1RGHA

Hydrolase, guanyloribonuclease
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ribonuclease from Streptomyces aureofaciens at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase (guanyloribonuclease)
molecule keywords RIBONUCLEASE
total genus 24
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1995-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rghA00
1BNGA 4GHOA 1BNIA 1MGWA 9RNTA 1BAOA 2SARA 3SYUA 3DGYA 3RNTA 1BSAA 1BU4A 1TRPA 1A2PA 1I0VA 1B2ZA 3AHWA 1LOWA 1I3IA 1JBRA 1BNEA 1RMSA 1BSEA 1FZUA 3AHSA 1BRSA 1PYLA 1CH0A 3AGOA 1Q9EA 1R4YA 1BRHA 1I2EA 1SARA 1ZGXA 2F5WA 1RNBA 1DETA 1C54A 1RGFA 1RN1A 1I0XA 3BU4A 3D4AA 1BSDA 1GSPA 1RGEA 1X1XA 2RNTA 1FW7A 1GOUA 1B27A 1UCKA 1RTUA 1RCLA 1RGGA 1BVIA 3D5GA 2KF3A 4J5KA 4J5GA 4BIRA 5GSPA 3WHOA 1B2UA 1JBTA 1YGWA 1X1WA 1BRJA 5BIRA 1X1UA 1BNJA 1LNIA 5BU4A 1UCJA 1I3FA 3Q3FA 1B2XA 1HYFA 1T2IA 4GSPA 1RN4A 1I2GA 2GSPA 7RNTA 1BRGA 1BUJA 2C4BA 1BIRA 1BRKA 1MGRA 1HZ1A 1BGSA 1FUSA 1I8VA 4HOHA 1BSBA 1BNRA 1I70A 1AQZA 2AADA 1X1YA 1FYSA 1UCIA 1TRQA 3URPA 1BOXA 1AY7A 3HOHA 8RNTA 2BIRA 4RNTA 1B2MA 1T2HA 1UCLA 2F56A 2RBIA 3DH2A 6RNTA 1RGHA 1RSNA 1RCKA 2KF6A 2ZA4A 3D5IA 1JBSA 1BRNL 1B20A 1LOYA 1YNVX 1B21A 1I2FA 2F4YA 7GSPA 1RGKA 4BU4A 3BIRA 5RNTA 4HAAA 3GSPA 1G02A 1BSCA 1BNFA 1B2SA 1GOYA 2HOHA 1RGLA 3AGNA 1BNSA 6GSPA 1LRAA 1YVSA 5HOHA 2F5MA 3WR2A 1TTOA 1PY3A 1IYYA 2KAAA 1RDSA 2KF4A 1RNTA 1BRIA 1GMPA 1GMQA 2KF5A 3A5EA 1GMRA 1GOVA 1DE3A 1RHLA 3KCHA 1RLSA 1FUTA 1RGCA 1B3SA 2BU4A 1LOVA 1BANA 1RGAA 2AAEA
chains in the Genus database with same CATH superfamily
1BNGA 2MF7A 4GHOA 1Q42A 5FGOA 1MGWA 1Q864 3I0YA 5AYSC 3ROBA 3G0KA 1RKYA 3CCV3 3EQQB 4JF8A 1TRPA 1A2PA 3KSPA 3NQYA 3OV4A 2GBWB 1JKGA 3F9SA 3CC23 5A0OB 3LTAA 1W7CA 4MMXB 5KP1A 1FUWA 1NDOB 2ZHXB 1C7HA 1RMSA 3CME3 1DMQA 1FZUA 3NXJA 5EEOA 1PYLA 4EC6A 3FG3A 1JB2A 2H0IA 1YHQ3 3EJVA 1JB4A 1IQYA 1Q9EA 1ZGXA 2CK3H 1DETA 4HBRA 4KFDA 4L8PA 4KFEA 1VQ93 1Q40B 1ZX2A 1YGEA 4Q53A 4CPKA 3HIIA 3GZYB 3MKIA 3KKGA 2F86B 2E2UA 1UCKA 5AIHA 4BL2A 2CFGA 1Q824 2E2TA 1WMOA 4WHAA 1YJN3 2GXFA 1RGGA 2Y74A 3CCQ3 5G2GA 2CFKA 5GSPA 3WHOA 3OX9A 4N6UA 1NJI4 1VQ83 4FCMA 4X2HA 5AIFA 5BVBA 4ORLA 1KQS2 2YX9A 1OCVA 3NX0A 1X1UA 5M19A 2W0QA 2XF3A 2UUGC 1LNIA 3PYJA 1I3FA 1TIJA 4CDLA 1B2XA 3I563 1NB5I 1T2IA 7RNTA 4EYCA 2UX0A 3OWYA 1BRGA 2CWUA 2RGQA 1O7NB 5CLKA 1BGSA 1OF5A 1NWWA 4R4KA 2B1XB 4HOHA 1AR0A 1L5GB 2ML5A 3LH4A 4XDWA 5IG3A 3CC43 3DGOA 2AADA 1UUGB 2IA7A 3LTDA 4X2OA 1FYSA 1WMNA 3X42A 3ECFA 3N8BA 1IT7A 1BOXA 1AY7A 4BTXA 4I5QA 3JUPA 3B4OA 1B2MA 1T2HA 2W56B 4HM7B 3SLUA 2IUKA 2GU3A 2KCDA 3FCSB 3JUOA 4OVMA 1N8R4 3Q1CA 1JBSA 1N8QA 1BRNL 1IV9A 4R9LA 1LOYA 1YNVX 3Q2PA 1B21A 2BMRB 3WA2X 3NQZA 5BXQA 1RGKA 1VQO3 1VQQA 3GSPA 3A76A 3SEDA 2RCDA 3DMCA 4HZ9B 1BSCA 1BNFA 2OQEC 2CFWA 2OTL3 3UL6A 3T8NA 1GOYA 2CWTA 1UI7A 3CCE3 1BNSA 1A2VA 4O2HA 5IG4A 5HGRA 2Z7AA 3K5TA 1W6CA 1TTOA 5D82A 1PY3A 1ZS7A 2KAAA 3EC9A 3EN8A 2HMMB 5CK6A 1VQ43 1VQN3 4NREA 3G8ZA 3ZG5A 2WO0A 2BO9B 1TJDA 3NBRA 3Q90A 3VF1A 3PCRA 2KF5A 1IVVA 3FG4A 3D9RA 3HK4A 4KVHA 4BL3A 1DMNA 2INXA 3KCHA 3OWUA 1Q814 3DZLA 1JN5A 3NUVA 2AAEA 1NU3A 1RN7A 3B4PA 2XFTA 3CU3A 2CC3A 1W01A 2SARA 1MNLA 3NV0A 1IVWA 3CCR3 1MOLA 3RNTA 3GZXB 1BSAA 4G1MB 3LMLA 2CFDA 1LVNA 2L4VA 1G0TA 3LTCA 1W2ZA 3PXMA 2ML6A 3AHWA 5EVHA 2J8XB 3NHXA 3S67A 2RFRA 6STDA 3TDGA 7STDA 4XBYA 4KT3B 4EXRA 1HKXA 1OACA 3FH1A 3GAXA 1BSEA 4KFFA 3AHSA 1A67A 2OCTA 4TX4A 4FMCA 2P0XA 1NO3A 1TFOA 2BMQB 1UGIA 3E99A 4N6LA 1MWRA 3AMOB 1CH0A 3CXC2 1OGZA 1SARA 3KE7A 3O8YA 2SBLA 2CHCA 2FGTA 4FMDA 5D81A 5AI1A 2XGNA 1RNBA 2W2CA 2PZVA 3U1WA 3SX1A 1IV7A 2CW9A 4R9KA 4XDVA 3CCL3 1BSDA 1GSPA 1FA3A 3T8UA 3MWZA 3DY5A 1RRLA 3OXAA 5IERA 4CJNA 3FKAA 4N3VA 4QWTA 1UUVB 2BT3A 1FGQA 1K734 3D79A 1JNQA 4FMAA 3STDA 1K8A4 2L1SA 1VQM3 2WOFA 1DVDA 4WFOA 5DRVA 1WMPA 1X1WA 3LT9A 3OW22 4JRFA 2K54A 3PZWA 4LGQA 1K41A 3UL5A 3DGNA 3FF2A 3PS8A 1UI8A 1KD14 1BNJA 1CQSA 1JJ22 2D42A 2CKFB 1UCJA 1W6YA 2KXGA 3DUKA 1W4NA 3V92A 2XGLA 1HYFA 1ULIB 1BUQA 3SXXA 1I2GA 3RGRA 1JB5A 2RSXA 4DKIA 4LYLB 3S5CA 5IW9A 2V1LA 3CC73 5LC7A 1HZ1A 4HM0B 5LC6A 3S27A 3WMDA 1FUSA 3HZPA 3X3ZA 5IENA 1I8VA 3DGMA 2K3DA 4IT7A 1JKGB 3FGYA 4FCZA 4CCVA 5KP4A 1I70A 1A2KA 1VZZA 5AYRB 1OHPA 2GU1A 1OUNA 2HMLB 4HM6B 4J9AA 4FCJA 3LT8A 1LQMB 1UCIA 3JUQA 1TRQA 1OF5B 5IEPA 3MG2A 2PNCA 4LMIA 1GY5A 3HI7A 1QAFA 1QAKA 3S29A 1N9EA 3DH2A 1RSNA 4ILFA 3LZAA 2OQEA 2KF6A 2ZA4A 3F40A 3SOAA 4RNZA 3JVCA 4XB5A 2F4YA 3BNDA 1E3RA 3G6E3 7GSPA 4HAAA 2QEX3 1G02A 1V74A 1JN5B 3F8HA 1B2SA 5CF1A 5I97A 3AGNA 4EBGA 1PU4A 3CMA3 1LXEA 6GSPA 2KRTA 4EV5A 3UNLA 1TP6A 4AKYA 3RDEA 1S723 3WA3A 1M1K4 1GD3A 1WNHA 1J2BA 3FG1A 3LTBA 3ZG0A 1Z1SA 3EN1B 5KP3A 4HM5B 1ZO2A 3EBTA 4EW5A 1LOXA 1GMPA 1UGHI 2QGUA 1CYUA 2LQVA 3A5EA 4IPBA 3F14A 4L7KA 4WP5A 1DE3A 1RHLA 1WQLB 4N6V0 3VSYA 1FUTA 1RLSA 1B3SA 2W9PA 3CCU3 1YIT3 1VQL3 1W02A 1RGAA 2BU4A 2W6JH 3BNCA 4FR9A 1RRHA 1JZOA 1N5HA 1BNIA 3SOYA 2BMOB 1BAOA 4L8OA 2CWVA 1Q7HA 2P05A 1BU4A 2H0GA 2IY2A 2XR8B 3EF8A 3S28A 3IPTA 3KSED 3JUNA 3B8LA 2HMNB 2Z77A 2CG1A 1B2ZA 1F8NA 2D1WA 1T5YA 1KSIA 1U8CB 1LOWA 3MSOA 1YI23 1IQXA 2XSOB 3G713 1ASKA 2CFLA 1N5PA 3QK9A 1A90A 4K61A 1QMAA 4XM4A 5ELJA 5STDA 5M18A 3RGAA 1RJOA 3V98A 3OWSA 1BRHA 1I2EA 1OHSA 2F5WA 3G4S3 1RGFA 1QVG2 1RN1A 1I0XA 3BU4A 3NBJA 4AKZA 2P0MA 1X1XA 1GY6A 2B24B 2RNTA 1FW7A 1MWTA 1B27A 2QIYA 3FF0A 1RTUA 1YJW3 2K0MA 3X41A 3PCSA 1KC84 5CXOA 1BVIA 3D5GA 3DGLA 2HMOB 2OOVA 4IIAA 4J5GA 1TUHA 5DREA 4AEQA 5D83A 1U5OA 2ZL8A 2I9WA 1YGWA 3M8CA 3NBBA 4HM2B 3MG1A 4O8SA 1JBTA 1BRJA 2F98A 4N6OB 4NPBA 2P38A 2JDIH 3CPOA 2GEYA 1EUIC 1NNVA 1JRQA 5ELUA 5BU4A 4MJDA 1YJ93 2C10A 3Q3FA 3FSDA 1E97A 5G1LA 1VQK3 2E2VA 3I553 3AMOA 2GSPA 3QRDA 4EV2A 3WODG 1EG9B 1OHOA 2C4BA 5AEUB 1FGMA 2YFIB 1BIRA 1BRKA 1Q40A 4XBTA 4HM1B 1EEJA 1STDA 1BSBA 2OTJ3 1VQP3 1BNRA 5JPUA 3CCS3 1QVF2 1AQZA 3LOYA 1EQKA 2STDA 1Q7Y4 2YFJB 1TU5A 4MMZB 5AEWB 2C11A 1W6GA 1MWSA 2W03A 3URPA 4WYKB 3HOHA 4BTYA 4O3VA 8RNTA 1FGRA 3NV0B 2OOVC 2XSHB 2BIRA 4K1UA 1UCLA 5CF2A 3LYGA 2WGOA 4GB5A 2F56A 2RBIA 6RNTA 1TFKA 1RGHA 4U13A 1W00A 1GS3A 3D5IA 4HZBB 3KIIA 1B20A 3NM7A 4N6NB 5M1AA 3WOFB 1IVUA 4RZMA 2F99A 3K0ZA 4BU4A 5RNTA 3HX8A 5IEOA 1IU7A 1US1A 4RBNA 1STFI 1QJGA 2HOHA 3T0UA 1D6ZA 2CG0A 3D3LA 3MYTA 2GBXB 1M1XB 4H61A 3SVAA 1KWIA 1GD4A 1Y4KA 2F5MA 3BNEA 1UDII 5HOHA 2XEPA 1SIIA 3BB9A 1O7WB 4HM4B 2KF4A 1AVLA 1SPUA 4MEIA 1BRIA 3J7Yd 3CCJ3 1GMQA 2O3OA 4R1KA 1IVXA 1GMRA 5IG5A 2IUJA 1V57A 1JZDA 2QA43 3K63A 5JPPA 5AIGA 4N6TA 3DM8A 3UB1A 1LOVA 2FXTA 8CHOA 4HM3B 2XRXB 3ER7A 2LYXA 5EQLA 9RNTA 1SIHA 2WOHA 3SYUA 1N9JA 3DGYA 1D6UA 2CIUA 4LSOA 1OGXA 4STDA 1LNHA 4OK0A 1CEWI 4HVNA 1I0VA 2BNGA 3EX9A 3X3YA 2A15A 1LQGC 1V58A 1I3IA 1GY7A 3JUMA 4N6MA 4WWUC 1JBRA 3DXOA 3N54B 1BNEA 2HMKB 1O7GB 3LXUX 2GEXA 3BNBA 1BRSA 3GZBA 3CD63 3H3HA 3B7CA 1HU9A 3UJMA 3AGOA 4ZM8A 4LZIA 1R4YA 4MMYB 3K9MC 1O7PB 3K7CA 1C54A 4H3UA 3G16A 3D4AA 3KN4A 5JBSA 1RGEA 1R4CA 4I4KA 3GRDA 1GOUA 4HYZA 1K28A 2MC8A 1VQ63 3CNMA 1WTHA 4FMBA 4HJLB 3ALAA 3KZTA 2CX0A 4K1VA 1RCLA 2HMJB 2W04A 3F7SA 2KF3A 4J5KA 2WGQA 4BIRA 2ZDJA 3MHEA 3BLZA 2W56A 1VQ53 1B2UA 1S5AA 5IG0A 1G96A 3CPW2 1T3BA 5BIRA 1FGTA 1K9M4 2CH9A 1IK3A 1W2B2 1DVCA 3X3XA 4GL6A 2M7OA 3U97A 4GSPA 2H0HA 1RN4A 2Z76A 5G1KA 1O7HB 1BUJA 1E3VA 2W9QA 4RNYA 5TGNA 1MGRA 1IDPA 1YVBI 3WOEB 4OUQA 2Y73A 1GYBA 1AV4A 4K90B 2XFSA 1IQ8A 1O7MB 4XBXA 2CX1A 1X1YA 1ROAA 1QALA 3IMAB 1DMMA 1EKMA 1UW1A 1W5ZA 1NB3I 3X40A 2Z6BA 3EB8A 3MG3A 4RNTA 2O9UX 3N9HA 1SQWA 3H51A 2JQ5A 3GWRA 4HKVB 1RCKA 4NHFA 2XH9A 4R80A 5AIIA 1JV2B 3EBYA 1I2FA 2OWPA 3CNXA 1ULJB 3BIRA 3FZWA 2UGIA 3F7XA 1DYUA 1OH0A 3KFQC 4PEJA 3FLJA 1RGLA 3F8XA 4O02B 3ZFZA 1LRAA 2BHMA 2IYJA 1YVSA 3IJEB 1EA2A 3L0RA 1ROVA 3WR2A 3GZRA 1IYYA 5IF6A 2FNQA 1RDSA 2YFLB 2P09A 3EE1A 3MPHA 1PFPA 4LEHA 3WDGB 1RNTA 1CYVA 2R41A 1UUWB 2IMJA 4WYKA 1D6YA 3NM2A 1AVKA 1IT8A 1MWUA 4HM8B 4J8TA 4BTWA 1GOVA 1M9GA 1VQ73 1M904 2R4IA 1ISKA 1FGOA 3EHCA 3VGNA 3PGBA 1OPYA 2Q07A 1RGCA 3HIGA 4KZ1A 3V99A 3CCM3 1YIJ3 1BANA 1SJWA 5FW5A
chains in the Genus database with same CATH topology
1BNGA 4GHOA 1BNIA 1MGWA 9RNTA 1BAOA 2SARA 3SYUA 3DGYA 3RNTA 1BSAA 1BU4A 1TRPA 1A2PA 1I0VA 1B2ZA 3AHWA 1LOWA 1I3IA 1JBRA 1BNEA 1RMSA 1BSEA 1FZUA 3AHSA 1BRSA 1PYLA 1CH0A 3AGOA 1Q9EA 1R4YA 1BRHA 1I2EA 1SARA 1ZGXA 2F5WA 1RNBA 1DETA 1C54A 1RGFA 1RN1A 1I0XA 3BU4A 3D4AA 1BSDA 1GSPA 1RGEA 1X1XA 2RNTA 1FW7A 1GOUA 1B27A 1UCKA 1RTUA 1RCLA 1RGGA 1BVIA 3D5GA 2KF3A 4J5KA 4J5GA 4BIRA 5GSPA 3WHOA 1B2UA 1JBTA 1YGWA 1X1WA 1BRJA 5BIRA 1X1UA 1BNJA 1LNIA 5BU4A 1UCJA 1I3FA 3Q3FA 1B2XA 1HYFA 1T2IA 4GSPA 1RN4A 1I2GA 2GSPA 7RNTA 1BRGA 1BUJA 2C4BA 1BIRA 1BRKA 1MGRA 1HZ1A 1BGSA 1FUSA 1I8VA 4HOHA 1BSBA 1BNRA 1I70A 1AQZA 2AADA 1X1YA 1FYSA 1UCIA 1TRQA 3URPA 1BOXA 1AY7A 3HOHA 8RNTA 2BIRA 4RNTA 1B2MA 1T2HA 1UCLA 2F56A 2RBIA 3DH2A 6RNTA 1RGHA 1RSNA 1RCKA 2KF6A 2ZA4A 3D5IA 1JBSA 1BRNL 1B20A 1LOYA 1YNVX 1B21A 1I2FA 2F4YA 7GSPA 1RGKA 4BU4A 3BIRA 5RNTA 4HAAA 3GSPA 1G02A 1BSCA 1BNFA 1B2SA 1GOYA 2HOHA 1RGLA 3AGNA 1BNSA 6GSPA 1LRAA 1YVSA 5HOHA 2F5MA 3WR2A 1TTOA 1PY3A 1IYYA 2KAAA 1RDSA 2KF4A 1RNTA 1BRIA 1GMPA 1GMQA 2KF5A 3A5EA 1GMRA 1GOVA 1DE3A 1RHLA 3KCHA 1RLSA 1FUTA 1RGCA 1B3SA 2BU4A 1LOVA 1BANA 1RGAA 2AAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNG A;  4GHO A;  1BNI A;  1MGW A;  9RNT A;  1BAO A;  2SAR A;  3SYU A;  3DGY A;  3RNT A;  1BSA A;  1BU4 A;  1TRP A;  1A2P A;  1I0V A;  1B2Z A;  3AHW A;  1LOW A;  1I3I A;  1JBR A;  1BNE A;  1RMS A;  1BSE A;  1FZU A;  3AHS A;  1BRS A;  1PYL A;  1CH0 A;  3AGO A;  1Q9E A;  1R4Y A;  1BRH A;  1I2E A;  1SAR A;  1ZGX A;  2F5W A;  1RNB A;  1DET A;  1C54 A;  1RGF A;  1RN1 A;  1I0X A;  3BU4 A;  3D4A A;  1BSD A;  1GSP A;  1RGE A;  1X1X A;  2RNT A;  1FW7 A;  1GOU A;  1B27 A;  1UCK A;  1RTU A;  1RCL A;  1RGG A;  1BVI A;  3D5G A;  2KF3 A;  4J5K A;  4J5G A;  4BIR A;  5GSP A;  3WHO A;  1B2U A;  1JBT A;  1YGW A;  1X1W A;  1BRJ A;  5BIR A;  1X1U A;  1BNJ A;  1LNI A;  5BU4 A;  1UCJ A;  1I3F A;  3Q3F A;  1B2X A;  1HYF A;  1T2I A;  4GSP A;  1RN4 A;  1I2G A;  2GSP A;  7RNT A;  1BRG A;  1BUJ A;  2C4B A;  1BIR A;  1BRK A;  1MGR A;  1HZ1 A;  1BGS A;  1FUS A;  1I8V A;  4HOH A;  1BSB A;  1BNR A;  1I70 A;  1AQZ A;  2AAD A;  1X1Y A;  1FYS A;  1UCI A;  1TRQ A;  3URP A;  1BOX A;  1AY7 A;  3HOH A;  8RNT A;  2BIR A;  4RNT A;  1B2M A;  1T2H A;  1UCL A;  2F56 A;  2RBI A;  3DH2 A;  6RNT A;  1RGH A;  1RSN A;  1RCK A;  2KF6 A;  2ZA4 A;  3D5I A;  1JBS A;  1BRN L;  1B20 A;  1LOY A;  1YNV X;  1B21 A;  1I2F A;  2F4Y A;  7GSP A;  1RGK A;  4BU4 A;  3BIR A;  5RNT A;  4HAA A;  3GSP A;  1G02 A;  1BSC A;  1BNF A;  1B2S A;  1GOY A;  2HOH A;  1RGL A;  3AGN A;  1BNS A;  6GSP A;  1LRA A;  1YVS A;  5HOH A;  2F5M A;  3WR2 A;  1TTO A;  1PY3 A;  1IYY A;  2KAA A;  1RDS A;  2KF4 A;  1RNT A;  1BRI A;  1GMP A;  1GMQ A;  2KF5 A;  3A5E A;  1GMR A;  1GOV A;  1DE3 A;  1RHL A;  3KCH A;  1RLS A;  1FUT A;  1RGC A;  1B3S A;  2BU4 A;  1LOV A;  1BAN A;  1RGA A;  2AAE A; 
#chains in the Genus database with same CATH topology
 1BNG A;  2MF7 A;  4GHO A;  1Q42 A;  5FGO A;  1MGW A;  1Q86 4;  3I0Y A;  5AYS C;  3ROB A;  3G0K A;  1RKY A;  3CCV 3;  3EQQ B;  4JF8 A;  1TRP A;  1A2P A;  3KSP A;  3NQY A;  3OV4 A;  2GBW B;  1JKG A;  3F9S A;  3CC2 3;  5A0O B;  3LTA A;  1W7C A;  4MMX B;  5KP1 A;  1FUW A;  1NDO B;  2ZHX B;  1C7H A;  1RMS A;  3CME 3;  1DMQ A;  1FZU A;  3NXJ A;  5EEO A;  1PYL A;  4EC6 A;  3FG3 A;  1JB2 A;  2H0I A;  1YHQ 3;  3EJV A;  1JB4 A;  1IQY A;  1Q9E A;  1ZGX A;  2CK3 H;  1DET A;  4HBR A;  4KFD A;  4L8P A;  4KFE A;  1VQ9 3;  1Q40 B;  1ZX2 A;  1YGE A;  4Q53 A;  4CPK A;  3HII A;  3GZY B;  3MKI A;  3KKG A;  2F86 B;  2E2U A;  1UCK A;  5AIH A;  4BL2 A;  2CFG A;  1Q82 4;  2E2T A;  1WMO A;  4WHA A;  1YJN 3;  2GXF A;  1RGG A;  2Y74 A;  3CCQ 3;  5G2G A;  2CFK A;  5GSP A;  3WHO A;  3OX9 A;  4N6U A;  1NJI 4;  1VQ8 3;  4FCM A;  4X2H A;  5AIF A;  5BVB A;  4ORL A;  1KQS 2;  2YX9 A;  1OCV A;  3NX0 A;  1X1U A;  5M19 A;  2W0Q A;  2XF3 A;  2UUG C;  1LNI A;  3PYJ A;  1I3F A;  1TIJ A;  4CDL A;  1B2X A;  3I56 3;  1NB5 I;  1T2I A;  7RNT A;  4EYC A;  2UX0 A;  3OWY A;  1BRG A;  2CWU A;  2RGQ A;  1O7N B;  5CLK A;  1BGS A;  1OF5 A;  1NWW A;  4R4K A;  2B1X B;  4HOH A;  1AR0 A;  1L5G B;  2ML5 A;  3LH4 A;  4XDW A;  5IG3 A;  3CC4 3;  3DGO A;  2AAD A;  1UUG B;  2IA7 A;  3LTD A;  4X2O A;  1FYS A;  1WMN A;  3X42 A;  3ECF A;  3N8B A;  1IT7 A;  1BOX A;  1AY7 A;  4BTX A;  4I5Q A;  3JUP A;  3B4O A;  1B2M A;  1T2H A;  2W56 B;  4HM7 B;  3SLU A;  2IUK A;  2GU3 A;  2KCD A;  3FCS B;  3JUO A;  4OVM A;  1N8R 4;  3Q1C A;  1JBS A;  1N8Q A;  1BRN L;  1IV9 A;  4R9L A;  1LOY A;  1YNV X;  3Q2P A;  1B21 A;  2BMR B;  3WA2 X;  3NQZ A;  5BXQ A;  1RGK A;  1VQO 3;  1VQQ A;  3GSP A;  3A76 A;  3SED A;  2RCD A;  3DMC A;  4HZ9 B;  1BSC A;  1BNF A;  2OQE C;  2CFW A;  2OTL 3;  3UL6 A;  3T8N A;  1GOY A;  2CWT A;  1UI7 A;  3CCE 3;  1BNS A;  1A2V A;  4O2H A;  5IG4 A;  5HGR A;  2Z7A A;  3K5T A;  1W6C A;  1TTO A;  5D82 A;  1PY3 A;  1ZS7 A;  2KAA A;  3EC9 A;  3EN8 A;  2HMM B;  5CK6 A;  1VQ4 3;  1VQN 3;  4NRE A;  3G8Z A;  3ZG5 A;  2WO0 A;  2BO9 B;  1TJD A;  3NBR A;  3Q90 A;  3VF1 A;  3PCR A;  2KF5 A;  1IVV A;  3FG4 A;  3D9R A;  3HK4 A;  4KVH A;  4BL3 A;  1DMN A;  2INX A;  3KCH A;  3OWU A;  1Q81 4;  3DZL A;  1JN5 A;  3NUV A;  2AAE A;  1NU3 A;  1RN7 A;  3B4P A;  2XFT A;  3CU3 A;  2CC3 A;  1W01 A;  2SAR A;  1MNL A;  3NV0 A;  1IVW A;  3CCR 3;  1MOL A;  3RNT A;  3GZX B;  1BSA A;  4G1M B;  3LML A;  2CFD A;  1LVN A;  2L4V A;  1G0T A;  3LTC A;  1W2Z A;  3PXM A;  2ML6 A;  3AHW A;  5EVH A;  2J8X B;  3NHX A;  3S67 A;  2RFR A;  6STD A;  3TDG A;  7STD A;  4XBY A;  4KT3 B;  4EXR A;  1HKX A;  1OAC A;  3FH1 A;  3GAX A;  1BSE A;  4KFF A;  3AHS A;  1A67 A;  2OCT A;  4TX4 A;  4FMC A;  2P0X A;  1NO3 A;  1TFO A;  2BMQ B;  1UGI A;  3E99 A;  4N6L A;  1MWR A;  3AMO B;  1CH0 A;  3CXC 2;  1OGZ A;  1SAR A;  3KE7 A;  3O8Y A;  2SBL A;  2CHC A;  2FGT A;  4FMD A;  5D81 A;  5AI1 A;  2XGN A;  1RNB A;  2W2C A;  2PZV A;  3U1W A;  3SX1 A;  1IV7 A;  2CW9 A;  4R9K A;  4XDV A;  3CCL 3;  1BSD A;  1GSP A;  1FA3 A;  3T8U A;  3MWZ A;  3DY5 A;  1RRL A;  3OXA A;  5IER A;  4CJN A;  3FKA A;  4N3V A;  4QWT A;  1UUV B;  2BT3 A;  1FGQ A;  1K73 4;  3D79 A;  1JNQ A;  4FMA A;  3STD A;  1K8A 4;  2L1S A;  1VQM 3;  2WOF A;  1DVD A;  4WFO A;  5DRV A;  1WMP A;  1X1W A;  3LT9 A;  3OW2 2;  4JRF A;  2K54 A;  3PZW A;  4LGQ A;  1K41 A;  3UL5 A;  3DGN A;  3FF2 A;  3PS8 A;  1UI8 A;  1KD1 4;  1BNJ A;  1CQS A;  1JJ2 2;  2D42 A;  2CKF B;  1UCJ A;  1W6Y A;  2KXG A;  3DUK A;  1W4N A;  3V92 A;  2XGL A;  1HYF A;  1ULI B;  1BUQ A;  3SXX A;  1I2G A;  3RGR A;  1JB5 A;  2RSX A;  4DKI A;  4LYL B;  3S5C A;  5IW9 A;  2V1L A;  3CC7 3;  5LC7 A;  1HZ1 A;  4HM0 B;  5LC6 A;  3S27 A;  3WMD A;  1FUS A;  3HZP A;  3X3Z A;  5IEN A;  1I8V A;  3DGM A;  2K3D A;  4IT7 A;  1JKG B;  3FGY A;  4FCZ A;  4CCV A;  5KP4 A;  1I70 A;  1A2K A;  1VZZ A;  5AYR B;  1OHP A;  2GU1 A;  1OUN A;  2HML B;  4HM6 B;  4J9A A;  4FCJ A;  3LT8 A;  1LQM B;  1UCI A;  3JUQ A;  1TRQ A;  1OF5 B;  5IEP A;  3MG2 A;  2PNC A;  4LMI A;  1GY5 A;  3HI7 A;  1QAF A;  1QAK A;  3S29 A;  1N9E A;  3DH2 A;  1RSN A;  4ILF A;  3LZA A;  2OQE A;  2KF6 A;  2ZA4 A;  3F40 A;  3SOA A;  4RNZ A;  3JVC A;  4XB5 A;  2F4Y A;  3BND A;  1E3R A;  3G6E 3;  7GSP A;  4HAA A;  2QEX 3;  1G02 A;  1V74 A;  1JN5 B;  3F8H A;  1B2S A;  5CF1 A;  5I97 A;  3AGN A;  4EBG A;  1PU4 A;  3CMA 3;  1LXE A;  6GSP A;  2KRT A;  4EV5 A;  3UNL A;  1TP6 A;  4AKY A;  3RDE A;  1S72 3;  3WA3 A;  1M1K 4;  1GD3 A;  1WNH A;  1J2B A;  3FG1 A;  3LTB A;  3ZG0 A;  1Z1S A;  3EN1 B;  5KP3 A;  4HM5 B;  1ZO2 A;  3EBT A;  4EW5 A;  1LOX A;  1GMP A;  1UGH I;  2QGU A;  1CYU A;  2LQV A;  3A5E A;  4IPB A;  3F14 A;  4L7K A;  4WP5 A;  1DE3 A;  1RHL A;  1WQL B;  4N6V 0;  3VSY A;  1FUT A;  1RLS A;  1B3S A;  2W9P A;  3CCU 3;  1YIT 3;  1VQL 3;  1W02 A;  1RGA A;  2BU4 A;  2W6J H;  3BNC A;  4FR9 A;  1RRH A;  1JZO A;  1N5H A;  1BNI A;  3SOY A;  2BMO B;  1BAO A;  4L8O A;  2CWV A;  1Q7H A;  2P05 A;  1BU4 A;  2H0G A;  2IY2 A;  2XR8 B;  3EF8 A;  3S28 A;  3IPT A;  3KSE D;  3JUN A;  3B8L A;  2HMN B;  2Z77 A;  2CG1 A;  1B2Z A;  1F8N A;  2D1W A;  1T5Y A;  1KSI A;  1U8C B;  1LOW A;  3MSO A;  1YI2 3;  1IQX A;  2XSO B;  3G71 3;  1ASK A;  2CFL A;  1N5P A;  3QK9 A;  1A90 A;  4K61 A;  1QMA A;  4XM4 A;  5ELJ A;  5STD A;  5M18 A;  3RGA A;  1RJO A;  3V98 A;  3OWS A;  1BRH A;  1I2E A;  1OHS A;  2F5W A;  3G4S 3;  1RGF A;  1QVG 2;  1RN1 A;  1I0X A;  3BU4 A;  3NBJ A;  4AKZ A;  2P0M A;  1X1X A;  1GY6 A;  2B24 B;  2RNT A;  1FW7 A;  1MWT A;  1B27 A;  2QIY A;  3FF0 A;  1RTU A;  1YJW 3;  2K0M A;  3X41 A;  3PCS A;  1KC8 4;  5CXO A;  1BVI A;  3D5G A;  3DGL A;  2HMO B;  2OOV A;  4IIA A;  4J5G A;  1TUH A;  5DRE A;  4AEQ A;  5D83 A;  1U5O A;  2ZL8 A;  2I9W A;  1YGW A;  3M8C A;  3NBB A;  4HM2 B;  3MG1 A;  4O8S A;  1JBT A;  1BRJ A;  2F98 A;  4N6O B;  4NPB A;  2P38 A;  2JDI H;  3CPO A;  2GEY A;  1EUI C;  1NNV A;  1JRQ A;  5ELU A;  5BU4 A;  4MJD A;  1YJ9 3;  2C10 A;  3Q3F A;  3FSD A;  1E97 A;  5G1L A;  1VQK 3;  2E2V A;  3I55 3;  3AMO A;  2GSP A;  3QRD A;  4EV2 A;  3WOD G;  1EG9 B;  1OHO A;  2C4B A;  5AEU B;  1FGM A;  2YFI B;  1BIR A;  1BRK A;  1Q40 A;  4XBT A;  4HM1 B;  1EEJ A;  1STD A;  1BSB A;  2OTJ 3;  1VQP 3;  1BNR A;  5JPU A;  3CCS 3;  1QVF 2;  1AQZ A;  3LOY A;  1EQK A;  2STD A;  1Q7Y 4;  2YFJ B;  1TU5 A;  4MMZ B;  5AEW B;  2C11 A;  1W6G A;  1MWS A;  2W03 A;  3URP A;  4WYK B;  3HOH A;  4BTY A;  4O3V A;  8RNT A;  1FGR A;  3NV0 B;  2OOV C;  2XSH B;  2BIR A;  4K1U A;  1UCL A;  5CF2 A;  3LYG A;  2WGO A;  4GB5 A;  2F56 A;  2RBI A;  6RNT A;  1TFK A;  1RGH A;  4U13 A;  1W00 A;  1GS3 A;  3D5I A;  4HZB B;  3KII A;  1B20 A;  3NM7 A;  4N6N B;  5M1A A;  3WOF B;  1IVU A;  4RZM A;  2F99 A;  3K0Z A;  4BU4 A;  5RNT A;  3HX8 A;  5IEO A;  1IU7 A;  1US1 A;  4RBN A;  1STF I;  1QJG A;  2HOH A;  3T0U A;  1D6Z A;  2CG0 A;  3D3L A;  3MYT A;  2GBX B;  1M1X B;  4H61 A;  3SVA A;  1KWI A;  1GD4 A;  1Y4K A;  2F5M A;  3BNE A;  1UDI I;  5HOH A;  2XEP A;  1SII A;  3BB9 A;  1O7W B;  4HM4 B;  2KF4 A;  1AVL A;  1SPU A;  4MEI A;  1BRI A;  3J7Y d;  3CCJ 3;  1GMQ A;  2O3O A;  4R1K A;  1IVX A;  1GMR A;  5IG5 A;  2IUJ A;  1V57 A;  1JZD A;  2QA4 3;  3K63 A;  5JPP A;  5AIG A;  4N6T A;  3DM8 A;  3UB1 A;  1LOV A;  2FXT A;  8CHO A;  4HM3 B;  2XRX B;  3ER7 A;  2LYX A;  5EQL A;  9RNT A;  1SIH A;  2WOH A;  3SYU A;  1N9J A;  3DGY A;  1D6U A;  2CIU A;  4LSO A;  1OGX A;  4STD A;  1LNH A;  4OK0 A;  1CEW I;  4HVN A;  1I0V A;  2BNG A;  3EX9 A;  3X3Y A;  2A15 A;  1LQG C;  1V58 A;  1I3I A;  1GY7 A;  3JUM A;  4N6M A;  4WWU C;  1JBR A;  3DXO A;  3N54 B;  1BNE A;  2HMK B;  1O7G B;  3LXU X;  2GEX A;  3BNB A;  1BRS A;  3GZB A;  3CD6 3;  3H3H A;  3B7C A;  1HU9 A;  3UJM A;  3AGO A;  4ZM8 A;  4LZI A;  1R4Y A;  4MMY B;  3K9M C;  1O7P B;  3K7C A;  1C54 A;  4H3U A;  3G16 A;  3D4A A;  3KN4 A;  5JBS A;  1RGE A;  1R4C A;  4I4K A;  3GRD A;  1GOU A;  4HYZ A;  1K28 A;  2MC8 A;  1VQ6 3;  3CNM A;  1WTH A;  4FMB A;  4HJL B;  3ALA A;  3KZT A;  2CX0 A;  4K1V A;  1RCL A;  2HMJ B;  2W04 A;  3F7S A;  2KF3 A;  4J5K A;  2WGQ A;  4BIR A;  2ZDJ A;  3MHE A;  3BLZ A;  2W56 A;  1VQ5 3;  1B2U A;  1S5A A;  5IG0 A;  1G96 A;  3CPW 2;  1T3B A;  5BIR A;  1FGT A;  1K9M 4;  2CH9 A;  1IK3 A;  1W2B 2;  1DVC A;  3X3X A;  4GL6 A;  2M7O A;  3U97 A;  4GSP A;  2H0H A;  1RN4 A;  2Z76 A;  5G1K A;  1O7H B;  1BUJ A;  1E3V A;  2W9Q A;  4RNY A;  5TGN A;  1MGR A;  1IDP A;  1YVB I;  3WOE B;  4OUQ A;  2Y73 A;  1GYB A;  1AV4 A;  4K90 B;  2XFS A;  1IQ8 A;  1O7M B;  4XBX A;  2CX1 A;  1X1Y A;  1ROA A;  1QAL A;  3IMA B;  1DMM A;  1EKM A;  1UW1 A;  1W5Z A;  1NB3 I;  3X40 A;  2Z6B A;  3EB8 A;  3MG3 A;  4RNT A;  2O9U X;  3N9H A;  1SQW A;  3H51 A;  2JQ5 A;  3GWR A;  4HKV B;  1RCK A;  4NHF A;  2XH9 A;  4R80 A;  5AII A;  1JV2 B;  3EBY A;  1I2F A;  2OWP A;  3CNX A;  1ULJ B;  3BIR A;  3FZW A;  2UGI A;  3F7X A;  1DYU A;  1OH0 A;  3KFQ C;  4PEJ A;  3FLJ A;  1RGL A;  3F8X A;  4O02 B;  3ZFZ A;  1LRA A;  2BHM A;  2IYJ A;  1YVS A;  3IJE B;  1EA2 A;  3L0R A;  1ROV A;  3WR2 A;  3GZR A;  1IYY A;  5IF6 A;  2FNQ A;  1RDS A;  2YFL B;  2P09 A;  3EE1 A;  3MPH A;  1PFP A;  4LEH A;  3WDG B;  1RNT A;  1CYV A;  2R41 A;  1UUW B;  2IMJ A;  4WYK A;  1D6Y A;  3NM2 A;  1AVK A;  1IT8 A;  1MWU A;  4HM8 B;  4J8T A;  4BTW A;  1GOV A;  1M9G A;  1VQ7 3;  1M90 4;  2R4I A;  1ISK A;  1FGO A;  3EHC A;  3VGN A;  3PGB A;  1OPY A;  2Q07 A;  1RGC A;  3HIG A;  4KZ1 A;  3V99 A;  3CCM 3;  1YIJ 3;  1BAN A;  1SJW A;  5FW5 A; 
#chains in the Genus database with same CATH homology
 1BNG A;  4GHO A;  1BNI A;  1MGW A;  9RNT A;  1BAO A;  2SAR A;  3SYU A;  3DGY A;  3RNT A;  1BSA A;  1BU4 A;  1TRP A;  1A2P A;  1I0V A;  1B2Z A;  3AHW A;  1LOW A;  1I3I A;  1JBR A;  1BNE A;  1RMS A;  1BSE A;  1FZU A;  3AHS A;  1BRS A;  1PYL A;  1CH0 A;  3AGO A;  1Q9E A;  1R4Y A;  1BRH A;  1I2E A;  1SAR A;  1ZGX A;  2F5W A;  1RNB A;  1DET A;  1C54 A;  1RGF A;  1RN1 A;  1I0X A;  3BU4 A;  3D4A A;  1BSD A;  1GSP A;  1RGE A;  1X1X A;  2RNT A;  1FW7 A;  1GOU A;  1B27 A;  1UCK A;  1RTU A;  1RCL A;  1RGG A;  1BVI A;  3D5G A;  2KF3 A;  4J5K A;  4J5G A;  4BIR A;  5GSP A;  3WHO A;  1B2U A;  1JBT A;  1YGW A;  1X1W A;  1BRJ A;  5BIR A;  1X1U A;  1BNJ A;  1LNI A;  5BU4 A;  1UCJ A;  1I3F A;  3Q3F A;  1B2X A;  1HYF A;  1T2I A;  4GSP A;  1RN4 A;  1I2G A;  2GSP A;  7RNT A;  1BRG A;  1BUJ A;  2C4B A;  1BIR A;  1BRK A;  1MGR A;  1HZ1 A;  1BGS A;  1FUS A;  1I8V A;  4HOH A;  1BSB A;  1BNR A;  1I70 A;  1AQZ A;  2AAD A;  1X1Y A;  1FYS A;  1UCI A;  1TRQ A;  3URP A;  1BOX A;  1AY7 A;  3HOH A;  8RNT A;  2BIR A;  4RNT A;  1B2M A;  1T2H A;  1UCL A;  2F56 A;  2RBI A;  3DH2 A;  6RNT A;  1RGH A;  1RSN A;  1RCK A;  2KF6 A;  2ZA4 A;  3D5I A;  1JBS A;  1BRN L;  1B20 A;  1LOY A;  1YNV X;  1B21 A;  1I2F A;  2F4Y A;  7GSP A;  1RGK A;  4BU4 A;  3BIR A;  5RNT A;  4HAA A;  3GSP A;  1G02 A;  1BSC A;  1BNF A;  1B2S A;  1GOY A;  2HOH A;  1RGL A;  3AGN A;  1BNS A;  6GSP A;  1LRA A;  1YVS A;  5HOH A;  2F5M A;  3WR2 A;  1TTO A;  1PY3 A;  1IYY A;  2KAA A;  1RDS A;  2KF4 A;  1RNT A;  1BRI A;  1GMP A;  1GMQ A;  2KF5 A;  3A5E A;  1GMR A;  1GOV A;  1DE3 A;  1RHL A;  3KCH A;  1RLS A;  1FUT A;  1RGC A;  1B3S A;  2BU4 A;  1LOV A;  1BAN A;  1RGA A;  2AAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...