1RGQA

M9a hcv protease complex with pentapeptide keto-amide inhibitor
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
154
structure length
154
Chain Sequence
QVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVTKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3 Protease
publication title Hepatitis C NS3 protease inhibition by peptidyl-alpha-ketoamide inhibitors: kinetic mechanism and structure.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein, hydrolase
total genus 32
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1rgqA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1rgqA01
2ZO3H 1NZQH 3LT3A 3MH5A 3PWBA 3NK8A 4NG9H 1AQ7A 1GHWH 3RMLH 2QXJA 3RP2A 1MQ5A 1YPEH 1NFYA 4GHQA 1G3DA 1Y5UT 2HPQH 1XKAC 1FUJA 2PKAA 3ZVEA 5A0CA 1G2MA 4AN7A 4B75A 2A7JA 1G30B 3AW0A 3SJ8A 1IQKA 1CA0B 4B73A 1A0LA 1QBNA 3D65E 3QLPH 1BB0B 1QBVH 1TWXB 1Y3VA 4NA7A 1KXAA 3RMOH 1C2MA 1XX9A 1AVGH 5LH8A 3PLPA 1ZMJA 1UVPA 3M3TA 2I6QA 2R0LA 8GCHF 5FBEA 1CT0E 3SI3H 4JYTA 1P8VC 3HATH 2B9LA 2SNWA 1ELGA 4Q7YA 4JYVH 3SU4A 1SPJA 1K1IA 4ZXXH 2VB0A 4OM9A 1YCPM 4X2XA 3GYLB 2ZF0H 2J38A 2XBYA 2PFEA 1PFXC 2P95A 7GCHG 2ODYB 4B6EA 2BYAX 4F49A 1THPB 4I31A 1B5GH 1ZHPA 3RXTA 3KCGH 1UHBB 1EXFA 1NFUA 3P8GA 1QB9A 2F9UA 3A7TA 1LPZB 1F92A 2TGDA 1QHRB 3LH1A 4CHAC 1XM1A 1TOMH 3U8TH 3OSYA 2EI6A 1H8IH 1KLJH 4M7GA 1K28D 3EYDA 1ELBA 3MH6A 1Y5AT 2OC1A 3V3MA 2WPJS 2WPKS 1T7CA 5J4QA 1W13U 2AIPA 4I7YH 2AMDA 2OXSA 1SGTA 5EU8A 2D1JA 1D4PB 3A7ZA 4MPVA 5JBAS 3ZVGA 2O8WA 5T6GA 1K1OA 4GHTA 2ODQA 1W7GH 5HGGA 4GSOA 1TPAE 4NZQA 2UWLA 3OTPA 2V3HH 1G36A 4J2YB 1KXEA 3VB5A 1W10U 2VVVA 1TA6A 3ZVBA 1TGCA 4FUGA 1SGQE 1SSXA 4OS1A 4K1SA 1VCQA 2VU8E 1BHXB 3PWCA 3FAOA 4OS2A 4WXIA 2THFB 1HFDA 3O8CA 1NU9A 4FUIA 2P94A 2NU1E 5EGMA 1DX5M 3UTUH 1CQQA 1LVOA 2FZZA 2A7CA 1W7XH 4A1XA 4Y11E 1P03A 4X8UH 4INHA 1HAVA 3F9FA 1PPBH 4XDEA 1LHCH 2JETC 3E8LA 3TJNA 5DKMA 4DOQA 2PGQB 2HVXA 1O2PA 1SQOA 4U01A 4X1RU 3E90B 1HJAC 5DPAA 3QGNB 4ABAA 2FDAA 2VINA 2BLVA 2Y5HA 3S7HB 2AGGX 4ABJA 1KYNA 1LVBA 1DY8A 1M9UA 4BAKB 1MQ6A 3SU1A 1YGCH 2BD8A 1QB1A 1YPMH 2OINA 1BT7A 2HWLB 4X8VH 3U69H 3ENSB 2ZDNA 4ISHH 1BUIA 2C90B 4JK6A 4K1EA 1F0SA 2UUYA 3TJOA 4AOQA 4JZDH 2ANMH 4I8KA 3M37A 3KGPA 2FS8A 3UQOA 3AW1A 3Q77A 1RJXB 1GJ9B 1HIAA 1AB9C 1CU1A 1VITH 5L2YH 3GDUA 2HOBA 4U30A 1TBRH 5ETXA 5JDUB 2ZFTA 1LMWB 1O5EH 1A4WH 3P95A 2PWXA 1YF4A 1MH0A 3LGVA 1C1VH 3L6PA 3TGIE 2FS9A 4ABEA 1C5XB 2ZU5A 1TNKA 3ODDA 4XBDA 2G8TA 2A5IA 4NFEA 3BF6H 1SG8B 1FZZA 1N6XA 2HPPH 2RA0A 3PMAB 3ZZ3A 1E0FD 1F5LA 1BTYA 1O2OA 8GCHG 1MBMA 1S82A 3FANA 3UUZA 3FP7E 1VCPA 1XUJA 4YOIA 2QF3A 3A89A 2Y5FA 2WYGA 3A80A 3MU0A 5GJ4B 1V2UT 1IQLA 1GBJA 5F03A 1BTPA 4ISIH 2ZU3A 2A1DB 1UTNA 1TIOA 1TQ7B 3LDXH 1AUTC 2BD2A 3QDZB 4FUHA 1QR3E 3EDXB 1ACBE 1F0TA 2A0QB 3ATLA 1C5MD 2F9PA 2Z3CA 5I25A 5C5OA 2IPHA 2ZU1A 3V13A 3Q3YA 3D49H 1C1MA 2GDDA 1C1RA 1ID5H 3S9BA 1FNIA 3RUOA 3VEQB 2VIQA 2Q1JA 3GCHC 1VITF 1SQAA 3SHCH 7ESTE 4K69A 3F9EA 5F8XA 2GKVE 1C2IA 1ZTJA 3MOCA 3GCNA 1XVOA 5FX5A 1A0JA 3LONA 3E1XB 3RXKA 3KF2A 1V2TT 2F9BH 1SGDE 1XXFA 1OKXA 1PQ5A 4BXWA 3SUEA 2ZDAH 2W3IA 1GVLA 1P02A 1BA8B 5AFYH 1N6YA 3SZNA 3U1IB 1UCYE 1HXEH 1NRPH 4IBLH 3PB1E 1NESE 1GHAG 1DFPA 1O2HA 2O8MA 2ZQ1A 1C5QA 3RXVA 1XXDA 3SYJA 1AUJA 3FZDA 1DWDH 2GD4B 3MMGA 1E34B 2GX4A 1ZGVA 5FHTA 3IWMA 2R3UA 2WV9A 1IAUA 5A2MH 1EAXA 1HV7A 2VH6A 1IQJA 4Y8XA 1O3CA 4JYUH 3SGQE 4BAQB 1OWJA 1SC8U 1AHTH 3U1JB 1SGRE 4IGDA 4ISNA 3FZZA 1C2LA 1O2KA 4H4FA 2JH6D 4ABBA 4TYDA 1QURH 1O5AB 2GCHF 2J94A 1FDPA 2ULLA 5IYTA 3QTVH 1AU8A 3KNXA 2WZQA 2HLCA 2QXGA 4MDSA 1BRCE 4Y71A 1F0UA 1T8OA 2W5EA 2Q6GA 4X1QU 1BIOA 1BRBE 1GG6C 3L3TA 5C67A 1SOTA 3UQVA 3DFJA 3MNXA 5DP3A 5FCKA 4NWKA 4K8YA 3BSQA 1GI0A 1YPHE 2OBQA 1D3DB 3LJOA 3V7TA 1N8OC 3PV5A 2ZHDA 2ZG0H 2PUXB 1UVOA 1H9HE 1YC0A 1V3XA 1C1NA 1Y3UA 2BD9A 1HGTH 3TJUA 2TGTA 4HFPB 4X1PU 2CF9H 3TNSA 1K21H 3UNRA 1RXPA 4H6SB 3STJA 5LGOA 2ZGJA 4Q80A 2FOAA 1C5OH 6GCHF 4MG3A 3VPKA 3BTTE 3MNCA 1C1SA 4A5TS 2G5VA 4DGJA 2XWAA 3PMJA 4AB9A 2SGPE 5E2PA 3UPEA 1GMHG 3BTKE 4NIXA 1LQDB 1A2CH 1YPJH 1P11E 1EATA 1C9TA 2FODA 2Z9IA 3T25A 1QGFA 2FOMB 1HPGA 3MU1A 2BDAA 1DWCH 2I6SA 2C8ZB 1C5LH 2H6MA 1P2OA 1PPEE 2ODPA 5JYIA 3UNSA 1TPOA 2FLRH 3PTNA 4X2VA 2ZC9H 2W26A 3GY2A 1BDAA 1BMNH 3MYWA 1GJ4H 1NM6A 1OOKB 1WAYB 1HNEE 5DP7A 1LHFH 1UCYH 3A84A 2G51A 1WSSH 5E0JA 1DLKB 2WYJA 1QA7A 2Y80A 1S84A 1ZMLA 3ATIA 4ABGA 2CHAC 5FPSA 3E3TA 4Q2KA 1QFKH 1G2LA 1DM4B 1PPGE 4ABHA 1KXFA 1TRNA 4B2AA 1JIMA 2VJ1A 1KDQB 1UVSH 3M7UA 3A8BA 3QK1A 2F9OA 1YCPH 2FXRA 4RN6A 4IN1A 2C8XB 4FUEA 5BPEA 3A85A 2VNTA 4CH8B 4D8NA 1SFIA 1TMUH 1O34A 2ZGCA 4ZKOU 2B0FA 3HKIB 1EZUC 1THRH 1ZR0A 3BIUH 3PO1C 1AD8H 3SGBE 4DJZB 2CHAB 3RXFA 1EP6A 1O2QA 2NU2E 5L2ZH 3EA7A 3ZVCA 4D76A 1O33A 8LPRA 3PM3A 2OBOA 4AGJA 4F4OC 1BMAA 1RD3B 4FXGH 1AY6H 1BRUP 4Q7ZA 5LPRA 1VITG 1Y5BT 2PTCE 1AN1E 1XUKA 1ARBA 2H5CA 1EJMA 3UR6A 1WXRA 1E37B 2C4FH 2YNBA 1L1GA 4UDWH 1LDTT 4X6MA 4THNH 4D7FA 1J16A 1EPTC 5EW2H 1MTUA 1H9LB 1VGCB 2KAIA 4E05H 4VGCB 5DK1A 3U8RH 2XCNA 1G3EA 3SU3A 1EQ9A 1C9PA 2CXVA 2BMGB 4I33A 4IC5A 4XOJA 1LO6A 2GCTC 3VB7A 5HMAA 1T32A 1FJSA 5DP8A 1FY5A 4AB8A 2ANKH 1OPHB 2FX6A 3M5LA 1P0SH 1GJ5H 2QA9E 2P8OC 1H8DH 3FFGA 1K1PA 2XRCA 2ZDVH 2ALVA 4U2WA 3SW2B 2AS9A 1ZPBA 3LGIA 1GHBG 1OWKA 1A5IA 1UJ1A 2H9HA 1BITA 4B2BA 1Z8JB 3LH3A 1RIWC 1O38A 3SV8A 2NU4E 3E0NB 4WJG2 1GJCB 1V2LT 1O2YA 7LPRA 1D6WA 1SI5H 2JH0D 2Y5GA 1JWTA 3QO6A 2HNTE 1O35A 4RI0A 2ZU4A 1EPTA 4Y6DA 1QJ6B 1NT1A 4UD9H 3VGCC 1GDUA 5TCAA 2FX4A 1ESBA 1A46H 1MTNC 1QIXB 2ZI2H 3RXUA 4AG2A 4UFFH 4I32A 2Y81A 1EJNA 3RXCA 1C2EA 1W0YH 3SU5A 4I8LA 4AORA 1TX8A 5EG4A 3GY5A 2ALPA 2R2MB 2WUBA 3IITA 1UK3A 2BDBA 1GPZA 2QV1A 4TPIZ 1S6FA 3OY6U 3BEUA 2YOLA 1GI8B 2TBSA 3F9HA 3Q76A 4HI3A 3VGCB 3MH7A 3ZV8A 4DY7B 4WY3A 2F91A 4YT7H 1SGCA 3F68H 2Q6DA 1ELEE 1ANEA 2A4QA 2O9QA 1C5NH 6CHAB 3TH2H 1GI6A 1EP5A 3P17H 4K1TA 2BD3A 1MCVA 3K6ZA 1TPSA 2VBCA 2AGEX 2BB4A 4GVUA 1LPKB 3H5CB 3T27A 1FN8A 4B6FA 1OP8A 2AFQB 1D3PB 1XMNB 3S9AA 3AASA 3A8AA 3TGJE 5C1YA 1T31A 4KTSA 2ASUB 1AKSB 1SGYE 2FO9A 4YLUA 4E06H 2C3SA 1CT4E 1D9IA 2PSYA 2ZFRH 2BD5A 1KXCA 3A7XA 2BHGA 2D26C 1O3OA 1P2MA 3R3GB 4JZFH 1AWFH 3BEIB 4ZAEA 1ZSKA 2GTBA 3GCTF 2BLQA 3SV9A 4NSVA 3TITA 1IQFA 2GV7A 5EXLA 3N7OA 1P9UA 1J9CH 2A2XH 4ZUHA 1O3NA 2B7DH 3PROA 4CRCA 3K2UA 2ZFPH 4U32A 4TY6A 4MLFB 5EXMA 1TGBA 5GDSH 3RXIA 1QL9A 5C5NA 3RMNH 1EUFA 2JKHA 3SOSA 2Z9JA 1HJ9A 4UEHH 2EC9H 2ANWA 1C4U2 1SOZA 1XUIA 1F2SE 1MKWH 3ZYDA 3PTBA 3P6ZB 1GBEA 1ANCA 4WVPE 1HYLA 3BV9B 1AI8H 1JIRA 1P57B 1P3CA 4MPWA 4KKDA 2J92A 1W11U 3S7KB 1AWHB 1P10A 4ZKSU 2ANYA 4MNXA 3UR9A 3TK9A 2WPMS 4XFQA 1UHBA 1MTSA 2STBE 4X1SU 1GBKA 1NRSH 1GJ7B 1V2ST 3F1SB 1AFEH 2A32A 2ZNKH 4SGBE 5DP6A 1ZYOA 1NROH 4RKOB 1CT2E 3VFEA 2M5TA 3URDA 3AAUA 3SNBA 4ZKRU 1FQ3A 3T2NA 1GDQA 1TNLA 1O2RA 3S69A 2PW8H 2WUCA 2VH0A 3ZZ8A 4K3JA 3ZZ5A 5L30H 1PYTD 1DXWA 1TQ0B 1L4ZA 2GP9B 1MKWK 3ESTA 2XC5A 3NWUA 4ISOA 2F4LA 1TRYA 1W12U 4YESB 1K1NA 1Y59T 3A83A 3QX5H 1UTPA 2BDYA 1EAIA 5GCHF 4Q7XA 1DICA 1WYKA 3MHWU 1DXPA 1DT2A 3EQ0H 4TWWA 5A09A 3P8OA 1SQTA 1A3EH 4INKA 2HNTF 2HRVA 3RLYH 2BVSH 2V6NA 1MTWA 3G01A 2J4IA 2SGEE 4Y0YE 2FEQH 5T6DA 3EA8A 4KTUA 5FPYA 1THSH 5LPEA 1HAIH 1C5SA 1TNGA 4WMDA 1O3JA 3KIDU 1CGJE 1UK4A 5DO4H 2TRMA 1NRRH 4GCHF 1L1NA 2D8WA 1UVUH 3Q3XA 1W0ZU 3TLOA 1KSNA 4WF8A 1GI4A 1NRNH 4YT6H 1ZPCA 4BTTB 2OK5A 4ABDA 1A1RA 1QBOA 1ZGIA 3SHAH 3GOVB 2R3YA 3RXHA 2IJOB 1BJUA 3GYMA 1Q2WA 1QY6A 1H4WA 1UMAH 1J14A 1HCGA 4NFFA 4RSPA 1ESTA 1PPHE 4SGAE 4AFQA 4MNWA 1DE7H 2FPZA 3ZZ9A 5HXFA 1KY9A 4CRDA 1P06A 4O03A 1GL1A 1G32B 1WOFA 3LC3A 3SU0A 4KGAA 3LU9B 1MTVA 5AF9H 1ZMNA 3U8OH 2TIOA 2XXLA 1GCTB 1O3BA 1BRAA 3QUMP 2GT7A 1QRWA 1GBIA 5AFZH 5K7RA 1O30A 1K9OE 4BAMB 1S5SA 1OP0A 1O36A 1GBBA 1SL3A 2R0KA 4FU8A 2J95A 4YOJA 5AVDA 5JBBS 2BM2A 4BOHA 1DITH 4CR5A 3GCTG 4H42U 2Z9GA 1PPFE 3O8DA 5FXLA 1OYQA 2EI7A 4NA8A 4X0WU 5FCRA 1K1LA 2J9NA 3ZVAA 2AERH 3KQCA 5L6NH 2BZAA 4JCNA 1E35B 2Y7XA 4A7IB 2ZKSA 2F3CE 1BTUA 1IQMA 2WV5A 2ZHWH 3F6UH 3SQHE 4TY7A 4NIVA 3BIVH 3PV2A 1TB6H 5DGJA 1O3GA 3GY6A 1O3LA 1SLUB 2ZPQA 3EAJA 3LKWA 2O8UA 3M35A 3MI4A 1W8BH 3S9CA 4NCYA 2GMTB 1O3DA 1S0RA 1PJPA 1JOUB 3H09A 1S85A 1FV9A 2VGCC 3A87A 2ZTXA 4H6TA 3KQDA 1GVKB 2P3FH 2QAAA 3GDSA 1TYNA 1ZSLA 3TGKE 1ELCA 2XCFA 3KL6A 1O5DH 4DURA 1DUAA 1YLCA 2PV9B 1DLEA 4LZ1H 4AYYB 1DSUA 1T8LA 2BDIA 1YPKH 2TGPZ 5E0HA 4ZXYH 1O3AA 2GZ8A 1QJ7B 2TPIZ 2BVXH 1K2I1 2CV3A 3BTQE 1TX7A 3P92A 4FU9A 2VGCB 3NKKA 2OTVA 2G55A 2Q6FA 3O8BA 3QZQA 3TU7H 2P93A 1UK2A 1YBWA 3VB6A 2Z3DA 1C4V2 3MO9A 4NIWA 1BJVA 3NZIA 1V2RT 1BTWA 1B7XB 1C1TA 3M3VA 4OGXA 2XNIA 3RXLA 3RXQA 3MU4A 1GBAA 4CREA 5B6OA 3W95A 1GBCA 2FWWA 2NU3E 4I8GA 2OQUA 5JBTA 1EAUA 1FAXA 5GCHG 2SNVA 2XC0A 1FPHH 3ZZ6A 4DT7B 4PROA 1C1UH 4OS5A 2FOCA 1O2VA 4OS6A 2Z3EA 1FY1A 1TMTH 1RGQA 2G00A 1F5RA 3PMBB 1O2JA 5CHAB 1GGDB 1V2KT 2A31A 4NA9H 3FP8E 1ZTKA 2ZP0H 3H7TA 4ASHA 2FI3E 1Z6JH 3QZRA 3BG4B 1GJDB 3OY5U 2WPLS 3TH3H 4X6PA 1SHYA 2ZHEH 1W14U 1S81A 2DUCA 2VIWA 4GCHG 3V0XA 2ZFSA 4AX9H 5EQSA 1EB1H 5JB9S 1DDJA 1O2IA 5C1UA 1HAXB 1P12E 1NFXA 3NUMA 4OS4A 1DSTA 2OC0A 2A4OA 1QB6A 1O37A 2FI4E 1WU1A 1TPPA 3BTHE 1OP2A 9ESTA 4AZ2B 1Z8IB 3LGYA 5AHGH 2ILNA 1ZLRA 3UWIA 2ZU2A 1NS3A 1MZDA 5CMXH 3GCOA 2V3OH 3IG6B 3SU6A 2Y7ZA 3E91A 4K2YA 2PHBA 3CENA 2ZCKP 5A8ZA 4ZHMU 2G81E 1K1JA 3R0FA 2CJIA 1JMOH 3T62A 4A6LA 3A8DA 4X6OA 1ANBA 3SV6A 3MNBA 3SORA 1LVYA 1AGJA 5HYOA 3EGKH 3RXDA 4Y7BA 1XVMA 3DA9B 1Y3WA 3DT0H 1O2LA 3UREA 2ZGHA 2FIRH 1C1QA 2OC8A 3RC5A 2Z7FE 1MKXK 1GMCF 1WV7H 1C5WB 1GI5A 4Y79A 4MPXA 2UWPA 1V2JT 1CHOF 2ZHFH 5EW1H 1IHSH 1CHGA 2OCVB 1FY3A 2FOGA 3OU0A 3ITIA 5T3HA 3JZ2B 1FXYA 1AFQB 4NZLA 2G4TA 1PQAA 1RRKA 2BDCA 3LGTA 1MUEB 4UFDH 5EOKA 3RDZA 4CRBA 4MNVA 1SFQB 2SGDE 3DUXH 1G3BA 4ABIA 1CBWB 4CBOA 3GISB 1C1PA 3HK3B 6ESTA 4OS7A 3TNTA 2WPHS 1K1MA 3M5MA 1VGCC 1BQYA 3A7YA 3MU8A 4X6NA 4VGCC 1LKBA 3PMHB 3TPIZ 1NRQH 1MCTA 3GICB 1KDQA 1DOJA 1UTOA 5HM2A 3T28A 2FYRA 4Y7AA 3HGPA 4D7GA 1WQSA 2FMJA 2FYQA 1AVXA 1ZZZA 2ZQ2A 2EA3A 1F5KU 1AE5A 1O31A 3A7VA 2Z6BD 2FM2A 2HGTH 3SNAA 1SGFG 1GI9B 2XBXA 4WXVA 3ZV9A 5DP5A 5J4SA 5FAHA 1IHTH 2BD7A 1BCUH 2ZGXH 2ZWLH 1P2QA 5CE1A 3SBKA 3SJOA 2BDGA 3MTYA 2OQ5A 1HUTH 1HAGE 1J8AA 2NWNA 3GY3A 4NGAH 4UFGH 2ZTYA 2FOBA 2RDLA 4ZH8A 3B8JA 3ZVDA 1V2WT 3BTWE 1WBGB 2PGBB 1MU8B 1L2EA 4K8BA 1YKTA 3O8RA 2ZTZA 4YO9A 5EODA 4B76A 3I77A 4GLYA 1V2VT 2FESH 1ELDE 4RKJB 1CO7E 1O3MA 3FVFB 3LOXA 3SQEE 2A4RA 3MO3A 3AK5A 1N1LA 3PLKA 5HM9A 1NC6A 5ABWA 1G37A 3AAVA 1SGNE 1NFWA 8KME2 1EASA 1Y3XA 2GCHG 3ODFA 3VXFH 2QF0A 1TONA 4JK5A 5K0HA 1XUGA 1ZOMA 1MU6B 1EB2A 2XTTB 4X2WA 3PYHA 4FU7A 2BOKA 1BBRH 6CHAC 2OP9A 3FP6E 1Q3XA 1WCZA 2FP7B 2A45B 1CGHA 1L1JA 1TGTA 1P3EA 2ESTE 1AO5A 1O2TA 2Z9LA 1QQ4A 1EOLA 3BTGE 2TGAA 2ZEBA 3PLBA 5E2OA 5GPIB 3LJJA 2K1QA 2SGAA 1FN6A 1TAWA 3A88A 2GV6A 2C8WB 5G4BA 1LKAA 6GCHG 2A2QH 1LTOA 1KXBA 1LHEH 1ZHRA 2IN2A 2ZCHP 2R2WU 1GJ6A 1HRTH 1G3CA 1AMHA 1DY9A 2CMYA 1EZXC 2BQWB 2ZDLA 2BTCE 1HAPH 4JZEH 1SGPE 3MFJA 2PKAB 3UOPA 2GDEH 1C1WH 4O3TA 2RA3A 4BXSA 2V35A 3ZZAA 1SB1H 1FI8A 3E6PH 1YPLH 1BOQA 1BBRK 4HZHA 2P3TB 1C1OA 3QGJA 1ARCA 1ETSH 4MQAA 4WMFA 2CF8H 2QXIA 1O2XA 5T6FA 4IC6A 4NWLA 1ETTH 5EXNA 5F8ZA 3P8FA 3UIRA 1FAKH 4CRAA 1OXGA 3QWCH 1TALA 3SV7A 3EA9A 1LVMA 2PTNA 3A82A 5JB8S 2A7HA 4YLQH 2IOTA 1EX3A 1GBTA 1GMCG 1HAYB 2ZDMA 4GUXA 1QRZA 2FOHA 4JZ1A 4B71A 2OD3B 4UONA 1CHOG 3OYPA 1C5TA 3RC4A 4DVAU 2QIQA 2STAE 1S0QA 1WQVH 2BY9X 1GJ8B 3RXMA 3AVZA 3QN7A 1AKSA 4ZHLU 1GBLA 4ABFA 2WHXA 1AZZA 4GPGA 4XBBA 3SI4H 1V2QT 1P9SA 2ZZUH 2XYAA 1ETRH 6LPRA 2ZECA 1GBFA 4I8JA 3NXPA 2W3KA 3BEFB 3TK5A 3RU4T 1F0RA 2QXHA 1G9IE 1ZPZA 1FONA 4ZROA 2Z9KA 1A5HA 3UOUA 2O8LA 5EPNA 1OX1A 1P2KA 2PSXA 1YPHC 1O32A 3BG8A 2ZFFH 3M5OA 3M3SA 4Z0KA 1LHGH 2ZDKA 1NTPA 1TX6A 3MNSA 1FIZA 5GWZA 5DG6A 4D9RA 3C1KA 5C2ZA 2OUAA 1ABJH 3VXEH 2Z94A 4FUBA 4CRGA 5DP4A 4E7NA 1PPZA 2WPIS 1MAXA 3GY8A 3EE0B 1QL7A 4R0IA 3ATWA 1DS2E 2GT8A 2PR3A 3A8CA 1LQEA 2ZHQH 1LHDH 3SUGA 2QN5T 2DE8A 3RU4D 4CHAB 8ESTE 1GHAF 2H9TH 2XWBI 4Y76A 4AG1A 3ZZBA 1L4DA 2PUQH 1UTJA 3BN9A 1P05A 1HAVB 3MO6A 1GI1A 3LGUA 1V6DA 1O2WA 2BY7X 2V0BA 3DHKH 3UY9A 3BTFE 5DP9A 1O5FH 4LZ4B 1NN6A 2H5DA 5F6MA 1OS8A 4YM9A 3CP7A 1IOEA 1FIWA 2P59A 3U9AH 5I46H 3OX7U 1TNHA 1HDTH 4XSKU 2G52A 3GDVA 3LPRA 1FPCH 3RXAA 5JBCS 3HK6B 1O2NA 3SO3A 1P01A 4JZIA 4HGCA 2P3UB 1P2NA 1FY8E 4NSYA 2OLGA 3HKJB 4UFEH 7KMEH 1J17T 1NU7B 1B0EA 1V2MT 1GMDF 4X1NU 2BX3A 5B6LA 1QTFA 1TGSZ 2FTMA 1TMBH 2H9EH 3GY7A 1GCTC 3T29A 2O8TA 1T4UH 1O5GH 1O3PB 1CVWH 1GBDA 1ELTA 1HIAB 3RXSA 1XKBC 1C2JA 1TOCB 4DIIH 1O5BB 1TFXA 2G5NA 5JPMH 3RM0H 3UNQA 1Z1IA 1H9IE 4IN2A 4TPYA 4B2CA 1SGEE 3CS7A 4IMQA 2JETB 2UWOA 1KTSB 1T8MA 3NPSA 4QT8C 1W2KH 2UUKB 3RXEA 4IW4E 3I78A 1GDNA 2A4GA 1O3HA 1OWDA 3UWJH 1GMHF 1HJAB 1V2PT 1O0DH 2AIQA 1TNIA 1U6QA 2F9NA 1SLVB 2AYWA 4DG4A 2WINI 1TABE 1O3KA 2PLXA 1HB0B 3K9XB 4O97A 3RM2H 5A8YA 1ESAA 1GWAA 3P70B 3QTOH 5TJXA 3WY8A 4TWYA 1BTXA 1ELFA 1EAWA 3B9FH 1QCPA 4A92A 1Z7KA 3SV2H 1QQUA 1UVTH 1Z1JA 2RCEA 2J34A 1Y8TA 1TNJA 2VVCA 4XBCA 1C5VA 5GIBA 1QJ1B 1O2GH 3BTDE 3BTME 4Y8YA 2PKSC 1SHHB 3SJKA 4AFZA 1TLDA 3SU2A 3RMMH 2A5KA 2GMTC 1SGIB 2FOFA 1A61H 1O39A 3M7QA 3NCLA 3OTJE 1CGIE 5E8EH 3SNCA 2AH4X 1Z6EA 1AB9B 1DWEH 1IQIA 2F83A 2BQ6B 4MVNA 2VIDA 2XW9A 1RTLA 2H2ZA 2SGQE 3GY4A 1SLXB 2C93B 2GZ9A 1ANDA 5SGAE 1H1BA 2F9VA 2PKSB 1GI2A 2P16A 1BMMH 1P09A 1GHVH 1EKBB 1LPGB 1O2ZA 2FOEA 2ZFQH 5BRRE 2QYIA 5E0GA 4B1TA 1GBHA 4IS5A 2BXUH 1V2NT 4M9FA 1ZRKA 1GI7B 3TH4H 1PYTC 1YYY1 2HNTC 4WWYA 2RG3A 1B0FA 2BQ7B 3HPTB 1MD7A 2ZIQH 3LC5A 1EZSC 3KQBA 3M5NA 2SFAA 1QNJA 5A8XA 5ESBA 1C2GA 4FUDA 1HLTH 1OWIA 3MH4A 1OSSA 2Y82A 4MNYA 3A7WA 4XE4A 3MU5A 1JBUH 1OWEA 2VWNA 4FUJA 3SN8A 2D2DA 5A0AE 4ZHAA 1BTZA 1Z71A 3DD2H 4MTBA 2QCYA 1A0HB 1W3CA 1OYTH 5T1VA 4A1TA 1S6HA 1UTKA 1TE0A 5LPFA 2B8OH 3K6YA 3KHVA 1PPCE 1AE8H 4FVBA 1A5GH 1P2JA 1P2IA 4BAHB 3UFAA 1C5YB 1ZJKA 2BDHA 5CHAC 3GCHB 4BANB 4YTAA 1GGDC 3LIWA 2UUJB 3TK6A 3M7TA 1JXPA 1QRXA 3BG4C 2JH5D 1V2OT 2W7UA 4INLA 2EEKA 1AIXH 1YP9A 3TVJB 1CA8B 1DPOA 2FI5E 1GHBF 1TGNA 1S83A 2VWLA 1A3BH 2OC7A 2VWOA 3KEEA 1ZTLA 2BY6X 4A1VA 3ATKA 1E38B 4J1YA 1CE5A 1J15A 4WMEA 3SZEA 2W7SA 3V12A 4Y0ZE 5DJ7A 4IMZA 1DVAH 4CBNA 4BNRA 1QL8A 3CS0A 1KTTB 4OGYA 1DANH 3RXOA 3RXJA 2VWMA 4KELA 3ZVFA 1DWBH 1SLWB 1ZJDA 2BX4A 5F8TA 1OWHA 1ABIH 3SJIA 4K5ZA 1C2FA 3TJVA 4Y10E 1RTFB 1KLIH 1GMDG 3E0PB 4CRFA 1FMGA 1BTHH 2BY5X 3P8NA 2J2UA 2EI8A 2WV4A 1BMLA 3SGAE 4Z6AH 1MKXH 1KIGH 1HBTH 1VJ9U 5TCCA 3ZYEA 1C4Y2 3KQEA 2DE9A 1DUEA 1UO6A 3ELAH 1IQGA 1C2DA 1HAZB 2ZPRA 2VVUA 1GHZA 2GZ7A 3ZZDA 1GG6B 1YM0A 9LPRA 1O3EA 1LCYA 1YPGH 1HXFH 1T8NA 1EZQA 1N8OB 1L0ZA 2ZPSA 2BZ6H 4AFUA 1VJAU 3LGWA 2GGVB 4I8HA 3RC6A 1MAYA 5C1XA 4X8TH 2QC2A 3B23B 1C5PA 1AFQC 1FLEE 1VZQH 1RS0A 3SUFA 5C3NA 2FTLE 1ELVA 1Z8RA 1O2SA 4X2YA 1CBWC 3D62A 1BZXE 4HTCH 1GI3A 2Y6TA 4R8TB 1XUFA 1JRSA 1XUHA 1Q31A 1UTLM 1PQ7A 1BBRE 2BXTH 2QY0B 4NIYA 4FUCA 1VR1H 3Q3KA 3SNEA 2XC4A 3SUDA 1KXDA 3RXGA 4D9QA 4KTCA 4FUFA 1WTHD 4DIHH 1RTKA 1K22H 1D3QB 4MPUA 1AVWA 1O2UA 3F9GA 3ATMA 3STIA 1SBWA 5FPTA 1GVZA 3SNDA 2VIPA 3URCA 2QGRA 3D23A 3BTEE 2CN0H 2LNCA 1P04A 2B5TB 2BVRH 1KLTA 1O2MA 3I29A 4K60A 5A0BA 1ELAA 2H1UA 5ESTE 7GCHF 1ZSJA 1INCA 3E16B 4BTUB 4AGKA 3M36A 1C5ZB 1O3IA 1E36B 5FBIA 2KAIB 4GAWA 2BD4A 1IQHA 4O9VA 2VIOA 3ZZ7A 2G4UA 1NO9H 1MBQA 1SGFA 3HGNA 4Y8ZA 3W94A 2CGAA 3L33A 2UUFB 1UCYK 1MMJN 1YLDA 1SR5C 2BLWA 4YOGA 1TA2A 1MD8A 5GNDA 4ZKNU 1T4VH 2BOHB 1ZRBA 4DW2U 4LK4A 1C2KA 3PO1B 4O3UA 1CSOE 3PV4A 1YCPK 4BTIB 1RFNA 4KP0A 4WH6A 2XBVA 5H4IB 3RXBA 1GJBB 3A86A 1HAHH 4WH8A 1D3TB 1SVPA 1O5CB 4ESTE 1D6RA 5C20A 1Z8GA 1GBMA 1HAOH 1NPMA 2HALA 1Y3YA 1QA0A 3MWIU 3RXPA 3S0NA 2R9PA 4AYVB 1WUNH 1A7SA 1O3FA 1C2HA 5EPYA 5GXPA 5EQQA 1TRMA 2AMPA 1GJAB 1EPTB 3Q00A 2VIVA 4ZMAH 1IQEA 1GHYH 4E7RG 1GCDA 2IJD1 2AGIX 2ZGBH 3SJ9A 2GVFA 3RU4E 2GCTB 3U98H 1TBZH 4ISLA 4UE7H 1F7ZA 1PQ8A 3VB4A 1HJ8A 3DFLA 4FVDA 3KN2A 2SGFE 1EJAA 3C27B 2LPRA 3K65B 4B74A 2FLBH 1AZ8A 4LOYH 4BAOB 2AEIH 3VB3A 4AFSA 4LXBH 2P8OB 3H7OA 2C8YB 2ZA5A 1MZAA 1FY4A 2AMQA 1GL0E 1ZHMA 4YZUA 1EOJA 5EQRA 5FX6A 1TBQH 1BHXF 4CR9A 3T5FH 1RIWB 2YNAA 3M61U 1ORFA 3RXRA 1JRTA 2ZCLP 2BY8X 4DCDA 4X8SH 1C5UA 1VCWA 3JZ1B 1GHXH 2XBWA 4JMYA 3TIUA 1X7AC 2A5AA 1UTMA 3ZZ4A 1UTQA 5PTPA 2BLOA 1WTGH 1MTNB 2NU0E 1SMFE 1CA0C 3T26A 4CH2B 1IQNA 3ZZCA 3RLWH 5IDKA 1C5RA 1NY22 3A81A
chains in the Genus database with same CATH superfamily
2ZO3H 1NZQH 3LT3A 3MH5A 3PWBA 3NK8A 4NG9H 1AQ7A 1GHWH 3RMLH 2QXJA 3RP2A 1MQ5A 1YPEH 1NFYA 4GHQA 1G3DA 5KEDA 1Y5UT 2HPQH 1XKAC 2CK3D 1FUJA 1FX0B 2PKAA 3ZVEA 5A0CA 1G2MA 4AN7A 4B75A 2A7JA 1G30B 3AW0A 3SJ8A 1IQKA 1CA0B 4B73A 1A0LA 1QBNA 3D65E 1E1QD 3QLPH 1BB0B 1QBVH 1TWXB 1Y3VA 4NA7A 1KXAA 3RMOH 1C2MA 1XX9A 1AVGH 5LH8A 3PLPA 1ZMJA 1UVPA 3M3TA 2I6QA 2R0LA 8GCHF 5FBEA 3OE7D 1CT0E 3SI3H 4JYTA 1P8VC 3HATH 2B9LA 2SNWA 1ELGA 4Q7YA 4JYVH 3SU4A 1SPJA 1K1IA 4ZXXH 2VB0A 4OM9A 1YCPM 4X2XA 3GYLB 2ZF0H 2J38A 2XBYA 2PFEA 1PFXC 2P95A 7GCHG 2ODYB 4B6EA 2BYAX 4F49A 1THPB 4I31A 1B5GH 1ZHPA 3RXTA 3KCGH 1UHBB 1EXFA 1NFUA 3P8GA 1QB9A 2F9UA 3A7TA 1LPZB 1F92A 2TGDA 1QHRB 3LH1A 4CHAC 1XM1A 1TOMH 3U8TH 3OSYA 2EI6A 1H8IH 1KLJH 4M7GA 1K28D 3EYDA 1SQRA 1ELBA 3MH6A 1Y5AT 2OC1A 3V3MA 2WPJS 2WPKS 1T7CA 5J4QA 1W13U 2AIPA 4I7YH 2AMDA 2OXSA 2J97A 1SGTA 5EU8A 1H8ED 2D1JA 1D4PB 3A7ZA 4MPVA 5JBAS 3ZVGA 2O8WA 5T6GA 1K1OA 4GHTA 2ODQA 4YXWD 1W7GH 5HGGA 4GSOA 1TPAE 4NZQA 2UWLA 3OTPA 2V3HH 1G36A 4J2YB 1KXEA 3VB5A 1W10U 2VVVA 1TA6A 3ZVBA 1TGCA 3KQ5A 4FUGA 1SGQE 1SSXA 4OS1A 4K1SA 1VCQA 2VU8E 1BHXB 3PWCA 3FAOA 4OS2A 4WXIA 2THFB 1HFDA 3O8CA 2RDEA 1NU9A 4FUIA 2P94A 2NU1E 5EGMA 1DX5M 3UTUH 1CQQA 1LVOA 2FZZA 2A7CA 1W7XH 4A1XA 4Y11E 1P03A 4X8UH 4INHA 1HAVA 3F9FA 1PPBH 4XDEA 1LHCH 2JETC 3E8LA 3TJNA 5DKMA 4DOQA 2PGQB 2HVXA 1O2PA 1SQOA 1OHHD 4U01A 4X1RU 3E90B 1HJAC 5DPAA 3QGNB 4ABAA 2KCPA 2FDAA 2VINA 2BLVA 2Y5HA 3S7HB 2AGGX 2JIZD 4ABJA 1KYNA 1LVBA 1DY8A 1M9UA 4BAKB 1MQ6A 3SU1A 1YGCH 2BD8A 1QB1A 1YPMH 2OINA 1BT7A 2HWLB 4X8VH 3U69H 3ENSB 2ZDNA 4ISHH 1BUIA 2C90B 4JK6A 3W1EA 4K1EA 1F0SA 2UUYA 3TJOA 3DCLA 4AOQA 4JZDH 2ANMH 4I8KA 3M37A 3KGPA 2FS8A 3UQOA 3AW1A 3Q77A 1NBME 1GJ9B 1HIAA 1AB9C 1CU1A 1RJXB 2J5UA 1VITH 5L2YH 3GDUA 2HOBA 4U30A 1TBRH 5ETXA 5JDUB 2ZFTA 1LMWB 1O5EH 1A4WH 3P95A 2PWXA 3UAIC 1YF4A 1MH0A 3LGVA 1C1VH 3L6PA 3TGIE 2FS9A 4ABEA 1C5XB 2ZU5A 1TNKA 3ODDA 4XBDA 2G8TA 2A5IA 4NFEA 3BF6H 1SG8B 1FZZA 1N6XA 2HPPH 2RA0A 3PMAB 3ZZ3A 1E0FD 1F5LA 1BTYA 1O2OA 8GCHG 1MBMA 1S82A 3FANA 2K8IA 3UUZA 3FP7E 1VCPA 1XUJA 4YOIA 2QF3A 3A89A 2Y5FA 2WYGA 3A80A 3MU0A 5GJ4B 1V2UT 1IQLA 1GBJA 5F03A 1BTPA 4ISIH 2ZU3A 2A1DB 1UTNA 1TIOA 1TQ7B 3LDXH 1AUTC 2BD2A 3QDZB 4FUHA 1QR3E 2L6OA 1ACBE 1F0TA 2A0QB 3ATLA 3EDXB 1C5MD 2F9PA 2Z3CA 5I25A 5C5OA 2IPHA 2ZU1A 3V13A 3Q3YA 3D49H 1C1MA 2GDDA 2L74A 1C1RA 1ID5H 3OAAD 3S9BA 1FNIA 3UB0A 3RUOA 3VEQB 2VIQA 2Q1JA 3GCHC 1VITF 1SQAA 3SHCH 7ESTE 4K69A 3F9EA 5F8XA 2GKVE 1C2IA 1ZTJA 3MOCA 3GCNA 1XVOA 5FX5A 1A0JA 3LONA 3E1XB 3RXKA 3KF2A 1V2TT 2F9BH 3OEED 1SGDE 1XXFA 4F48B 1OKXA 1PQ5A 4BXWA 3SUEA 2ZDAH 2W3IA 1K0HA 1EFRD 1GVLA 1P02A 1BA8B 5AFYH 1N6YA 3SZNA 3U1IB 1UCYE 1HXEH 1NRPH 4IBLH 3PB1E 1NESE 1GHAG 1DFPA 1O2HA 2O8MA 2ZQ1A 1C5QA 2EY4C 3RXVA 1XXDA 3SYJA 1AUJA 3FZDA 1DWDH 2GD4B 5FL7D 3MMGA 1E34B 2GX4A 1ZGVA 5FHTA 3IWMA 2R3UA 2WV9A 2XNDD 1IAUA 5A2MH 1EAXA 1HV7A 2VH6A 1IQJA 4Y8XA 1O3CA 4JYUH 3SGQE 4BAQB 1OWJA 1SC8U 1AHTH 3U1JB 1SGRE 4IGDA 4ISNA 3FZZA 1C2LA 1O2KA 4H4FA 2JH6D 4ABBA 4TYDA 1QURH 1O5AB 2GCHF 2J94A 1FDPA 2ULLA 5IYTA 2V3MA 3QTVH 1AU8A 2WZQA 3KNXA 2HLCA 2QXGA 4MDSA 1BRCE 4Y71A 1F0UA 1T8OA 2W5EA 2Q6GA 4X1QU 1BIOA 1BRBE 1GG6C 3L3TA 3N7EA 5C67A 1SOTA 3UQVA 3DFJA 3MNXA 5DP3A 5FCKA 4NWKA 4K8YA 3BSQA 1GI0A 1YPHE 2OBQA 1D3DB 3LJOA 3V7TA 1N8OC 3PV5A 2ZHDA 2ZG0H 2PUXB 1UVOA 1H9HE 1YC0A 1V3XA 1C1NA 1Y3UA 2BD9A 1HGTH 3TJUA 2TGTA 4HFPB 4X1PU 2CF9H 3TNSA 1K21H 3UNRA 1RXPA 4H6SB 3STJA 3F0OA 2ZGJA 5LGOA 4Q80A 2FOAA 5C17A 1C5OH 6GCHF 4MG3A 5DSFA 3VPKA 3BTTE 3MNCA 1C1SA 4A5TS 2G5VA 3N99A 4DGJA 2XWAA 3PMJA 4AB9A 2SGPE 5E2PA 3UPEA 1GMHG 3BTKE 5KECA 4NIXA 1LQDB 1A2CH 1YPJH 1P11E 1EATA 1C9TA 2FODA 2Z9IA 3T25A 1QGFA 2FOMB 1HPGA 3MU1A 2BDAA 1DWCH 2I6SA 2C8ZB 1C5LH 2H6MA 1P2OA 1PPEE 2K0QA 2ODPA 5HKKD 2HVYB 5JYIA 3UNSA 1TPOA 2FLRH 3PTNA 4X2VA 2ZC9H 2W26A 3GY2A 1BDAA 1BMNH 3MYWA 1GJ4H 1NM6A 1OOKB 1WAYB 1HNEE 5DP7A 2KCYA 4Z1MD 1LHFH 1UCYH 3A84A 2G51A 1WSSH 5E0JA 1DLKB 2WYJA 1QA7A 2Y80A 1S84A 1ZMLA 3ATIA 4ABGA 2CHAC 5FPSA 3E3TA 4Q2KA 1QFKH 1G2LA 1DM4B 1PPGE 4ABHA 1KXFA 1TRNA 4B2AA 1JIMA 3ZIAD 2VJ1A 1KDQB 1UVSH 3M7UA 3GS9A 3A8BA 3QK1A 2F9OA 1YCPH 2FXRA 4RN6A 4IN1A 2C8XB 4FUEA 5BPEA 3A85A 2VNTA 4CH8B 4D8NA 1SFIA 1TMUH 1O34A 2ZGCA 4ZKOU 2B0FA 3HKIB 1EZUC 1THRH 1ZR0A 3BIUH 3PO1C 1AD8H 3SGBE 4DJZB 2CHAB 3RXFA 1EP6A 1O2QA 2NU2E 5L2ZH 3EA7A 3ZVCA 4D76A 1O33A 8LPRA 3PM3A 2OBOA 4AGJA 4F4OC 1BMAA 1RD3B 4FXGH 1AY6H 1BRUP 4Q7ZA 5LPRA 1VITG 1Y5BT 2PTCE 1AN1E 1XUKA 1ARBA 2H5CA 1EJMA 3UR6A 1WXRA 1E37B 2C4FH 1VKYA 2RFKC 2YNBA 1L1GA 4UDWH 1LDTT 4X6MA 4THNH 4D7FA 1J16A 1EPTC 5EW2H 1MTUA 1H9LB 1VGCB 2KAIA 4E05H 4VGCB 5DK1A 3U8RH 2XCNA 1G3EA 1S6LA 3SU3A 1EQ9A 1C9PA 2CXVA 2BMGB 4I33A 4IC5A 4XOJA 1LO6A 2GCTC 3VB7A 5HMAA 1T32A 1FJSA 5DP8A 1FY5A 2IPQX 4AB8A 2ANKH 1OPHB 2FX6A 3M5LA 3F3BA 1P0SH 1GJ5H 2QA9E 2P8OC 1H8DH 3FFGA 1K1PA 2XRCA 2ZDVH 2ALVA 4U2WA 3SW2B 2AS9A 1ZPBA 3LGIA 1GHBG 1OWKA 1A5IA 2JJ1D 1UJ1A 2H9HA 1BITA 4B2BA 1Z8JB 2YMSB 3LH3A 1RIWC 1O38A 3SV8A 2NU4E 3E0NB 4WJG2 1GJCB 1V2LT 2KCAA 1O2YA 7LPRA 1D6WA 1SI5H 2JH0D 2Y5GA 1JWTA 3QO6A 2HNTE 1O35A 4RI0A 2ZU4A 1EPTA 4Y6DA 1QJ6B 1NT1A 4UD9H 3VGCC 1GDUA 5TCAA 2FX4A 1ESBA 1A46H 1MTNC 1QIXB 2ZI2H 3RXUA 4AG2A 4UFFH 4I32A 2Y81A 1EJNA 3RXCA 1C2EA 1W0YH 3SU5A 4I8LA 4AORA 1TX8A 5EG4A 3GY5A 2ALPA 2R2MB 2WUBA 3IITA 1UK3A 2BDBA 1YLNA 1GPZA 2QV1A 4TPIZ 1S6FA 3OY6U 3BEUA 2YOLA 1GI8B 2TBSA 3F9HA 3Q76A 4HI3A 3VGCB 3MH7A 3ZV8A 4DY7B 4WY3A 2F91A 4YT7H 1SGCA 3F2FA 3F68H 3WWFA 2Q6DA 1ELEE 1ANEA 2A4QA 2O9QA 1C5NH 6CHAB 5IK2D 3TH2H 1GI6A 1EP5A 3P17H 4K1TA 2BD3A 1MCVA 3K6ZA 1TPSA 2VBCA 2AGEX 2BB4A 4GVUA 1LPKB 3H5CB 3T27A 2KFWA 2M2AA 1FN8A 4B6FA 1OP8A 2AFQB 1D3PB 4RT1A 1XMNB 3S9AA 3AASA 3A8AA 3TGJE 5C1YA 1T31A 4KTSA 2ASUB 1AKSB 1SGYE 2FO9A 4YLUA 4E06H 2C3SA 1CT4E 1D9IA 2PSYA 2ZFRH 2BD5A 1KXCA 3A7XA 2BHGA 2D26C 1O3OA 1P2MA 3R3GB 4JZFH 1AWFH 3BEIB 4ZAEA 1ZSKA 2GTBA 3GCTF 2BLQA 3SV9A 4NSVA 5F53A 3TITA 1IQFA 2GV7A 2KCOA 5EXLA 3N7OA 1P9UA 1J9CH 2A2XH 4ZUHA 1O3NA 2B7DH 5EJLA 3PROA 4CRCA 3K2UA 2ZFPH 4U32A 4TY6A 1KMHB 4MLFB 5EXMA 1TGBA 5GDSH 3RXIA 1QL9A 5C5NA 3RMNH 1EUFA 2JKHA 3SOSA 2Z9JA 1HJ9A 4UEHH 2EC9H 2ANWA 1C4U2 1SOZA 1XUIA 1F2SE 1MKWH 3ZYDA 3PTBA 3P6ZB 1GBEA 1ANCA 4WVPE 1HYLA 3BV9B 1AI8H 1JIRA 1P57B 1P3CA 4MPWA 4KKDA 2J92A 1W11U 3S7KB 1AWHB 1P10A 4ZKSU 2ANYA 4MNXA 3UR9A 3TK9A 2WPMS 4Q63A 4XFQA 1UHBA 1MTSA 2STBE 4X1SU 1GBKA 1NRSH 2AHME 1GJ7B 1V2ST 3F1SB 1AFEH 2A32A 2ZNKH 4SGBE 5DP6A 1ZYOA 1NROH 4RKOB 1CT2E 3VFEA 2M5TA 3URDA 3AAUA 3SNBA 4ZKRU 1FQ3A 3T2NA 1GDQA 1TNLA 1O2RA 3S69A 2PW8H 2WUCA 2VH0A 3ZZ8A 4K3JA 3ZZ5A 5L30H 1PYTD 1DXWA 1TQ0B 1L4ZA 2GP9B 1MKWK 3ESTA 2XC5A 3NWUA 4ISOA 2F4LA 1TRYA 1W12U 4YESB 1K1NA 1Y59T 3A83A 3QX5H 1UTPA 2BDYA 1EAIA 5GCHF 4Q7XA 1DICA 1WYKA 3MHWU 1DXPA 1DT2A 3EQ0H 4TWWA 5A09A 3P8OA 1SQTA 1A3EH 4INKA 2HNTF 2HRVA 3RLYH 2BVSH 3WW7A 2V6NA 1MTWA 3G01A 4I86A 2J4IA 2SGEE 4Y0YE 2FEQH 5T6DA 3EA8A 4KTUA 5FPYA 1THSH 5LPEA 1HAIH 1C5SA 1TNGA 4WMDA 1O3JA 3KIDU 1CGJE 1UK4A 5DO4H 2TRMA 1NRRH 4GCHF 1L1NA 2D8WA 1UVUH 3Q3XA 1W0KD 1W0ZU 3TLOA 1KSNA 4WF8A 1GI4A 1NRNH 4YT6H 1ZPCA 4BTTB 2OK5A 4ABDA 1A1RA 1QBOA 1ZGIA 3SHAH 3GOVB 2R3YA 3RXHA 2IJOB 1BJUA 3GYMA 1Q2WA 1QY6A 1H4WA 1UMAH 1J14A 1HCGA 4NFFA 4RSPA 1ESTA 1PPHE 4SGAE 4AFQA 4MNWA 5DN6D 1DE7H 2FPZA 3ZZ9A 2V7QD 5HXFA 1KY9A 4CRDA 1P06A 4O03A 1GL1A 1G32B 1WOFA 3LC3A 3SU0A 4KGAA 3LU9B 1MTVA 5AF9H 1ZMNA 3U8OH 5EJZA 2TIOA 2XXLA 3VG8A 1GCTB 1O3BA 1BRAA 2GJGA 1YY3A 3QUMP 2GT7A 1QRWA 1GBIA 5AFZH 5K7RA 1O30A 1K9OE 4BAMB 1S5SA 1OP0A 1O36A 1GBBA 1SL3A 2R0KA 4FU8A 2J95A 4YOJA 5AVDA 5JBBS 2BM2A 4BOHA 1DITH 4CR5A 3GCTG 3MQKC 4H42U 2Z9GA 1PPFE 3O8DA 5FXLA 1OYQA 2EI7A 4NA8A 4X0WU 2HLDD 5FCRA 1K1LA 2J9NA 3ZVAA 2AERH 3KQCA 5L6NH 2BZAA 4JCNA 1E35B 2Y7XA 4A7IB 2ZKSA 4ZCNA 2F3CE 1BTUA 1IQMA 2WV5A 2ZHWH 3CNRA 3F6UH 3SQHE 4TY7A 4NIVA 3BIVH 3PV2A 1TB6H 5DGJA 1O3GA 3GY6A 1O3LA 1SLUB 2ZPQA 3EAJA 3LKWA 2O8UA 3M35A 3MI4A 1W8BH 3S9CA 4NCYA 2GMTB 1O3DA 1S0RA 1PJPA 1JOUB 3H09A 1S85A 1FV9A 2VGCC 3A87A 2ZTXA 4H6TA 3KQDA 1GVKB 4FOUC 2P3FH 2QAAA 3GDSA 1TYNA 1ZSLA 3TGKE 1ELCA 2XCFA 3KL6A 1O5DH 4DURA 1DUAA 4DT4A 1YLCA 2PV9B 1DLEA 4LZ1H 4AYYB 1DSUA 1T8LA 2BDIA 1YPKH 2TGPZ 5E0HA 4ZXYH 1O3AA 3OFND 2GZ8A 1QJ7B 2TPIZ 2BVXH 1K2I1 2CV3A 1E79D 1BMFD 1TX7A 3BTQE 3P92A 2VGCB 4FU9A 3NKKA 2OTVA 2G55A 2Q6FA 3O8BA 3QZQA 3TU7H 2P93A 1UK2A 1YBWA 2W6JD 2Z3DA 3VB6A 1C4V2 3MO9A 4NIWA 1BJVA 3NZIA 1V2RT 1BTWA 1B7XB 1C1TA 3M3VA 4OGXA 2XNIA 3RXLA 3RXQA 3MU4A 1GBAA 4CREA 5B6OA 3W95A 1GBCA 2FWWA 2NU3E 4I8GA 2OQUA 5JBTA 1EAUA 1FAXA 5GCHG 2SNVA 2XC0A 1FPHH 3ZZ6A 4DT7B 4PROA 1C1UH 4OS5A 2FOCA 1O2VA 4OS6A 2Z3EA 1FY1A 1TMTH 1RGQA 2G00A 1F5RA 3PMBB 1O2JA 1YWUA 5CHAB 1GGDB 1V2KT 2A31A 4NA9H 3FP8E 1ZTKA 2ZP0H 3H7TA 4ASHA 2FI3E 1Z6JH 3QZRA 3BG4B 1GJDB 3OY5U 2WPLS 3TH3H 4X6PA 1SHYA 2ZHEH 1W14U 4XD7D 1S81A 2DUCA 2VIWA 2QE7D 4GCHG 3V0XA 2ZFSA 4AX9H 5EQSA 1EB1H 3FN8A 5JB9S 1DDJA 1O2IA 5C1UA 1HAXB 1P12E 4XRNA 5HIYA 3WWBA 1NFXA 3NUMA 4OS4A 1DSTA 2OC0A 2A4OA 1QB6A 2F43B 1O37A 2FI4E 1WU1A 1TPPA 3BTHE 1OP2A 9ESTA 4AZ2B 1Z8IB 3LGYA 5AHGH 2ILNA 1ZLRA 3UWIA 2ZU2A 1NS3A 1MZDA 2KR7A 5CMXH 3GCOA 2V3OH 3IG6B 3SU6A 2Y7ZA 3E91A 4K2YA 2PHBA 3CENA 2ZCKP 5A8ZA 4ZHMU 2G81E 1K1JA 3R0FA 2CJIA 1JMOH 3T62A 4A6LA 3A8DA 4X6OA 1ANBA 5EJ1A 3SV6A 3MNBA 3N7DA 3SORA 1LVYA 1AGJA 5HYOA 3EGKH 3RXDA 4Y7BA 1XVMA 3DA9B 1Y3WA 3DT0H 1O2LA 3UREA 2ZGHA 2FIRH 4ASUD 1C1QA 2OC8A 3RC5A 2Z7FE 1MKXK 1GMCF 1WV7H 1C5WB 1GI5A 4Y79A 4MPXA 2UWPA 1V2JT 1CHOF 2ZHFH 5EW1H 1IHSH 1CHGA 2OCVB 1FY3A 2FOGA 3OU0A 3ITIA 5T3HA 3JZ2B 1FXYA 1AFQB 4NZLA 2G4TA 1PQAA 1RRKA 2BDCA 3LGTA 1MUEB 4UFDH 5EOKA 3RDZA 4CRBA 4MNVA 1SFQB 2SGDE 3DUXH 1G3BA 4ABIA 1CBWB 4CBOA 3GISB 1C1PA 3HK3B 6ESTA 4OS7A 3TNTA 2WPHS 1K1MA 3M5MA 1VGCC 1BQYA 3A7YA 3MU8A 4X6NA 4VGCC 1LKBA 3PMHB 3TPIZ 1NRQH 1MCTA 3GICB 1KDQA 1DOJA 1UTOA 5HM2A 3DSGA 3T28A 2FYRA 4Y7AA 3HGPA 4D7GA 1WQSA 2FMJA 2FYQA 1AVXA 1ZZZA 1WDIA 2ZQ2A 2EA3A 1F5KU 1AE5A 1O31A 3A7VA 4F55A 2Z6BD 2FM2A 2HGTH 3SNAA 1SGFG 1GI9B 2XBXA 4WXVA 3ZV9A 2J98B 5DP5A 5J4SA 5FAHA 1IHTH 2BD7A 1BCUH 2ZGXH 2ZWLH 1P2QA 5CE1A 3SBKA 3SJOA 2BDGA 2YMSC 2W6ID 3MTYA 2OQ5A 1HUTH 1HAGE 1J8AA 2NWNA 4P02A 3GY3A 4NGAH 4UFGH 2ZTYA 2FOBA 2RDLA 4ZH8A 3B8JA 3ZVDA 1V2WT 3FKSD 3BTWE 1WBGB 2PGBB 1MU8B 1L2EA 4K8BA 1YKTA 3O8RA 2ZTZA 4YO9A 5EODA 4B76A 3I77A 4GLYA 1V2VT 2FESH 1ELDE 4RKJB 1CO7E 1O3MA 3FVFB 3LOXA 3SQEE 2A4RA 3MO3A 3AK5A 1N1LA 3PLKA 5HM9A 1NC6A 5ABWA 1G37A 3AAVA 5HIZA 1SGNE 1NFWA 8KME2 1EASA 1Y3XA 2GCHG 3ODFA 3VXFH 3OEHD 2QF0A 3DSPA 1TONA 4JK5A 5K0HA 1XUGA 1ZOMA 1MU6B 1EB2A 2XTTB 4X2WA 3PYHA 4FU7A 4FETA 2BOKA 1BBRH 6CHAC 2OP9A 3FP6E 1Q3XA 1WCZA 2FP7B 2A45B 1CGHA 1L1JA 1TGTA 1P3EA 2ESTE 1AO5A 1O2TA 2Z9LA 5CHBA 1QQ4A 1EOLA 3BTGE 2TGAA 2ZEBA 3PLBA 5E2OA 5GPIB 3LJJA 2K1QA 2SGAA 1FN6A 1TAWA 3A88A 2GV6A 2C8WB 5G4BA 1LKAA 6GCHG 2A2QH 1LTOA 1KXBA 1LHEH 1ZHRA 2IN2A 2ZCHP 2R2WU 1GJ6A 1HRTH 1G3CA 1AMHA 1DY9A 2CMYA 1EZXC 2BQWB 2ZDLA 2BTCE 1HAPH 4JZEH 1SGPE 3MFJA 2PKAB 3UOPA 2GDEH 1C1WH 4O3TA 2RA3A 4BXSA 2LP6A 2V35A 3ZZAA 1SB1H 1FI8A 3E6PH 1YPLH 1BOQA 1BBRK 4HZHA 2P3TB 1C1OA 3QGJA 1ARCA 1ETSH 4MQAA 4WMFA 2CF8H 2QXIA 1O2XA 5T6FA 4IC6A 4NWLA 1ETTH 5EXNA 5F8ZA 3P8FA 3UIRA 1FAKH 4CRAA 1OXGA 3QWCH 1TALA 3SV7A 3EA9A 1LVMA 2PTNA 3A82A 5JB8S 2A7HA 4YLQH 1SKYE 2IOTA 1EX3A 1GBTA 1GMCG 1HAYB 2ZDMA 4GUXA 1QRZA 2FOHA 4JZ1A 4B71A 2OD3B 4UONA 1CHOG 3OYPA 1C5TA 3RC4A 4DVAU 2QIQA 2STAE 1S0QA 1WQVH 2BY9X 1GJ8B 3RXMA 3AVZA 3QN7A 1AKSA 4ZHLU 1GBLA 2WHXA 4ABFA 1AZZA 4GPGA 4XBBA 3SI4H 1V2QT 1P9SA 2ZZUH 2XYAA 1ETRH 6LPRA 2ZECA 2WSSD 1GBFA 4I8JA 3NXPA 2W3KA 3BEFB 3TK5A 3RU4T 1F0RA 2QXHA 1G9IE 1ZPZA 1FONA 4ZROA 2Z9KA 1A5HA 3UOUA 2O8LA 5EPNA 1OX1A 1P2KA 2PSXA 1YPHC 2JJ2D 1O32A 3BG8A 2ZFFH 3M5OA 3M3SA 4Z0KA 1LHGH 2ZDKA 5KGOA 1NTPA 1TX6A 3MNSA 1FIZA 5GWZA 4AC9A 5DG6A 4D9RA 3C1KA 5C2ZA 2OUAA 1ABJH 3VXEH 2Z94A 4FUBA 4CRGA 5DP4A 4E7NA 1PPZA 2WPIS 1MAXA 3GY8A 3EE0B 1QL7A 4R0IA 3ATWA 1DS2E 2GT8A 2PR3A 3A8CA 1LQEA 2ZHQH 1LHDH 3SUGA 2QN5T 2DE8A 3RU4D 4CHAB 8ESTE 1GHAF 2H9TH 2XWBI 4Y76A 4AG1A 3ZZBA 5C0UA 1L4DA 2PUQH 1UTJA 3BN9A 1P05A 1HAVB 3MO6A 3PRBA 1GI1A 3LGUA 1V6DA 1O2WA 1COWD 2BY7X 2V0BA 3DHKH 3UY9A 3BTFE 5DP9A 1O5FH 4LZ4B 1NN6A 2H5DA 5F6MA 1OS8A 3F2HA 4YM9A 3CP7A 1IOEA 1FIWA 2P59A 3U9AH 5I46H 3OX7U 1TNHA 1HDTH 4XSKU 2G52A 3GDVA 3LPRA 1FPCH 3RXAA 5JBCS 3HK6B 1O2NA 3SO3A 1P01A 4JZIA 4HGCA 2P3UB 1P2NA 1FY8E 4NSYA 2OLGA 3HKJB 4UFEH 1H8HD 7KMEH 1J17T 1NU7B 1B0EA 1V2MT 1GMDF 4X1NU 2BX3A 5B6LA 4RT0A 1QTFA 1TGSZ 2FTMA 1TMBH 2H9EH 3GY7A 1GCTC 3T29A 2O8TA 1T4UH 1O5GH 2WPDD 1O3PB 1CVWH 1GBDA 1ELTA 1HIAB 3U28C 3RXSA 1XKBC 1C2JA 1TOCB 4DIIH 1O5BB 3NRLA 1TFXA 2G5NA 5JPMH 3RM0H 3UNQA 1Z1IA 1H9IE 4IN2A 4TPYA 4B2CA 1SGEE 3CS7A 4IMQA 2JETB 2UWOA 1KTSB 1T8MA 3NPSA 4QT8C 1W2KH 2UUKB 3RXEA 4IW4E 3I78A 1GDNA 2A4GA 1O3HA 1OWDA 3UWJH 1GMHF 1HJAB 1V2PT 1O0DH 2AIQA 1TNIA 1U6QA 2F9NA 1SLVB 2AYWA 2XOKD 4DG4A 2WINI 1TABE 1O3KA 2PLXA 1HB0B 3K9XB 4O97A 3RM2H 5A8YA 1ESAA 1GWAA 3P70B 3QTOH 5TJXA 3WY8A 4TWYA 1BTXA 1ELFA 1EAWA 3B9FH 1QCPA 4A92A 1Z7KA 3SV2H 1QQUA 1UVTH 1Z1JA 2RCEA 2J34A 1Y8TA 1TNJA 2VVCA 4XBCA 1C5VA 5GIBA 1QJ1B 1O2GH 3BTDE 3BTME 4Y8YA 2PKSC 1SHHB 3SJKA 4AFZA 1TLDA 3KYGA 3SU2A 3RMMH 2A5KA 2GMTC 1SGIB 2FOFA 1A61H 1O39A 3M7QA 3NCLA 3OTJE 1CGIE 5E8EH 3SNCA 2AH4X 1Z6EA 4ACAA 1AB9B 1DWEH 1IQIA 2F83A 2BQ6B 4MVNA 2VIDA 2XW9A 1RTLA 2H2ZA 2SGQE 3GY4A 1SLXB 2C93B 2GZ9A 1ANDA 4TT3D 5SGAE 1H1BA 2KZ4A 2F9VA 2P16A 1GI2A 2PKSB 1BMMH 1P09A 1GHVH 1EKBB 1LPGB 1E1RD 1O2ZA 2FOEA 2ZFQH 5BRRE 2QYIA 2PP6A 5E0GA 4B1TA 1GBHA 4IS5A 2BXUH 1V2NT 4M9FA 1ZRKA 1GI7B 3TH4H 1PYTC 1YYY1 2HNTC 4WWYA 5CDFE 2RG3A 1B0FA 2BQ7B 3HPTB 1MD7A 2ZIQH 3LC5A 1EZSC 3KQBA 3M5NA 3FO8D 2SFAA 1QNJA 5A8XA 5ESBA 1C2GA 4FUDA 1HLTH 1OWIA 3MH4A 1OSSA 2Y82A 4MNYA 3A7WA 4XE4A 3MU5A 1JBUH 1OWEA 2VWNA 4FUJA 3SN8A 2D2DA 5A0AE 4ZHAA 1BTZA 1Z71A 3DD2H 4MTBA 2QCYA 1A0HB 1W3CA 1OYTH 5T1VA 4A1TA 1S6HA 1UTKA 1TE0A 5LPFA 2B8OH 3K6YA 3KHVA 1PPCE 1AE8H 4FVBA 4ACBA 1A5GH 1P2JA 1P2IA 4BAHB 3UFAA 1QZ8A 1C5YB 1ZJKA 2BDHA 5CHAC 3GCHB 4BANB 4YTAA 1GGDC 5C94A 3LIWA 2UUJB 3TK6A 3M7TA 1JXPA 1QRXA 3BG4C 2JH5D 1V2OT 2W7UA 4INLA 2EEKA 1AIXH 1YP9A 3TVJB 1CA8B 1DPOA 4HG6A 2FI5E 1GHBF 5C0TA 1TGNA 1S83A 2VWLA 1A3BH 2OC7A 2VWOA 3KEEA 1ZTLA 2BY6X 4A1VA 3ATKA 1E38B 4J1YA 1CE5A 3KYFA 1J15A 4WMEA 3SZEA 2W7SA 3V12A 4Y0ZE 3PRDA 5DJ7A 4IMZA 1DVAH 4CBNA 4BNRA 1QL8A 3CS0A 1KTTB 2YMSD 1DANH 4OGYA 3RXOA 3RXJA 2VWMA 4KELA 3ZVFA 1DWBH 1SLWB 1ZJDA 2BX4A 5F8TA 1OWHA 1ABIH 3SJIA 4K5ZA 1C2FA 3TJVA 4Y10E 1RTFB 1KLIH 1GMDG 3E0PB 4CRFA 1FMGA 1BTHH 2BY5X 3P8NA 2J2UA 2EI8A 2WV4A 1BMLA 3SGAE 4Z6AH 1MKXH 1KIGH 1HBTH 1VJ9U 5TCCA 3ZYEA 1C4Y2 3KQEA 2DE9A 1DUEA 1UO6A 3ELAH 1IQGA 1C2DA 1HAZB 1NBMD 2ZPRA 2VVUA 3F0PA 1GHZA 2GZ7A 3ZZDA 1GG6B 1YM0A 9LPRA 1O3EA 1LCYA 1YPGH 1W0JD 1HXFH 1T8NA 1EZQA 1N8OB 1L0ZA 2ZPSA 2BZ6H 4AFUA 1VJAU 3LGWA 2GGVB 4I8HA 3RC6A 1MAYA 5C1XA 4X8TH 2QC2A 3B23B 1C5PA 1AFQC 1FLEE 1VZQH 1RS0A 3SUFA 5C3NA 2FTLE 1ELVA 1Z8RA 1O2SA 4X2YA 1CBWC 3D62A 1BZXE 4HTCH 1GI3A 2Y6TA 2QF5A 4R8TB 1XUFA 1JRSA 1XUHA 1Q31A 1UTLM 1PQ7A 1BBRE 2BXTH 2QY0B 4NIYA 4FUCA 1VR1H 3Q3KA 4Q4LA 3SNEA 2XC4A 4TSFD 3SUDA 1KXDA 1UW7A 3RXGA 3F2GA 4D9QA 4KTCA 4FUFA 1WTHD 4DIHH 1RTKA 1K22H 1D3QB 4MPUA 1AVWA 1O2UA 3F9GA 3FOAA 3ATMA 3STIA 1SBWA 5FPTA 1GVZA 3SNDA 2VIPA 3URCA 2QGRA 3D23A 3BTEE 2CN0H 2LNCA 1P04A 2B5TB 2BVRH 1KLTA 1O2MA 3I29A 4K60A 5A0BA 1ELAA 2H1UA 5ESTE 7GCHF 1ZSJA 1INCA 3E16B 4BTUB 4AGKA 3M36A 1C5ZB 1O3IA 1E36B 5FBIA 2KAIB 4GAWA 2BD4A 1IQHA 4O9VA 2VIOA 3ZZ7A 2G4UA 1NO9H 1MBQA 1SGFA 3HGNA 4Y8ZA 3W94A 2CGAA 3L33A 2UUFB 2JDID 1MABB 1UCYK 1MMJN 1YLDA 1SR5C 2BLWA 4YOGA 1TA2A 1MD8A 5GNDA 4ZKNU 1T4VH 2BOHB 1ZRBA 4DW2U 5EIYA 4LK4A 1C2KA 3PO1B 4O3UA 1CSOE 3PV4A 1YCPK 4BTIB 1RFNA 4KP0A 4WH6A 2XBVA 5H4IB 3RXBA 1GJBB 3A86A 1HAHH 4WH8A 1D3TB 1SVPA 1O5CB 4ESTE 1D6RA 5C20A 1Z8GA 1GBMA 3DSOA 2EQNA 1HAOH 1NPMA 2HALA 1Y3YA 1QA0A 2J98A 3MWIU 3RXPA 3S0NA 2R9PA 4AYVB 1WUNH 1A7SA 1O3FA 1C2HA 5EPYA 5GXPA 5EQQA 1TRMA 2AMPA 3EE7A 1GJAB 1EPTB 3Q00A 2VIVA 4ZMAH 1IQEA 1GHYH 4E7RG 1GCDA 2IJD1 2QF4A 2AGIX 2ZGBH 3SJ9A 2GVFA 3RU4E 2GCTB 3U98H 1TBZH 2KM0A 4ISLA 4UE7H 1F7ZA 1PQ8A 3VB4A 1HJ8A 3DFLA 4FVDA 3KN2A 2SGFE 1EJAA 3C27B 2LPRA 3K65B 4B74A 2FLBH 1AZ8A 4LOYH 4BAOB 2AEIH 3VB3A 4AFSA 4LXBH 2P8OB 3H7OA 2C8YB 2ZA5A 1MZAA 1FY4A 2AMQA 1GL0E 1ZHMA 2LELA 4YZUA 1EOJA 5EQRA 5FX6A 1TBQH 1BHXF 4CR9A 3T5FH 1RIWB 2YNAA 3M61U 1ORFA 3RXRA 1JRTA 2ZCLP 2BY8X 4DCDA 4X8SH 1C5UA 1VCWA 3JZ1B 1GHXH 2XBWA 4JMYA 3TIUA 1X7AC 2A5AA 1UTMA 3ZZ4A 1UTQA 5PTPA 2BLOA 1WTGH 2KX4A 1MTNB 2NU0E 1SMFE 1CA0C 3T26A 4CH2B 1IQNA 3ZZCA 3RLWH 5IDKA 1C5RA 4P00A 1NY22 3A81A
chains in the Genus database with same CATH topology
2ZO3H 1NZQH 3LT3A 3MH5A 3PWBA 3NK8A 4NG9H 1AQ7A 1GHWH 3RMLH 2QXJA 3RP2A 1MQ5A 1YPEH 1NFYA 4GHQA 1G3DA 1Y5UT 2HPQH 1XKAC 2CK3D 1FUJA 2PKAA 1FX0B 3ZVEA 5A0CA 1G2MA 4AN7A 4B75A 2A7JA 1G30B 3AW0A 3SJ8A 1IQKA 1CA0B 4B73A 1A0LA 1QBNA 3D65E 1E1QD 3QLPH 1BB0B 1QBVH 1TWXB 1Y3VA 4NA7A 1KXAA 3RMOH 1C2MA 1XX9A 1AVGH 5LH8A 3PLPA 1ZMJA 1UVPA 3M3TA 2I6QA 2R0LA 8GCHF 5FBEA 3OE7D 1CT0E 3SI3H 4JYTA 1P8VC 3HATH 2B9LA 2SNWA 1ELGA 4Q7YA 4JYVH 3SU4A 1SPJA 1K1IA 4ZXXH 2VB0A 4OM9A 1YCPM 4X2XA 3GYLB 2ZF0H 2J38A 2XBYA 2PFEA 1PFXC 2P95A 7GCHG 2ODYB 4B6EA 2BYAX 4F49A 1THPB 4I31A 1B5GH 1ZHPA 3RXTA 3KCGH 1UHBB 1EXFA 1NFUA 3P8GA 1QB9A 2F9UA 3A7TA 1LPZB 1F92A 2TGDA 1QHRB 3LH1A 4CHAC 1XM1A 1TOMH 3U8TH 3OSYA 2EI6A 1H8IH 1KLJH 4M7GA 1K28D 3EYDA 1ELBA 3MH6A 1Y5AT 2OC1A 3V3MA 2WPJS 2WPKS 1T7CA 5J4QA 1W13U 2AIPA 4I7YH 2AMDA 2OXSA 1SGTA 5EU8A 1H8ED 2D1JA 1D4PB 3A7ZA 4MPVA 5JBAS 3ZVGA 2O8WA 5T6GA 1K1OA 4GHTA 2ODQA 4YXWD 1W7GH 5HGGA 4GSOA 1TPAE 4NZQA 2UWLA 3OTPA 2V3HH 1G36A 4J2YB 1KXEA 3VB5A 1W10U 2VVVA 1TA6A 3ZVBA 1TGCA 4FUGA 1SGQE 1SSXA 4OS1A 4K1SA 1VCQA 2VU8E 1BHXB 3PWCA 3FAOA 4OS2A 4WXIA 2THFB 1HFDA 3O8CA 1NU9A 4FUIA 2P94A 2NU1E 5EGMA 1DX5M 3UTUH 1CQQA 1LVOA 2FZZA 2A7CA 1W7XH 4A1XA 4Y11E 1P03A 4X8UH 4INHA 1HAVA 3F9FA 1PPBH 4XDEA 1LHCH 2JETC 3E8LA 3TJNA 5DKMA 4DOQA 2PGQB 2HVXA 1O2PA 1SQOA 1OHHD 4U01A 4X1RU 3E90B 1HJAC 5DPAA 3QGNB 4ABAA 2KCPA 2FDAA 2VINA 2BLVA 2Y5HA 3S7HB 2AGGX 2JIZD 4ABJA 1KYNA 1LVBA 1DY8A 1M9UA 4BAKB 1MQ6A 3SU1A 1YGCH 2BD8A 1QB1A 1YPMH 2OINA 1BT7A 2HWLB 4X8VH 3U69H 3ENSB 2ZDNA 4ISHH 1BUIA 2C90B 4JK6A 3W1EA 4K1EA 1F0SA 2UUYA 3TJOA 3DCLA 4AOQA 4JZDH 2ANMH 4I8KA 3M37A 3KGPA 2FS8A 3UQOA 3AW1A 3Q77A 1RJXB 1GJ9B 1HIAA 1AB9C 1CU1A 1NBME 2J5UA 1VITH 5L2YH 3GDUA 2HOBA 4U30A 1TBRH 5ETXA 5JDUB 2ZFTA 1LMWB 1O5EH 1A4WH 3P95A 2PWXA 1YF4A 1MH0A 3LGVA 1C1VH 3L6PA 3TGIE 2FS9A 4ABEA 1C5XB 2ZU5A 1TNKA 3ODDA 4XBDA 2G8TA 2A5IA 4NFEA 3BF6H 1SG8B 1FZZA 1N6XA 2HPPH 2RA0A 3PMAB 3ZZ3A 1E0FD 1F5LA 1BTYA 1O2OA 8GCHG 1MBMA 1S82A 3FANA 2K8IA 3UUZA 3FP7E 1VCPA 1XUJA 4YOIA 2QF3A 3A89A 2Y5FA 2WYGA 3A80A 3MU0A 5GJ4B 1V2UT 1IQLA 1GBJA 5F03A 1BTPA 4ISIH 2ZU3A 2A1DB 1UTNA 1TIOA 1TQ7B 3LDXH 1AUTC 2BD2A 3QDZB 4FUHA 1QR3E 3EDXB 1ACBE 1F0TA 2A0QB 3ATLA 2L6OA 1C5MD 2F9PA 2Z3CA 5I25A 5C5OA 2IPHA 2ZU1A 3V13A 3Q3YA 3D49H 1C1MA 2GDDA 1C1RA 1ID5H 3OAAD 3S9BA 1FNIA 3UB0A 3RUOA 3VEQB 2VIQA 2Q1JA 3GCHC 1VITF 1SQAA 3SHCH 7ESTE 4K69A 3F9EA 5F8XA 2GKVE 1C2IA 1ZTJA 3MOCA 3GCNA 1XVOA 5FX5A 1A0JA 3LONA 3E1XB 3RXKA 3KF2A 1V2TT 2F9BH 3OEED 1SGDE 1XXFA 1OKXA 1PQ5A 4BXWA 3SUEA 2ZDAH 2W3IA 1GVLA 1P02A 1EFRD 1BA8B 5AFYH 1N6YA 3SZNA 3U1IB 1UCYE 1HXEH 1NRPH 4IBLH 3PB1E 1NESE 1GHAG 1DFPA 1O2HA 2O8MA 2ZQ1A 1C5QA 3RXVA 1XXDA 3SYJA 1AUJA 3FZDA 1DWDH 2GD4B 5FL7D 3MMGA 1E34B 2GX4A 1ZGVA 5FHTA 3IWMA 2R3UA 2WV9A 2XNDD 1IAUA 5A2MH 1EAXA 1HV7A 2VH6A 1IQJA 4Y8XA 1O3CA 4JYUH 3SGQE 4BAQB 1OWJA 1SC8U 1AHTH 3U1JB 1SGRE 4IGDA 4ISNA 3FZZA 1C2LA 1O2KA 4H4FA 2JH6D 4ABBA 4TYDA 1QURH 1O5AB 2GCHF 2J94A 1FDPA 2ULLA 5IYTA 3QTVH 1AU8A 3KNXA 2WZQA 2HLCA 2QXGA 4MDSA 1BRCE 4Y71A 1F0UA 1T8OA 2W5EA 2Q6GA 4X1QU 1BIOA 1BRBE 1GG6C 3L3TA 5C67A 3N7EA 1SOTA 3UQVA 3DFJA 3MNXA 5DP3A 5FCKA 4NWKA 4K8YA 3BSQA 1GI0A 1YPHE 2OBQA 1D3DB 3LJOA 3V7TA 1N8OC 3PV5A 2ZHDA 2ZG0H 2PUXB 1UVOA 1H9HE 1YC0A 1V3XA 1C1NA 1Y3UA 2BD9A 1HGTH 3TJUA 2TGTA 4HFPB 4X1PU 2CF9H 3TNSA 1K21H 3UNRA 1RXPA 4H6SB 3STJA 5LGOA 2ZGJA 3F0OA 4Q80A 2FOAA 5C17A 1C5OH 6GCHF 4MG3A 5DSFA 3VPKA 3BTTE 3MNCA 1C1SA 4A5TS 2G5VA 4DGJA 3N99A 2XWAA 3PMJA 4AB9A 2SGPE 5E2PA 3UPEA 1GMHG 3BTKE 4NIXA 1LQDB 1A2CH 1YPJH 1P11E 1EATA 1C9TA 2FODA 2Z9IA 3T25A 1QGFA 2FOMB 1HPGA 3MU1A 2BDAA 1DWCH 2I6SA 2C8ZB 1C5LH 2H6MA 1P2OA 1PPEE 2ODPA 2K0QA 5HKKD 5JYIA 3UNSA 1TPOA 2FLRH 3PTNA 4X2VA 2ZC9H 2W26A 3GY2A 1BDAA 1BMNH 3MYWA 1GJ4H 1NM6A 1OOKB 1WAYB 1HNEE 5DP7A 2KCYA 4Z1MD 1LHFH 1UCYH 3A84A 2G51A 1WSSH 5E0JA 1DLKB 2WYJA 1QA7A 2Y80A 1S84A 1ZMLA 3ATIA 4ABGA 2CHAC 5FPSA 3E3TA 4Q2KA 1QFKH 1G2LA 1DM4B 1PPGE 4ABHA 1KXFA 1TRNA 4B2AA 1JIMA 3ZIAD 2VJ1A 1KDQB 1UVSH 3M7UA 3GS9A 3A8BA 3QK1A 2F9OA 1YCPH 2FXRA 4RN6A 4IN1A 2C8XB 4FUEA 5BPEA 3A85A 2VNTA 4CH8B 4D8NA 1SFIA 1TMUH 1O34A 2ZGCA 4ZKOU 2B0FA 3HKIB 1EZUC 1THRH 1ZR0A 3BIUH 3PO1C 1AD8H 3SGBE 4DJZB 2CHAB 3RXFA 1EP6A 1O2QA 2NU2E 5L2ZH 3EA7A 3ZVCA 4D76A 1O33A 8LPRA 3PM3A 2OBOA 4AGJA 4F4OC 1BMAA 1RD3B 4FXGH 1AY6H 1BRUP 4Q7ZA 5LPRA 1VITG 1Y5BT 2PTCE 1AN1E 1XUKA 1ARBA 2H5CA 1EJMA 3UR6A 1WXRA 1E37B 2C4FH 2YNBA 1L1GA 4UDWH 1LDTT 4X6MA 4THNH 4D7FA 1J16A 1EPTC 5EW2H 1MTUA 1H9LB 1VGCB 2KAIA 4E05H 4VGCB 5DK1A 3U8RH 2XCNA 1G3EA 3SU3A 1S6LA 1EQ9A 1C9PA 2CXVA 2BMGB 4I33A 4IC5A 4XOJA 1LO6A 2GCTC 3VB7A 5HMAA 1T32A 1FJSA 5DP8A 1FY5A 4AB8A 2ANKH 1OPHB 2FX6A 3M5LA 3F3BA 1P0SH 1GJ5H 2QA9E 2P8OC 1H8DH 3FFGA 1K1PA 2XRCA 2ZDVH 2ALVA 4U2WA 3SW2B 2AS9A 1ZPBA 3LGIA 1GHBG 1OWKA 1A5IA 2JJ1D 1UJ1A 2H9HA 1BITA 4B2BA 1Z8JB 3LH3A 2YMSB 1RIWC 1O38A 3SV8A 2NU4E 3E0NB 4WJG2 1GJCB 1V2LT 2KCAA 1O2YA 7LPRA 1D6WA 1SI5H 2JH0D 2Y5GA 1JWTA 3QO6A 2HNTE 1O35A 4RI0A 2ZU4A 1EPTA 4Y6DA 1QJ6B 1NT1A 4UD9H 3VGCC 1GDUA 5TCAA 2FX4A 1ESBA 1A46H 1MTNC 1QIXB 2ZI2H 3RXUA 4AG2A 4UFFH 4I32A 2Y81A 1EJNA 3RXCA 1C2EA 1W0YH 3SU5A 4I8LA 4AORA 1TX8A 5EG4A 3GY5A 2ALPA 2R2MB 2WUBA 3IITA 1UK3A 2BDBA 1GPZA 2QV1A 4TPIZ 1S6FA 3OY6U 3BEUA 2YOLA 1GI8B 2TBSA 3F9HA 3Q76A 4HI3A 3VGCB 3MH7A 3ZV8A 4DY7B 4WY3A 2F91A 4YT7H 1SGCA 3F68H 3F2FA 3WWFA 2Q6DA 1ELEE 1ANEA 2A4QA 2O9QA 1C5NH 6CHAB 5IK2D 3TH2H 1GI6A 1EP5A 3P17H 4K1TA 2BD3A 1MCVA 3K6ZA 1TPSA 2VBCA 2AGEX 2BB4A 4GVUA 1LPKB 3H5CB 3T27A 2KFWA 2M2AA 1FN8A 4B6FA 1OP8A 2AFQB 1D3PB 1XMNB 3S9AA 3AASA 3A8AA 3TGJE 5C1YA 1T31A 4KTSA 2ASUB 1AKSB 1SGYE 2FO9A 4YLUA 4E06H 2C3SA 1CT4E 1D9IA 2PSYA 2ZFRH 2BD5A 1KXCA 3A7XA 2BHGA 2D26C 1O3OA 1P2MA 3R3GB 4JZFH 1AWFH 3BEIB 4ZAEA 1ZSKA 2GTBA 3GCTF 2BLQA 3SV9A 4NSVA 5F53A 3TITA 1IQFA 2GV7A 5EXLA 2KCOA 3N7OA 1P9UA 1J9CH 2A2XH 4ZUHA 1O3NA 2B7DH 3PROA 4CRCA 3K2UA 2ZFPH 4U32A 4TY6A 1KMHB 4MLFB 5EXMA 1TGBA 5GDSH 3RXIA 1QL9A 5C5NA 3RMNH 1EUFA 2JKHA 3SOSA 2Z9JA 1HJ9A 4UEHH 2EC9H 2ANWA 1C4U2 1SOZA 1XUIA 1F2SE 1MKWH 3ZYDA 3PTBA 3P6ZB 1GBEA 1ANCA 4WVPE 1HYLA 3BV9B 1AI8H 1JIRA 1P57B 1P3CA 4MPWA 4KKDA 2J92A 1W11U 3S7KB 1AWHB 1P10A 4ZKSU 2ANYA 4MNXA 3UR9A 3TK9A 2WPMS 4XFQA 4Q63A 1UHBA 1MTSA 2STBE 4X1SU 1GBKA 1NRSH 2AHME 1GJ7B 1V2ST 3F1SB 1AFEH 2A32A 2ZNKH 4SGBE 5DP6A 1ZYOA 1NROH 4RKOB 1CT2E 3VFEA 2M5TA 3URDA 3AAUA 3SNBA 4ZKRU 1FQ3A 3T2NA 1GDQA 1TNLA 1O2RA 3S69A 2PW8H 2WUCA 2VH0A 3ZZ8A 4K3JA 3ZZ5A 5L30H 1PYTD 1DXWA 1TQ0B 1L4ZA 2GP9B 1MKWK 3ESTA 2XC5A 3NWUA 4ISOA 2F4LA 1TRYA 1W12U 4YESB 1K1NA 1Y59T 3A83A 3QX5H 1UTPA 2BDYA 1EAIA 5GCHF 4Q7XA 1DICA 1WYKA 3MHWU 1DXPA 1DT2A 3EQ0H 4TWWA 5A09A 3P8OA 1SQTA 1A3EH 4INKA 2HNTF 2HRVA 3RLYH 2BVSH 3WW7A 2V6NA 1MTWA 3G01A 2J4IA 2SGEE 4Y0YE 2FEQH 5T6DA 3EA8A 4KTUA 5FPYA 1THSH 5LPEA 1HAIH 1C5SA 1TNGA 4WMDA 1O3JA 3KIDU 1CGJE 1UK4A 5DO4H 2TRMA 1NRRH 4GCHF 1L1NA 2D8WA 1UVUH 3Q3XA 1W0KD 1W0ZU 3TLOA 1KSNA 4WF8A 1GI4A 1NRNH 4YT6H 1ZPCA 4BTTB 2OK5A 4ABDA 1A1RA 1QBOA 1ZGIA 3SHAH 3GOVB 2R3YA 3RXHA 2IJOB 1BJUA 3GYMA 1Q2WA 1QY6A 1H4WA 1UMAH 1J14A 1HCGA 4NFFA 4RSPA 1ESTA 1PPHE 4SGAE 4AFQA 4MNWA 5DN6D 1DE7H 2FPZA 3ZZ9A 2V7QD 5HXFA 1KY9A 4CRDA 1P06A 4O03A 1GL1A 1G32B 1WOFA 3LC3A 3SU0A 4KGAA 3LU9B 1MTVA 5AF9H 1ZMNA 3U8OH 2TIOA 2XXLA 3VG8A 1GCTB 1O3BA 1BRAA 3QUMP 2GT7A 1QRWA 1GBIA 5AFZH 5K7RA 1O30A 1K9OE 4BAMB 1S5SA 1OP0A 1O36A 1GBBA 1SL3A 2R0KA 4FU8A 2J95A 4YOJA 5AVDA 5JBBS 2BM2A 4BOHA 1DITH 4CR5A 3GCTG 4H42U 2Z9GA 1PPFE 3O8DA 5FXLA 1OYQA 2EI7A 4NA8A 4X0WU 2HLDD 5FCRA 1K1LA 2J9NA 3ZVAA 2AERH 3KQCA 5L6NH 2BZAA 4JCNA 1E35B 2Y7XA 4A7IB 2ZKSA 4ZCNA 2F3CE 1BTUA 1IQMA 2WV5A 2ZHWH 3F6UH 3SQHE 4TY7A 4NIVA 3BIVH 3PV2A 1TB6H 5DGJA 1O3GA 3GY6A 1O3LA 1SLUB