1RGJA

Nmr structure of the complex between alpha-bungarotoxin and mimotope of the nicotinic acetylcholine receptor with enhanced activity
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords long neurotoxin 1
publication title NMR and MD studies on the interaction between ligand peptides and alpha-bungarotoxin.
pubmed doi rcsb
molecule tags Toxin
total genus 8
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2003-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1rgjA00
1JE9A 1CXOA 2MJ4A 2UWRA 1KTZB 2H7ZB 3NH7A 1TXBA 1CXNA 4RUDA 2N99A 1F94A 1KL8A 2PJYB 1IKCA 1JBDA 2H64B 3LAQU 1LXHA 3KFDE 1CDSA 1HOYA 1V6PA 1ES7B 1H0JA 1KFHA 1KS6A 1BTEA 1CREA 1QM7A 1NORA 2CRSA 1TGXA 1HAJA 1KC4A 2H8UA 1KXIA 1KU6B 2OFSA 3VTSA 1IDIA 1CDRA 2LA1A 1BXPA 1HC9A 2MJ0A 1FASA 2MUPA 3NDSA 2GOOC 1B41B 1IJCA 3BT2U 1I02A 1MAHF 3NEQA 2MFAA 4EY8B 4DO8A 1IK8A 2I9BE 2K3GA 2QJ9C 1IDHA 3PLCA 1CHVS 1TXAA 1CCQA 2CTXA 1VB0A 4IYEA 2CDXA 4FAOE 1CRFA 1IDGA 1RGJA 1ZADA 1LSIA 1QKEA 2H62D 1YWHA 1UG4A 1NXBA 1CB9A 2BTXA 2LCRA 4HQPF 1XT3A 1ERAA 1CODA 1PLOA 3EVSC 1F8UB 2H62C 1IQ9A 1ERGA 2QJBC 1LXGA 3EBXA 1KBSA 5DZ5A 2UX2A 1NTNA 5EBXA 1CTXA 5DU1A 2HLQA 2GOOB 1FF4A 1COEA 1QKDA 1FSSB 1LX5B 1G6MA 1MR6A 1M9ZA 4LFTA 2CRTA 3ERAA 6EBXA 1CVOA 1REWC 2FD6U 1W6BA 3U74U 2HLRA 1FFJA 5IMTD 2BHIA 1FSCA 4UY2C 2NBTA 4FAOC 1HAAA 1HC9B 2MJYA 3QB4B 4P7UA 5DO6A 2PJYC 2L03A 4OM4A 1L4WA 2H64C 2CCXA 3FEVA 2JQPA 4AEAA 3KFDI 3BT1U 4BIKB 5IMYC 2ABXA 1S4YA 1ABTA 1LJZA 1ONJA 2J8BA 1TFSA 1NYSA 2H7ZA 1NTXA 2JVEA 3U73U 2L5SA 2X8BB 4QTIU 1JGKA 4ZQYA 4XJJA 1FRAA 1NYUA 2MHYA 4OM5A 2MUOA 1KBAA 4BDTB 2ERAA 1KBTA 2H5FA 1RL5A 1CDTA 1DRSA 1IDLA 2VLWA 3HH7A 1CDQA 1NEAA 2QJAC 2QC1A
chains in the Genus database with same CATH superfamily
1JE9A 1CXOA 2MJ4A 2UWRA 1KTZB 2H7ZB 3NH7A 1TXBA 1CXNA 4RUDA 2N99A 1F94A 1KL8A 2PJYB 1IKCA 1JBDA 2H64B 3LAQU 1LXHA 3KFDE 1CDSA 1HOYA 1V6PA 1ES7B 1H0JA 1KFHA 1KS6A 1BTEA 1CREA 1QM7A 1NORA 2CRSA 1TGXA 1HAJA 1KC4A 2H8UA 1KXIA 1KU6B 2OFSA 3VTSA 1IDIA 1CDRA 2LA1A 1BXPA 1HC9A 2MJ0A 1FASA 2MUPA 3NDSA 2GOOC 1B41B 1IJCA 3BT2U 1I02A 1MAHF 3NEQA 2MFAA 4EY8B 4DO8A 1IK8A 2I9BE 2K3GA 2QJ9C 1IDHA 3PLCA 1CHVS 1TXAA 1CCQA 2CTXA 1VB0A 4IYEA 2CDXA 4FAOE 1CRFA 1IDGA 1RGJA 1ZADA 1LSIA 1QKEA 2H62D 1YWHA 1UG4A 1NXBA 4KSNA 1CB9A 2BTXA 2LCRA 4HQPF 1XT3A 1ERAA 1CODA 1PLOA 3EVSC 1F8UB 2H62C 1IQ9A 1ERGA 2QJBC 1LXGA 3EBXA 1KBSA 5DZ5A 2UX2A 1NTNA 5EBXA 1CTXA 5DU1A 2HLQA 2GOOB 1FF4A 1COEA 1QKDA 1FSSB 1LX5B 1G6MA 1MR6A 1M9ZA 4LFTA 2CRTA 3ERAA 6EBXA 1CVOA 1REWC 2FD6U 1W6BA 3U74U 2HLRA 1FFJA 5IMTD 2BHIA 1FSCA 4UY2C 2NBTA 4FAOC 1HAAA 1HC9B 2MJYA 3QB4B 4P7UA 5DO6A 2PJYC 2L03A 4OM4A 1L4WA 2H64C 2CCXA 3FEVA 2JQPA 4AEAA 3KFDI 3BT1U 4BIKB 5IMYC 2ABXA 1S4YA 1ABTA 1LJZA 1ONJA 2J8BA 1TFSA 1NYSA 2H7ZA 1NTXA 2JVEA 3U73U 2L5SA 2X8BB 4QTIU 1JGKA 4ZQYA 4XJJA 1FRAA 1NYUA 2MHYA 4OM5A 2MUOA 1KBAA 4BDTB 2ERAA 1KBTA 2H5FA 1RL5A 1CDTA 1DRSA 1IDLA 2VLWA 3HH7A 1CDQA 1NEAA 2QJAC 2QC1A
chains in the Genus database with same CATH topology
1JE9A 1CXOA 2MJ4A 2UWRA 1KTZB 2H7ZB 3NH7A 1TXBA 1CXNA 4RUDA 2N99A 1F94A 1KL8A 2PJYB 1IKCA 1JBDA 2H64B 3LAQU 1LXHA 3KFDE 1CDSA 1HOYA 1V6PA 1ES7B 1H0JA 1KFHA 1KS6A 1BTEA 1CREA 1QM7A 1NORA 2CRSA 1TGXA 1HAJA 1KC4A 2H8UA 1KXIA 1KU6B 2OFSA 3VTSA 1IDIA 1CDRA 2LA1A 1BXPA 1HC9A 2MJ0A 1FASA 2MUPA 3NDSA 2GOOC 1B41B 1IJCA 3BT2U 1I02A 1MAHF 3NEQA 2MFAA 4EY8B 4DO8A 1IK8A 2I9BE 2K3GA 2QJ9C 1IDHA 3PLCA 1CHVS 1TXAA 1CCQA 2CTXA 1VB0A 4IYEA 2CDXA 4FAOE 1CRFA 1IDGA 1RGJA 1ZADA 1LSIA 1QKEA 2H62D 1YWHA 1UG4A 1NXBA 4KSNA 1CB9A 2BTXA 2LCRA 4HQPF 1XT3A 1ERAA 1CODA 1PLOA 3EVSC 1F8UB 2H62C 1IQ9A 1ERGA 2QJBC 1LXGA 3EBXA 1KBSA 5DZ5A 2UX2A 1NTNA 5EBXA 1CTXA 5DU1A 2HLQA 2GOOB 1FF4A 1COEA 1QKDA 1FSSB 1LX5B 1G6MA 1MR6A 1M9ZA 4LFTA 2CRTA 3ERAA 6EBXA 1CVOA 1REWC 2FD6U 1W6BA 3U74U 2HLRA 1FFJA 5IMTD 2BHIA 1FSCA 4UY2C 2NBTA 4FAOC 1HAAA 1HC9B 2MJYA 3QB4B 4P7UA 5DO6A 2PJYC 2L03A 4OM4A 1L4WA 2H64C 2CCXA 3FEVA 2JQPA 4AEAA 3KFDI 3BT1U 4BIKB 5IMYC 2ABXA 1S4YA 1ABTA 1LJZA 1ONJA 2J8BA 1TFSA 1NYSA 2H7ZA 1NTXA 2JVEA 3U73U 2L5SA 2X8BB 4QTIU 1JGKA 4ZQYA 4XJJA 1FRAA 1NYUA 2MHYA 4OM5A 2MUOA 1KBAA 4BDTB 2ERAA 1KBTA 2H5FA 1RL5A 1CDTA 1DRSA 1IDLA 2VLWA 3HH7A 1CDQA 1NEAA 2QJAC 2QC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JE9 A;  1CXO A;  2MJ4 A;  2UWR A;  1KTZ B;  2H7Z B;  3NH7 A;  1TXB A;  1CXN A;  4RUD A;  2N99 A;  1F94 A;  1KL8 A;  2PJY B;  1IKC A;  1JBD A;  2H64 B;  3LAQ U;  1LXH A;  3KFD E;  1CDS A;  1HOY A;  1V6P A;  1ES7 B;  1H0J A;  1KFH A;  1KS6 A;  1BTE A;  1CRE A;  1QM7 A;  1NOR A;  2CRS A;  1TGX A;  1HAJ A;  1KC4 A;  2H8U A;  1KXI A;  1KU6 B;  2OFS A;  3VTS A;  1IDI A;  1CDR A;  2LA1 A;  1BXP A;  1HC9 A;  2MJ0 A;  1FAS A;  2MUP A;  3NDS A;  2GOO C;  1B41 B;  1IJC A;  3BT2 U;  1I02 A;  1MAH F;  3NEQ A;  2MFA A;  4EY8 B;  4DO8 A;  1IK8 A;  2I9B E;  2K3G A;  2QJ9 C;  1IDH A;  3PLC A;  1CHV S;  1TXA A;  1CCQ A;  2CTX A;  1VB0 A;  4IYE A;  2CDX A;  4FAO E;  1CRF A;  1IDG A;  1RGJ A;  1ZAD A;  1LSI A;  1QKE A;  2H62 D;  1YWH A;  1UG4 A;  1NXB A;  1CB9 A;  2BTX A;  2LCR A;  4HQP F;  1XT3 A;  1ERA A;  1COD A;  1PLO A;  3EVS C;  1F8U B;  2H62 C;  1IQ9 A;  1ERG A;  2QJB C;  1LXG A;  3EBX A;  1KBS A;  5DZ5 A;  2UX2 A;  1NTN A;  5EBX A;  1CTX A;  5DU1 A;  2HLQ A;  2GOO B;  1FF4 A;  1COE A;  1QKD A;  1FSS B;  1LX5 B;  1G6M A;  1MR6 A;  1M9Z A;  4LFT A;  2CRT A;  3ERA A;  6EBX A;  1CVO A;  1REW C;  2FD6 U;  1W6B A;  3U74 U;  2HLR A;  1FFJ A;  5IMT D;  2BHI A;  1FSC A;  4UY2 C;  2NBT A;  4FAO C;  1HAA A;  1HC9 B;  2MJY A;  3QB4 B;  4P7U A;  5DO6 A;  2PJY C;  2L03 A;  4OM4 A;  1L4W A;  2H64 C;  2CCX A;  3FEV A;  2JQP A;  4AEA A;  3KFD I;  3BT1 U;  4BIK B;  5IMY C;  2ABX A;  1S4Y A;  1ABT A;  1LJZ A;  1ONJ A;  2J8B A;  1TFS A;  1NYS A;  2H7Z A;  1NTX A;  2JVE A;  3U73 U;  2L5S A;  2X8B B;  4QTI U;  1JGK A;  4ZQY A;  4XJJ A;  1FRA A;  1NYU A;  2MHY A;  4OM5 A;  2MUO A;  1KBA A;  4BDT B;  2ERA A;  1KBT A;  2H5F A;  1RL5 A;  1CDT A;  1DRS A;  1IDL A;  2VLW A;  3HH7 A;  1CDQ A;  1NEA A;  2QJA C;  2QC1 A; 
#chains in the Genus database with same CATH topology
 1JE9 A;  1CXO A;  2MJ4 A;  2UWR A;  1KTZ B;  2H7Z B;  3NH7 A;  1TXB A;  1CXN A;  4RUD A;  2N99 A;  1F94 A;  1KL8 A;  2PJY B;  1IKC A;  1JBD A;  2H64 B;  3LAQ U;  1LXH A;  3KFD E;  1CDS A;  1HOY A;  1V6P A;  1ES7 B;  1H0J A;  1KFH A;  1KS6 A;  1BTE A;  1CRE A;  1QM7 A;  1NOR A;  2CRS A;  1TGX A;  1HAJ A;  1KC4 A;  2H8U A;  1KXI A;  1KU6 B;  2OFS A;  3VTS A;  1IDI A;  1CDR A;  2LA1 A;  1BXP A;  1HC9 A;  2MJ0 A;  1FAS A;  2MUP A;  3NDS A;  2GOO C;  1B41 B;  1IJC A;  3BT2 U;  1I02 A;  1MAH F;  3NEQ A;  2MFA A;  4EY8 B;  4DO8 A;  1IK8 A;  2I9B E;  2K3G A;  2QJ9 C;  1IDH A;  3PLC A;  1CHV S;  1TXA A;  1CCQ A;  2CTX A;  1VB0 A;  4IYE A;  2CDX A;  4FAO E;  1CRF A;  1IDG A;  1RGJ A;  1ZAD A;  1LSI A;  1QKE A;  2H62 D;  1YWH A;  1UG4 A;  1NXB A;  4KSN A;  1CB9 A;  2BTX A;  2LCR A;  4HQP F;  1XT3 A;  1ERA A;  1COD A;  1PLO A;  3EVS C;  1F8U B;  2H62 C;  1IQ9 A;  1ERG A;  2QJB C;  1LXG A;  3EBX A;  1KBS A;  5DZ5 A;  2UX2 A;  1NTN A;  5EBX A;  1CTX A;  5DU1 A;  2HLQ A;  2GOO B;  1FF4 A;  1COE A;  1QKD A;  1FSS B;  1LX5 B;  1G6M A;  1MR6 A;  1M9Z A;  4LFT A;  2CRT A;  3ERA A;  6EBX A;  1CVO A;  1REW C;  2FD6 U;  1W6B A;  3U74 U;  2HLR A;  1FFJ A;  5IMT D;  2BHI A;  1FSC A;  4UY2 C;  2NBT A;  4FAO C;  1HAA A;  1HC9 B;  2MJY A;  3QB4 B;  4P7U A;  5DO6 A;  2PJY C;  2L03 A;  4OM4 A;  1L4W A;  2H64 C;  2CCX A;  3FEV A;  2JQP A;  4AEA A;  3KFD I;  3BT1 U;  4BIK B;  5IMY C;  2ABX A;  1S4Y A;  1ABT A;  1LJZ A;  1ONJ A;  2J8B A;  1TFS A;  1NYS A;  2H7Z A;  1NTX A;  2JVE A;  3U73 U;  2L5S A;  2X8B B;  4QTI U;  1JGK A;  4ZQY A;  4XJJ A;  1FRA A;  1NYU A;  2MHY A;  4OM5 A;  2MUO A;  1KBA A;  4BDT B;  2ERA A;  1KBT A;  2H5F A;  1RL5 A;  1CDT A;  1DRS A;  1IDL A;  2VLW A;  3HH7 A;  1CDQ A;  1NEA A;  2QJA C;  2QC1 A; 
#chains in the Genus database with same CATH homology
 1JE9 A;  1CXO A;  2MJ4 A;  2UWR A;  1KTZ B;  2H7Z B;  3NH7 A;  1TXB A;  1CXN A;  4RUD A;  2N99 A;  1F94 A;  1KL8 A;  2PJY B;  1IKC A;  1JBD A;  2H64 B;  3LAQ U;  1LXH A;  3KFD E;  1CDS A;  1HOY A;  1V6P A;  1ES7 B;  1H0J A;  1KFH A;  1KS6 A;  1BTE A;  1CRE A;  1QM7 A;  1NOR A;  2CRS A;  1TGX A;  1HAJ A;  1KC4 A;  2H8U A;  1KXI A;  1KU6 B;  2OFS A;  3VTS A;  1IDI A;  1CDR A;  2LA1 A;  1BXP A;  1HC9 A;  2MJ0 A;  1FAS A;  2MUP A;  3NDS A;  2GOO C;  1B41 B;  1IJC A;  3BT2 U;  1I02 A;  1MAH F;  3NEQ A;  2MFA A;  4EY8 B;  4DO8 A;  1IK8 A;  2I9B E;  2K3G A;  2QJ9 C;  1IDH A;  3PLC A;  1CHV S;  1TXA A;  1CCQ A;  2CTX A;  1VB0 A;  4IYE A;  2CDX A;  4FAO E;  1CRF A;  1IDG A;  1RGJ A;  1ZAD A;  1LSI A;  1QKE A;  2H62 D;  1YWH A;  1UG4 A;  1NXB A;  4KSN A;  1CB9 A;  2BTX A;  2LCR A;  4HQP F;  1XT3 A;  1ERA A;  1COD A;  1PLO A;  3EVS C;  1F8U B;  2H62 C;  1IQ9 A;  1ERG A;  2QJB C;  1LXG A;  3EBX A;  1KBS A;  5DZ5 A;  2UX2 A;  1NTN A;  5EBX A;  1CTX A;  5DU1 A;  2HLQ A;  2GOO B;  1FF4 A;  1COE A;  1QKD A;  1FSS B;  1LX5 B;  1G6M A;  1MR6 A;  1M9Z A;  4LFT A;  2CRT A;  3ERA A;  6EBX A;  1CVO A;  1REW C;  2FD6 U;  1W6B A;  3U74 U;  2HLR A;  1FFJ A;  5IMT D;  2BHI A;  1FSC A;  4UY2 C;  2NBT A;  4FAO C;  1HAA A;  1HC9 B;  2MJY A;  3QB4 B;  4P7U A;  5DO6 A;  2PJY C;  2L03 A;  4OM4 A;  1L4W A;  2H64 C;  2CCX A;  3FEV A;  2JQP A;  4AEA A;  3KFD I;  3BT1 U;  4BIK B;  5IMY C;  2ABX A;  1S4Y A;  1ABT A;  1LJZ A;  1ONJ A;  2J8B A;  1TFS A;  1NYS A;  2H7Z A;  1NTX A;  2JVE A;  3U73 U;  2L5S A;  2X8B B;  4QTI U;  1JGK A;  4ZQY A;  4XJJ A;  1FRA A;  1NYU A;  2MHY A;  4OM5 A;  2MUO A;  1KBA A;  4BDT B;  2ERA A;  1KBT A;  2H5F A;  1RL5 A;  1CDT A;  1DRS A;  1IDL A;  2VLW A;  3HH7 A;  1CDQ A;  1NEA A;  2QJA C;  2QC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...