1RGHA

Hydrolase, guanyloribonuclease
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
b'DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE
publication title Ribonuclease from Streptomyces aureofaciens at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase (guanyloribonuclease)
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1995-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rghA00
2GSPA 1R4YA 1B3SA 1BRHA 2KF6A 1BRNL 1RGGA 3WHOA 1BRKA 1FYSA 1RGHA 3SYUA 1BNEA 2KF4A 3GSPA 4RNTA 5BU4A 1B2ZA 1CH0A 1RSNA 1G02A 1X1UA 3RNTA 9RNTA 3D4AA 1I2EA 2SARA 1BNIA 1BNFA 3AHWA 1JBRA 1JBSA 8RNTA 1YGWA 1YVSA 5HOHA 1BANA 1C54A 1PYLA 1RGKA 1X1XA 1X1WA 1FZUA 1I70A 2KAAA 1B21A 1I2FA 1RTUA 1UCIA 2AADA 3URPA 1BRSA 1I2GA 1UCJA 1BVIA 1GOVA 1T2IA 1RMSA 4HOHA 1BRIA 1BSAA 2HOHA 2RBIA 1BNRA 1BGSA 1I3FA 2F4YA 2AAEA 1AQZA 2BIRA 1B2XA 3HOHA 1RGLA 1RN4A 1I8VA 2F56A 1RHLA 4GSPA 1BIRA 1LOVA 1MGRA 4GHOA 7GSPA 1TRPA 5GSPA 1UCLA 4J5GA 1A2PA 1RCKA 1LRAA 1TTOA 1PY3A 3D5IA 1Q9EA 1RGEA 1FW7A 1I0XA 1X1YA 3BU4A 1BSDA 1BOXA 1HZ1A 3DGYA 4BU4A 1FUTA 1MGWA 1BNGA 3AGNA 1BUJA 1GMPA 1B2SA 1BRGA 2KF5A 1BSCA 3Q3FA 1B2UA 1GOUA 1RCLA 1YNVX 1BSEA 1GSPA 1LOWA 2F5WA 1B2MA 3AHSA 3KCHA 1RNBA 1RDSA 1RGCA 1RN1A 6RNTA 1RNTA 1AY7A 4J5KA 1RLSA 2BU4A 1UCKA 1FUSA 1LOYA 1ZGXA 1T2HA 6GSPA 1SARA 1IYYA 1BSBA 1BAOA 1DETA 1B20A 4HAAA 1I3IA 1LNIA 3A5EA 3WR2A 4BIRA 5BIRA 1GOYA 3BIRA 1GMQA 2C4BA 2KF3A 3AGOA 1B27A 1RGFA 1GMRA 2F5MA 2ZA4A 2RNTA 1BRJA 1JBTA 1BNJA 5RNTA 1BNSA 1BU4A 7RNTA 1HYFA 1I0VA 3DH2A 3D5GA 1DE3A 1TRQA 1RGAA
chains in the Genus database with same CATH superfamily
5IG4A 1U5OA 2J8XB 2GSPA 5BVBA 3ECFA 1AV4A 3CC73 3X3XA 5G2GA 1BRNL 3F8HA 1E97A 4BL2A 3F14A 1FA3A 1D6ZA 1FYSA 2K3DA 2FNQA 3X41A 3OW22 4AKZA 1YI23 3N9HA 2P0XA 5IEOA 5JPPA 1FGQA 1X1UA 4X2HA 2F98A 1Z1SA 3RNTA 1GY7A 2XSHB 3WMDA 2SARA 5JPUA 1JZDA 2XH9A 1KSIA 4MEIA 4BTXA 1VQ83 1CEWI 1NU3A 4O02B 5AYRB 1YVSA 3SVAA 1W5ZA 2UGIA 1C54A 2K54A 1PYLA 1RGKA 1X1XA 1X1WA 4HYZA 3MKIA 5CF1A 4WWUC 3S5CA 1JJ22 3DGLA 2QIYA 1GY6A 3SX1A 3DGNA 1NDOB 1V57A 4KFDA 5CK6A 1BVIA 1KWIA 3CCL3 4NPBA 2HOHA 1W6GA 3JUQA 1N5PA 4FMCA 4XDVA 2D1WA 1I3FA 2F4YA 4N3VA 1PFPA 1AQZA 2W04A 1VQM3 1MWSA 3PXMA 5AIIA 1VQO3 2CWUA 5G1KA 4O3VA 1QAKA 1OHSA 2CC3A 1OHPA 1O7WB 3EN8A 3CC23 1ROAA 3G0KA 1NJI4 1MOLA 2KCDA 1LQMB 3JUMA 2R4IA 4L8OA 4XDWA 1J2BA 2BT3A 2ML6A 1Q42A 2HMKB 4GSPA 2XGNA 1BIRA 2P09A 1S5AA 4HJLB 4CJNA 1C7HA 1DMMA 4HZBB 1IT7A 1OCVA 1DVCA 1RCKA 1WQLB 4BTYA 1LRAA 4IT7A 1Q7Y4 1PY3A 3D5IA 1A2VA 1Q9EA 4HZ9B 1OH0A 3FGYA 5A0OB 1FW7A 1I0XA 1X1YA 3BU4A 1FGRA 3UJMA 3G4S3 3F7SA 3BNEA 1FUTA 1JV2B 1MGWA 2CFGA 3CD63 2IUJA 3G8ZA 2M7OA 4GB5A 4XB5A 1A67A 1BUJA 2W9QA 1GMPA 1B2SA 1VQ63 3MWZA 3HIGA 3F40A 4HM1B 1S723 1NB5I 4Q53A 3CXC2 1YNVX 1ZX2A 3FCSB 3KE7A 4HM5B 3F8XA 4IPBA 4HM2B 1RNBA 2SBLA 4K90B 4R4KA 1RGCA 4WFOA 5CXOA 1NWWA 1ZS7A 2OOVA 3G713 1EUIC 1NNVA 2F86B 2BHMA 3FZWA 1QVG2 1W2ZA 5FW5A 1TJDA 2WGOA 2W56A 1FGTA 5M1AA 1VQ93 1T2HA 4RBNA 4NHFA 1IYYA 1VQ53 2MF7A 1BSBA 2W9PA 1DETA 1VQP3 1Y4KA 4KFFA 1YHQ3 4HM7B 2CFWA 3NUVA 4BIRA 1W02A 2CHCA 3DZLA 3HIIA 1GOYA 5BIRA 3I563 5EVHA 2C4BA 3AGOA 5G1LA 3DUKA 2V1LA 1FUWA 3BB9A 1Q814 3CMA3 1RGFA 1G0TA 2XFTA 1GMRA 5BXQA 3HX8A 3S67A 3FKAA 5CLKA 1CYVA 4HM8B 2HMLB 4LMIA 1N8QA 3GZRA 4OK0A 3RGAA 3S27A 3UL6A 3CCV3 1EEJA 1RRLA 2OQEC 1IQYA 3Q90A 4K61A 1RJOA 5AI1A 3RDEA 4J8TA 1TRQA 1RGAA 1VZZA 1O7HB 2A15A 3OWUA 4R9KA 5LC7A 2H0HA 1GD4A 2UUGC 3X3YA 1JZOA 1IDPA 1RGGA 3EJVA 1IT8A 1JNQA 1MWTA 3WHOA 1M904 1TU5A 2W0QA 1RGHA 4XBYA 3X40A 3MSOA 4RNTA 1STFI 2OWPA 1B2ZA 1CH0A 2F99A 2P0MA 3GAXA 1TFOA 2K0MA 3KFQC 3O8YA 9RNTA 1W2B2 2C11A 1BNIA 2Z6BA 4FMBA 4WYKB 3UB1A 1VQL3 1JBSA 1KC84 3D3LA 8RNTA 3LTDA 1LVNA 1EA2A 2BO9B 3EN1B 3MG3A 3T0UA 1IK3A 1MWRA 1K734 2BNGA 3CNXA 5IENA 4H3UA 3KZTA 1N9JA 1I2FA 4XBTA 4KVHA 1KD14 2AADA 1SPUA 1MWUA 5DREA 1ULIB 2XF3A 4EYCA 2CKFB 2O9UX 3NM2A 3L0RA 3AMOB 3CME3 1F8NA 2ML5A 3HI7A 1QJGA 4FMAA 3I553 4HOHA 3BLZA 4CPKA 4CDLA 2XR8B 1BGSA 2AAEA 2C10A 5EEOA 4LZIA 5DRVA 4I4KA 4R1KA 4HM3B 3HOHA 1UGHI 2BMRB 2CWTA 4HM0B 4TX4A 3V92A 1I8VA 1RN7A 2F56A 3RGRA 3LH4A 2MC8A 2W6JH 1RHLA 2JQ5A 1LOVA 1QVF2 1MGRA 7GSPA 1N9EA 1HU9A 1TRPA 2FXTA 3ER7A 3KSED 4LEHA 3PS8A 4O8SA 5GSPA 3NV0B 2FGTA 3STDA 4J5GA 1A2PA 1JKGB 3CNMA 2O3OA 5STDA 1L5GB 1TTOA 4I5QA 4STDA 3WOEB 1VQK3 1WMOA 1TP6A 4BL3A 2WOFA 3KIIA 1K9M4 1YGEA 4N6NB 1O7GB 2KXGA 2H0GA 3K9MC 1OACA 2QGUA 3M8CA 1BNGA 4RZMA 3T8UA 2GEXA 3NQYA 4LSOA 5LC6A 4JF8A 4IIAA 5AEWB 3VSYA 2Y74A 4J9AA 1BSCA 3GZYB 8CHOA 4ZM8A 1UUGB 1GOUA 2YFIB 2L1SA 1IV9A 1LOWA 1B2MA 3V99A 3VGNA 3CPW2 1ISKA 3MG1A 1FGOA 3AHSA 3KCHA 2RSXA 4MMXB 1DYUA 1YVBI 1RDSA 3ZFZA 4EXRA 1OUNA 1RKYA 2R41A 6RNTA 1TUHA 1R4CA 1AY7A 2ZHXB 4J5KA 2XEPA 3WODG 4U13A 1JRQA 3IJEB 6GSPA 1ZGXA 1W6CA 2STDA 3I0YA 1JB4A 3LZAA 3NHXA 5AIGA 5IW9A 1GS3A 1W01A 1BAOA 1B20A 4X2OA 1BUQA 3UNLA 4WP5A 1JN5A 1PU4A 2BMOB 3NXJA 1DVDA 2YFJB 3BNBA 3KSPA 2F5MA 2ZA4A 2PNCA 2RNTA 1CYUA 1JBTA 1TIJA 1QALA 1K8A4 2Z77A 4O2HA 1N5HA 5RNTA 7RNTA 3S29A 4R9LA 2WGQA 1IVVA 1UI7A 3MPHA 2IY2A 1VQN3 3NBBA 5AIHA 5HOHA 4EV5A 3LOYA 4L8PA 4WYKA 2I9WA 3GRDA 4N6MA 2XFSA 1BRKA 3OV4A 5IG3A 1QAFA 2P38A 3SYUA 3GSPA 3G16A 2IUKA 3NX0A 3D4AA 3ZG5A 3OX9A 1WMPA 3AHWA 4EV2A 2CG0A 3CC43 2B24B 3SEDA 3AMOA 1YGWA 2CIUA 1BANA 2Z76A 1HKXA 3FG4A 3E99A 4DKIA 1FZUA 2ZDJA 3PCRA 1GY5A 1M9GA 1I70A 5IEPA 2KAAA 3G6E3 4N6OB 1RTUA 5IF6A 1UCIA 3CCS3 3URPA 2BMQB 3GWRA 1UDII 5AIFA 3SOYA 1LOXA 3HZPA 1T2IA 2B1XB 2WO0A 3U1WA 2QA43 1ULJB 3CPOA 2RBIA 1EKMA 5D83A 3T8NA 4N6V0 3CCM3 5KP4A 2BIRA 1UUVB 2UX0A 3PYJA 1B2XA 3NV0A 3WA3A 2Y73A 1JKGA 1Q7HA 5D81A 3DY5A 3K63A 2OCTA 4CCVA 3SXXA 1OPYA 3LT9A 1K28A 2H0IA 1QMAA 1Q40B 3S28A 1ZO2A 1VQ73 2E2UA 1VQ43 2IYJA 3EHCA 1U8CB 4RNZA 5CF2A 5ELJA 1RGEA 3CCE3 3SLUA 1HZ1A 3DGYA 3NM7A 5AEUB 4RNYA 2Z7AA 3MG2A 4LGQA 5I97A 7STDA 1LNHA 2W2CA 1BRGA 2KF5A 3LXUX 3Q3FA 5KP1A 4EBGA 1B2UA 1WNHA 5IG0A 3PGBA 1GD3A 3EX9A 4FMDA 1SJWA 1CQSA 1YIJ3 1BSEA 1GSPA 1K41A 2HMJB 3FG1A 2CW9A 3DGMA 1T3BA 3EQQB 4G1MB 5IG5A 2ZL8A 5FGOA 4FR9A 1YJ93 3FSDA 3OWSA 1RNTA 1IVXA 2L4VA 2PZVA 3SOAA 2OQEA 2CFDA 1RLSA 4H61A 2BU4A 1FGMA 1UCKA 2CFKA 2LQVA 3KN4A 3LTBA 1SARA 4K1VA 3GZXB 3K7CA 1EQKA 3A76A 4MMZB 3VF1A 1E3VA 1ROVA 5KP3A 3A5EA 3F9SA 3PZWA 1LQGC 1IV7A 1LXEA 2CX1A 3CU3A 3NQZA 2OTL3 3U97A 3B4PA 4GL6A 3CCQ3 1IQ8A 2YX9A 4PEJA 3BNCA 2XSOB 2CFLA 2OOVC 1BNJA 4XBXA 2RFRA 3J7Yd 3X3ZA 1I0VA 3NBJA 4R80A 1SQWA 3B4OA 4AKYA 1OGZA 2D42A 3TDGA 3DH2A 3EB8A 4BTWA 2CK3H 2KRTA 3QK9A 3WDGB 1O7PB 3MYTA 3K0ZA 4N6UA 3ROBA 1W00A 3BNDA 2E2TA 1R4YA 2RGQA 3JUPA 4EW5A 1B3SA 3FG3A 1BRHA 2KF6A 1V74A 3LTCA 1OF5B 3H3HA 3Q2PA 2CX0A 4FCMA 1BNEA 2KF4A 2YFLB 4K1UA 5BU4A 3DMCA 1RSNA 1G02A 3JUOA 4EC6A 1DMQA 1I2EA 2XRXB 4XM4A 1BNFA 1UUWB 3CCU3 2CG1A 1JBRA 2CH9A 2LYXA 1UI8A 3FF2A 3FH1A 3IPTA 3CCJ3 1IU7A 1RRHA 1VQQA 2INXA 2HMNB 2IMJA 1B21A 1E3RA 1N8R4 2QEX3 3D79A 4HM4B 5ELUA 1BRSA 3CCR3 1I2GA 3WOFB 2OTJ3 3LT8A 5TGNA 1DMNA 1O7NB 1UCJA 3DXOA 1GOVA 3EE1A 4AEQA 3DM8A 1RMSA 1UW1A 1BRIA 1BSAA 1YJW3 5M19A 1W4NA 1BNRA 3LTAA 3JVCA 4HKVB 1MNLA 1Q40A 1EG9B 3B8LA 4HVNA 5IERA 1KQS2 4KFEA 3Q1CA 4NREA 3IMAB 1RGLA 1RN4A 1OHOA 1UGIA 4HM6B 1T5YA 3NBRA 1OGXA 4FCJA 4ILFA 4GHOA 2GU1A 1JB5A 1D6YA 1UCLA 4FCZA 4MMYB 3FF0A 1NB3I 5HGRA 3GZBA 3LMLA 3B7CA 3UL5A 1M1XB 3F7XA 1US1A 3HK4A 1BSDA 1BOXA 2GEYA 3OXAA 3FLJA 3N54B 3WA2X 4BU4A 1A90A 2E2VA 1AR0A 2GBWB 1WMNA 3DGOA 4KZ1A 3AGNA 4N6LA 2GXFA 3H51A 2WOHA 4OVMA 1D6UA 1AVLA 4L7KA 1GYBA 3K5TA 1G96A 1NO3A 4JRFA 3V98A 1RCLA 4QWTA 1IQXA 2F5WA 3ALAA 1V58A 2HMOB 1JB2A 1TFKA 2GU3A 2P05A 2RCDA 1WTHA 3EC9A 1O7MB 3ZG0A 1W6YA 1IVUA 3EF8A 1RN1A 1JN5B 3N8BA 3EBYA 1Q824 1ASKA 6STDA 1FUSA 4KT3B 3X42A 1LOYA 3EBTA 3JUNA 5EQLA 2JDIH 1AVKA 3D9RA 1M1K4 1YJN3 4HAAA 5AYSC 2IA7A 1I3IA 1Q864 1LNIA 2W03A 3WR2A 2W56B 1GMQA 3BIRA 4WHAA 2KF3A 5D82A 3MHEA 1W7CA 1B27A 4MJDA 5M18A 4HBRA 2XGLA 3PCSA 1BRJA 2HMMB 3OWYA 1SIIA 1BNSA 1BU4A 3KKGA 1HYFA 4OUQA 1IVWA 2CWVA 1STDA 3QRDA 4ORLA 2GBXB 1OF5A 1YIT3 3D5GA 1DE3A 2Q07A 4LYLB 5JBSA 3LYGA 1A2KA 4N6TA 1SIHA
chains in the Genus database with same CATH topology
2GSPA 1R4YA 1B3SA 1BRHA 2KF6A 1BRNL 1RGGA 3WHOA 1BRKA 1FYSA 1RGHA 3SYUA 1BNEA 2KF4A 3GSPA 4RNTA 5BU4A 1B2ZA 1CH0A 1RSNA 1G02A 1X1UA 3RNTA 9RNTA 3D4AA 1I2EA 2SARA 1BNIA 1BNFA 3AHWA 1JBRA 1JBSA 8RNTA 1YGWA 1YVSA 5HOHA 1BANA 1C54A 1PYLA 1RGKA 1X1XA 1X1WA 1FZUA 1I70A 2KAAA 1B21A 1I2FA 1RTUA 1UCIA 2AADA 3URPA 1BRSA 1I2GA 1UCJA 1BVIA 1GOVA 1T2IA 1RMSA 4HOHA 1BRIA 1BSAA 2HOHA 2RBIA 1BNRA 1BGSA 1I3FA 2F4YA 2AAEA 1AQZA 2BIRA 1B2XA 3HOHA 1RGLA 1RN4A 1I8VA 2F56A 1RHLA 4GSPA 1BIRA 1LOVA 1MGRA 4GHOA 7GSPA 1TRPA 5GSPA 1UCLA 4J5GA 1A2PA 1RCKA 1LRAA 1TTOA 1PY3A 3D5IA 1Q9EA 1RGEA 1FW7A 1I0XA 1X1YA 3BU4A 1BSDA 1BOXA 1HZ1A 3DGYA 4BU4A 1FUTA 1MGWA 1BNGA 3AGNA 1BUJA 1GMPA 1B2SA 1BRGA 2KF5A 1BSCA 3Q3FA 1B2UA 1GOUA 1RCLA 1YNVX 1BSEA 1GSPA 1LOWA 2F5WA 1B2MA 3AHSA 3KCHA 1RNBA 1RDSA 1RGCA 1RN1A 6RNTA 1RNTA 1AY7A 4J5KA 1RLSA 2BU4A 1UCKA 1FUSA 1LOYA 1ZGXA 1T2HA 6GSPA 1SARA 1IYYA 1BSBA 1BAOA 1DETA 1B20A 4HAAA 1I3IA 1LNIA 3A5EA 3WR2A 4BIRA 5BIRA 1GOYA 3BIRA 1GMQA 2C4BA 2KF3A 3AGOA 1B27A 1RGFA 1GMRA 2F5MA 2ZA4A 2RNTA 1BRJA 1JBTA 1BNJA 5RNTA 1BNSA 1BU4A 7RNTA 1HYFA 1I0VA 3DH2A 3D5GA 1DE3A 1TRQA 1RGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GSP A;  1R4Y A;  1B3S A;  1BRH A;  2KF6 A;  1BRN L;  1RGG A;  3WHO A;  1BRK A;  1FYS A;  1RGH A;  3SYU A;  1BNE A;  2KF4 A;  3GSP A;  4RNT A;  5BU4 A;  1B2Z A;  1CH0 A;  1RSN A;  1G02 A;  1X1U A;  3RNT A;  9RNT A;  3D4A A;  1I2E A;  2SAR A;  1BNI A;  1BNF A;  3AHW A;  1JBR A;  1JBS A;  8RNT A;  1YGW A;  1YVS A;  5HOH A;  1BAN A;  1C54 A;  1PYL A;  1RGK A;  1X1X A;  1X1W A;  1FZU A;  1I70 A;  2KAA A;  1B21 A;  1I2F A;  1RTU A;  1UCI A;  2AAD A;  3URP A;  1BRS A;  1I2G A;  1UCJ A;  1BVI A;  1GOV A;  1T2I A;  1RMS A;  4HOH A;  1BRI A;  1BSA A;  2HOH A;  2RBI A;  1BNR A;  1BGS A;  1I3F A;  2F4Y A;  2AAE A;  1AQZ A;  2BIR A;  1B2X A;  3HOH A;  1RGL A;  1RN4 A;  1I8V A;  2F56 A;  1RHL A;  4GSP A;  1BIR A;  1LOV A;  1MGR A;  4GHO A;  7GSP A;  1TRP A;  5GSP A;  1UCL A;  4J5G A;  1A2P A;  1RCK A;  1LRA A;  1TTO A;  1PY3 A;  3D5I A;  1Q9E A;  1RGE A;  1FW7 A;  1I0X A;  1X1Y A;  3BU4 A;  1BSD A;  1BOX A;  1HZ1 A;  3DGY A;  4BU4 A;  1FUT A;  1MGW A;  1BNG A;  3AGN A;  1BUJ A;  1GMP A;  1B2S A;  1BRG A;  2KF5 A;  1BSC A;  3Q3F A;  1B2U A;  1GOU A;  1RCL A;  1YNV X;  1BSE A;  1GSP A;  1LOW A;  2F5W A;  1B2M A;  3AHS A;  3KCH A;  1RNB A;  1RDS A;  1RGC A;  1RN1 A;  6RNT A;  1RNT A;  1AY7 A;  4J5K A;  1RLS A;  2BU4 A;  1UCK A;  1FUS A;  1LOY A;  1ZGX A;  1T2H A;  6GSP A;  1SAR A;  1IYY A;  1BSB A;  1BAO A;  1DET A;  1B20 A;  4HAA A;  1I3I A;  1LNI A;  3A5E A;  3WR2 A;  4BIR A;  5BIR A;  1GOY A;  3BIR A;  1GMQ A;  2C4B A;  2KF3 A;  3AGO A;  1B27 A;  1RGF A;  1GMR A;  2F5M A;  2ZA4 A;  2RNT A;  1BRJ A;  1JBT A;  1BNJ A;  5RNT A;  1BNS A;  1BU4 A;  7RNT A;  1HYF A;  1I0V A;  3DH2 A;  3D5G A;  1DE3 A;  1TRQ A;  1RGA A; 
#chains in the Genus database with same CATH topology
 5IG4 A;  1U5O A;  2J8X B;  2GSP A;  5BVB A;  3ECF A;  1AV4 A;  3CC7 3;  3X3X A;  5G2G A;  1BRN L;  3F8H A;  1E97 A;  4BL2 A;  3F14 A;  1FA3 A;  1D6Z A;  1FYS A;  2K3D A;  2FNQ A;  3X41 A;  3OW2 2;  4AKZ A;  1YI2 3;  3N9H A;  2P0X A;  5IEO A;  5JPP A;  1FGQ A;  1X1U A;  4X2H A;  2F98 A;  1Z1S A;  3RNT A;  1GY7 A;  2XSH B;  3WMD A;  2SAR A;  5JPU A;  1JZD A;  2XH9 A;  1KSI A;  4MEI A;  4BTX A;  1VQ8 3;  1CEW I;  1NU3 A;  4O02 B;  5AYR B;  1YVS A;  3SVA A;  1W5Z A;  2UGI A;  1C54 A;  2K54 A;  1PYL A;  1RGK A;  1X1X A;  1X1W A;  4HYZ A;  3MKI A;  5CF1 A;  4WWU C;  3S5C A;  1JJ2 2;  3DGL A;  2QIY A;  1GY6 A;  3SX1 A;  3DGN A;  1NDO B;  1V57 A;  4KFD A;  5CK6 A;  1BVI A;  1KWI A;  3CCL 3;  4NPB A;  2HOH A;  1W6G A;  3JUQ A;  1N5P A;  4FMC A;  4XDV A;  2D1W A;  1I3F A;  2F4Y A;  4N3V A;  1PFP A;  1AQZ A;  2W04 A;  1VQM 3;  1MWS A;  3PXM A;  5AII A;  1VQO 3;  2CWU A;  5G1K A;  4O3V A;  1QAK A;  1OHS A;  2CC3 A;  1OHP A;  1O7W B;  3EN8 A;  3CC2 3;  1ROA A;  3G0K A;  1NJI 4;  1MOL A;  2KCD A;  1LQM B;  3JUM A;  2R4I A;  4L8O A;  4XDW A;  1J2B A;  2BT3 A;  2ML6 A;  1Q42 A;  2HMK B;  4GSP A;  2XGN A;  1BIR A;  2P09 A;  1S5A A;  4HJL B;  4CJN A;  1C7H A;  1DMM A;  4HZB B;  1IT7 A;  1OCV A;  1DVC A;  1RCK A;  1WQL B;  4BTY A;  1LRA A;  4IT7 A;  1Q7Y 4;  1PY3 A;  3D5I A;  1A2V A;  1Q9E A;  4HZ9 B;  1OH0 A;  3FGY A;  5A0O B;  1FW7 A;  1I0X A;  1X1Y A;  3BU4 A;  1FGR A;  3UJM A;  3G4S 3;  3F7S A;  3BNE A;  1FUT A;  1JV2 B;  1MGW A;  2CFG A;  3CD6 3;  2IUJ A;  3G8Z A;  2M7O A;  4GB5 A;  4XB5 A;  1A67 A;  1BUJ A;  2W9Q A;  1GMP A;  1B2S A;  1VQ6 3;  3MWZ A;  3HIG A;  3F40 A;  4HM1 B;  1S72 3;  1NB5 I;  4Q53 A;  3CXC 2;  1YNV X;  1ZX2 A;  3FCS B;  3KE7 A;  4HM5 B;  3F8X A;  4IPB A;  4HM2 B;  1RNB A;  2SBL A;  4K90 B;  4R4K A;  1RGC A;  4WFO A;  5CXO A;  1NWW A;  1ZS7 A;  2OOV A;  3G71 3;  1EUI C;  1NNV A;  2F86 B;  2BHM A;  3FZW A;  1QVG 2;  1W2Z A;  5FW5 A;  1TJD A;  2WGO A;  2W56 A;  1FGT A;  5M1A A;  1VQ9 3;  1T2H A;  4RBN A;  4NHF A;  1IYY A;  1VQ5 3;  2MF7 A;  1BSB A;  2W9P A;  1DET A;  1VQP 3;  1Y4K A;  4KFF A;  1YHQ 3;  4HM7 B;  2CFW A;  3NUV A;  4BIR A;  1W02 A;  2CHC A;  3DZL A;  3HII A;  1GOY A;  5BIR A;  3I56 3;  5EVH A;  2C4B A;  3AGO A;  5G1L A;  3DUK A;  2V1L A;  1FUW A;  3BB9 A;  1Q81 4;  3CMA 3;  1RGF A;  1G0T A;  2XFT A;  1GMR A;  5BXQ A;  3HX8 A;  3S67 A;  3FKA A;  5CLK A;  1CYV A;  4HM8 B;  2HML B;  4LMI A;  1N8Q A;  3GZR A;  4OK0 A;  3RGA A;  3S27 A;  3UL6 A;  3CCV 3;  1EEJ A;  1RRL A;  2OQE C;  1IQY A;  3Q90 A;  4K61 A;  1RJO A;  5AI1 A;  3RDE A;  4J8T A;  1TRQ A;  1RGA A;  1VZZ A;  1O7H B;  2A15 A;  3OWU A;  4R9K A;  5LC7 A;  2H0H A;  1GD4 A;  2UUG C;  3X3Y A;  1JZO A;  1IDP A;  1RGG A;  3EJV A;  1IT8 A;  1JNQ A;  1MWT A;  3WHO A;  1M90 4;  1TU5 A;  2W0Q A;  1RGH A;  4XBY A;  3X40 A;  3MSO A;  4RNT A;  1STF I;  2OWP A;  1B2Z A;  1CH0 A;  2F99 A;  2P0M A;  3GAX A;  1TFO A;  2K0M A;  3KFQ C;  3O8Y A;  9RNT A;  1W2B 2;  2C11 A;  1BNI A;  2Z6B A;  4FMB A;  4WYK B;  3UB1 A;  1VQL 3;  1JBS A;  1KC8 4;  3D3L A;  8RNT A;  3LTD A;  1LVN A;  1EA2 A;  2BO9 B;  3EN1 B;  3MG3 A;  3T0U A;  1IK3 A;  1MWR A;  1K73 4;  2BNG A;  3CNX A;  5IEN A;  4H3U A;  3KZT A;  1N9J A;  1I2F A;  4XBT A;  4KVH A;  1KD1 4;  2AAD A;  1SPU A;  1MWU A;  5DRE A;  1ULI B;  2XF3 A;  4EYC A;  2CKF B;  2O9U X;  3NM2 A;  3L0R A;  3AMO B;  3CME 3;  1F8N A;  2ML5 A;  3HI7 A;  1QJG A;  4FMA A;  3I55 3;  4HOH A;  3BLZ A;  4CPK A;  4CDL A;  2XR8 B;  1BGS A;  2AAE A;  2C10 A;  5EEO A;  4LZI A;  5DRV A;  4I4K A;  4R1K A;  4HM3 B;  3HOH A;  1UGH I;  2BMR B;  2CWT A;  4HM0 B;  4TX4 A;  3V92 A;  1I8V A;  1RN7 A;  2F56 A;  3RGR A;  3LH4 A;  2MC8 A;  2W6J H;  1RHL A;  2JQ5 A;  1LOV A;  1QVF 2;  1MGR A;  7GSP A;  1N9E A;  1HU9 A;  1TRP A;  2FXT A;  3ER7 A;  3KSE D;  4LEH A;  3PS8 A;  4O8S A;  5GSP A;  3NV0 B;  2FGT A;  3STD A;  4J5G A;  1A2P A;  1JKG B;  3CNM A;  2O3O A;  5STD A;  1L5G B;  1TTO A;  4I5Q A;  4STD A;  3WOE B;  1VQK 3;  1WMO A;  1TP6 A;  4BL3 A;  2WOF A;  3KII A;  1K9M 4;  1YGE A;  4N6N B;  1O7G B;  2KXG A;  2H0G A;  3K9M C;  1OAC A;  2QGU A;  3M8C A;  1BNG A;  4RZM A;  3T8U A;  2GEX A;  3NQY A;  4LSO A;  5LC6 A;  4JF8 A;  4IIA A;  5AEW B;  3VSY A;  2Y74 A;  4J9A A;  1BSC A;  3GZY B;  8CHO A;  4ZM8 A;  1UUG B;  1GOU A;  2YFI B;  2L1S A;  1IV9 A;  1LOW A;  1B2M A;  3V99 A;  3VGN A;  3CPW 2;  1ISK A;  3MG1 A;  1FGO A;  3AHS A;  3KCH A;  2RSX A;  4MMX B;  1DYU A;  1YVB I;  1RDS A;  3ZFZ A;  4EXR A;  1OUN A;  1RKY A;  2R41 A;  6RNT A;  1TUH A;  1R4C A;  1AY7 A;  2ZHX B;  4J5K A;  2XEP A;  3WOD G;  4U13 A;  1JRQ A;  3IJE B;  6GSP A;  1ZGX A;  1W6C A;  2STD A;  3I0Y A;  1JB4 A;  3LZA A;  3NHX A;  5AIG A;  5IW9 A;  1GS3 A;  1W01 A;  1BAO A;  1B20 A;  4X2O A;  1BUQ A;  3UNL A;  4WP5 A;  1JN5 A;  1PU4 A;  2BMO B;  3NXJ A;  1DVD A;  2YFJ B;  3BNB A;  3KSP A;  2F5M A;  2ZA4 A;  2PNC A;  2RNT A;  1CYU A;  1JBT A;  1TIJ A;  1QAL A;  1K8A 4;  2Z77 A;  4O2H A;  1N5H A;  5RNT A;  7RNT A;  3S29 A;  4R9L A;  2WGQ A;  1IVV A;  1UI7 A;  3MPH A;  2IY2 A;  1VQN 3;  3NBB A;  5AIH A;  5HOH A;  4EV5 A;  3LOY A;  4L8P A;  4WYK A;  2I9W A;  3GRD A;  4N6M A;  2XFS A;  1BRK A;  3OV4 A;  5IG3 A;  1QAF A;  2P38 A;  3SYU A;  3GSP A;  3G16 A;  2IUK A;  3NX0 A;  3D4A A;  3ZG5 A;  3OX9 A;  1WMP A;  3AHW A;  4EV2 A;  2CG0 A;  3CC4 3;  2B24 B;  3SED A;  3AMO A;  1YGW A;  2CIU A;  1BAN A;  2Z76 A;  1HKX A;  3FG4 A;  3E99 A;  4DKI A;  1FZU A;  2ZDJ A;  3PCR A;  1GY5 A;  1M9G A;  1I70 A;  5IEP A;  2KAA A;  3G6E 3;  4N6O B;  1RTU A;  5IF6 A;  1UCI A;  3CCS 3;  3URP A;  2BMQ B;  3GWR A;  1UDI I;  5AIF A;  3SOY A;  1LOX A;  3HZP A;  1T2I A;  2B1X B;  2WO0 A;  3U1W A;  2QA4 3;  1ULJ B;  3CPO A;  2RBI A;  1EKM A;  5D83 A;  3T8N A;  4N6V 0;  3CCM 3;  5KP4 A;  2BIR A;  1UUV B;  2UX0 A;  3PYJ A;  1B2X A;  3NV0 A;  3WA3 A;  2Y73 A;  1JKG A;  1Q7H A;  5D81 A;  3DY5 A;  3K63 A;  2OCT A;  4CCV A;  3SXX A;  1OPY A;  3LT9 A;  1K28 A;  2H0I A;  1QMA A;  1Q40 B;  3S28 A;  1ZO2 A;  1VQ7 3;  2E2U A;  1VQ4 3;  2IYJ A;  3EHC A;  1U8C B;  4RNZ A;  5CF2 A;  5ELJ A;  1RGE A;  3CCE 3;  3SLU A;  1HZ1 A;  3DGY A;  3NM7 A;  5AEU B;  4RNY A;  2Z7A A;  3MG2 A;  4LGQ A;  5I97 A;  7STD A;  1LNH A;  2W2C A;  1BRG A;  2KF5 A;  3LXU X;  3Q3F A;  5KP1 A;  4EBG A;  1B2U A;  1WNH A;  5IG0 A;  3PGB A;  1GD3 A;  3EX9 A;  4FMD A;  1SJW A;  1CQS A;  1YIJ 3;  1BSE A;  1GSP A;  1K41 A;  2HMJ B;  3FG1 A;  2CW9 A;  3DGM A;  1T3B A;  3EQQ B;  4G1M B;  5IG5 A;  2ZL8 A;  5FGO A;  4FR9 A;  1YJ9 3;  3FSD A;  3OWS A;  1RNT A;  1IVX A;  2L4V A;  2PZV A;  3SOA A;  2OQE A;  2CFD A;  1RLS A;  4H61 A;  2BU4 A;  1FGM A;  1UCK A;  2CFK A;  2LQV A;  3KN4 A;  3LTB A;  1SAR A;  4K1V A;  3GZX B;  3K7C A;  1EQK A;  3A76 A;  4MMZ B;  3VF1 A;  1E3V A;  1ROV A;  5KP3 A;  3A5E A;  3F9S A;  3PZW A;  1LQG C;  1IV7 A;  1LXE A;  2CX1 A;  3CU3 A;  3NQZ A;  2OTL 3;  3U97 A;  3B4P A;  4GL6 A;  3CCQ 3;  1IQ8 A;  2YX9 A;  4PEJ A;  3BNC A;  2XSO B;  2CFL A;  2OOV C;  1BNJ A;  4XBX A;  2RFR A;  3J7Y d;  3X3Z A;  1I0V A;  3NBJ A;  4R80 A;  1SQW A;  3B4O A;  4AKY A;  1OGZ A;  2D42 A;  3TDG A;  3DH2 A;  3EB8 A;  4BTW A;  2CK3 H;  2KRT A;  3QK9 A;  3WDG B;  1O7P B;  3MYT A;  3K0Z A;  4N6U A;  3ROB A;  1W00 A;  3BND A;  2E2T A;  1R4Y A;  2RGQ A;  3JUP A;  4EW5 A;  1B3S A;  3FG3 A;  1BRH A;  2KF6 A;  1V74 A;  3LTC A;  1OF5 B;  3H3H A;  3Q2P A;  2CX0 A;  4FCM A;  1BNE A;  2KF4 A;  2YFL B;  4K1U A;  5BU4 A;  3DMC A;  1RSN A;  1G02 A;  3JUO A;  4EC6 A;  1DMQ A;  1I2E A;  2XRX B;  4XM4 A;  1BNF A;  1UUW B;  3CCU 3;  2CG1 A;  1JBR A;  2CH9 A;  2LYX A;  1UI8 A;  3FF2 A;  3FH1 A;  3IPT A;  3CCJ 3;  1IU7 A;  1RRH A;  1VQQ A;  2INX A;  2HMN B;  2IMJ A;  1B21 A;  1E3R A;  1N8R 4;  2QEX 3;  3D79 A;  4HM4 B;  5ELU A;  1BRS A;  3CCR 3;  1I2G A;  3WOF B;  2OTJ 3;  3LT8 A;  5TGN A;  1DMN A;  1O7N B;  1UCJ A;  3DXO A;  1GOV A;  3EE1 A;  4AEQ A;  3DM8 A;  1RMS A;  1UW1 A;  1BRI A;  1BSA A;  1YJW 3;  5M19 A;  1W4N A;  1BNR A;  3LTA A;  3JVC A;  4HKV B;  1MNL A;  1Q40 A;  1EG9 B;  3B8L A;  4HVN A;  5IER A;  1KQS 2;  4KFE A;  3Q1C A;  4NRE A;  3IMA B;  1RGL A;  1RN4 A;  1OHO A;  1UGI A;  4HM6 B;  1T5Y A;  3NBR A;  1OGX A;  4FCJ A;  4ILF A;  4GHO A;  2GU1 A;  1JB5 A;  1D6Y A;  1UCL A;  4FCZ A;  4MMY B;  3FF0 A;  1NB3 I;  5HGR A;  3GZB A;  3LML A;  3B7C A;  3UL5 A;  1M1X B;  3F7X A;  1US1 A;  3HK4 A;  1BSD A;  1BOX A;  2GEY A;  3OXA A;  3FLJ A;  3N54 B;  3WA2 X;  4BU4 A;  1A90 A;  2E2V A;  1AR0 A;  2GBW B;  1WMN A;  3DGO A;  4KZ1 A;  3AGN A;  4N6L A;  2GXF A;  3H51 A;  2WOH A;  4OVM A;  1D6U A;  1AVL A;  4L7K A;  1GYB A;  3K5T A;  1G96 A;  1NO3 A;  4JRF A;  3V98 A;  1RCL A;  4QWT A;  1IQX A;  2F5W A;  3ALA A;  1V58 A;  2HMO B;  1JB2 A;  1TFK A;  2GU3 A;  2P05 A;  2RCD A;  1WTH A;  3EC9 A;  1O7M B;  3ZG0 A;  1W6Y A;  1IVU A;  3EF8 A;  1RN1 A;  1JN5 B;  3N8B A;  3EBY A;  1Q82 4;  1ASK A;  6STD A;  1FUS A;  4KT3 B;  3X42 A;  1LOY A;  3EBT A;  3JUN A;  5EQL A;  2JDI H;  1AVK A;  3D9R A;  1M1K 4;  1YJN 3;  4HAA A;  5AYS C;  2IA7 A;  1I3I A;  1Q86 4;  1LNI A;  2W03 A;  3WR2 A;  2W56 B;  1GMQ A;  3BIR A;  4WHA A;  2KF3 A;  5D82 A;  3MHE A;  1W7C A;  1B27 A;  4MJD A;  5M18 A;  4HBR A;  2XGL A;  3PCS A;  1BRJ A;  2HMM B;  3OWY A;  1SII A;  1BNS A;  1BU4 A;  3KKG A;  1HYF A;  4OUQ A;  1IVW A;  2CWV A;  1STD A;  3QRD A;  4ORL A;  2GBX B;  1OF5 A;  1YIT 3;  3D5G A;  1DE3 A;  2Q07 A;  4LYL B;  5JBS A;  3LYG A;  1A2K A;  4N6T A;  1SIH A; 
#chains in the Genus database with same CATH homology
 2GSP A;  1R4Y A;  1B3S A;  1BRH A;  2KF6 A;  1BRN L;  1RGG A;  3WHO A;  1BRK A;  1FYS A;  1RGH A;  3SYU A;  1BNE A;  2KF4 A;  3GSP A;  4RNT A;  5BU4 A;  1B2Z A;  1CH0 A;  1RSN A;  1G02 A;  1X1U A;  3RNT A;  9RNT A;  3D4A A;  1I2E A;  2SAR A;  1BNI A;  1BNF A;  3AHW A;  1JBR A;  1JBS A;  8RNT A;  1YGW A;  1YVS A;  5HOH A;  1BAN A;  1C54 A;  1PYL A;  1RGK A;  1X1X A;  1X1W A;  1FZU A;  1I70 A;  2KAA A;  1B21 A;  1I2F A;  1RTU A;  1UCI A;  2AAD A;  3URP A;  1BRS A;  1I2G A;  1UCJ A;  1BVI A;  1GOV A;  1T2I A;  1RMS A;  4HOH A;  1BRI A;  1BSA A;  2HOH A;  2RBI A;  1BNR A;  1BGS A;  1I3F A;  2F4Y A;  2AAE A;  1AQZ A;  2BIR A;  1B2X A;  3HOH A;  1RGL A;  1RN4 A;  1I8V A;  2F56 A;  1RHL A;  4GSP A;  1BIR A;  1LOV A;  1MGR A;  4GHO A;  7GSP A;  1TRP A;  5GSP A;  1UCL A;  4J5G A;  1A2P A;  1RCK A;  1LRA A;  1TTO A;  1PY3 A;  3D5I A;  1Q9E A;  1RGE A;  1FW7 A;  1I0X A;  1X1Y A;  3BU4 A;  1BSD A;  1BOX A;  1HZ1 A;  3DGY A;  4BU4 A;  1FUT A;  1MGW A;  1BNG A;  3AGN A;  1BUJ A;  1GMP A;  1B2S A;  1BRG A;  2KF5 A;  1BSC A;  3Q3F A;  1B2U A;  1GOU A;  1RCL A;  1YNV X;  1BSE A;  1GSP A;  1LOW A;  2F5W A;  1B2M A;  3AHS A;  3KCH A;  1RNB A;  1RDS A;  1RGC A;  1RN1 A;  6RNT A;  1RNT A;  1AY7 A;  4J5K A;  1RLS A;  2BU4 A;  1UCK A;  1FUS A;  1LOY A;  1ZGX A;  1T2H A;  6GSP A;  1SAR A;  1IYY A;  1BSB A;  1BAO A;  1DET A;  1B20 A;  4HAA A;  1I3I A;  1LNI A;  3A5E A;  3WR2 A;  4BIR A;  5BIR A;  1GOY A;  3BIR A;  1GMQ A;  2C4B A;  2KF3 A;  3AGO A;  1B27 A;  1RGF A;  1GMR A;  2F5M A;  2ZA4 A;  2RNT A;  1BRJ A;  1JBT A;  1BNJ A;  5RNT A;  1BNS A;  1BU4 A;  7RNT A;  1HYF A;  1I0V A;  3DH2 A;  3D5G A;  1DE3 A;  1TRQ A;  1RGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...