1GOY A;  1AY7 A;  1PY3 A;  1R4Y A;  1BNF A;  2AAD A;  1BRI A;  3AGO A;  1MGW A;  1C54 A;  3Q3F A;  1X1Y A;  1B21 A;  3SYU A;  3AGN A;  1BAN A;  4HAA A;  1FYS A;  1HZ1 A;  1BNS A;  1JBS A;  1GSP A;  2SAR A;  1BNI A;  1FZU A;  1GOU A;  1BSC A;  1RGH A;  1BVI A;  2BU4 A;  1I2G A;  5HOH A;  3A5E A;  2KF5 A;  2RNT A;  5RNT A;  1B2M A;  1RGK A;  1BRN L;  1B20 A;  8RNT A;  3BIR A;  1FUS A;  3D5G A;  3WR2 A;  1GOV A;  1FUT A;  1I2E A;  1BNE A;  1I3I A;  1BSE A;  3RNT A;  1LRA A;  1UCL A;  2HOH A;  1RSN A;  1B2U A;  1BSA A;  1BSB A;  1FW7 A;  1UCK A;  2BIR A;  4GHO A;  3D5I A;  7RNT A;  2AAE A;  1BOX A;  1X1U A;  1X1W A;  1AQZ A;  4J5G A;  1DET A;  1T2I A;  4HOH A;  1GMQ A;  5GSP A;  3URP A;  1X1X A;  1SAR A;  1RGG A;  1RLS A;  1A2P A;  1BAO A;  1TRP A;  1BUJ A;  1GMR A;  2F5W A;  2C4B A;  5BIR A;  1BSD A;  6RNT A;  1BRH A;  2RBI A;  4RNT A;  1G02 A;  1RGA A;  4BIR A;  1TRQ A;  1RGF A;  2F5M A;  3KCH A;  1I0V A;  7GSP A;  1YGW A;  1BNJ A;  3WHO A;  1JBT A;  1ZGX A;  4GSP A;  1RCL A;  1RCK A;  1RHL A;  1DE3 A;  3HOH A;  1BRS A;  1LOV A;  3DH2 A;  2KAA A;  1BNG A;  1BU4 A;  1I70 A;  2KF4 A;  1TTO A;  1YVS A;  1RGL A;  1RDS A;  1CH0 A;  1Q9E A;  1BNR A;  1RGC A;  1YNV X;  3AHS A;  1RGE A;  1LOY A;  3BU4 A;  5BU4 A;  1I3F A;  1B27 A;  1GMP A;  1RTU A;  4J5K A;  1PYL A;  1RNT A;  1BRK A;  1BGS A;  1T2H A;  4BU4 A;  1RN1 A;  1RMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...