1RGQA

M9a hcv protease complex with pentapeptide keto-amide inhibitor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
154
structure length
154
Chain Sequence
QVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVTKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hepatitis C NS3 protease inhibition by peptidyl-alpha-ketoamide inhibitors: kinetic mechanism and structure.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein, hydrolase
molecule keywords NS3 Protease
total genus 32
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1rgqA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1rgqA01
2GT7A 1WYKA 1RJXB 2UWPA 2FPZA 1AB9C 2ZF0H 1EZUC 1RRKA 2LNCA 1D4PB 8LPRA 5HGGA 1HUTH 1ZHRA 2BHGA 5A8XA 1ZGVA 2G00A 3SV9A 4NA9H 1ESAA 5FX5A 2BD5A 1PPBH 3ZVGA 3GCOA 3R0FA 4K5ZA 2BB4A 1ZSJA 2C93B 2C8WB 1ELBA 1FLEE 2A7HA 3H7TA 4ISOA 3SO3A 1E34B 4GSOA 1V2LT 1MH0A 1XM1A 1C5YB 1QR3E 3FVFB 1FONA 1EQ9A 1EB1H 3VB5A 4DGJA 5EW2H 5ABWA 1OXGA 1PPCE 1GMDG 1LMWB 1VITG 2ZG0H 3SN8A 1C5OH 1GDNA 1EXFA 1P12E 2CF9H 2PKSC 1UTNA 2XRCA 3PO1B 1RGQA 2BDCA 3QO6A 3Q00A 1V3XA 4GCHF 2BZAA 3NZIA 1FN6A 1O5BB 2FX4A 2A2XH 3UNRA 1O2UA 3RC5A 1CBWC 2VH0A 3M5OA 3FANA 1YPLH 4NFFA 5CMXH 4D7FA 2O8LA 2BDYA 1C5WB 1VITF 1UMAH 4RKJB 4TY7A 5IYTA 1V2RT 1E37B 1C1UH 1C5SA 1FIZA 3MOCA 2GV7A 4XSKU 5JPMH 2ZU1A 1ELDE 1TNGA 2J34A 3F68H 2ASUB 5DPAA 5C5OA 1LHFH 3A7YA 4JYVH 1C1RA 1W10U 4UFEH 1F5RA 3RU4D 1SC8U 7LPRA 2BDHA 4KP0A 1UK3A 1P3EA 3ZYDA 1NRQH 1MKXH 5G4BA 3FP6E 2Y6TA 5DKMA 3O8RA 3M3SA 3KL6A 2BLVA 2GZ8A 2JH0D 4FU7A 4NSVA 2H5CA 1O2HA 2B0FA 3RLYH 1TFXA 1GI0A 3RXIA 4X1NU 1W11U 1DLEA 1O2GH 1GI6A 4ABIA 2ZGHA 1DY8A 1IQJA 4ASHA 4CHAB 3UR9A 2OCVB 1G30B 1TNHA 1SGFA 2GMTC 1ANDA 1LKBA 1UVOA 1FQ3A 3LC5A 3O8DA 1XUGA 2FOFA 1EAXA 4JCNA 1GCTB 3RDZA 2ULLA 4BAKB 2PTNA 5CE1A 3F9HA 1BRAA 2A4OA 1VCPA 2NU4E 1V2JT 5GNDA 5DP3A 3GY5A 4AGJA 3QUMP 1ELEE 1W14U 3EA8A 3F6UH 3URCA 2OLGA 1NU9A 1ZGIA 1O3FA 1CGJE 3AVZA 2OC7A 1D9IA 1ZR0A 1AVGH 4AORA 2GP9B 5PTPA 1LVOA 4HFPB 5GWZA 4NA7A 2EEKA 4HZHA 2ZP0H 1EPTC 4A1XA 8KME2 5JB9S 1F5KU 1AVXA 1BTYA 2OQUA 3AAUA 1SGNE 1C1TA 1EPTB 2IJD1 2AYWA 2FESH 1OSSA 3MH5A 1MTVA 5L2YH 2Y81A 3A87A 1GDQA 1ELCA 1OX1A 3S9BA 5F8ZA 1OP8A 1HRTH 1O2OA 3F1SB 2BVRH 4YM9A 1BMNH 4WXVA 4H6SB 4HTCH 1O2MA 3U69H 4DJZB 2G5NA 2F83A 3HK6B 3SZNA 5LGOA 1G3BA 3URDA 5C5NA 1S83A 4JK5A 1HAIH 3PYHA 3AASA 1GBJA 3B8JA 3ATMA 4O3TA 4X8SH 3SHAH 3STJA 2QF3A 3EA7A 1ZPZA 1GGDC 1CSOE 2BXTH 3U1IB 1TE0A 1TNLA 1E35B 1SOZA 4CR9A 3ATKA 2GDEH 4OS5A 2CHAB 3KGPA 3UY9A 3PLPA 4AB9A 1Z1JA 1O3CA 2ZU4A 5DP8A 3TH4H 4AFUA 1GJ8B 3LJJA 5HM2A 1NN6A 3TJUA 3QTVH 3SNEA 4RI0A 2FTMA 2OBOA 1NRRH 1XVMA 3F9GA 1J8AA 1C5VA 2RCEA 4MPXA 1MAYA 2A5KA 4JMYA 4NWKA 3RXPA 1CU1A 1ZHMA 2SGEE 2PLXA 1DE7H 3FP7E 1GI8B 4ISHH 4M7GA 4MNWA 1T7CA 1GBKA 1JWTA 2ZFRH 3RXLA 4GUXA 1FAXA 1ACBE 1V2UT 3OY6U 2TGTA 3M3VA 1ETSH 4D8NA 2VIWA 4U01A 4YT6H 1AVWA 2F4LA 1XKBC 5T1VA 2BY5X 3G01A 1DFPA 1B7XB 1BRBE 1JIRA 4B2CA 4NIVA 4NA8A 2BQWB 2J4IA 2ZDNA 1ELGA 3GY8A 2A7CA 2PSXA 4I8KA 2Y7XA 1PPZA 3UWIA 4INHA 2WZQA 1YYY1 3SJ8A 4A1TA 1CBWB 3RUOA 1HAVB 1N6YA 1LHEH 2C90B 3E3TA 1DUEA 2ZHEH 3ITIA 4DW2U 2PKSB 2BY7X 3HKJB 2FX6A 3MNXA 1OWEA 2O8WA 4Y11E 1P2KA 1O2YA 1SHYA 1OWJA 2YNAA 1G9IE 2TGAA 3A7WA 3LH1A 4YLUA 1CA0B 2FI5E 4ABDA 2F9NA 5C67A 1ZLRA 3MWIU 1A5HA 1QNJA 1RXPA 1SSXA 3P17H 1EZSC 1LKAA 4ZMAH 3M5NA 3EGKH 1EJMA 1ANEA 4GLYA 2OD3B 1M9UA 2FS8A 2WPJS 3T5FH 3TK9A 1TMTH 2ZGCA 2W7UA 5LPEA 1MU8B 4BAHB 1AKSA 1SGTA 5EXNA 2PHBA 1DICA 1N1LA 3ODDA 3SU4A 1BTZA 5HMAA 2VVVA 3L3TA 5JBCS 1ZRBA 1O2IA 1CT2E 2C4FH 1B5GH 1QIXB 2QN5T 1ZTKA 3NPSA 2FOMB 4FUDA 3T62A 2OP9A 2JKHA 3SV6A 3R3GB 3NUMA 2ZDKA 2M5TA 2AGGX 1THPB 3BTWE 1T8LA 2QGRA 3P92A 4XOJA 2W26A 3OTJE 3LC3A 3SJ9A 2BY8X 5FPYA 2Z9KA 1TBQH 3P8GA 3MU4A 4AFZA 5DO4H 3GY2A 3T25A 2G55A 3A81A 3O8BA 3IG6B 4IMQA 4IS5A 1ZOMA 3NK8A 2GDDA 1D3QB 4XE4A 3RXKA 1HJAB 3SU0A 1DOJA 4OS1A 4X6MA 4DIHH 1P2QA 1JRSA 3M61U 4WMFA 4X1PU 1WQVH 2UWLA 5CHAB 3S0NA 1C5ZB 2GMTB 1GI3A 1Y5UT 3UOUA 2VWOA 1L0ZA 2VH6A 1V2OT 1BHXF 4BXSA 1CGHA 1H9LB 1K1IA 3C1KA 1GI7B 4ISIH 1QY6A 1W12U 4ABGA 1BUIA 4DURA 2PWXA 1J14A 2QXGA 1JIMA 1FAKH 1C9TA 3MFJA 4K3JA 4BXWA 4DOQA 1T8NA 1TQ0B 1V2ST 1YPJH 3MO3A 1TB6H 1PFXC 5JYIA 5JBBS 2QCYA 4IGDA 3W94A 1VGCC 3UQVA 1WU1A 3AW1A 2HALA 1JXPA 4AZ2B 4ZAEA 1HYLA 2HNTF 2ZFPH 1EATA 4ZH8A 2ODQA 1ARBA 1HXEH 5T6FA 5DP5A 2FS9A 1YPGH 2UUYA 4ZXYH 2ZU3A 1SGEE 1HXFH 1W7XH 5T3HA 7GCHF 1P9SA 2H9HA 3K6YA 3QWCH 5J4SA 1TA2A 1WTHD 4FVBA 2ZIQH 1BOQA 3UQOA 1EPTA 1EP5A 1TX7A 4MNYA 4ISNA 3T27A 1NFYA 2NU3E 2ZU2A 4I33A 1C5RA 2XCFA 1XUFA 2BOHB 4MVNA 3SGQE 2TGDA 2WV4A 1DITH 2BDGA 3BG4C 1HAOH 4A5TS 1AHTH 2C8XB 1ZMLA 1O32A 2FZZA 2ZKSA 3TJVA 2FMJA 3LH3A 3ATWA 2OK5A 1ZMJA 2Q6GA 2UWOA 3SUEA 5C1XA 1S0QA 2ZQ1A 1NRNH 2GCHG 4IC5A 3UUZA 1D6RA 2FI4E 4LZ1H 1FUJA 1ABIH 1YBWA 1MTUA 2FP7B 2HNTC 3D65E 4INLA 4AFQA 1HIAB 1Z6EA 1L1JA 4B6FA 5LH8A 1BTHH 2A1DB 1CGIE 2VVUA 2XWBI 3E16B 1RTLA 3B9FH 1WXRA 1C2MA 1P10A 2QF0A 3SNCA 3RMNH 3D49H 3NCLA 3UNSA 3ENSB 1EASA 1FNIA 1BMLA 3A8CA 4F4OC 1ELFA 2TRMA 4XBBA 3GDSA 1OP0A 2HGTH 3C27B 2G52A 1LCYA 4HI3A 2SGPE 2ZTXA 2VIOA 1HAYB 2O8TA 1XVOA 3M7QA 3OU0A 1DSTA 4I8GA 1C5NH 1SGCA 1GJBB 3FP8E 4OGXA 2Q6FA 5T6GA 2CHAC 2QXIA 1A3EH 1C2JA 3HPTB 1Z8GA 1MBQA 1G3DA 1V2TT 2Y5HA 2TGPZ 3SJOA 3SUDA 3MU0A 8GCHG 4AGKA 3TLOA 1WV7H 1GJ6A 4DVAU 1MD7A 2BLWA 2JH5D 3ZYEA 1KXDA 3BIVH 2FYQA 3ZZ7A 2HNTE 4OS4A 1SQTA 1SHHB 1GHYH 2QAAA 3GCHB 1LPZB 4K60A 2OC1A 2ZNKH 3M5MA 3PTBA 4ABJA 1T31A 2ZDMA 4Y7AA 4Q7ZA 1K1MA 1AI8H 5GDSH 4OS2A 2FEQH 2W5EA 1O2VA 3KQBA 1AQ7A 2GZ9A 2ANYA 2BY6X 2ZTZA 3UWJH 1BRCE 4J2YB 4FUCA 3RXCA 1OWIA 3ZVBA 4BNRA 1ZHPA 1EJNA 1C1NA 1LVBA 2A45B 1QJ7B 3ZVDA 1SMFE 3MO9A 3IITA 1O3JA 1MTWA 3E1XB 4R0IA 4ABBA 4DIIH 1C2FA 1NROH 1FPCH 2LPRA 2HVXA 3RXMA 2FO9A 1NT1A 1ZJKA 4B76A 2VBCA 2WINI 5FPTA 1P2IA 1YCPK 5E8EH 2ANWA 2THFB 2G4TA 3RXDA 1BITA 1AGJA 4YESB 1HAGE 4AG2A 5HYOA 1EZQA 1MD8A 5AVDA 3K2UA 2BQ6B 3PMJA 4AOQA 1V2KT 4CRCA 3A7VA 4Y6DA 4D9QA 4BTTB 3SU3A 2FOGA 5IDKA 1IQNA 1KYNA 2VJ1A 1DWEH 2XBXA 5TJXA 1GDUA 1ZZZA 1K1JA 1HBTH 3SGAE 7ESTE 1BBRH 3FFGA 2QIQA 4TPYA 4Q7XA 3QZQA 3BTHE 1W13U 2CV3A 2VWNA 3HGPA 4MPVA 3B23B 3SW2B 2BVXH 3UNQA 1V2QT 4YOIA 3BTTE 5CHAC 1CHOG 5ESBA 1S6FA 4GPGA 1G3EA 3A83A 4NZLA 2H5DA 1TNKA 1MUEB 2WPHS 1KLJH 2F3CE 1VJ9U 6LPRA 4CBOA 1D3PB 4F49A 2RDLA 1C5UA 2ZI2H 1LPKB 2ZCLP 4X2XA 2OINA 3UTUH 5K0HA 1QHRB 3LIWA 1GL0E 2JH6D 1GI5A 1GMHF 1SVPA 3KN2A 1BMAA 1O2PA 2AGIX 3M35A 3PMBB 3SYJA 2A31A 4OGYA 1NRPH 4YOJA 1QGFA 2WYJA 1RTFB 3A82A 4WXIA 1KDQB 3T28A 4J1YA 5DG6A 5E0JA 4I8HA 1ZSKA 1HAXB 3NXPA 4BANB 1G37A 4MLFB 1C4Y2 1V2VT 3BG4B 3NKKA 1ORFA 2BD7A 3CENA 3T26A 1DM4B 4KELA 1BDAA 2WUCA 2GX4A 3MNSA 2FLRH 5I25A 1XKAC 1GHBF 3L33A 2B9LA 3UR6A 4HGCA 4B74A 4BTIB 1SLVB 3PV2A 1A5GH 1SGQE 2AERH 4I31A 1PPFE 2WUBA 2FIRH 2ZHWH 3RU4E 3VGCB 1HGTH 1VCWA 2XW9A 3PTNA 1O0DH 1KY9A 1SLXB 3LGYA 1C2GA 3GOVB 3MH4A 5JDUB 3BEUA 4RKOB 2VIDA 1O3PB 4FUFA 3UPEA 3V3MA 2NU1E 1C1OA 3BEFB 5FCKA 1AY6H 1H9HE 4JYUH 2ALVA 9ESTA 4MNVA 1HJ9A 3LGWA 1GJ5H 3DD2H 1G36A 2WPLS 4I32A 5DP4A 1MKWH 4FU8A 3RXOA 1JMOH 1H8IH 4X1RU 2HPPH 3P70B 5C20A 3LGVA 4GHQA 3RMMH 3F9EA 4B75A 1LHDH 3Q3KA 5GJ4B 2FODA 1A5IA 2SGFE 5JB8S 2ZFTA 3K6ZA 1YPHC 1QTFA 2Z9LA 1O3DA 3OX7U 4NCYA 4UE7H 3QTOH 4Y76A 3SGBE 3EE0B 1O30A 1C1VH 4I7YH 2A32A 1NM6A 1AE8H 1FJSA 1O3AA 1OWHA 1C2DA 4QT8C 2PKAB 5EXLA 1O31A 3VXFH 4CRFA 3PMHB 3SORA 2ZECA 2V3HH 1O2WA 4Y10E 4DCDA 4FUIA 2ALPA 3BTQE 1CT0E 1K9OE 1K1NA 4A92A 3RP2A 3QLPH 1GWAA 3HGNA 4K1SA 1DPOA 1KXBA 1O3IA 3TJOA 2ZWLH 1O3KA 1S82A 2FM2A 2Z9IA 1LVYA 1UTKA 2G4UA 3T29A 3ZZ9A 2HRVA 2J92A 1NS3A 3W95A 1MAXA 1XXDA 3GY3A 1N6XA 1YPEH 3ZV9A 3K9XB 1GI1A 3RXFA 1L2EA 1S85A 3A7ZA 1AMHA 4A1VA 1OYTH 4SGBE 1O2XA 2Z6BD 1FXYA 3I29A 1WOFA 4Y0ZE 5E2PA 3ATLA 3MI4A 5FBIA 4TY6A 4MG3A 3MNBA 3SU1A 3QGJA 3DFLA 3M36A 1SL3A 3U9AH 1PPGE 1THRH 4X6NA 1YPMH 1MMJN 1L1GA 1F0TA 1O3OA 1C1PA 3HK3B 3LOXA 1SPJA 2F9BH 1E38B 4XFQA 4Q7YA 2HOBA 4U2WA 1UO6A 2FXRA 1IQEA 1O3LA 4NIWA 3RMLH 2Y5GA 2ESTE 5DK1A 1YF4A 2HLCA 1Q3XA 4BAMB 1MTNC 1SQAA 1PQ7A 1GI2A 4XBDA 1AKSB 4ABEA 3N7OA 3GYLB 4TWYA 3BTFE 1O3HA 2FOEA 5FAHA 2ZTYA 2XBVA 5GIBA 2Z7FE 4O9VA 1P01A 4NWLA 3P95A 1BBRE 3RU4T 1QA0A 3RXQA 1AWFH 2FWWA 1EAWA 1YC0A 2R0LA 1MBMA 3M37A 2XC5A 1NESE 3NWUA 3PO1C 1OOKB 2ZDVH 1C9PA 3KQDA 3RMOH 2ZU5A 4LXBH 1P06A 1TGSZ 3E90B 2P93A 5A0CA 3PLKA 2J2UA 2F9OA 4D9RA 1O5GH 3BEIB 2BZ6H 1K1OA 5A0BA 4WH8A 1T32A 2BD8A 2CN0H 1QRWA 2AIQA 3GCHC 4B2BA 1K21H 1W8BH 1AIXH 5F6MA 1WSSH 2YNBA 1F0UA 1ZPBA 4IBLH 3PMAB 1TRMA 3GICB 2ZO3H 3SI4H 1UVPA 1GMHG 1GI4A 1F0SA 5E0HA 3TGJE 1WTGH 1ID5H 3A85A 3SV8A 5GXPA 3ZZCA 1K1LA 1Z71A 3TJNA 1F2SE 5AF9H 3BTKE 3TVJB 2XXLA 2SNVA 1KDQA 1T4UH 4Z6AH 9LPRA 1EAUA 3LT3A 1UTQA 1QRZA 1KLTA 1DLKB 8ESTE 4LZ4B 2ZFQH 1TA6A 2AMPA 4UEHH 3SNDA 3GDVA 2OC8A 1NY22 2F91A 1IAUA 1TPSA 2RA3A 2RA0A 2D8WA 1A7SA 1YGCH 1TOMH 2ZFFH 4MTBA 1QQUA 3BTEE 3Q77A 1YKTA 2FDAA 2SFAA 5J4QA 4IN2A 3EDXB 3P6ZB 1O5EH 3MYWA 3RXBA 4H6TA 4WY3A 2WPMS 3A7TA 2AS9A 3EAJA 8GCHF 1XUKA 1T8MA 2Q1JA 1PYTD 3H09A 2P94A 2CXVA 1SBWA 2BD4A 1UCYK 1YPHE 3UFAA 1TX6A 5AHGH 5EPYA 3VFEA 2P8OB 1FV9A 3LGIA 3LGTA 4WJG2 1A2CH 1G32B 1ETRH 2AEIH 3GCNA 1P05A 1SGRE 1C1MA 4ZUHA 3GDUA 5DGJA 1HLTH 3OTPA 1V6DA 2WPIS 2Z3DA 1NZQH 2R2MB 6CHAB 2ZPRA 1CE5A 1C1SA 1MTNB 3GY4A 3UREA 1GJ4H 1BTXA 4O3UA 3SU2A 2Y82A 1D3TB 1OWKA 1YCPM 4Z0KA 1SGPE 1WUNH 3Q3YA 1HAZB 2BMGB 5FX6A 3RXEA 1VR1H 2BLQA 5FXLA 5A8YA 1VGCB 1AU8A 4Y71A 3MH7A 1GVKB 2DUCA 4Y8YA 1DWCH 4JZDH 4OS7A 2I6QA 1TNJA 1C4U2 4GHTA 4KTSA 1UVSH 5EQSA 3S69A 2O8MA 1Y5AT 6CHAC 1UHBA 1HNEE 2PSYA 2A5AA 1ELVA 4Y79A 1F92A 4CH2B 1U6QA 1GHWH 1GVLA 2A4QA 2W7SA 1P0SH 4E05H 1WCZA 3RXAA 1XUIA 2VIVA 1DUAA 2ODYB 1O2LA 4U32A 2Y5FA 1GBAA 3P8FA 4X8VH 1HV7A 3PB1E 3RXSA 3MNCA 1YCPH 2BD3A 1O3NA 3QK1A 2SGAA 1IQHA 2QXJA 1J15A 1W0YH 1ANCA 1UVUH 3H7OA 1KXCA 1PPHE 1VJAU 1S0RA 2HWLB 5EG4A 1QFKH 5ESTE 4B1TA 1LPGB 1Z8JB 4D7GA 2OBQA 3LGUA 3PROA 2GTBA 2GKVE 2BYAX 3DT0H 2O8UA 4TPIZ 3RXTA 1NFUA 1QJ1B 3QZRA 4X8UH 3S7HB 5FPSA 3UOPA 1DXPA 1P2NA 3PV4A 1J9CH 2V3OH 4TWWA 3ZZ8A 4CRDA 2VNTA 1EP6A 4O97A 2P59A 4VGCB 4KTCA 3ZV8A 1O35A 2K1QA 2ZA5A 3I78A 4KKDA 3Q3XA 1TGTA 1RS0A 1C2IA 2UUFB 1O3MA 1ABJH 3ZVCA 4X2YA 3M7UA 1UTPA 1AN1E 5FHTA 3MU8A 2ZGXH 3V0XA 4AX9H 1KXEA 1N8OB 1GBTA 3VB4A 2A0QB 4ABAA 4K1EA 2P16A 3GCTG 3ZZ3A 1HIAA 1THSH 3IWMA 1Y8TA 2CJIA 1L1NA 4ISLA 2P3UB 1BCUH 4ZROA 2GVFA 3BF6H 3ZVEA 1DDJA 5EOKA 3A8BA 3ZZ4A 3TH3H 1UHBB 2GCTC 2EI8A 4YT7H 1P8VC 2BY9X 1DANH 1C5QA 1GBDA 3BIUH 1SI5H 1CA0C 3FAOA 2OTVA 2R2WU 1O2RA 1LHGH 2QV1A 5BPEA 2XBWA 2D26C 3RC4A 1RFNA 4K8BA 1MTSA 2Q6DA 1C4V2 1GG6B 3V7TA 1ETTH 4NIXA 1UTOA 1HCGA 1MCVA 3BTDE 3VGCC 3E8LA 1AFEH 3LU9B 1NFWA 2AIPA 1MQ5A 1RD3B 2P3FH 4YLQH 3I77A 2XBYA 1RTKA 2A4RA 1GBIA 3BTGE 4YOGA 1UTMA 2OXSA 2DE8A 1XMNB 1GBBA 3VB6A 1O2SA 1C2KA 1IOEA 2VWLA 4MPUA 1C2LA 2ZDAH 2BX3A 1FY1A 1XX9A 1ZRKA 1GBFA 3JZ2B 2B8OH 2ZCKP 4ZHLU 1K28D 1OPHB 1IHTH 2OC0A 4A7IB 2WV9A 4AN7A 3SZEA 3PWCA 3BG8A 1AWHB 1GBMA 1J17T 1NU7B 1O38A 1Z8IB 1XUJA 3TITA 3RXHA 1UK4A 4ZXXH 4NGAH 1GHAF 1O2ZA 1QL7A 4ABFA 2TBSA 3DUXH 2KAIB 4IMZA 4Y7BA 5HXFA 5A8ZA 1DS2E 5B6OA 3EYDA 1P57B 2VB0A 2FOBA 5ETXA 3A84A 3M5LA 4JK6A 3V12A 2ZDLA 4ABHA 1UTLM 3HATH 4U30A 3SI3H 4YTAA 1RIWC 4X6OA 3GISB 1AZZA 3SU6A 1A0LA 1MKWK 3RLWH 4A6LA 1TONA 1S5SA 1WAYB 1Z8RA 3LPRA 1C1QA 2BM2A 1D3DB 3QX5H 2YOLA 3VB7A 3HKIB 1EJAA 2TPIZ 3AAVA 1O2KA 2XC0A 1O2NA 3MMGA 1J16A 2GV6A 1BHXB 2XNIA 2G8TA 4I8LA 1AE5A 3RM0H 3TIUA 3ESTA 2A2QH 2XWAA 1GHVH 1FPHH 3T2NA 1IQFA 4JZ1A 1GVZA 1K1PA 2HPQH 2PTCE 5E0GA 1XXFA 1Y59T 1C1WH 5C1UA 3PV5A 1UJ1A 4JZEH 1V2WT 2VGCC 4AFSA 1FDPA 3FZZA 2W3IA 1GMCF 2VIQA 4UDWH 3S9CA 1BJVA 1LQDB 1TX8A 1O5DH 1GBLA 2ZFSA 1Y3UA 1NFXA 4TYDA 1TABE 3PWBA 4XDEA 1G2MA 1NC6A 1S81A 1L4ZA 5EXMA 4DY7B 1QA7A 1TGBA 1QCPA 4JYTA 1ELAA 4WH6A 3TGKE 1A3BH 1IQKA 2BLOA 3KQEA 6GCHF 1IQGA 1JBUH 3PLBA 5C2ZA 1FMGA 3LKWA 3KF2A 1BMMH 5B6LA 2ZPQA 1OYQA 2BDAA 1SGFG 1GHXH 1VITH 1FY4A 4BAOB 1TOCB 1YM0A 5A2MH 1ZTJA 1GBEA 4O03A 1BBRK 2GT8A 4ZKRU 2PUQH 2ZHDA 1GPZA 1GCTC 1LTOA 3BTME 1BB0B 1Y3YA 2OUAA 1CHGA 1D6WA 1BZXE 1HPGA 2Z9JA 5A09A 1G2LA 2ZHQH 5DP6A 1V2MT 3VXEH 5F8TA 4B6EA 1PJPA 1OP2A 1A1RA 5L2ZH 1DWBH 2P8OC 4Q2KA 4X2WA 4MPWA 4B2AA 1P9UA 1S6HA 2ZEBA 1TPPA 5I46H 5L6NH 1A4WH 1FZZA 3P8NA 4WF8A 1Y3WA 2Z3CA 1ANBA 1C5XB 4UD9H 4AB8A 4UONA 1EKBB 1O36A 2W3KA 4UFFH 1TGCA 3S7KB 2J95A 1TYNA 2A7JA 1HJAC 2GGVB 4AG1A 2R0KA 3TPIZ 3KCGH 1NRSH 1TGNA 2B7DH 2STAE 1ARCA 3TU7H 1A46H 1CVWH 1ZJDA 1UTJA 1HAPH 3A8DA 1QB1A 4THNH 1Z6JH 2EI7A 1QB9A 4OS6A 5JBAS 1GJ9B 3TGIE 1TAWA 2BDBA 2PKAA 3RXGA 1L4DA 2R3UA 3CS7A 1TIOA 3TK5A 3TK6A 1DWDH 2F9UA 4K2YA 1KXAA 3KHVA 1SOTA 5EODA 4LOYH 2J94A 5BRRE 1H4WA 1AFQB 4MDSA 2EC9H 1TQ7B 2ZZUH 4CR5A 1PPEE 4E06H 4UFGH 2PUXB 4INKA 2ZHFH 1CO7E 1GGDB 4BTUB 1DX5M 1TMBH 2BTCE 2G5VA 1IQIA 2EI6A 4E7NA 1BA8B 1BQYA 3KNXA 3ATIA 4NFEA 5E2OA 3SU5A 1QBVH 1DY9A 1H8DH 1EUFA 1TWXB 1YLDA 4NZQA 3A88A 1HDTH 3LONA 2XYAA 4K1TA 4ZHMU 2V35A 2XC4A 2FLBH 3ZVFA 1EX3A 2BDIA 5EQRA 2BX4A 1O37A 1BIOA 1BTUA 1C5MD 4MQAA 2PW8H 1F5LA 1O39A 1EOJA 3K65B 5EW1H 1VCQA 3TNSA 1T8OA 1HFDA 2SGQE 4X1QU 1AFQC 4JZIA 4FUEA 1EZXC 1P2MA 1GCDA 2H9EH 5C3NA 2FI3E 5DP9A 4OM9A 3DHKH 1FY3A 3OYPA 1NO9H 4CREA 2IPHA 2XCNA 7GCHG 2PGBB 3SNAA 2CMYA 1AB9B 3SJKA 4NIYA 4FUJA 1KIGH 2FYRA 3E6PH 1GJCB 3FZDA 1AO5A 1GHAG 1FY8E 1LQEA 1QURH 1W2KH 1SGDE 2BD2A 4CH8B 1BTWA 2ZQ2A 4GAWA 1Y3XA 2NU2E 2VIPA 2QA9E 1HB0B 3DFJA 2BQ7B 3ZZBA 2IOTA 3MU1A 1UVTH 4GCHG 2PGQB 5AFYH 2QC2A 4UFDH 3VPKA 1JRTA 2VVCA 3P8OA 3WY8A 1NTPA 1QL8A 3GCTF 3SHCH 3MTYA 3UIRA 2FOAA 4ZKSU 1SFQB 1ZSLA 1TRNA 2UUKB 2WV5A 2ANMH 4KGAA 3CP7A 3QDZB 1ZTLA 3S9AA 3AK5A 5F03A 3V13A 3SUFA 1QRXA 1TALA 1C2EA 4R8TB 3SNBA 3RC6A 4CHAC 4PROA 1RIWB 2UUJB 2J38A 2AGEX 1TBRH 1QQ4A 2ZPSA 4YO9A 5JBTA 1A61H 4NSYA 1LDTT 3A7XA 1ESBA 4IN1A 4M9FA 1B0FA 2EA3A 3KQCA 1Q31A 1SQOA 5AFZH 2BXUH 3M7TA 1O3EA 1KLIH 1GBCA 2VWMA 1P09A 3E0PB 1AD8H 3AW0A 4ESTE 1BTPA 2F9VA 2C3SA 1OWDA 1PQAA 4ZHAA 1TLDA 1GHZA 1MZAA 1P11E 1B0EA 1GI9B 1O2JA 3H5CB 4FU9A 3U98H 3GY6A 1TPOA 3SV7A 2JETC 3TNTA 4WVPE 1GMDF 2IJOB 2WHXA 4FUHA 3ZZ5A 2O9QA 5K7RA 1V2NT 1AUJA 3A89A 1O34A 3SJIA 1AZ8A 4FVDA 4CRGA 1QJ6B 2Y80A 1AUTC 4AYYB 3LDXH 3QGNB 6ESTA 3SOSA 3E91A 4E7RG 1Y3VA 2IN2A 2C8ZB 3CS0A 4YZUA 2A4GA 1GHBG 2BOKA 2WPKS 3SV2H 3STIA 3U8OH 1UCYE 3GYMA 4Y0YE 1MKXK 2BD9A 4K8YA 1P3CA 2C8YB 3A8AA 5T6DA 2ZC9H 1QBNA 5GCHF 2SNWA 2VINA 4Q80A 3RM2H 3TH2H 1FIWA 1O2TA 5DP7A 1T4VH 1GJ7B 3SBKA 1QB6A 1Y5BT 5TCCA 5SGAE 1GG6C 2JETB 1SR5C 3OSYA 1O5AB 2Z3EA 1V2PT 2V6NA 2H9TH 1OKXA 3BSQA 1FN8A 1HJ8A 1IQMA 1KTSB 1S84A 3M3TA 4WMEA 1EB2A 3EQ0H 1HAHH 4KTUA 4FXGH 3ZZAA 1G3CA 4LK4A 5HM9A 1FI8A 1F7ZA 3QN7A 2SGDE 4ZKOU 1N8OC 2G81E 3D23A 4B71A 2CGAA 3PM3A 1CT4E 4CRAA 1BRUP 2I6SA 3EA9A 3LJOA 2ODPA 3MO6A 4RSPA 3KIDU 1Q2WA 2BVSH 4X8TH 2QXHA 5EU8A 2J9NA 4FUGA 1TNIA 1CHOF 1WBGB 1EAIA 1YP9A 2D1JA 1TBZH 1X7AC 1C5LH 5C1YA 4Y8XA 2PR3A 2VU8E 1MQ6A 4VGCC 2P3TB 4X0WU 5GPIB 1E36B 1W7GH 1MU6B 2WYGA 1GL1A 1LVMA 1BT7A 2NU0E 2ZCHP 2H1UA 1ELTA 1P2JA 3ODFA 3L6PA 1KSNA 1XUHA 3ZZDA 3O8CA 3ELAH 1C2HA 1CA8B 4X1SU 2AFQB 1W3CA 1QBOA 4NG9H 1SB1H 2D2DA 4IW4E 3RXVA 3BN9A 1SGYE 1O3BA 3MU5A 1SLWB 1A0HB 3VEQB 1ZMNA 4WWYA 1DXWA 1WQSA 1GMCG 2P95A 2ILNA 5EPNA 1VZQH 4SGAE 1SG8B 1C5TA 2PV9B 1MCTA 3SUGA 4CRBA 4I8JA 2GCHF 2Y7ZA 3E0NB 2R3YA 2CF8H 3MH6A 1BJUA 1DT2A 1IHSH 4ZKNU 1TRYA 1O2QA 3KEEA 2F9PA 4GVUA 5A0AE 2V0BA 5F8XA 4CBNA 1GBHA 4H42U 1FY5A 4RN6A 5FBEA 1LO6A 1A0JA 3ZZ6A 2XTTB 2GCTB 1TPAE 1GJDB 2VGCB 1SGIB 1LHCH 1O33A 3SQEE 2GD4B 3GY7A 2R9PA 1P03A 2H6MA 5TCAA 2A5IA 1JOUB 3A80A 1H1BA 4D76A 1OS8A 1H9IE 3U8TH 2H2ZA 3OY5U 1SLUB 1PYTC 1INCA 1ESTA 4H4FA 3RXUA 2GZ7A 1MZDA 2ZGBH 3D62A 1HAVA 4Y8ZA 2FTLE 3RXJA 1PQ5A 1ZPCA 3JZ1B 3F9FA 1O5CB 2Z9GA 4DT7B 5LPFA 3A86A 5H4IB 3U1JB 1K2I1 2QYIA 1C5PA 1W0ZU 4BAQB 1EOLA 1P02A 1ZYOA 1YPKH 4JZFH 4X6PA 2G51A 1GJAB 4DG4A 1NPMA 1DSUA 1SFIA 2FOCA 1P2OA 1IQLA 6GCHG 2AMQA 3ZVAA 2DE9A 3SQHE 2B5TB 4MNXA 5L30H 5LPRA 2AH4X 2OQ5A 2RG3A 4AYVB 4K69A 5FCRA 7KMEH 2FOHA 1O5FH 1KXFA 2PFEA 2NWNA 5DJ7A 3Q76A 1O3GA 1Z7KA 2KAIA 1E0FD 1UCYH 5EGMA 1PQ8A 4BOHA 5GCHG 1YLCA 4WMDA 1CQQA 1Z1IA 2AMDA 1F0RA 2QY0B 2ZGJA 4IC6A 4FUBA 5EQQA 2Z94A 1K22H 3RXRA 3VB3A 3U8RH 2ANKH 2STBE 1UK2A 4XBCA 4X2VA 1DVAH 4B73A 2TIOA 3DA9B 1TMUH 1KTTB 1P04A 3MHWU 1QL9A 3BV9B
chains in the Genus database with same CATH superfamily
2GT7A 1WYKA 1RJXB 2UWPA 2FPZA 3UB0A 1AB9C 2ZF0H 1EZUC 1RRKA 2LNCA 1D4PB 8LPRA 1QZ8A 5HGGA 1HUTH 1ZHRA 2BHGA 5A8XA 1ZGVA 2G00A 3SV9A 4NA9H 1ESAA 5FX5A 2BD5A 1PPBH 3ZVGA 3GCOA 3R0FA 2RDEA 4K5ZA 2BB4A 1ZSJA 2C93B 2C8WB 1ELBA 1FLEE 2A7HA 3H7TA 4ISOA 3SO3A 1E34B 5C17A 4GSOA 1V2LT 1MH0A 1XM1A 1C5YB 1QR3E 2J97A 3FVFB 1FONA 1EQ9A 1EB1H 3VB5A 4DGJA 5EW2H 5ABWA 1OXGA 1PPCE 1GMDG 1LMWB 1VITG 2ZG0H 3SN8A 1C5OH 1GDNA 1EXFA 1P12E 2CF9H 2PKSC 4P00A 1UTNA 2XRCA 3PO1B 1RGQA 2BDCA 3QO6A 5IK2D 3Q00A 1V3XA 4GCHF 2QE7D 2BZAA 3NZIA 1FN6A 1O5BB 2FX4A 2A2XH 3UNRA 1O2UA 3RC5A 1CBWC 2VH0A 3M5OA 3FANA 1YPLH 4NFFA 5CMXH 4D7FA 2O8LA 2BDYA 1C5WB 1VITF 1UMAH 4RKJB 4TY7A 5IYTA 1V2RT 1E37B 1C1UH 1C5SA 1FIZA 3MOCA 2GV7A 4XSKU 5JPMH 2ZU1A 3OAAD 1ELDE 1TNGA 2J34A 3F68H 2ASUB 5DPAA 5C5OA 1LHFH 3A7YA 4JYVH 1C1RA 1W10U 4UFEH 1F5RA 3RU4D 1SC8U 4RT0A 7LPRA 2BDHA 3WWFA 4KP0A 1UK3A 1P3EA 5HKKD 3ZYDA 1NRQH 1MKXH 5G4BA 3FP6E 2Y6TA 3W1EA 5DKMA 3GS9A 3O8RA 3M3SA 3KL6A 2BLVA 2GZ8A 2JH0D 4FU7A 4NSVA 2H5CA 2J98A 1O2HA 2B0FA 3RLYH 1TFXA 1GI0A 3RXIA 4X1NU 1W11U 1DLEA 1O2GH 1GI6A 4ABIA 2ZGHA 1DY8A 1IQJA 4ASHA 4CHAB 3UR9A 2OCVB 1G30B 1TNHA 1SGFA 2GMTC 3WWBA 1ANDA 1LKBA 1UVOA 1FQ3A 3LC5A 3O8DA 1XUGA 3DCLA 2FOFA 1EAXA 4JCNA 1GCTB 3RDZA 2ULLA 3F3BA 2PTNA 4BAKB 5CE1A 3F9HA 1BRAA 2A4OA 1VCPA 2NU4E 1V2JT 5GNDA 5DP3A 3GY5A 4AGJA 3QUMP 1ELEE 1W14U 3EA8A 3F6UH 3URCA 2OLGA 1NU9A 1ZGIA 1O3FA 1CGJE 3AVZA 2OC7A 1D9IA 1ZR0A 1AVGH 4AORA 2GP9B 5PTPA 1LVOA 4HFPB 5GWZA 4NA7A 1YLNA 2EEKA 4HZHA 2ZP0H 1EPTC 4A1XA 8KME2 5JB9S 1F5KU 1AVXA 1BTYA 2OQUA 3AAUA 1SGNE 1C1TA 1EPTB 2IJD1 2AYWA 2FESH 1OSSA 3MH5A 1MTVA 5L2YH 2Y81A 3A87A 1GDQA 1ELCA 1OX1A 3S9BA 5F8ZA 1OP8A 1HRTH 1O2OA 3F1SB 2BVRH 4YM9A 1BMNH 2KCPA 4WXVA 4H6SB 4HTCH 1O2MA 3U69H 4DJZB 2G5NA 2F83A 3HK6B 3SZNA 5LGOA 1G3BA 3URDA 5C5NA 1S83A 4JK5A 1HAIH 3PYHA 3AASA 4FETA 1GBJA 3B8JA 3ATMA 4O3TA 4X8SH 3SHAH 1W0KD 3VG8A 1YY3A 3STJA 5KEDA 2QF3A 3EA7A 1ZPZA 1GGDC 1CSOE 2BXTH 3U1IB 1TE0A 1TNLA 1E35B 1SOZA 4CR9A 3ATKA 2GDEH 4OS5A 2CHAB 3KGPA 1E79D 3UY9A 3PLPA 2JIZD 4AB9A 1Z1JA 1O3CA 2ZU4A 5DP8A 3TH4H 4AFUA 1GJ8B 3LJJA 5HM2A 1NN6A 3TJUA 3QTVH 3SNEA 4RI0A 2FTMA 3DSGA 2OBOA 1NRRH 1XVMA 3F9GA 1J8AA 1C5VA 2RCEA 4MPXA 1MAYA 2A5KA 4JMYA 4NWKA 3RXPA 3WW7A 1CU1A 1ZHMA 2SGEE 2PLXA 1DE7H 3FP7E 1GI8B 4ISHH 4M7GA 4MNWA 1T7CA 1GBKA 1JWTA 2ZFRH 3RXLA 4GUXA 1FAXA 1ACBE 1V2UT 3OY6U 2J98B 2TGTA 1ETSH 3M3VA 2VIWA 4D8NA 4U01A 2W6JD 4YT6H 1AVWA 2F4LA 1XKBC 5T1VA 2BY5X 3G01A 1DFPA 1B7XB 1BRBE 1JIRA 4B2CA 4NIVA 4NA8A 2BQWB 2J4IA 2ZDNA 1ELGA 3GY8A 2A7CA 2PSXA 4I8KA 2Y7XA 1PPZA 3UWIA 4INHA 2WZQA 1YYY1 3SJ8A 4A1TA 1CBWB 3RUOA 1HAVB 1N6YA 1LHEH 3ZIAD 2C90B 3E3TA 1DUEA 2ZHEH 3ITIA 4DW2U 2PKSB 2BY7X 3HKJB 2FX6A 3MNXA 1OWEA 2O8WA 4Y11E 1P2KA 1O2YA 1SHYA 3PRDA 1OWJA 3OE7D 2YNAA 1G9IE 2TGAA 3A7WA 3LH1A 4YLUA 2JJ1D 1CA0B 2FI5E 4ABDA 2F9NA 5C67A 1ZLRA 3MWIU 1A5HA 1QNJA 1RXPA 1SSXA 3P17H 1EZSC 1LKAA 4ZMAH 3M5NA 3EGKH 1EJMA 1ANEA 4GLYA 2OD3B 4YXWD 1M9UA 2FS8A 2WPJS 3T5FH 3TK9A 1TMTH 2ZGCA 2W7UA 5LPEA 1MU8B 4BAHB 1AKSA 5EJLA 1SGTA 5EXNA 2PHBA 1DICA 1N1LA 3ODDA 3SU4A 1BTZA 5HMAA 2VVVA 3L3TA 5JBCS 1ZRBA 1O2IA 1CT2E 2C4FH 1B5GH 1QIXB 2QN5T 1ZTKA 3NPSA 2FOMB 4FUDA 3T62A 2OP9A 2JKHA 3SV6A 3R3GB 3NUMA 2ZDKA 1FX0B 2M5TA 2AGGX 1THPB 3BTWE 1T8LA 2QGRA 3P92A 4XOJA 2W26A 3OTJE 3LC3A 3SJ9A 2BY8X 5FPYA 2Z9KA 1TBQH 3P8GA 3MU4A 4AFZA 5DO4H 3GY2A 3T25A 2G55A 3A81A 3O8BA 3IG6B 4IMQA 4IS5A 1ZOMA 3NK8A 2GDDA 1D3QB 4XE4A 3RXKA 1HJAB 3SU0A 1DOJA 4OS1A 4X6MA 4DIHH 2KCYA 1P2QA 1JRSA 3M61U 4WMFA 4X1PU 1WQVH 2UWLA 5CHAB 3S0NA 1C5ZB 2GMTB 1GI3A 1Y5UT 3UOUA 2VWOA 1L0ZA 2VH6A 1V2OT 1BHXF 4BXSA 1CGHA 1H9LB 1K1IA 3C1KA 1GI7B 4ISIH 1QY6A 1W12U 4ABGA 1BUIA 4DURA 1H8ED 2PWXA 1J14A 2QXGA 1JIMA 1FAKH 1C9TA 3MFJA 4K3JA 4BXWA 4DOQA 1T8NA 1TQ0B 1V2ST 1YPJH 3MO3A 3OFND 1TB6H 5FL7D 1PFXC 5JYIA 2M2AA 4TSFD 5JBBS 2QCYA 4IGDA 3W94A 1VGCC 4P02A 3UQVA 1WU1A 3AW1A 2HALA 1JXPA 4AZ2B 4ZAEA 1HYLA 2HNTF 2ZFPH 1EATA 4ZH8A 2ODQA 1ARBA 1HXEH 5T6FA 5DP5A 2FS9A 1YPGH 2UUYA 4ZXYH 4Q4LA 2ZU3A 1SGEE 1HXFH 1W7XH 5T3HA 7GCHF 1P9SA 2H9HA 3K6YA 3QWCH 5J4SA 1TA2A 1WTHD 4FVBA 2ZIQH 1BOQA 3UQOA 1EPTA 1EP5A 1TX7A 4MNYA 4ISNA 1S6LA 3T27A 1NFYA 3KYFA 2NU3E 2ZU2A 4I33A 1C5RA 2XCFA 1XUFA 2BOHB 5C94A 4MVNA 3SGQE 2TGDA 2WV4A 1DITH 2BDGA 3BG4C 1HAOH 4A5TS 1AHTH 2C8XB 1ZMLA 1O32A 2FZZA 2ZKSA 3TJVA 2FMJA 2GJGA 3LH3A 3ATWA 2OK5A 5HIYA 1ZMJA 1E1QD 2Q6GA 2UWOA 3SUEA 5C1XA 1S0QA 2ZQ1A 1NRNH 2GCHG 4IC5A 3UUZA 1D6RA 2FI4E 4LZ1H 2WSSD 1FUJA 1ABIH 1YBWA 1MTUA 2FP7B 2HNTC 3D65E 4INLA 4AFQA 1E1RD 1HIAB 1Z6EA 1L1JA 4B6FA 5EJ1A 5LH8A 1BTHH 2A1DB 1CGIE 2VVUA 2XWBI 3E16B 1RTLA 3B9FH 3OEHD 1WXRA 1C2MA 1P10A 2QF0A 3SNCA 3RMNH 3D49H 3NCLA 3UNSA 3ENSB 1EASA 1FNIA 1BMLA 3A8CA 4F4OC 1ELFA 2TRMA 4XBBA 3GDSA 1OP0A 2HGTH 3C27B 2G52A 1LCYA 4HI3A 3F0OA 2SGPE 2ZTXA 2VIOA 1HAYB 2O8TA 1XVOA 3M7QA 3OU0A 1DSTA 4I8GA 1C5NH 1SGCA 1GJBB 3FP8E 4OGXA 2Q6FA 5T6GA 2CHAC 2QXIA 1A3EH 1C2JA 3HPTB 1Z8GA 1MBQA 1G3DA 1V2TT 2Y5HA 2TGPZ 3SJOA 3SUDA 3MU0A 8GCHG 4AGKA 3TLOA 1WV7H 1GJ6A 4AC9A 4DVAU 1MD7A 2BLWA 2JH5D 3ZYEA 1KXDA 3BIVH 2FYQA 3ZZ7A 2HNTE 4OS4A 1SQTA 1SHHB 1GHYH 2QAAA 3GCHB 1LPZB 4K60A 2OC1A 2ZNKH 3M5MA 3PTBA 4ABJA 1T31A 2ZDMA 4Y7AA 4Q7ZA 1SQRA 1K1MA 1AI8H 5GDSH 4OS2A 2FEQH 2W5EA 2F43B 1O2VA 4Z1MD 3KQBA 1AQ7A 2GZ9A 2ANYA 2BY6X 2ZTZA 3UWJH 1BRCE 4J2YB 4FUCA 3RXCA 1OWIA 3ZVBA 4BNRA 1ZHPA 1EJNA 1C1NA 1LVBA 2A45B 1QJ7B 3ZVDA 1SMFE 3MO9A 3IITA 1O3JA 1MTWA 3E1XB 4R0IA 4ABBA 4DIIH 1C2FA 1NROH 1FPCH 2LPRA 2HVXA 3RXMA 2FO9A 1NT1A 1ZJKA 2VBCA 4B76A 2WINI 5FPTA 1P2IA 1YCPK 3MQKC 5E8EH 2ANWA 2THFB 2G4TA 3RXDA 1BITA 1AGJA 4YESB 1HAGE 4AG2A 5HYOA 1EZQA 1MD8A 5AVDA 3K2UA 2BQ6B 3PMJA 4AOQA 1V2KT 4CRCA 3A7VA 4Y6DA 4D9QA 4BTTB 3SU3A 2FOGA 5IDKA 1UW7A 1IQNA 1KYNA 2VJ1A 1DWEH 2XBXA 5TJXA 1GDUA 1ZZZA 1K1JA 1HBTH 3SGAE 7ESTE 1BBRH 3FFGA 2QIQA 4TPYA 4Q7XA 3QZQA 3BTHE 1W13U 2CV3A 2VWNA 3HGPA 4MPVA 3B23B 3SW2B 2BVXH 3UNQA 1V2QT 4YOIA 3BTTE 5CHAC 1CHOG 5ESBA 1S6FA 4GPGA 1G3EA 3A83A 4NZLA 2H5DA 1TNKA 1MUEB 2WPHS 1KLJH 3F0PA 2F3CE 1VJ9U 6LPRA 3CNRA 4CBOA 1D3PB 4F49A 2RDLA 1C5UA 2ZI2H 1LPKB 2ZCLP 4X2XA 2OINA 3UTUH 3OEED 5K0HA 2RFKC 1QHRB 3LIWA 1GL0E 2JH6D 1GI5A 1GMHF 1SVPA 3KN2A 1BMAA 1O2PA 2AGIX 3M35A 3PMBB 5CDFE 3SYJA 2A31A 4OGYA 5DSFA 1NRPH 4YOJA 1QGFA 2WYJA 1RTFB 3A82A 4WXIA 1KDQB 3T28A 4J1YA 5DG6A 5E0JA 4I8HA 1ZSKA 1HAXB 3NXPA 4BANB 1G37A 4MLFB 1C4Y2 1V2VT 3BG4B 3NKKA 3FN8A 1ORFA 2BD7A 3CENA 3T26A 3EE7A 1DM4B 4KELA 1BDAA 2WUCA 2GX4A 3MNSA 2FLRH 5I25A 1XKAC 1GHBF 3L33A 2B9LA 3UR6A 4HGCA 4B74A 4BTIB 1SLVB 3PV2A 1A5GH 1SGQE 2AERH 4I31A 1PPFE 2WUBA 2FIRH 2ZHWH 3RU4E 3VGCB 1HGTH 1VCWA 2XW9A 3PTNA 2PP6A 1O0DH 1KY9A 1SLXB 3F2HA 3LGYA 1C2GA 3GOVB 3MH4A 5JDUB 3BEUA 4RKOB 2VIDA 1O3PB 4FUFA 3UPEA 3V3MA 2NU1E 1C1OA 3BEFB 5FCKA 1AY6H 1H9HE 4JYUH 2ALVA 9ESTA 5EJZA 4MNVA 1EFRD 1HJ9A 3LGWA 1GJ5H 3DD2H 2QF5A 1G36A 2WPLS 4I32A 5DP4A 1MKWH 4FU8A 3RXOA 1JMOH 1H8IH 4X1RU 2HPPH 3P70B 5C20A 3LGVA 4GHQA 3RMMH 3F9EA 4B75A 1LHDH 3Q3KA 5GJ4B 2FODA 1A5IA 2SGFE 5JB8S 2ZFTA 4RT1A 3K6ZA 1YPHC 1QTFA 2Z9LA 1O3DA 3OX7U 4NCYA 4UE7H 3QTOH 4Y76A 3SGBE 3EE0B 1O30A 1C1VH 4I7YH 2A32A 1NM6A 1AE8H 1FJSA 1O3AA 1OWHA 1C2DA 4QT8C 2PKAB 5EXLA 1O31A 3VXFH 3DSOA 4CRFA 3PMHB 3SORA 2ZECA 2V3HH 1O2WA 4Y10E 4DCDA 4FUIA 2ALPA 3BTQE 1CT0E 1K9OE 1K1NA 4A92A 3RP2A 3QLPH 1GWAA 3HGNA 4K1SA 1DPOA 1KXBA 1O3IA 3TJOA 2ZWLH 1O3KA 1S82A 2FM2A 2Z9IA 1LVYA 1UTKA 2G4UA 3T29A 1BMFD 3ZZ9A 2HRVA 2J92A 1NS3A 3W95A 2K0QA 1MAXA 1XXDA 3GY3A 1N6XA 1YPEH 3ZV9A 3K9XB 1GI1A 3RXFA 1L2EA 1S85A 3A7ZA 1AMHA 4A1VA 1OYTH 4SGBE 3FO8D 1O2XA 2Z6BD 1FXYA 3I29A 1WOFA 4Y0ZE 5E2PA 3ATLA 3MI4A 5FBIA 4TY6A 4MG3A 3MNBA 3SU1A 3QGJA 3DFLA 3M36A 1SL3A 3U9AH 1PPGE 1THRH 4X6NA 4TT3D 1YPMH 1MMJN 1L1GA 1F0TA 1O3OA 1C1PA 3HK3B 3LOXA 1SPJA 2F9BH 1E38B 4XFQA 4Q7YA 2HOBA 4U2WA 1UO6A 2FXRA 1IQEA 1O3LA 4NIWA 3RMLH 2Y5GA 2ESTE 5DK1A 1YF4A 2HLCA 1Q3XA 4BAMB 1MTNC 1SQAA 1PQ7A 1GI2A 2HLDD 4XBDA 1AKSB 4ABEA 3N7OA 3GYLB 4TWYA 3BTFE 1O3HA 2FOEA 5FAHA 2ZTYA 2XBVA 5GIBA 2Z7FE 4O9VA 1P01A 4NWLA 3P95A 1BBRE 3RU4T 1QA0A 3RXQA 1AWFH 2FWWA 1EAWA 1YC0A 2R0LA 1MBMA 3M37A 2XC5A 1NESE 3NWUA 3PO1C 1OOKB 2ZDVH 3N7DA 1C9PA 4ZCNA 3KQDA 3RMOH 2ZU5A 4LXBH 1P06A 1TGSZ 3E90B 2P93A 5A0CA 3PRBA 3PLKA 2J2UA 2F9OA 4D9RA 1O5GH 3BEIB 2BZ6H 1K1OA 2YMSB 5A0BA 4WH8A 1T32A 2BD8A 2CN0H 1QRWA 2AIQA 3GCHC 4B2BA 1K21H 1W8BH 1AIXH 5F6MA 2KM0A 1WSSH 2YNBA 1F0UA 1ZPBA 4IBLH 3PMAB 1TRMA 3GICB 2ZO3H 3SI4H 3FOAA 1UVPA 1OHHD 1GMHG 1GI4A 1F0SA 5E0HA 3TGJE 1WTGH 1ID5H 3A85A 3SV8A 5GXPA 3ZZCA 1K1LA 1Z71A 3TJNA 1F2SE 5AF9H 3BTKE 3TVJB 2XXLA 2SNVA 3N99A 1KDQA 1T4UH 4Z6AH 9LPRA 2CK3D 1EAUA 1COWD 3LT3A 4XRNA 1UTQA 4ASUD 1QRZA 1KLTA 3UAIC 1DLKB 8ESTE 4LZ4B 2ZFQH 1TA6A 2AMPA 4UEHH 3SNDA 3GDVA 2OC8A 1NY22 2F91A 1IAUA 1TPSA 2RA3A 2RA0A 2D8WA 1A7SA 1YGCH 1TOMH 2ZFFH 4MTBA 4XD7D 1QQUA 3BTEE 3Q77A 1YKTA 2FDAA 4ACAA 2SFAA 5J4QA 4IN2A 3EDXB 3P6ZB 1O5EH 3MYWA 3RXBA 4H6TA 4WY3A 2WPMS 3A7TA 2AS9A 3EAJA 8GCHF 1XUKA 1T8MA 2Q1JA 1PYTD 3H09A 2P94A 2CXVA 1SBWA 2BD4A 1UCYK 1YPHE 3UFAA 1TX6A 5AHGH 5EPYA 3VFEA 2P8OB 1FV9A 3LGIA 3LGTA 4WJG2 1A2CH 1G32B 1ETRH 2AEIH 3GCNA 1P05A 1SGRE 1C1MA 4ZUHA 3GDUA 5DGJA 1HLTH 3OTPA 1V6DA 2WPIS 2Z3DA 1NZQH 2R2MB 6CHAB 2ZPRA 1CE5A 1C1SA 1MTNB 2L74A 3GY4A 3UREA 1GJ4H 1BTXA 4O3UA 3SU2A 2Y82A 1D3TB 1OWKA 1YCPM 4Z0KA 1SGPE 1WUNH 3Q3YA 1HAZB 2BMGB 5FX6A 2L6OA 3RXEA 1VR1H 2BLQA 5FXLA 5A8YA 1VGCB 1AU8A 4Y71A 1K0HA 3MH7A 1GVKB 2DUCA 4Y8YA 2IPQX 1DWCH 4JZDH 4OS7A 2V7QD 2LELA 2I6QA 1TNJA 1C4U2 4GHTA 4KTSA 1UVSH 5EQSA 3S69A 2O8MA 1Y5AT 6CHAC 1UHBA 1HNEE 2PSYA 2A5AA 1ELVA 4Y79A 1F92A 4CH2B 1U6QA 1GHWH 1GVLA 2A4QA 2W7SA 1P0SH 4E05H 1WCZA 3RXAA 1XUIA 2VIVA 1DUAA 2ODYB 1O2LA 4U32A 2Y5FA 1GBAA 3P8FA 4X8VH 2J5UA 1HV7A 3PB1E 3RXSA 3MNCA 1YCPH 2BD3A 1O3NA 3QK1A 2SGAA 1IQHA 2QXJA 1J15A 1W0YH 1ANCA 1UVUH 3H7OA 1KXCA 1PPHE 1VJAU 1S0RA 2HWLB 1YWUA 5EG4A 3FKSD 1H8HD 1QFKH 5ESTE 4B1TA 1LPGB 1Z8JB 4D7GA 2OBQA 3LGUA 3PROA 2GTBA 2GKVE 2BYAX 3DT0H 2O8UA 4TPIZ 3RXTA 1NFUA 1QJ1B 3QZRA 4X8UH 3S7HB 5FPSA 3UOPA 1DXPA 1P2NA 3U28C 3PV4A 1J9CH 2V3OH 4TWWA 3ZZ8A 4CRDA 2VNTA 1EP6A 4O97A 2P59A 4VGCB 4KTCA 3ZV8A 1O35A 2K1QA 2ZA5A 3I78A 4KKDA 3Q3XA 1TGTA 1RS0A 1C2IA 2UUFB 1O3MA 1ABJH 2JJ2D 3ZVCA 4X2YA 3M7UA 1UTPA 1AN1E 5FHTA 3MU8A 2ZGXH 3V0XA 4AX9H 1KXEA 1N8OB 1GBTA 3VB4A 2A0QB 4ABAA 4K1EA 2P16A 3GCTG 3ZZ3A 1HIAA 1THSH 3IWMA 1Y8TA 2CJIA 1L1NA 4ISLA 2P3UB 1BCUH 4ZROA 2GVFA 3BF6H 3ZVEA 1DDJA 5EOKA 3A8BA 3ZZ4A 3TH3H 1UHBB 2GCTC 2EI8A 4YT7H 1P8VC 2BY9X 1DANH 1C5QA 1GBDA 3BIUH 1SI5H 1CA0C 3FAOA 2OTVA 2R2WU 1O2RA 1LHGH 2QV1A 5BPEA 4FOUC 2XBWA 2D26C 3RC4A 1RFNA 4K8BA 2YMSD 1MTSA 2Q6DA 4DT4A 1C4V2 1GG6B 3V7TA 1ETTH 4NIXA 1UTOA 1HCGA 1MCVA 3BTDE 3VGCC 3E8LA 4F55A 1AFEH 3LU9B 1NFWA 2AIPA 1MQ5A 1RD3B 2P3FH 4YLQH 3I77A 2XBYA 1RTKA 2KCOA 2A4RA 1GBIA 3BTGE 4YOGA 1UTMA 3KQ5A 2OXSA 2DE8A 1XMNB 1GBBA 3VB6A 1O2SA 1C2KA 1IOEA 2VWLA 4MPUA 1C2LA 2ZDAH 2BX3A 1FY1A 1XX9A 5C0UA 1ZRKA 1GBFA 3JZ2B 2B8OH 2ZCKP 4ZHLU 1K28D 1OPHB 1IHTH 2OC0A 2WV9A 4A7IB 4AN7A 3SZEA 3PWCA 3BG8A 1AWHB 2KFWA 1GBMA 1J17T 1NU7B 1O38A 1Z8IB 1XUJA 3TITA 3RXHA 1UK4A 4ZXXH 4NGAH 1GHAF 1O2ZA 1QL7A 4ABFA 2TBSA 3DUXH 2KAIB 4IMZA 4Y7BA 5HXFA 5A8ZA 1DS2E 5B6OA 3EYDA 1P57B 2VB0A 2FOBA 5ETXA 3A84A 3M5LA 4JK6A 3V12A 2ZDLA 4ABHA 1UTLM 3HATH 4U30A 3SI3H 4YTAA 1RIWC 4X6OA 3GISB 1AZZA 3SU6A 2EQNA 1A0LA 1MKWK 3RLWH 4A6LA 1TONA 1S5SA 1WAYB 1Z8RA 3LPRA 1C1QA 2BM2A 1D3DB 3QX5H 2YOLA 3VB7A 3HKIB 1EJAA 2TPIZ 3AAVA 1O2KA 2XC0A 1O2NA 3MMGA 1J16A 2GV6A 2KCAA 1BHXB 2XNIA 2G8TA 4I8LA 1AE5A 3RM0H 3TIUA 3ESTA 2A2QH 2XWAA 1GHVH 1FPHH 3T2NA 1IQFA 4JZ1A 1GVZA 1K1PA 2HPQH 2PTCE 5E0GA 1XXFA 1Y59T 1C1WH 3PV5A 5C1UA 1UJ1A 4JZEH 1V2WT 2VGCC 4AFSA 1FDPA 3FZZA 2W3IA 1GMCF 2VIQA 4UDWH 3S9CA 1BJVA 1LQDB 1TX8A 1O5DH 1GBLA 2ZFSA 1Y3UA 1NFXA 1VKYA 4TYDA 1TABE 3PWBA 4XDEA 1G2MA 1NC6A 1S81A 1L4ZA 5EXMA 4DY7B 1QA7A 1TGBA 1QCPA 4JYTA 1ELAA 4WH6A 3TGKE 1A3BH 1IQKA 2BLOA 3KQEA 6GCHF 1IQGA 1JBUH 3PLBA 5C2ZA 1FMGA 3LKWA 3KF2A 1BMMH 5B6LA 2ZPQA 1OYQA 2BDAA 1SGFG 1GHXH 1VITH 1FY4A 1W0JD 4BAOB 1TOCB 1YM0A 5A2MH 1ZTJA 1GBEA 4O03A 1BBRK 2GT8A 4ZKRU 2PUQH 3KYGA 2ZHDA 5KECA 1GPZA 4Q63A 1GCTC 1LTOA 4F48B 3BTME 1BB0B 1Y3YA 2OUAA 1CHGA 1D6WA 1BZXE 1HPGA 2Z9JA 5A09A 1G2LA 2ZHQH 5DP6A 1V2MT 3VXEH 4I86A 5F8TA 4B6EA 1PJPA 1OP2A 1A1RA 2HVYB 5L2ZH 1DWBH 2P8OC 4Q2KA 4X2WA 4MPWA 4B2AA 1P9UA 1S6HA 2ZEBA 1TPPA 5I46H 5L6NH 1A4WH 1FZZA 3P8NA 4WF8A 1Y3WA 2Z3CA 1ANBA 1C5XB 4UD9H 4AB8A 4UONA 1EKBB 1O36A 2W3KA 4UFFH 1TGCA 3S7KB 2J95A 1TYNA 2A7JA 1HJAC 2JDID 2GGVB 4AG1A 2R0KA 3TPIZ 3KCGH 1NRSH 1TGNA 2B7DH 3DSPA 2STAE 1ARCA 5EIYA 3TU7H 1A46H 1CVWH 1ZJDA 1UTJA 1HAPH 3A8DA 1QB1A 5F53A 4THNH 1Z6JH 2EI7A 1QB9A 2XOKD 4OS6A 5JBAS 1GJ9B 3TGIE 1TAWA 2BDBA 2PKAA 3RXGA 3F2GA 1L4DA 2R3UA 3CS7A 1TIOA 3TK5A 3TK6A 1DWDH 2F9UA 4K2YA 1KXAA 3KHVA 5DN6D 2XNDD 1SOTA 5EODA 4LOYH 2J94A 5BRRE 1H4WA 1AFQB 4MDSA 2EC9H 1TQ7B 2ZZUH 4CR5A 1PPEE 4E06H 4UFGH 2PUXB 4INKA 2ZHFH 1CO7E 1GGDB 4BTUB 1DX5M 1TMBH 2BTCE 2G5VA 1IQIA 2EI6A 4E7NA 1BA8B 1BQYA 3KNXA 3ATIA 4NFEA 2WPDD 5E2OA 3SU5A 1QBVH 1DY9A 1H8DH 1EUFA 1TWXB 1YLDA 4NZQA 3A88A 1HDTH 3LONA 2XYAA 4K1TA 4ZHMU 2V35A 2XC4A 2FLBH 3ZVFA 1EX3A 2BDIA 5EQRA 2BX4A 1O37A 1BIOA 1BTUA 1C5MD 4MQAA 2PW8H 1F5LA 1O39A 1EOJA 3K65B 5EW1H 1VCQA 3TNSA 1T8OA 1HFDA 2SGQE 4X1QU 1AFQC 4JZIA 4FUEA 1EZXC 1P2MA 2K8IA 1GCDA 2H9EH 5C3NA 2FI3E 4OM9A 5DP9A 3DHKH 1FY3A 3OYPA 1NO9H 4CREA 2IPHA 2XCNA 7GCHG 2PGBB 3SNAA 2CMYA 1AB9B 3SJKA 4NIYA 4FUJA 1KIGH 2FYRA 3E6PH 1GJCB 3FZDA 1AO5A 1GHAG 1FY8E 1LQEA 1QURH 1W2KH 1SGDE 2BD2A 4CH8B 1BTWA 2ZQ2A 4GAWA 1Y3XA 2NU2E 2QA9E 2VIPA 1HB0B 3DFJA 2BQ7B 3ZZBA 2IOTA 3MU1A 1UVTH 4GCHG 2PGQB 5AFYH 2QC2A 4UFDH 3VPKA 1JRTA 2VVCA 3P8OA 3WY8A 1NTPA 1QL8A 3GCTF 3SHCH 3MTYA 3UIRA 2FOAA 4ZKSU 1SFQB 1ZSLA 2UUKB 1TRNA 1NBMD 2WV5A 2ANMH 4KGAA 3CP7A 3QDZB 1ZTLA 3S9AA 3AK5A 5KGOA 5F03A 3V13A 3SUFA 1QRXA 1TALA 1C2EA 4R8TB 3SNBA 3RC6A 4CHAC 4PROA 1RIWB 1SKYE 2KX4A 2UUJB 2J38A 2AGEX 1TBRH 1QQ4A 2ZPSA 4YO9A 5JBTA 1A61H 4NSYA 1LDTT 3A7XA 1ESBA 4IN1A 4M9FA 1B0FA 2EA3A 3KQCA 1Q31A 1SQOA 5AFZH 2BXUH 3M7TA 1O3EA 1KLIH 3N7EA 1GBCA 1KMHB 2VWMA 1P09A 3E0PB 1AD8H 3AW0A 4ESTE 1BTPA 2F9VA 2C3SA 1OWDA 1PQAA 4ZHAA 1TLDA 1GHZA 1MZAA 1P11E 1B0EA 1GI9B 1O2JA 3H5CB 4FU9A 3U98H 3GY6A 1TPOA 3SV7A 2JETC 3TNTA 4WVPE 1GMDF 2IJOB 2WHXA 4FUHA 3ZZ5A 2O9QA 5K7RA 1V2NT 1AUJA 3A89A 1O34A 3SJIA 1AZ8A 4FVDA 1MABB 4CRGA 1QJ6B 2Y80A 1AUTC 4AYYB 3LDXH 3QGNB 2EY4C 6ESTA 3SOSA 3E91A 4E7RG 1Y3VA 2IN2A 3NRLA 2C8ZB 3CS0A 4YZUA 2A4GA 1GHBG 2BOKA 2WPKS 3SV2H 2LP6A 3STIA 3U8OH 1UCYE 3GYMA 4Y0YE 1MKXK 2BD9A 4K8YA 1P3CA 2C8YB 3A8AA 5T6DA 2ZC9H 1QBNA 5GCHF 2SNWA 2VINA 4Q80A 3RM2H 3TH2H 1FIWA 1O2TA 5DP7A 1T4VH 1GJ7B 3SBKA 1QB6A 1Y5BT 5TCCA 5SGAE 1GG6C 2JETB 1SR5C 3OSYA 1O5AB 2Z3EA 1V2PT 2AHME 2V6NA 2H9TH 1OKXA 3BSQA 1FN8A 1HJ8A 2V3MA 1IQMA 1KTSB 1S84A 3M3TA 4WMEA 1EB2A 3EQ0H 1HAHH 4KTUA 4FXGH 3ZZAA 1G3CA 4LK4A 5HM9A 1FI8A 1F7ZA 3QN7A 2SGDE 4ZKOU 1N8OC 2G81E 3D23A 4B71A 2CGAA 3PM3A 1CT4E 4CRAA 1BRUP 2I6SA 3EA9A 3LJOA 2ODPA 3MO6A 4RSPA 4HG6A 3KIDU 1Q2WA 2BVSH 1WDIA 4X8TH 2QXHA 5EU8A 2J9NA 4FUGA 1TNIA 1CHOF 1WBGB 1EAIA 1YP9A 2D1JA 1TBZH 1X7AC 1C5LH 5C1YA 4Y8XA 2PR3A 2VU8E 1MQ6A 4VGCC 2P3TB 4X0WU 5GPIB 1E36B 1W7GH 1MU6B 2KR7A 2WYGA 1GL1A 1LVMA 1BT7A 2NU0E 2QF4A 2H1UA 2ZCHP 1ELTA 1P2JA 3ODFA 3L6PA 1KSNA 1XUHA 3ZZDA 3O8CA 3ELAH 1C2HA 1CA8B 4X1SU 2AFQB 2YMSC 1W3CA 1QBOA 4NG9H 1SB1H 2D2DA 4IW4E 3RXVA 3BN9A 1SGYE 1O3BA 3MU5A 1SLWB 1A0HB 3VEQB 1ZMNA 4WWYA 1DXWA 1WQSA 1GMCG 2P95A 2ILNA 5EPNA 1VZQH 5C0TA 4SGAE 1SG8B 1C5TA 2PV9B 1MCTA 3SUGA 4CRBA 4I8JA 2GCHF 2Y7ZA 3E0NB 2R3YA 5CHBA 2CF8H 3MH6A 1BJUA 1DT2A 1IHSH 4ZKNU 1TRYA 1O2QA 3KEEA 2KZ4A 2F9PA 4GVUA 5A0AE 2V0BA 5F8XA 4CBNA 1GBHA 4H42U 1FY5A 4RN6A 5FBEA 1LO6A 1A0JA 3ZZ6A 2XTTB 2GCTB 1TPAE 1GJDB 2VGCB 1SGIB 1LHCH 1O33A 3SQEE 2GD4B 3GY7A 2R9PA 1P03A 2H6MA 5TCAA 2A5IA 1NBME 1JOUB 3A80A 1H1BA 4D76A 1OS8A 1H9IE 3U8TH 2H2ZA 3OY5U 3F2FA 1SLUB 1PYTC 1INCA 1ESTA 4H4FA 3RXUA 2GZ7A 1MZDA 2ZGBH 3D62A 1HAVA 4Y8ZA 2FTLE 3RXJA 1PQ5A 1ZPCA 3JZ1B 3F9FA 1O5CB 2Z9GA 4DT7B 5LPFA 3A86A 5H4IB 3U1JB 1K2I1 2QYIA 2W6ID 1C5PA 1W0ZU 4BAQB 1EOLA 1P02A 1ZYOA 1YPKH 4JZFH 4X6PA 2G51A 1GJAB 4DG4A 1NPMA 1DSUA 4ACBA 1SFIA 2FOCA 1P2OA 1IQLA 6GCHG 2AMQA 3ZVAA 2DE9A 3SQHE 2B5TB 4MNXA 5L30H 5LPRA 2AH4X 2OQ5A 2RG3A 4AYVB 4K69A 5FCRA 7KMEH 2FOHA 1O5FH 1KXFA 2PFEA 2NWNA 5DJ7A 3Q76A 1O3GA 1Z7KA 2KAIA 5HIZA 1E0FD 1UCYH 5EGMA 1PQ8A 4BOHA 5GCHG 1YLCA 4WMDA 1CQQA 1Z1IA 2AMDA 1F0RA 2QY0B 2ZGJA 4IC6A 4FUBA 5EQQA 2Z94A 1K22H 3RXRA 3VB3A 3U8RH 2ANKH 2STBE 1UK2A 4XBCA 4X2VA 1DVAH 4B73A 2TIOA 3DA9B 1TMUH 1KTTB 1P04A 3MHWU 1QL9A 3BV9B
chains in the Genus database with same CATH topology
2GT7A 1WYKA 1RJXB 2UWPA 2FPZA 3UB0A 1AB9C 2ZF0H 1EZUC 1RRKA 2LNCA 1D4PB 8LPRA 5HGGA 1HUTH 1ZHRA 2BHGA 5A8XA 1ZGVA 2G00A 3SV9A 4NA9H 1ESAA 5FX5A 2BD5A 1PPBH 3ZVGA 3GCOA 3R0FA 4K5ZA 2BB4A 1ZSJA 2C93B 2C8WB 1ELBA 1FLEE 2A7HA 3H7TA 4ISOA 3SO3A 1E34B 5C17A 4GSOA 1V2LT 1MH0A 1XM1A 1C5YB 1QR3E 3FVFB 1FONA 1EQ9A 1EB1H 3VB5A 4DGJA 5EW2H 5ABWA 1OXGA 1PPCE 1GMDG 1LMWB 1VITG 2ZG0H 3SN8A 1C5OH 1GDNA 1EXFA 1P12E 2CF9H 2PKSC 1UTNA 2XRCA 3PO1B 1RGQA 2BDCA 3QO6A 5IK2D 3Q00A 1V3XA 4GCHF 2QE7D 2BZAA 3NZIA 1FN6A 1O5BB 2FX4A 2A2XH 3UNRA 1O2UA 3RC5A 1CBWC 2VH0A 3M5OA 3FANA 1YPLH 4NFFA 5CMXH 4D7FA 2O8LA 2BDYA 1C5WB 1VITF 1UMAH 4RKJB 4TY7A 5IYTA 1V2RT 1E37B 1C1UH 1C5SA 1FIZA 3MOCA 2GV7A 4XSKU 5JPMH 2ZU1A 3OAAD 1ELDE 1TNGA 2J34A 3F68H 2ASUB 5DPAA 5C5OA 1LHFH 3A7YA 4JYVH 1C1RA 1W10U 4UFEH 1F5RA 3RU4D 1SC8U 7LPRA 2BDHA 3WWFA 4KP0A 1UK3A 1P3EA 5HKKD 3ZYDA 1NRQH 1MKXH 5G4BA 3FP6E 2Y6TA 3W1EA 5DKMA 3GS9A 3O8RA 3M3SA 3KL6A 2BLVA 2GZ8A 2JH0D 4FU7A 4NSVA 2H5CA 1O2HA 2B0FA 3RLYH 1TFXA 1GI0A 3RXIA 4X1NU 1W11U 1DLEA 1O2GH 1GI6A 4ABIA 2ZGHA 1DY8A 1IQJA 4ASHA 4CHAB 3UR9A 2OCVB 1G30B 1TNHA 1SGFA 2GMTC 3WWBA 1ANDA 1LKBA 1UVOA 1FQ3A 3LC5A 3O8DA 1XUGA 3DCLA 2FOFA 1EAXA 4JCNA 1GCTB 3RDZA 2ULLA 4BAKB 2PTNA 5CE1A 3F3BA 3F9HA 1BRAA 2A4OA 1VCPA 2NU4E 1V2JT 5GNDA 5DP3A 3GY5A 4AGJA 3QUMP 1ELEE 1W14U 3EA8A 3F6UH 3URCA 2OLGA 1NU9A 1ZGIA 1O3FA 1CGJE 3AVZA 2OC7A 1D9IA 1ZR0A 1AVGH 4AORA 2GP9B 5PTPA 1LVOA 4HFPB 5GWZA 4NA7A 2EEKA 4HZHA 2ZP0H 1EPTC 4A1XA 8KME2 5JB9S 1F5KU 1AVXA 1BTYA 2OQUA 3AAUA 1SGNE 1C1TA 1EPTB 2IJD1 2AYWA 2FESH 1OSSA 3MH5A 1MTVA 5L2YH 2Y81A 3A87A 1GDQA 1ELCA 1OX1A 3S9BA 5F8ZA 1OP8A 1HRTH 1O2OA 3F1SB 2BVRH 4YM9A 1BMNH 2KCPA 4WXVA 4H6SB 4HTCH 1O2MA 3U69H 4DJZB 2G5NA 2F83A 3HK6B 3SZNA 5LGOA 1G3BA 3URDA 5C5NA 1S83A 4JK5A 1HAIH 3PYHA 3AASA 4FETA 1GBJA 3B8JA 3ATMA 4O3TA 4X8SH 3SHAH 1W0KD 3VG8A 3STJA 2QF3A 3EA7A 1ZPZA 1GGDC 1CSOE 2BXTH 3U1IB 1TE0A 1TNLA 1E35B 1SOZA 4CR9A 3ATKA 2GDEH 4OS5A 2CHAB 3KGPA 1E79D 3UY9A 3PLPA 2JIZD 4AB9A 1Z1JA 1O3CA 2ZU4A 5DP8A 3TH4H 4AFUA 1GJ8B 3LJJA 5HM2A 1NN6A 3TJUA 3QTVH 3SNEA 4RI0A 2FTMA 2OBOA 1NRRH 1XVMA 3F9GA 1J8AA 1C5VA 2RCEA 4MPXA 1MAYA 2A5KA 4JMYA 4NWKA 3RXPA 3WW7A 1CU1A 1ZHMA 2SGEE 2PLXA 1DE7H 3FP7E 1GI8B 4ISHH 4M7GA 4MNWA 1T7CA 1GBKA 1JWTA 2ZFRH 3RXLA 4GUXA 1FAXA 1ACBE 1V2UT 3OY6U 2TGTA 3M3VA 1ETSH 4D8NA 2VIWA 4U01A 2W6JD 4YT6H 1AVWA 2F4LA 1XKBC 5T1VA 2BY5X 3G01A 1DFPA 1B7XB 1BRBE 1JIRA 4B2CA 4NIVA 4NA8A 2BQWB 2J4IA 2ZDNA 1ELGA 3GY8A 2A7CA 2PSXA 4I8KA 2Y7XA 1PPZA 3UWIA 4INHA 2WZQA 1YYY1 3SJ8A 4A1TA 1CBWB 3RUOA 1HAVB 1N6YA 1LHEH 3ZIAD 2C90B 3E3TA 1DUEA 2ZHEH 3ITIA 4DW2U 2PKSB 2BY7X 3HKJB 2FX6A 3MNXA 1OWEA 2O8WA 4Y11E 1P2KA 1O2YA 1SHYA 3PRDA 1OWJA 3OE7D 2YNAA 1G9IE 2TGAA 3A7WA 3LH1A 4YLUA 2JJ1D 1CA0B 2FI5E 4ABDA 2F9NA 5C67A 1ZLRA 3MWIU 1A5HA 1QNJA 1RXPA 1SSXA 3P17H 1EZSC 1LKAA 4ZMAH 3M5NA 3EGKH 1EJMA 1ANEA 4GLYA 2OD3B 4YXWD 1M9UA 2FS8A 2WPJS 3T5FH 3TK9A 1TMTH 2ZGCA 2W7UA 5LPEA 1MU8B 4BAHB 1AKSA 1SGTA 5EXNA 2PHBA 1DICA 1N1LA 3ODDA 3SU4A 1BTZA 5HMAA 2VVVA 3L3TA 5JBCS 1ZRBA 1O2IA 1CT2E 2C4FH 1B5GH 1QIXB 2QN5T 1ZTKA 3NPSA 2FOMB 4FUDA 3T62A 2OP9A 2JKHA 3SV6A 3R3GB 3NUMA 2ZDKA 1FX0B 2M5TA 2AGGX 1THPB 3BTWE 1T8LA 2QGRA 3P92A 4XOJA 2W26A 3OTJE 3LC3A 3SJ9A 2BY8X 5FPYA 2Z9KA 1TBQH 3P8GA 3MU4A 4AFZA 5DO4H 3GY2A 3T25A 2G55A 3A81A 3O8BA 3IG6B 4IMQA 4IS5A 1ZOMA 3NK8A 2GDDA 1D3QB 4XE4A 3RXKA 1HJAB 3SU0A 1DOJA 4OS1A 4X6MA 4DIHH 2KCYA 1P2QA 1JRSA 3M61U 4WMFA 4X1PU 1WQVH 2UWLA 5CHAB 3S0NA 1C5ZB 2GMTB 1GI3A 1Y5UT 3UOUA 2VWOA 1L0ZA 2VH6A 1V2OT 1BHXF 4BXSA 1CGHA 1H9LB 1K1IA 3C1KA 1GI7B 4ISIH 1QY6A 1W12U 4ABGA 1BUIA 4DURA 2PWXA 1H8ED 1J14A 2QXGA 1JIMA 1FAKH 1C9TA 3MFJA 4K3JA 4BXWA 4DOQA 1T8NA 1TQ0B 1V2ST 1YPJH 3MO3A 3OFND 1TB6H 5FL7D 1PFXC 5JYIA 2M2AA 4TSFD 5JBBS 2QCYA 4IGDA 3W94A 1VGCC 3UQVA 1WU1A 3AW1A 2HALA 1JXPA 4AZ2B 4ZAEA 1HYLA 2HNTF 2ZFPH 1EATA 4ZH8A 2ODQA 1ARBA 1HXEH 5T6FA 5DP5A 2FS9A 1YPGH 2UUYA 4ZXYH 4Q4LA 2ZU3A 1SGEE 1HXFH 1W7XH 5T3HA 7GCHF 1P9SA 2H9HA 3K6YA 3QWCH 5J4SA 1TA2A 1WTHD 4FVBA 2ZIQH 1BOQA 3UQOA 1EPTA 1EP5A 1TX7A 4MNYA 4ISNA 1S6LA 3T27A 1NFYA 2NU3E 2ZU2A 4I33A 1C5RA 2XCFA 1XUFA 2BOHB 4MVNA 3SGQE 2TGDA 2WV4A 1DITH 2BDGA 3BG4C 1HAOH 4A5TS 1AHTH 2C8XB 1ZMLA 1O32A 2FZZA 2ZKSA 3TJVA 2FMJA 3LH3A 3ATWA 2OK5A 1ZMJA 1E1QD 2Q6GA 2UWOA 3SUEA 5C1XA 1S0QA 2ZQ1A 1NRNH 2GCHG 4IC5A 3UUZA 1D6RA 2FI4E 4LZ1H 2WSSD 1FUJA 1ABIH 1YBWA 1MTUA 2FP7B 2HNTC 3D65E 4INLA 4AFQA 1E1RD 1HIAB 1Z6EA 1L1JA 4B6FA 5LH8A 1BTHH 2A1DB 1CGIE 2VVUA 2XWBI 3E16B 1RTLA 3B9FH 3OEHD 1WXRA 1C2MA 1P10A 2QF0A 3SNCA 3RMNH 3D49H 3NCLA 3UNSA 3ENSB 1EASA 1FNIA 1BMLA 3A8CA 4F4OC 1ELFA 2TRMA 4XBBA 3GDSA 1OP0A 2HGTH 3C27B 2G52A 1LCYA 4HI3A 3F0OA 2SGPE 2ZTXA 2VIOA 1HAYB 2O8TA 1XVOA 3M7QA 3OU0A 1DSTA 4I8GA 1C5NH 1SGCA 1GJBB 3FP8E 4OGXA 2Q6FA 5T6GA 2CHAC 2QXIA 1A3EH 1C2JA 3HPTB 1Z8GA 1MBQA 1G3DA 1V2TT 2Y5HA 2TGPZ 3SJOA 3SUDA 3MU0A 8GCHG 4AGKA 3TLOA 1WV7H 1GJ6A 4DVAU 1MD7A 2BLWA 2JH5D 3ZYEA 1KXDA 3BIVH 2FYQA 3ZZ7A 2HNTE 4OS4A 1SQTA 1SHHB 1GHYH 2QAAA 3GCHB 1LPZB 4K60A 2OC1A 2ZNKH 3M5MA 3PTBA 4ABJA 1T31A 2ZDMA 4Y7AA 4Q7ZA 1K1MA 1AI8H 5GDSH 4OS2A 2FEQH 2W5EA 2F43B 1O2VA 4Z1MD 3KQBA 1AQ7A 2GZ9A 2ANYA 2BY6X 2ZTZA 3UWJH 1BRCE 4J2YB 4FUCA 3RXCA 1OWIA 3ZVBA 4BNRA 1ZHPA 1EJNA 1C1NA 1LVBA 2A45B 1QJ7B 3ZVDA 1SMFE 3MO9A 3IITA 1O3JA 1MTWA 3E1XB 4R0IA 4ABBA 4DIIH 1C2FA 1NROH 1FPCH 2LPRA 2HVXA 3RXMA 2FO9A 1NT1A 1ZJKA 4B76A 2VBCA 2WINI 5FPTA 1P2IA 1YCPK 5E8EH 2ANWA 2THFB 2G4TA 3RXDA 1BITA 1AGJA 4YESB 1HAGE 4AG2A 5HYOA 1EZQA 1MD8A 5AVDA 3K2UA 2BQ6B 3PMJA 4AOQA 1V2KT 4CRCA 3A7VA 4Y6DA 4D9QA 4BTTB 3SU3A 2FOGA 5IDKA 1IQNA 1KYNA 2VJ1A 1DWEH 2XBXA 5TJXA 1GDUA 1ZZZA 1K1JA 1HBTH 3SGAE 7ESTE 1BBRH 3FFGA 2QIQA 4TPYA 4Q7XA 3QZQA 3BTHE 1W13U 2CV3A 2VWNA 3HGPA 4MPVA 3B23B 3SW2B 2BVXH 3UNQA 1V2QT 4YOIA 3BTTE 5CHAC 1CHOG 5ESBA 1S6FA 4GPGA 1G3EA 3A83A 4NZLA 2H5DA 1TNKA 1MUEB 2WPHS 1KLJH 3F0PA 2F3CE 1VJ9U 6LPRA 4CBOA 1D3PB 4F49A 2RDLA 1C5UA 2ZI2H 1LPKB 2ZCLP 4X2XA 2OINA 3UTUH 3OEED 5K0HA 1QHRB 3LIWA 1GL0E 2JH6D 1GI5A 1GMHF 1SVPA 3KN2A 1BMAA 1O2PA 2AGIX 3M35A 3PMBB 5CDFE 3SYJA 2A31A 4OGYA 5DSFA 1NRPH 4YOJA 1QGFA 2WYJA 1RTFB 3A82A 4WXIA 1KDQB 3T28A 4J1YA 5DG6A 5E0JA 4I8HA 1ZSKA 1HAXB 3NXPA 4BANB 1G37A 4MLFB 1C4Y2 1V2VT 3BG4B 3NKKA 3FN8A 1ORFA 2BD7A 3CENA 3T26A 1DM4B 4KELA 1BDAA 2WUCA 2GX4A 3MNSA 2FLRH 5I25A 1XKAC 1GHBF 3L33A 2B9LA 3UR6A 4HGCA 4B74A 4BTIB 1SLVB 3PV2A 1A5GH 1SGQE 2AERH 4I31A 1PPFE 2WUBA 2FIRH 2ZHWH 3RU4E 3VGCB 1HGTH 1VCWA 2XW9A 3PTNA 1O0DH 1KY9A 1SLXB 3LGYA 3F2HA 1C2GA 3GOVB 3MH4A 5JDUB 3BEUA 4RKOB 2VIDA 1O3PB 4FUFA 3UPEA 3V3MA 2NU1E 1C1OA 3BEFB 5FCKA 1AY6H 1H9HE 4JYUH 2ALVA 9ESTA 4MNVA 1EFRD 1HJ9A 3LGWA 1GJ5H 3DD2H 2QF5A 1G36A 2WPLS 4I32A 5DP4A 1MKWH 4FU8A 3RXOA 1JMOH 1H8IH 4X1RU 2HPPH 3P70B 5C20A 3LGVA 4GHQA 3RMMH 3F9EA 4B75A 1LHDH 3Q3KA 5GJ4B 2FODA 1A5IA 2SGFE 5JB8S 2ZFTA 3K6ZA 1YPHC 1QTFA 2Z9LA 1O3DA 3OX7U 4NCYA 4UE7H 3QTOH 4Y76A 3SGBE 3EE0B 1O30A 1C1VH 4I7YH 2A32A 1NM6A 1AE8H 1FJSA 1O3AA 1OWHA 1C2DA 4QT8C 2PKAB 5EXLA 1O31A 3VXFH 4CRFA 3DSOA 3PMHB 3SORA 2ZECA 2V3HH 1O2WA 4Y10E 4DCDA 4FUIA 2ALPA 3BTQE 1CT0E 1K9OE 1K1NA 4A92A 3RP2A 3QLPH 1GWAA 3HGNA 4K1SA 1DPOA 1KXBA 1O3IA 3TJOA 2ZWLH 1O3KA 1S82A 2FM2A 2Z9IA 1LVYA 1UTKA 2G4UA 3T29A 1BMFD 3ZZ9A 2HRVA 2J92A 1NS3A 3W95A 2K0QA 1MAXA 1XXDA 3GY3A 1N6XA 1YPEH 3ZV9A 3K9XB 1GI1A 3RXFA 1L2EA 1S85A 3A7ZA 1AMHA 4A1VA 1OYTH 4SGBE 3FO8D 1O2XA 2Z6BD 1FXYA 3I29A 1WOFA 4Y0ZE 5E2PA 3ATLA 3MI4A 5FBIA 4TY6A 4MG3A 3MNBA 3SU1A 3QGJA 3DFLA 3M36A 1SL3A 3U9AH 1PPGE 1THRH 4X6NA 4TT3D 1YPMH 1MMJN 1L1GA 1F0TA 1O3OA 1C1PA 3HK3B 3LOXA 1SPJA 2F9BH 1E38B 4XFQA 4Q7YA 2HOBA 4U2WA 1UO6A 2FXRA 1IQEA 1O3LA 4NIWA 3RMLH 2Y5GA 2ESTE 5DK1A 1YF4A 2HLCA 1Q3XA 4BAMB 1MTNC 1SQAA