1RH8A

Three-dimensional structure of the calcium-free piccolo c2a-domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
142
structure length
142
Chain Sequence
b'ASHPITGEIQLQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLMKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in the Piccolo C2A domain regulated by alternative splicing.
pubmed doi rcsb
molecule keywords Piccolo protein
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 20
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2003-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1rh8A00
2CHDA 4FLHA 1E90A 3SD5A 1QASA 4NP9A 1YRKA 2RD0A 2WXQA 3N5AA 4JPSA 5H4YA 1E8WA 2N1TE 1W15A 4L1LA 3R7QA 2WXIA 3GPEA 4WWPA 3JZYA 4KZ0A 2BWQA 2FK9A 2WXOA 2D8KA 2ZKMX 3L17A 3TWYA 1RSYA 4BGDA 3QR1A 4WWOA 2CHWA 2NCEA 4DK5A 4AJWA 4A55A 4PS7A 2QZQA 2CHZA 4L2YA 2EP6A 4G11A 4NS0A 4QJ3B 3S2AA 5JHBA 4XX5A 3QJZA 2WXRA 5CCGE 1DJIA 1DJZA 3FDWA 3HIZA 3NZSA 4KZCA 4FJZA 4ANXA 4V11A 1E8YA 4FADA 3F00A 4IQHA 1WFJA 4OVVA 3W56A 2K3HA 4GB9A 4TV3A 4FA6A 4GNKB 2V4LA 3QR0A 3L13A 2ENJA 3FBKA 2ENQA 3L16A 4XZ4A 3ZVVA 4NPKA 4NPJA 2DMGA 5CCHE 5CCJA 2DMHA 3L54A 2B3RA 2WXNA 4ICXA 4QAMB 4HVBA 1E7UA 2WXPA 1CJYA 3CSFA 3OHMB 2A4ZA 4LDCA 1UOWA 1RLWA 4FHKA 1E8XA 5G2NA 4DNLA 4FJYA 3NSJA 3HHMA 3L4CA 2CJTA 4TUUA 4WEEA 2WXLA 1UOVA 1A25A 1DQVA 2WXMA 3ML9A 1QATA 3ENEA 3ML8A 1RH8A 4FULA 4PS8A 4XE0A 3PFQA 1W16A 1TJMA 4LCVA 3TL5A 3KWUA 4ICWA 5H4ZA 4WWNA 5JHAA 2Q0ZX 2WXGA 4ANUA 3CSTA 2CHXA 4ANWA 4EZJA 1UGKA 4IHBA 3IM1A 3RPBA 4EZKA 4KITB 1K5WA 2YRBA 2K8MA 2Z0UA 4FHJA 3PS6A 4MJJA 2NQ3A 3RDJA 2NSQA 3APDA 1E8ZA 2WXHA 3APCA 5G55A 1BYNA 3QARA 1E7VA 4LT7A 4QJ4B 2YOAA 4QJ5B 4F91B 2R83A 2ENPA 2WXFA 3KWTA 2FJUB 1DJWA 5T8IA 3MJWA 2X38A 1DJXA 1DSYA 3TJPA 3B7YA 2WXKA 3ZIMA 2K4AA 2KI6A 1BDYA 3F04A 4URKA 5EDSA 3R7RA 4WAFA 2CJSA 4Y1SA 2Y3AA 3PYCA 4J6IA 3DPDA 3OAWA 3F05A 2ISDA 2CM6A 2WXJA 3LJ3A 4OVUA 1DJYA 2A5UA 4F1SA 1HE8A 1TJXA 3L08A 4PS3A 3W57A 3ZW3A 2K45A 3M7FB 2Q3XA 2CM5A 3F01A 4F93B 3T8MA 3P2BA 3DBSA 1GMIA 4L1BA 2QZ5A 2UZPA 4BFRA 4TS6A 4HLEA 1DJHA 5KJ7E 3HN8A 3NZUA 4L23A 3QK0A 3PRZA 4F92B 3QAQA 4AOFA 4ANVA 1DJGA 1BCIA 3APFA 3IBEA 1V27A 3PREA 1WFMA 2JQZA 3L9BA 4Y1TA 4EZLA 2LHAA
chains in the Genus database with same CATH superfamily
2CLRA 1U9KA 3P9MB 4XR8C 3SYAA 2J4WL 1KBGL 1NCGA 1K4DA 2N1TE 1FG2A 1MJ7L 1UT2A 4JM2C 2MQ3A 3GHEL 3HRZA 3NJFA 1AQ8A 1M6OA 5I6XB 5EV7A 2Q76A 2NCMA 1SXCA 4DH2A 3ATDA 5FA4A 5E9DB 5FYLL 3UTTE 4Z7QF 4JHBA 4BZ1L 4Y1AD 2NY2D 4RBPK 2ADJA 4EBQL 1BZOA 3Q2LA 1EEZB 3UXFA 3OJVC 1SXNA 2OPCA 3FFOA 2HFEA 1BIIB 1YN7B 4MHHG 3MRIB 1SBSH 3II2A 1JD9A 4OCNC 5HSFA 3F00A 1CF8H 1I9RL 1D5BB 3TPKA 3VM7A 1AO7B 4NM8L 1AD0A 2BVQB 1A4JB 4GB9A 1O6SA 1OEZW 1J12A 3FTYA 1MJ8L 4U4BA 1VZGA 5E70A 2A6IB 2XJKA 1EEYA 3KLAB 5KN5A 3KR3L 3NA9H 2NNAB 3TZVA 2VKWA 4UIKL 1FRGL 1MI5A 5D71H 5DYOB 3DX7A 4JFPA 5F7EH 2YD0A 4JFWA 1KCUH 5DJ2B 4O5LL 3UBXA 1VESA 3UTSD 4DPCX 5DWUH 1BQKA 1IL1B 1EBAA 4R7XA 3EAKA 1UT1A 4G6FD 2ZCHL 3C08L 4FOMA 1R3JA 4KBPA 5F96L 1E2ZA 3GUFA 1UXMA 1GC1C 3TL5A 4L4VD 1WAAF 3MYJB 3O2DH 3AU1A 4Z1PA 3OX8A 3UO1L 3VI3F 4DP2X 1M7UA 4J8RB 4ZBJA 3SPGA 1DFXA 4IHOB 3LZOA 3OXRB 3VDCA 4FL4C 3APDA 2HLFC 1KCBA 3MKGA 5HYQB 3VXPB 5ID1A 2XACC 3K4AA 1INDL 3B5HA 1H3TA 1T7ZA 5H2BB 3QNYA 4CW1A 4OT1H 1I8LA 3I6LD 4HSQA 1R34A 2NY6B 4FN0A 4FD0A 2IOMA 3SZ6A 4R6UA 5IB1A 3MNVA 4UIMB 5EA0L 4OV5A 2DQHL 1N19A 4OIBA 3WD5H 2IH9A 1AVAA 3O4OC 4O51B 2R56H 1PY0A 1AZBA 2F6AA 2P8MB 4XMPL 2IGLA 3SIKA 4AKPA 2ROYA 1THCA 2AK1H 3L95B 1WA0X 2LU5A 4BZ2A 3EJCA 3HC4L 5AUMA 4KUZL 4HZLB 2BW4A 1D5IL 1E2WA 5E2TH 4TVPH 4O2EB 5E99L 4H8VA 1UURA 4AY0A 2D7MA 5CZVL 5E1QA 3AS1A 5AYUH 3IDJB 1MLCA 1MNUL 2Q6WB 4MZIA 4JHVA 5MEND 5I5IA 2ICWJ 1RZ7L 4GXVL 2DQGH 2FQGA 2IBZY 3VW3L 3EBHA 2XKNB 4B9JA 5KVEE 2R27A 3MLZL 1SDDA 2XVGA 5EN2B 4QHNA 5HHXH 2BFGA 2WVTA 2JB6B 4TNVF 4N3UA 5CM1A 3ABMB 2MCPH 4BCYA 3QIBB 3QAZC 4JG0L 3LNFA 3AY2A 2WQWA 3SE3C 2O30A 2Z31D 2W95A 1XVSA 4KROD 1KN4L 3D4YA 1TJHL 1TMQA 2GFBA 4AG4H 1HAUA 4XC3L 4HJUA 4AEHL 2QVKA 2WQRA 3NSYA 4QXTB 3LS5H 3GMOB 5DLLA 1KPUB 3DX9B 1TXKA 1IBGH 3BN9D 5EUOF 4HMEA 2IQAB 4KXAA 5DRNA 3D0AA 2Z7ZA 4MJ6B 3ALWA 1WGVA 3GF8A 1A7NH 1MFVA 2XBZA 2W60B 3VG0H 3ZTDC 4L1SA 3QUZB 2OMTB 2R69L 3GIZL 3LS4L 1RLBA 4PWEA 2AXGB 3L3DB 4WUUB 3VI4A 3RFZA 2EDDA 4BHUA 3WMPA 1I4FB 1T5XB 3SSGA 3TYGL 3V7MA 3ARBA 1R3HA 3WN6A 5FV1L 1HI6B 4JE4B 1HWHB 4MNHB 4N25A 3TBWA 5LKNA 3OZKA 3RZCB 3K2MC 1ETZA 2OMXA 4M4PA 1BAGA 4TNEA 4HIEA 1OT4A 4E36A 4KGJA 3IF1B 2XG4B 2ZOOA 5AB9A 4XCNB 1NEUA 4IJ3C 5E8DH 5IW3A 4KVCL 3TZVD 3HRPA 1MI5D 3EFDH 3CVBA 4RRPA 5T1LB 2WXHA 4X4ME 5B8CB 2G9HB 3B2MA 1TSRA 3DROA 4KRLB 4PJBA 3SBWA 2FJUB 4Y8DC 5IROA 3WS3B 2A6DA 3IMSA 3N04A 1DSYA 1A6WL 3IN2A 2X6VA 4KDTA 2C3HA 1U8OB 4DVBB 4HU8A 4XVTH 4V1DA 3LPPA 5DVOA 3SDAA 2NW3A 5AOZA 3DX8B 3Q6FA 4F9LC 5HI5D 4ZTEA 2ZP8A 3BE1L 2UXFA 3GSXA 2V6HA 4F1SA 3QFJA 2VRQA 4LLDA 4W93A 4BKLA 3BPCB 1K2DA 2JQAA 1HQ4A 5CHNB 1UD8A 4D0CA 3VFMA 5C0NC 1OHZA 4PWIA 3GUTB 1KLGB 3QHZH 5FO9B 1G6RB 4FNQA 4QYAA 4ZQKA 3T4AA 3KMDA 4NO2B 4XO3A 5D2LA 3D30A 1MVYA 1AQDB 3X2QB 2BSDA 3QIUC 1N6QH 1UZGA 1NBVH 4HP5A 1KXVA 3TYFA 4Z0BH 3RAJH 4L1TA 5JO5B 1T1YA 5DHVH 3EJTA 3P4LA 4K07A 2NY2B 4Y1AB 1UM4H 4ZNEE 2UYLB 1CURA 2IFFL 1T83A 1R5WA 3MRFB 3MRRA 2FK9A 2WVVA 4H5SA 1NCJA 4KI5F 1OB1B 2APWA 3X14B 2YAEA 1FO0L 3I6KB 4A68A 4R2GC 1I82A 4DK5A 1P4IH 5AALA 2UY6B 4PS7A 4RMWA 3PABA 4L2YA 2F68X 3HMXA 5EZLB 2NLJB 3ZZSA 3TVMC 1IGJA 2XV3A 3MGTB 4QWWD 2O61A 3OKMB 2ZX9A 4KTDH 2D31B 2FB4H 1BBJA 4JFQA 2ICWB 3HG1A 3WEMA 4PHZA 1JN6A 1G7LA 3EOTL 3RWEB 1CQKA 3UTSB 4F2MB 2VXQL 1V7NH 3KCPB 3IXTA 3BD4A 1SF5A 4G6FB 1A6AB 3MJ8A 1NFDB 4L4VB 1AOHA 2ZXGA 2BZ7A 4JZOA 1MPAH 2WJ5A 3THMH 4GRWH 2OL3B 2W0KA 2Z0BA 3MLUH 3LKNA 4L29A 2EDHA 3DJRA 3QFGA 3QR2A 3VJ6B 4JRYA 2R1WA 1F3DJ 1OWWA 1IQWL 2WO2B 35C8L 1AZRA 3GNMH 4HWZA 3V0WH 2FIKB 2WXGA 4GBXA 4QHUA 2OR9H 3KBPA 4U6HB 5F21B 2ZOTA 3KH4A 4J1UA 3VAEA 1S7WA 5I6XC 4JVWA 2BNRB 1U91A 2VDKH 1XB6A 3QUYC 4C83B 5I1KL 1I9EA 3W11D 4I3RL 3WFCH 5BJTA 4M7LL 4J3UA 4EPSA 3QQ4A 2X4SB 5I8EA 3WNPA 4Q56A 1XGTA 2X1WL 1TZIB 5KBPA 3QDHA 3ARBD 2BW5A 2YLHA 2FSDA 3ZL4H 2V5RA 2H3KA 4HW6A 4LVHB 3ZDYB 3E9UA 4TSAL 1NGWB 3IJYB 3PWUA 2XIDA 2YGNA 2FL5B 4AWJC 3VSUA 3V6ZA 2RIKA 4XH2B 1MQ8A 2BXYA 4GO8A 2A6KA 3CU1A 1NJ9A 4RMUA 5GJSL 3ULUL 4NNXB 1UXWB 1KJ3L 3GI8H 4UT7L 5BVPH 3OKLB 3QQDB 4AIEA 2WWMC 1AXSB 5GS1C 5MENB 3CFDB 1CR9L 5IROD 1B9ZA 1WBXB 2CG9X 3U7WH 2ETWA 2LABA 3PHAA 1EGJA 5C9KA 4V1DD 2B59A 2OMNA 3L9BA 4WVRA 5TK4A 2ZTBA 3SDAD 1NQBA 1CG9A 1R3LA 1TJIH 2CDEB 2F58L 3QFJD 4O2CB 1NLDL 2W07B 2Z31B 3OF6A 5ESAA 2CUAA 3HAEA 4WTWA 1MW3A 4F5CE 5I1GH 4KROB 5IHWA 1ITCA 3QNFA 1RKRA 1FL3A 3T6ZA 2CLRB 4X2UA 2ZKYA 4LAQL 2OV0A 4NUMA 1K4DB 1FG2B 2OYPA 3FU8A 2YGPA 3HRZB 1M6OB 4KVNL 3T09A 2I5YH 2Q76B 3S0PA 4N90D 1CDYA 1V8HA 4KKBC 5FA4B 3S6CA 4JHWH 1AZUA 2OTWA 3P30L 3MZGB 2ADJB 4GNKB 5BQ7A 3KYMA 2X42A 2ZOWA 1MWAA 3FFCA 3GI9H 4JKWA 3EADA 4OF5A 1WYJA 1CL7I 2HFEB 3C5SA 2F8XC 3GBML 1AKJA 2BP5M 2E86A 1X5GA 3ABGA 4JO1H 1IO4C 5I0WA 1MCQA 3B83A 2PXYC 3WUWG 1AD0B 5T3ZD 4LEXH 1O6SB 1NIEA 5DD0L 5DRZA 1Q1PA 2C4FT 4UOZA 1PKQE 5AVZB 3PL6C 5E0QA 2NY0D 2DQIH 1EEYB 5DJ6A 1S5IH 5F8QC 5KN5B 4FULA 1J1OH 3WTTA 3TZVB 4X42A 1MI5B 4NZDA 3ZRCC 3DX7B 3HG1D 2AABL 2K78A 4JFPB 3QPQC 4K5LA 2XPYA 3UBXB 3UACA 1RZKC 3RDTA 5I0ZA 1FQ9C 4GSDH 4WI5A 5C0GA 5I5RA 5BXFA 3Q5TA 5ITBL 1N4XL 4XRCA 5TK2A 3QHFH 1R3JB 1TT6A 1EMTL 1JWSA 3TH3T 2YKKA 5FXCH 3RWGA 3F7YA 3D18A 3AU1B 3OX8B 3ZU8A 2NTFA 1WA2X 2R29A 1A6UH 2ZXEB 3G08A 4ZUWA 1LP9A 1UCBH 4O02H 1A9BA 1RUKL 4JRYD 1SOQA 3O2WH 5ID1B 3FHQA 2F7QA 4GBXD 2MPAH 3K1KC 2ZP9A 4OVUA 1FE8H 1UC6A 2H5UA 3CX2A 3QNYB 4CW1B 1FFRA 2EH8H 2HZHA 3F01A 3SDXA 2GTZA 3REVA 3QUZC 2HX9A 4K2UH 3QDMA 4PI0A 1K8DA 3MNVB 3RKPA 3OHXC 4IRZH 3PHSA 4BRVA 5IB1B 4OV5B 5T3XL 1RHHA 1N67A 3D52A 2YO3A 4POYA 1WFMA 3SKOA 5FFGA 1Z2KA 3TWCH 5FB8A 1DVSA 1B6DA 5AUMB 1HXYA 1MFEH 3TBSA 1EO7A 1GH7A 5DD6A 4HV8A 4QTIH 4OUUA 1P84J 2VB5A 3NJMA 2G60H 5F7BA 5LBSH 3K2KA 2Y06L 3NRQA 2WINA 1W0WA 2ZKHH 3CTTA 3T04D 1MLCB 1CXFA 3F2LA 5DI8A 4E9LA 2WQXA 4YVNA 4N0FA 3S35L 4ERSH 1DDHA 1WDAA 3QNXA 4JFDE 5BS0A 1DQIA 1NCBL 1RJCA 1SDDB 2F19L 2WV3A 2GHWB 4QHNB 1GKOA 1OTUC 1E67A 4OVVA 3BVDB 2L0DA 1KGXA 3KCWA 4DOHE 3H9SE 3F6IA 2Y2YA 5KVEH 4FQQA 3OF6D 4PVMA 1IBHA 1CLOH 3ECBA 1E4XL 1YUHA 1E4WH 2AXJA 2GFBB 5IBTL 5JHLH 2OSLA 1J5IA 4MXQC 1ODUA 1AZVA 1KCVH 3X3GL 1TIUA 3B8SA 2RCSL 3LAFA 3OVUB 2DWYA 4LPYA 2EINB 3O0LA 3V5KA 3UIYA 1ZLUK 4JR9L 5DRNB 4HJGA 3FZUD 5LQBH 2YLKA 3PP4H 1XL6A 4B41A 3IGUA 1E28A 5BNXD 5HDQH 3KWUA 2NY2C 3HG5A 4U1GC 4KMQA 1CFVL 3FFCD 1RIUL 1T1ZA 4EZJA 3ES6A 3TO4C 3VI4B 3RPKA 3RFZB 2K1MA 1AKJD 3ARBB 1A9EA 1R3HB 2WBXA 4AGPA 1NZRA 1QEWA 3TBWB 1SJEA 1MCEA 3RIAK 1ETZB 3RB7A 4GMSL 5BV7L 1TCRA 3IRPX 4LCUA 4U7SA 1S9XA 3V4PH 4HCGA 1OW0A 2OMXB 5I75B 4Q14A 4HIEB 1PW3A 2AQTA 4IMKA 4TN9A 4K8RL 3IDYC 4KGLA 4KWUA 5KSBE 4P2RA 1TEYA 4YUEL 4OZIF 2GSIA 3DROB 1NIAA 1RY7B 3FN0H 4M7JL 1UH4A 4PJBB 3RDTD 3DTXA 4AL8H 1TJXA 4F7KA 5F9WC 2A6DB 1GMEA 2K45A 3G5ZA 5B7FA 1RUAL 5F89A 3RJOA 4V1DB 3H6AA 4DGUA 3SDAB 2NW3B 4M62H 4QGYA 3Q6FB 4TM9A 4U1JA 2CKNA 2IWEA 3GSXB 2D4DA 3QFJB 1KTKE 3WSQL 4LLDB 4PG2A 3I50L 4BKLB 1K2DB 1HQ4B 4MZRA 4Y2OA 4XPTH 3MJ9A 5I1IL 4D0CB 4PMEA 3VFMB 3STZA 5I8OL 1WFIA 1N70A 5EEXA 1U6AL 3T4AB 3DOSA 1SUJA 4LOFA 4ZQKB 1JF5A 2VR7A 5D2LB 4TLSA 2BDNL 4XB7A 4KQ3L 1A1NA 1CI5A 5TE4H 3CFKA 3UROR 3SGKA 1IC4H 1RSYA 2ZX7A 2JJSC 5FGRA 3QDMD 3TYFB 1T5WA 1WEJH 3UBFA 1MW1A 1T1YB 1CIDA 1GZHA 1O5PA 3GFUA 5IEHA 4NS0A 1VAHA 4F9PA 3CZSA 3BAXA 1BZDA 1KG0A 1T6BX 1R5WB 4GMTL 4PWHA 5E2JA 2X0UA 3MRRB 3NH7L 5JQ6H 2ORBL 2WVVB 4G6JL 4H5SB 3VXMA 2MCMA 1W0YT 3QISA 6TAAA 1OWRM 4F8QA 1ZJAA 3VD5A 2HFTA 4XO9A 3JUZA 3PABB 1D9KA 1GGUA 3PWPE 5EIVA 1OVZA 1PZSA 1FWXA 2V17L 1KC5H 2P49B 1L9PA 4NPKA 4XBGA 4U05A 1YYMH 3V0JA 1IGJB 2NY0B 1Z9SA 1IILE 1XCQA 2V9QA 5L4JA 3D1MC 2O61B 1VFUA 4NZUH 1D6VL 4JFQB 1BBJB 5BS0D 3HG1B 2GTQA 2VR5A 1JN6B 1G7LB 3U4EA 1NFAA 3AM8A 1G43A 4JQXA 2Y07H 1B4JL 2BVTA 4G7VL 4R7NA 2VW6A 4P2QE 1JXGA 3IXTB 1RZFL 3PGDA 3MRDA 1YECH 4F1ZA 5L9DL 3MJ8B 4FXKA 2EDFA 2A1WL 4DN4L 1GGCL 4JZOB 3OLEA 3UAJC 1J1PL 3WDHA 2H2SD 5F3BA 3R0NA 3JYBA 5E56A 1KJ2H 1S7TA 1TVBA 4BFEA 3LKNB 4L29B 1URZA 2XWJA 2H2PD 2PF6A 2QGBA 3II1A 3MUZ1 4JRYB 2VLMD 2R1WB 3ZHNA 4NO3A 2OULB 4HWZB 5GJTH 1QI3A 4GBXB 4QHUB 4J1UB 3TNNA 1S7WB 5FM5O 5IQMA 1U91B 3EF4A 5FGBC 2LLGA 3DHJA 1NCAL 5JOFA 1O7SA 5LWYL 3QE5A 4GAJH 4P05A 5BJTB 4WI7A 4FXTA 1UHVA 1TDQA 1WD9A 2B0SH 4Z7OF 1C1EH 5CCKL 1U4FA 1XEDA 1A0QL 2WP3T 3QQ4B 5I8EB 1XGTB 3I9AA 5AWNL 2R23A 3CX5J 3WFBH 4UANA 3NABH 3V9FA 3LNHA 3LXBA 4MB4A 1CE1H 1BMWA 1HZLA 4DERA 5C0FA 4KPHH 3C09B 1CGWA 2H0JA 3PWUB 2X6AA 4GRLC 4ZUSA 3S3PA 1F3DH 2DM4A 3V6ZB 1J8KA 4KQ0A 5E51A 2A6KB 4IDJL 1NJ9B 4KO5A 1MIML 4P2RD 3I9GL 5LLIC 4JPWH 3CFMA 2UZIH 1U3HC 3E3QC 3KBEA 4JFHE 4RMRA 4XNZB 5EBGA 25C8L 5JA9A 4ZFFA 2IDTA 5AOLA 5FKPA 4W70A 3CH8A 2IWGA 3WS6C 1JTOA 4B5EA 2B59B 2NY3D 3GHPA 1QSEA 3K4DA 4KKPA 4XWOC 1UH3A 3BVVA 1CG9B 1F11A 1R3LB 2VL4A 3HZ3A 3GRWA 5ESAB 3NAAL 1LO0H 3HAEB 3C12A 3BP7A 3EKCA 1ERNA 2XT1B 3Q1EA 5CSBA 1FL3B 5EU7E 1NCDL 2IOIA 4AV4A 4ONGH 2DQEH 1SFHA 4HLZH 1UD4A 1GR7A 5CCJA 1QYGL 2EE9A 5TE7H 1HH6A 4LCIL 4V33A 3NFSH 3QS2A 3CLEH 4KY1H 2OTWB 4LZKA 3T0WA 1QBBA 2HX7A 5BQ7B 3KYMB 2FBJL 1MWAB 3FFCB 1OLLA 3K8LA 3VXMD 3C5SB 1ADQL 1AKJB 4YGAB 2XA3A 2VQ4A 5LDUA 1MCDA 4NP4L 4FQPA 1T6VN 1D9KD 4XN2A 1KTLA 3L4ZA 2NY4C 4P06A 5I17A 1QBLH 3VRIA 2B77A 5DRZB 3WNOA 3FT0A 2AQNA 3VD9A 1YO4A 3CVIL 5DJ6B 2YMXL 8CGTA 3VH8G 1IIKA 4HHAA 3ASNB 2YAHA 2K7QA 4OCSL 1VZIA 1P6AB 1CD9B 5F7FA 4X9GA 1IC1A 3RDTB 3ZTJH 5I28A 2P5WE 3PGCA 5C0GB 5BXFB 4D9LL 1HQRA 4XRCB 5D7KD 3RGHA 5HYJA 2X9WA 1S7SA 1JWSB 1S9YA 2XWEA 3RWGB 2G3ZA 3F7YB 4Y9CA 3F05A 3D18B 2DN7A 5EEYA 5J56B 3SO5A 2NTFB 1KYDA 1AE6L 3FULA 3G08B 1VERA 4ZUWB 1LP9B 4WHYH 3M7FB 5D7LE 1ZE3H 1A9BB 3CPUA 1LD9A 4X80H 4A66A 5DUBA 1ZOXA 4XPFL 4KX7A 4YDLC 3AXLA 1OP9A 3MLSH 3E6HA 1Z66A 4M6OL 4Z7VE 1SMOA 3ZYIA 1KCSL 1EDQA 5DJXA 3OSKA 4RA3A 3SDXB 2FX9H 2GTZB 4UILH 4LRIA 3REVB 3BWZA 1E90A 3P1VA 3QDMB 1K8DB 1J0HA 1KWKA 4PBDA 1RHHB 3WNLA 3RFZC 1EQWA 1QFUH 1QPPA 4JS7A 3IETA 4JANA 5CU5A 2Q3AA 3IFNL 4OV6F 2RB8A 4NBXB 2YUXA 4X98A 1M7XA 4AQ1A 3BUBA 2WAHA 3QEUA 3SKOB 3MACL 5FB8B 5EOTA 2EXYC 4X0NA 1HXYB 2PO6C 2EDEA 3TBSB 4XOEA 2Q5BA 3A0OA 4GINA 5DD6B 4HV8B 1EO8L 4OUUB 3KXFA 4HAGA 4ELDA 2FLBT 4LKCA 5K39A 3LPOA 2WINB 1W0WB 1KMGA 5ICZA 4R3SA 4XB3A 5DI8B 3ATAA 5A2IH 4N0FB 1W72H 4AXWA 1DDHB 4C57C 3QNXB 5BS0B 2K3TA 4CILA 1LMKA 3WNMA 2AJYL 5BO1H 4KDTC 1XHHA 1FBIH 5FO2A 1R6VA 2H1XA 3AADB 4LIQL 1E7UA 1QSED 2WBKA 4PJCE 3CSPA 2WLJA 1J0JA 4AYID 2QKIC 5KAQF 4FA8A 3P0GB 3LZRA 4NO0A 4FQQB 1YA5A 3QXWA 3QJXA 2NNCA 3ECBB 1YUHB 1SQ2N 2FQFA 5HDLA 4BK8A 1DQVA 4S1RH 4BUHA 4JZNA 5LGHH 1EZSA 2DQFA 2JVUA 3VMOA 4J3OH 2OKMA 5EU5A 1PMYA 2OSLB 4DGWC 4F57H 3FL7A 4CSPA 2QTEA 3K1DA 3KPRE 1U8QA 4PJDE 5EU6E 5FKAA 4BSWA 3V5KB 1FFTB 1SYSA 5F93C 4HJGB 1HJCA 1VGKA 3OLDA 2AEQL 2KMWA 1JDCA 2P8PA 1E28B 1M6UA 5C7XL 2DLTA 1K5NA 1NIBA 5KBLA 1T1ZB 1RMFH 4X50A 3ES6B 1U8CA 3BDYH 4PG9A 1A9EB 4KXZI 1QEWB 1S78D 2G0KA 4P23A 1CTMA 1SJEB 3BN3B 5HJBA 1TCRB 4LCUB 1S9XB 3FH5A 2R2CA 2KT6A 2JCCF 5F9OH 1KTCA 1MXDA 3IKKA 3Q6GL 2ZOLA 3AU0A 3FQ2A 4XBEH 4Y7MA 3ZW3A 4JG5A 2XV6B 4JGNA 4QY8A 1I85A 2KZ1B 4I5BA 4YVUA 4P2RB 3ZRFC 2GSIB 1G9NL 1BM3L 5TD4A 3PWNA 3FN9A 4TTDC 4DO4A 1WISA 4K71C 4ZUTA 3DTXB 4MQXD 4N2GA 4GKSA 5DD3H 4MJIA 3G5ZB 4AM0Q 3EGDA 2WQ8A 3IKCA 3LDBC 1AGFA 4I77L 5HYJD 4WI8A 4UNUA 5F89B 2Y1YA 4ZTOH 2W8CA 4OJCA 4HDIA 2NY3B 2F15A 4HZ1A 4UOW1 1RUQH 2X89A 1JNNL 4NWUH 4U1JB 4HKJA 1JDDA 5FHAL 3U4BL 1R5VA 5D6CA 1P69B 4Z95H 4FMFA 4Q6IA 4Y2OB 3STZB 4GBXC 2VITA 1JHKH 1A5FH 3DOSB 1AJ7L 1DUZA 4JRXA 2GSMB 1DJIA 2A74C 4PUBH 3S98A 1G6VK 1A1NB 3NFPA 3CFKB 3MLYL 3DJTA 3LH8A 2ZUWA 1EGJH 1T5WB 5ALCH 4P5TA 5CGYD 3LKQA 4AENA 5IEHB 1P4BH 1YEHH 2E76C 2V5TA 4K23H 3I74A 1RIHH 1MCOH 4J23A 1KG0B 4F2FA 3MBEC 4EOWH 3QJUB 3VXMB 3EGXA 3C09C 1B0GA 1MFBL 4DFIA 3C6SA 3CHSA 5EC2A 3T0AA 1SRDA 1JZIA 1MCRA 4OZ4A 3IDNA 2HTKC 1OF0A 1BP3B 3KXFD 4M02A 1D9KB 2YSSA 1PIGA 4XBGB 4NQQA 3ENEA 4EIUA 3L4VA 5C3LD 1Z9SB 1XCQB 5E6IA 4BKSC 2WPGA 3U7YL 2UXVA 1NA8A 4WFGE 5B1AB 4RMBA 2QR0A 3U4EB 3CN2A 1YN6A 4U0RB 1TTGA 4R7NB 2OX5A 1LO2H 1QRKA 2YKLH 3LRKA 5JOPE 3ULUD 3PGDB 3WMSA 3MRDB 1A02N 1OCOB 1A8JH 4FXKB 4NO0D 3UDWA 1GGBL 3QFDA 2WXFA 4Y4FA 2I26N 3WAKA 4AUUA 5F3BB 1YMMA 1HEJC 1PFCA 1C12A 1XZ0A 2K4AA 1S7TB 1CFMA 1TVBB 2F53E 2WYIA 4MA7H 2XWJB 2DMKA 2E7CA 4X9IA 5EDXA 1RZJC 4NO3B 4GT0A 2A4EA 1DJYA 4D3CL 2DTMH 3UJJH 3TNNB 1KULA 3Q0HA 2ZXDA 5JOFB 5CBAA 5EG6C 4F33A 2VZUA 3QO0A 1VCBC 3FQWA 1PG7W 3FAWA 2R23B 4PJGA 3QK0A 4BA8A 1XXFC 1DJGA 2NXYC 1UENA 1L9NA 1J9QA 1EVTC 1RPQA 5J1TC 4P23D 1S9VA 3UYRL 4FLHA 3RWIA 5C0FB 4NCC2 2RBLA 5IFHH 1GJIA 2AQ1A 2OSWA 1E8WA 4ZUSB 3KGUA 1FA4A 3H53A 1ZEAL 2Z35A 3GBDA 2B39A 3L1GA 4KJWD 4GUQA 3DIFA 2AC0A 3FCSA 5L2KE 5D4QA 1LO3L 3IFLL 3VXTA 4MHHI 4MJID 4ZFFB 3OLIA 5FKPB 1PY9A 1SFDA 4IBUA 3U25A 4N0YL 2X4NA 1PX3A 3UC0L 2WNKA 1QSEB 2Q2LA 2X89D 2DKSA 4HKBA 4WCYL 1CD8A 1YC8A 3FUIA 3NJIA 1OD7A 1YYLH 2JB5H 1F11B 3T6VA 5D1QE 3UX9B 4BQ8A 3BP7B 2ALWA 2B16A 4MVBD 1UOLA 4FFYA 1BZEA 4HGKC 1ZLEA 4R7DA 1NGXA 1S46A 3MO1A 1KYOK 1RU9L 5IQNA 4O4YH 4JRXD 3UPAA 5EOCJ 4Z23A 4IU2A 4R5TA 4L4TE 2GVYA 4HUMB 3KHOA 3C87A 4P5TD 1IGIL 3BUDA 1HH6B 2Q10A 1JTTA 3N41B 3MXWH 3VQ2C 4GYBA 4EDWH 4TUKL 2JK5A 1MFCL 5E9DE 3EJQA 3P77A 4NQUA 5F72S 3FPXA 4APQA 4QXWA 4E42A 3CFCL 4NNPL 5DQDH 5BO0D 2ED9A 1JZ7A 4UTAA 3S34H 4K15A 2GIMA 2IBZX 4N0CD 4YHMH 3Q01A 3EYFA 5TTRA 4NDMA 5GS0L 1KTDA 1DSFL 1KTLB 5I17B 1AO7E 2VXVL 4JVPA 4PIBA 3AUVA 3EO9L 4M4RA 3WJJA 1DO6A 1FSKB 3DO4A 5E6ID 4EI5A 4HHAB 1IB5A 4ORGA 2HG5B 2JJTA 4ZAKA 3NCBB 3O6FC 5E00A 5TFSL 3NJJA 4HQQH 4TUJA 3ZDXF 4P9HC 3IS0X 3LZQA 2W94A 3DA0A 3HG4A 4QT5A 4B3VA 4FHBD 3KLDA 3KL3A 3EFFA 3PGCB 3RA7L 1HQRB 2OYLA 3D9AH 4IBZA 5HYJB 1S7SB 1S9YB 1TQVA 5I18L 1DJHA 4P46C 4WLCA 5ALBL 4Y4FD 5A7EA 1YMMD 4H0IA 2DH2A 3QWRA 5I6MA 3ZUNC 3LEXA 4FQIL 2YD8A 1LD9B 1C8QA 1HXMA 2ARJA 5DUBB 1YY8A 1I9IL 3FKUS 1EX0A 3ZHDA 5ANMA 5LXGL 1BMGA 1L0XA 4JPVH 2NTSP 4KTYA 4OGQC 3AXLB 4Q52A 4TUOA 2BOCA 2Y1AA 3E6HB 4TSCH 1SJXA 1XAKA 4ESKA 1NEZA 5DJXB 5JOEA 2ODIA 5HVHB 5D96C 4W6WB 1KN2L 1JV5A 5IB3A 2HT2C 1P7BA 3OMNB 4KKRA 4QRPE 2EIBA 4ZRGA 3PY9A 3IETB 1PSKL 4JANB 3ZOAA 3EXJA 1DO5A 5J12B 4AMXA 4X98B 4KXCA 4ODVH 4AQ1B 3QEUB 3ZIYA 1N26A 4WI0A 5EOTB 1OW0C 1G9EA 3MJ9H 4JFTA 4XZ4A 4QHPA 3KXFB 2W88A 5LO7A 1XGRA 4LKCB 5K39B 1U3ZA 4H40A 1YC7A 4JCWA 1VPOH 4B96A 4R3SB 5LAPA 5ICZB 1GGYA 1N0LA 1JYVA 4AXWB 4PCYA 2R4RH 4P48A 4OSUH 5H8DA 4DKAA 4IIQC 3DX6A 1VFMA 2Z1PA 3EBGA 3RUGA 5DC4B 2NY3C 3X1BA 4DEUA 3G6JE 3MV11 1XGYL 2WANA 2ZWYA 3SEPA 2NY7H 4XP6H 3SQOH 4NO0B 4JPIA 1FPTH 3SDYH 4EZKA 2X53A 4M43L 5FFLA 4JZNB 2DQFB 1PCSA 3ALXA 1CXLA 1RFDH 4H8HA 5EU5B 3V52H 4D9QE 4KNUA 1PZBA 4TQEH 5KOVC 4ABUA 5FYJL 4XMVA 1U8QB 5FKAB 4BSWB 1SYSB 3SGKC 2OJEA 5ICXA 3BSZH 1LQBC 5I5MA 1VGKB 1MWOA 5FHBH 4JY5H 4PWFA 3F7VA 2P8PB 1K5NB 4XP5H 2BIQA 1ACYH 1U8PA 2LE9A 4R7LA 3CFEA 1WBYA 4APQD 1A8ZA 1HE8A 4QAWA 1MJJA 4KX9A 1U8CB 4BINA 1YEEL 2PMZA 4PG9B 4M8QA 4P23B 1WG3A 4E41E 2UZPA 1QWUA 1UD5A 2H1LM 3HVNA 3RVWC 2QSTA 1IZJA 3GKWL 3FT4A 4DO5A 1JHLL 3B37A 2AVFA 2UXGA 2LTQC 2FNWA 4HIJA 2ZOLB 4FE9A 4Q89A 1EAOA 4LFHD 4QY8B 1KZQA 3VVWA 4EI5D 4I5BB 5F7WC 4HUNB 1F13A 2WYZA 3CLWA 1UATA 4ZAKD 3SD5A 1FDLH 3PWNB 3WOVA 4M48H 3VYOA 5IGXL 4K3JH 1QR4A 3RVVC 4ZUTB 2Y24A 1F6AA 4HWBA 4GKSB 5KAQG 4MJIB 4NJAH 3L17A 3EGDB 3IKCB 3ZYJA 1AGFB 2PYFA 3SDDC 1ETB1 5DUPH 2BX5A 3VFRA 4C4BA 1J8SA 1NBCA 4YFDB 2CSPA 4HDIB 5KSBF 2QMJA 4HKJB 4UB0H 3A47A 3B34A 3OD3A 1DJZA 3QWRD 1PZDA 4RFNB 1B90A 3OR6A 1R5VB 5D6CB 3RNKA 4Q6IB 1VZHA 4NOBA 2VXSH 3G5YA 3ZDZE 3ZL2A 2NY1C 3UYOD 3K0WA 3GXNA 2VITB 4TRPL 1UA6L 3AW5A 5BW7C 4MCZA 1DUZB 4JRXB 2F5BH 5IEKA 5KBDA 5D7JC 5D2NA 3TNMA 3L54A 3NFPB 4U33A 4GQRA 3QWOA 4QNPE 3MPCA 5I73C 4P5TB 3LZLA 1IM9A 2BNUA 2FT8A 3LKQB 5AVUB 3ESUF 4AENB 5E4OA 2XWTA 4KMLB 1J8HA 2QTVA 3GHBL 1CGTA 2D0HA 3P3UA 4EN3A 3EGXB 1B0GB 4UQAA 3C6SB 4G6ML 4I3GA 5EC2B 2Z8SA 4WGVB 1HAWA 3RZWA 1A2YA 4OZ4B 4XMUA 4AEIH 3IDNB 4JJ5A 5F71A 4H88H 1GJUA 2YFOA 2YSSB 4A7GA 5E94A 3MXVL 1C9SA 1Z1WA 3FUHA 4XNUH 2BVUA 1V10A 2KH2B 5F7NC 3R06A 4NB7A 2GABA 4OZHA 5E6IB 1ZY9A 1X5FA 1FH2A 2QR0B 5GRJH 4KKLD 2QPDB 2EC9T 1PAMA 3HHSA 4WNQA 1YN6B 1Q1JL 2APVA 2OX5B 5AVWB 2IDQA 2KLRA 2R2HA 2VDRL 1AG0A 3K2IA 3UTSE 4F2ME 4M7ZC 4OLUH 1AACA 3NK3A 1ZLWH 1FF5A 2COQA 3STBA 3QFDB 5FUOH 3Q8EA 4OCWL 4Y4FB 2BSRA 1NFDE 3BIKA 3MDJA 3ZKNC 2X28A 1YMMB 2CZNA 1NLBL 2BPBA 1C12B 1XZ0B 3BD3A 4LRNL 4BFOA 4HMDA 2H32A 5CJ8A 4YHKH 5B38A 3PAVA 1WITA 4LSDA 1CLCA 4Y5XA 2DD8L 4QXUL 2L7UA 4M03A 5E9NA 3CXDH 2OK0H 1QSFA 4FZEH 5CBAB 2VOTA 5CCHE 3TCLA 4XX1E 4F33B 2D3LA 4P59L 3QO0B 3FQWB 2J73A 4IIZA 3OGOE 2V2XA 3HI5H 3I6LE 4UT9A 5AW4B 3V9EA 1W15A 4XO5A 3V4VH 4WFHD 2A73A 4MFHA 3P40A 4PJGB 4A63A 3S3JA 4XMLH 5INDA 1OP3H 3M07A 3VSQA 1S9VB 4JEGB 4PLJD 2Y1VA 4G43A 2V8LA 3RWIB 4KTEL 4LSQL 2J21A 1MHCA 4PGZA 1F1AA 2ZYIA 1Z3GH 5C08A 1FSKC 15C8H 3MC0A 2Z35B 5F1KC 4IQHA 4ZX4A 1TUPA 1HXKA 1MFAL 5BV7B 1SPDA 3DIFB 1X7QA 2DQCH 3FCSB 1XCWA 1SN0A 2DY2A 3VXTB 2O5YL 3HNSL 4FKEA 4ZXBA 1UD6A 4TNGA 2WXNA 2E47A 2X4NB 4MJ2A 3GXDA 4HKBB 2JI2A 1PPIA 1A7QL 1NM4A 4PJHF 2CO3A 2FLRT 5JMRA 3LH2L 2KERA 3MRJA 5IBLC 2X12A 5L88H 3MN8A 3EZJB 4R7DB 4YQXH 1NGXB 3MO1B 2N59A 4DQOL 3S9DB 5K9KA 1PLGH 4OFDA 4IU2B 1MFNA 2EH7H 2IADA 2Z7WA 4NNYA 1QKZL 2QHRH 2F7IA 1IM9D 5CGYC 5DA0B 4PJ7A 4XMZA 4RQQA 3I2CL 1MCLA 5D7IE 1J8HD 2JK5B 5IZ7A 1ZMYA 3P77B 1M1XA 4APQB 1UT9A 4E42B 3B7YA 3UYPA 4ZFOL 4EN3D 2B8OT 4NZJA 1MCFA 3B9VA 5DUJA 4J3WA 4QIRA 3LHPH 3EYFB 4UQCA 4NDMB 3RIAF 4GSQA 4PJXF 1KTDB 2Q7YA 4FYTA 4HYTB 4H2AA 4G6KH 1DVZA 4XP9H 1SXBA 1GRWA 5IVXA 4M4RB 3LZFH 4CU6A 5JDJA 1ORSA 12E8L 3L2LA 1LWRA 4EI5B 4ORGB 5HHOA 1UXLA 3HZVA 4LLVA 4ZAKB 2JKIS 5DK3A 5E00B 1MIEL 4HSAC 4TUJB 3LEVH 4XPGH 3E3QE 4X7FC 1GW0A 4QT5B 1DBJH 1WTLA 5DQ9A 2VSDA 2DJMA 3EFFB 4F2EA 4OAWA 2ZUTA 3KL5A 5C2BL 3RWHA 3BZDA 5FYJU 4NZFA 5BZWA 1P84K 3WN5A 5JXAL 2B1AH 4I0PC 3ZL1A 1OK0A 2JWYA 4HPYL 2WZ0A 3RX7A 1MFDH 3NIGB 4UDUA 4UINL 3LEXB 5GRUH 1AMXA 3EG9A 2IBBA 1JK9A 3RLSA 1HXMB 2ARJB 3S8FB 4F20A 1OSYA 1YY8B 4IBLT 5EEVA 5ANMB 2C5DC 2H6OA 3S3CB 3ZMEA 1FYTA 4F7EA 4TUOB 2BOCB 1LEKA 1QSFD 1Q0EA 1NEZB 3OB0H 1F58L 1JV5B 3W82A 5IB3B 1UACL 4ZMXA 1NGPL 4WI4A 4UQIM 4BSJA 2VXTL 5DMGD 3E6FA 5T33H 4EUPG 2FBRA 1M2OA 5J5EA 3A22A 1T5KA 1HINH 2XTSA 4Z7VF 4WI0B 2OA9A 3QQXA 4AW4A 5C08D 2ZJSH 4YXHH 3MOBH 1F4AA 1XGRB 4ABQA 2Y6SD 3LEYH 1IC0A 1YPZA 4WEMB 3S36H 3K6IA 1N0LB 2H0FA 1BLNA 4J27A 2I60H 4IGBC 4ZXBD 3WLWC 4M6ML 3DX6B 1IGML 3RUGB 2EDYA 3MUUA 4LPWA 1A7PL 4U1KA 4DPRA 4HF5L 2A9MH 2VDQH 1IT9H 4CGTA 4OU3A 4HCRL 1JERA 5EUKA 4RFNC 4JPIB 3LQAH 1UADC 3TJEL 4D7PA 1FZKA 3QJHA 3S5ZA 4N0RA 3RIFF 4KNQA 1NGQL 1TFHA 3ARFC 4HAKA 5EO9A 3DX1A 2BLFA 4G8FA 4LSVL 5GHWH 3WNNA 5JR1H 3II3A 3IJSA 2OJEB 4O58H 5ICXB 1FZOA 1AXTL 2J72A 1CK0H 3UG4A 4TLUA 5TQ2H 3F7VB 4E5XA 2ZNWA 4U2ZA 1XXDC 2HKFH 1IGTA 3ZYZA 1HKFA 1U8PB 2RALA 3MCKA 3EHBD 5L4MA 3CFEB 1WBYB 4OJFH 1PX8A 1SM3H 2VC2L 1MJJB 2COVD 4MAUH 5BMFH 3ZQ9A 3DTUB 3D05A 3O6LH 3EYOA 4M8QB 4JL1A 2ZX8A 4I0KA 4N0CC 3LN5A 3VI4E 5I8KH 4OM0L 3QUXA 3F83A 1A6ZA 3FUKA 1MAJA 4LXFA 3FT4B 3DRTA 2VN7A 5DFVC 3MBXH 2HT3D 3DVNA 4HIJB 1QP1A 4LVNB 5KW9L 2IDSA 3WO3B 3V95A 3MV9A 3MV01 3SKMA 4MMXC 1N10A 5HHOD 3VFWA 1D5RA 3LIZL 4ZOCA 4Y7OC 3TFBA 1F6AB 1CL7H 4RDQF 4YDKH 3FH7A 3SYCA 2PYFB 3DXAE 3US0A 4M1GH 1W9XA 3VFRB 2O5ZL 5DHXB 3OZ9H 3RY6A 4Y4FC 5F0PB 4UUJA 4XPAL 4V1DE 4B9FA 3CFIC 2H45A 3ARXA 3OAUL 2ZAGA 2IH3A 3LY6A 1CBJA 1TTFA 4LL4A 4WRLA 5AW2B 4F8LA 2X4PA 4PRIA 4YLQT 1BOGA 3FQXA 5L8JB 1CLZL 3O81A 3OR6B 4OZFA 3DMMC 3QFJE 1LGVA 3RNKB 1UQSA 3G5YB 3ABLB 5AKSA 4ODTL 1QTSA 4M8RA 1OK8A 1FYTD 1WF5A 4MCZB 4YIQA 5IEKB 4A39A 5D2NB 1Q9OA 3TNMB 5L7XL 5FAAA 1N0XH 3QWOB 5EC1A 3BKMH 4HUXA 2DQUH 5B7MA 1DL7H 2N3JA 1IM9B 2BNUB 4R8WL 2HT4C 3MA7A 4R4BA 4U7KA 1Q0YH 4DN3H 4IHBA 2XWTB 3D7PA 1J8HB 1P0SE 1TQBC 1SJMA 3CUPA 3UTZA 3X3FL 4EDXA 2NQ3A 2E46A 1RJYA 3G5VA 1UWYA 4EN3B 4MASA 1PY4A 5JQHC 1A2YB 1WQVT 1CLYH 4FG6D 4UTBL 4BUGA 2X6UA 4JJ5B 2DKUA 1QBMH 3EYUH 4NWTL 5E94B 2VSCA 3VD2A 1BQ5A 4AEFA 1Q4NX 2BFVL 5T3ZE 3R06B 1QLFA 4I3SH 2Y3AA 4JM4L 4LSPL 5CEZL 4OZHB 3WDJA 2QGCA 1DVUA 3CX5K 1UJTA 3VD4A 3KEHA 2V33A 5FLUA 1Q72L 3GMNA 3DX2A 3M1OA 3ISYA 3HHSB 4K8RC 4WNQB 3OB8A 3HG1E 1OGTA 2R2HB 1U92A 4L8BA 1CC3A 4R4ND 3VXRA 3FUMA 4UTAH 2BSSA 3A24A 4I9WD 1JPEA 2ZAIA 3GSRA 2BSRB 3BIKB 4OF8A 2D2CC 2JTYA 4LOUD 4QI3A 2OMUA 2H32B 5GRYA 4HBQA 2BH0A 4X5QA 2D0GA 1SLXA 4ZFZA 4ELMA 5B38B 3UJTH 4Y5XB 5KS9F 3V0FA 4JRYE 3ALPA 4AYMC 1I75A 4BELD 1KELL 1KJMA 3GTVA 3TA3A 3GJFH 4CVXA 1QSFB 4AKOA 3TCLB 4NJ9L 1TPXC 2I32A 2V2XB 4YHZL 4NAQA 3RGVC 2R4SL 2R15A 4HALA 2A73B 4FTDA 1SVZA 2ZX5A 3JWDL 3Q9QA 4JW3A 3KPLA 3S37H 4NXSA 3KJ4B 4PS4H 3ZMNA 5INDB 3L5XL 1Q9WA 3QUXD 2PUQT 3F12A 4G43B 1TNMA 2F8OA 2M8XA 3QJFA 1GY2A 4I9XA 3ZE2B 1BREA 2FAUA 4RX4A 2IPTL 2VJ8A 4B95C 1J0KA 1MHCB 3AY4A 5FFOA 4KZDL 1DLFH 5C08B 2W92A 2EYTA 3GSOA 1L9TA 2GJ6A 3ZKQD 3MV9D 1YQVH 4CKVX 2VO8A 1FH5L 4ZAKC 5GS0D 3F6LA 4BZYA 4Y19A 1X7QB 4AM0A 3HB3C 4F58L 2XBTA 3H42L 1JCVA 1KF9B 3FT3A 5TE6H 4GT7A 4KI5C 1R0AL 3FO2A 1UFUA 4ZXBB 3MLRL 3MLVH 5J6HA 3VG9B 4DPBX 1E6OH 4OGZA 2FO1A 2L8AA 1THAA 1IEBA 1GAFL 4O00A 3MX0A 5KBKA 4DKEL 4G71B 1WTGT 2W9DL 2W9LA 4HG4J 4JB9L 5M95B 1OPGL 1L0QA 1E43A 4I18A 1YAIA 4QGTA 1DBKH 1KFAL 3CMOL 2DMCA 3MRJB 5J6GA 3QARA 1GZQA 4DAGH 1TFPA 3JQOB 3FB5A 4IS6A 1F18A 3JVGC 3U82B 2CJ3A 2E7LC 5FF6A 4ZS6C 1JP5A 5K9KB 4GFXA 3WEBA 4HIXH 3EUDA 2WHVA 3BUTA 3KYAA 4HUCA 3JV0A 2IADB 3V10A 4NNYB 2KS0A 1F00I 2TSAA 3WXVL 3MA9L 5FEBA 5IHZA 5J1SC 4DEPC 2EDNA 4KFZC 4Q2ZA 4WK0B 1RIVL 4PJ7B 4RQQB 3EOYG 3EYQC 1R4XA 2BY2A 1VFBA 4DGVH 3T0XA 3EHBB 1M1XB 4PB0L 1BJMA 3UYPB 4NRZA 4JHAH 3ULVF 1DSWA 2AHIA 1JZ5A 1ML0A 1KCRH 1ULVA 4BWTA 4BFRA 2XWBA 3IEAA 5IREA 3ELQA 4J12A 1JTPA 2Q7YB 4Z7IA 3UAAA 3UEQA 3F7PC 1TTCA 4GKOA 4Y4HA 5IVXB 1NCOA 4AI7A 1RPUA 2Y36H 4XT1C 1UYWH 4NZRL 3SHSA 1ORSB 4AGMA 1K3ZA 4R7VA 2IF7A 4JO4H 5HHOB 3HE7A 3HZVB 4KKLC 4LLVB 1RK7A 5ABZA 4UAOC 3BO8A 2YARA 4OJDH 1BZQK 3VXRD 4BFBD 3GIVA 5DQ9B 1YCSA 5B39G 3OAYH 2BSTA 4UYPA 4OAWB 1UD2A 3FAXA 4PGCA 1FIGH 3RWHB 4U6VL 4QJ3B 5SWQA 5BZWB 3WN5B 3QYMA 2J6EA 4N5EC 3T0EC 2E6QA 3E2HB 1TMCB 4P9ML 4UWQB 3O3DA 3OPZL 4MTMA 1LK2A 5ADPH 2HMIC 4UDUB 1ODAA 4Q9RL 3DPBA 4PRHE 5C0CE 3EG9B 4K94H 1JK9B 5CP3H 1GCFA 4FXGA 3VX1A 3G7TA 1I3RA 1V7MH 3F64A 1KBPA 4ZX6A 2B5IB 2AGJL 2EZ0D 4BFFA 4ODBD 1FYTB 5K93A 4F7EB 5E1GA 3TA3D 1LEKB 2YXWA 3DVIA 2H3NA 4L4JA 2F5AL 1PG7H 2E74C 5F70A 1LHZA 3SDXE 3W81A 1YY9D 1K3IA 3R0MA 4GIPD 5G2NA 1TTBA 3CV5A 4UV7H 1KGYE 1BXUA 3E6FB 3TJHD 2J43A 2XZAL 3EJRA 2NX5D 3AG4B 3FW6A 4NI6A 2H7WA 3GSNA 4RX4D 5B3JF 4LBAA 2HP4A 4X7SL 4ZZFA 3S3DB 1WSST 4S0SD 4B0MM 3GBNL 4MKTA 1SY6A 3BVNA 3BAEL 2GJ6D 3ZE0E 1UWEL 1X5IA 3EDFA 1YPZB 1NFIA 5SX4I 4Y19D 4ZT1A 2ENPA 2R0ZL 3BKYH 2EEDA 3LV3A 5CWSA 1ZANH 2EDMA 1JZ6A 1BLNB 3WIHL 3TJPA 4Z7AA 5GSRA 4L18A 2Y23A 1NMCC 5ECGA 1NCTA 5BS0E 2AEPH 4U1KB 4WAFA 1FZJA 2V7NA 2C8NA 1GYVA 1MQKL 3C6LC 3ROLA 3ULSA 1FG9C 4H1LG 4ELKA 5EUKB 1NMAL 4G8AC 4AE1A 3C2AH 1FZKB 3QJHB 2AF2A 1HVXA 3L3JA 4HH9A 5H37H 3B43A 5T1DL 1LEIA 4HC1L 4DGYH 2ZWNA 5LCVH 1F0LA 4FG2A 5EO9B 3TIDA 4G8FB 2J1WA 2NYZA 3IJSB 1J87A 5LHDA 4U1IA 3L3OA 4KJPD 2ZD0A 1FZOB 3OJ2C 2HRPL 5C0AA 4M7KH 2RR3A 1PYWA 5EZIH 4E5XB 4LESA 1IGTB 1QI4A 1KB5A 3E0GA 3MCKB 4GAYA 4WWPA 5KBNC 2BWQA 3NPSB 5HGAA 4PLOB 1R5IA 4YN3A 2XHNA 3MNZA 2CKBA 3EYOB 3LN5B 1CD0A 1M3IA 2BSBA 3QUXB 2DLEA 1A6ZB 3ESOA 5JPMC 1CF8L 3QJZA 2WXRA 2QQLH 3L4XA 5F3FA 3DRTB 1M9SA 1X9LA 2FWSA 4Y4HD 1CLVA 3DSFH 3DVNB 5I6PA 1SXAA 2ENSA 4ZMYA 3EW3B 5ANHA 2XSKA 1BQLL 5E2VL 4PJAA 3T8VA 5C0RL 3MV9B 3QXDA 3SKMB 1T0MA 3VFWB 1HZKA 5DFWH 2WLHA 3HE7D 3NA9L 2XTJD 3QR0A 3U79A 1YNLL 5D71L 4P2RE 4LLQA 3KWWA 1C7SA 4Y9EA 4BYHA 1H0DA 2XVBA 4I13B 1D7DA 3MRMA 1RK0A 4L5FH 4MDJA 1UOWA 3NJVA 1HDMA 4IRJA 5FYKH 3B8YA 3DC0A 4PJ6A 5BRZA 4PRNA 4RZCA 4W1TA 4UUJB 2Z64C 3F62A 3P11L 5DO2C 3RRQA 5JIKA 3O2DL 5CKAA 2AQRA 2IH3B 4WWID 1CBVH 2X4PB 4PRIB 1BOGB 3FQXB 4TMPA 4M3KB 4OZFB 1X5KA 1UQSB 4NQVA 2CGYA 3BX7C 4LSUL 2WWKT 4GS7C 3OQ3B 1B0WA 4WJKB 5KVGH 3CSTA 1EXUA 4FLSA 5DU7A 2QEJA 3N85H 1SXZA 2Z0UA 1ET7A 4GP4B 4YIQB 5D70L 5IQ7H 1Q9OB 4M8VA 1ZGLP 4OT1L 2JJVA 3CCHA 2WYTA 3FUNA 5EC1B 4QJ4B 4HUXB 5DA4A 4JFFA 4FTVE 1OP3K 1Z5YD 3MA7B 2PWDA 1EVUA 4R4BB 3ZE1B 4QRRA 5C0EA 5JXEA 3WD5L 3FF8A 3CUPB 1ZIBA 2VDML 3UTZB 4EDXB 4NHCH 1RJYB 3G5VB 3WJMA 2DL9A 3GO1H 1DVFC 1DE4A 1A3LH 2WSKA 3IU4L 3R8BB 3VXME 3SOBH 1WP6A 4QNPF 2J88H 2X2IA 3SE4C 3LZPA 4WWKA 5E2TL 2LU3A 3LCYA 3LNDA 3E8UL 1CU4H 1QLFB 3CIAA 4RDQG 2NT0A 4N8CL 4NN7C 3FOMA 2Z8WC 3GMNB 4KRPC 3GYRA 3U0WH 2TRYA 3B7UX 2RQ8A 3K2UH 2E4FA 1BF8A 1OGTB 3HNTH 2LHAA 1S2EA 1U92B 4L8BB 1E4JA 3VXRB 1G9NC 5HHXL 3W0WA 4JKPL 5E4EB 2BSSB 5ECJE 2MCPL 3ZJAA 2DJUA 4L1DA 3UP6A 4XCCH 3GSRB 1JZEA 2IWKA 3L2NA 2ZZUT 4MQTB 1DBAL 2F54A 3VU1A 1B4LA 2VDPL 4XBMA 1HILA 5F6HI 4CC0A 2G4EA 5I24A 1BWWA 1IV8A 2OMUB 4ELMB 3CN3A 5E5MA 4ZFZB 4AG4L 3AG2B 1TZ8A 3U0TA 5DUML 2VLJA 1V3JA 5C07E 4POZC 2CXKA 2YOCA 1KJMB 3VGAB 2NZ9D 4KK9D 2IDFA 1IBGL 1UZ6E 3TA3B 1SLVA 5C0AD 4CVXB 3D6GA 3TONA 1A7BA 1NFDF 4WW2A 4GW4A 5HD8D 5LN8A 1U0QA 2ZG2A 2NZIA 2JJUA 4XPHL 4DVRH 2GQHA 2EILB 1NC2A 4D0DA 2WKLA 4JKMA 4Y5YA 2ADFL 4YSDA 5EZOH 3KPLB 1XF4A 1Q9WB 3F12B 5J11C 5JNYA 4PBWD 3QJFB 4CJ0A 1CI3M 3WAJA 2YBGA 3SBQA 3EYVA 4H0GA 2XX1A 2ZXCA 5D4IA 3EYSH 2HT3C 2I25N 4OIIH 3KPQA 3BGAA 2EYTB 1J1XH 3U4AA 3GSOB 2CO7A 2GJ6B 1AGEA 1MAML 2FHFA 1JBJA 1IFHH 1UOKA 5E8DL 5JIQA 1DBBL 1YEKL 4X99A 4Y19B 5KSAC 1K85A 3EFDL 4P2YA 1HSBA 4AM0B 3IT8D 1P5UA 2WM0A 3FT3B 3QDGE 3QWNA 3FO2B 3ZDYF 4TULH 5B3SB 1QZNA 3QIWA 4N8VG 1I8IA 5J6HB 2H0PA 3FT9A 2XKSA 4IRJD 4ZD3H 1ZT1A 2ZNXA 5BRZD 3VYPA 4XVTL 1IEBB 2PKDA 4HULB 4UBDC 3MX0B 5HI4C 2EXWD 1QSEE 4UMGA 1H6UA 4IKLA 4HMCA 4P5RA 3CGTA 4IW4C 3S48A 5GGTL 1WWAX 4CC1A 3AUWB 4I18B 4OGXH 4W9ZA 5J6GB 1GZQB 3WLBA 1E65A 4W9DC 3FB5B 4IS6B 2XZCH 4YK4C 2B5IC 4Z7NB 3OB0K 4UT6H 4G1MA 5E9AA 5FF6B 5IVOA 1UWGH 3QHZL 2C9QA 5AW7B 1QLEL 2AP2A 4PJ8C 3BUQA 4MS8D 3P9LA 3FU7A 3W38A 2UWEE 4UV4H 4WO4A 5IHZB 3ZKMD 2YXMA 4JFFD 1XX9C 4Q2ZB 1N6QL 5HYSA 2XCMC 4KK6D 3R1GH 4UNVA 1B3IA 4QRRD 1VFOA 1VFBB 5JXED 2J20A 4JNXA 5F9DC 1TR7A 1UM4L 4NRZB 1I7UA 3VU2A 1INEH 4FERA 3UJIL 3TV3L 3S8GB 2RD0A 2XWBB 2TSBA 3N1QC 2ITEA 2CR0A 2W0FA 2YGQA 4EQ2A 5CFHA 4WWKD 3V9CA 4MDIA 3ULVL 1P4IL 3MR9A 4KKAD 4X8XA 4RGND 3Q5OA 2FLMA 4Y4HB 3CVHA 4H8PA 4KUCD 2CRMA 5JIDA 1MREL 3FH8A 2P43B 3HE7B 2XTJB 1EDHA 1RERA 3G3LA 5IB4A 2FB4L 3S3BB 2D7QA 1X5LA 3BO8B 2W0LA 4A38A 3WKMH 4F3FA 3GIVB 3NGBB 4R4NC 3W56A 1E30A 3W0WD 2AV1A 2BSTB 3ARGA 5D1ZC 5D7SH 3RP1A 4PGCB 3X11A 5SWQB 1R3IH 5HYJE 2I7SA 4H8UA 2F54D 1RJLA 1DHKA 4MXVE 1MPAL 2W9EH 3O3DB 3ME0A 4GUCA 1DFBL 1LK2B 4NKIL 2MTAA 3DPBB 4QTHA 2O5NA 3MLUL 3MLTA 4DNLA 3H85A 2VLJD 4FXGB 3RWCA 2I85A 2WSDA 5CD5D 1I3RB 1KDJA 5BUPA 3X1NA 3GNML 3V0WL 2WXMA 5ENWA 2L7QA 1ZT7A 4HWEH 2H3NB 2IBGA 3V4UH 3FU6A 2A9AA 3WFCL 2XBDA 4LHQB 5ADOL 5TDPA 1NC2D 3CDYA 3WTWA 3CSGA 1ITBB 1Y1DA 3SPIA 1WHOA 3PV7A 3PNRB 3LHAA 2J1ZA 3FCTA 3QUXC 3ZL4L 1X3DA 3GSNB 4GAAA 4I4WA 1WUZA 1J9CT 3B4NA 5CGMA 3QZLA 2MCG1 3BVNB 3AREC 1E0OB 4HUVA 3K46A 1Z9OA 5TQ0H 4PM1A 3EF7A 1QRNE 3IMWA 1NFIB 2BVOA 5GS0C 4Q97A 1X5JA 3TEUA 3MI6A 2IMMA 3LV3B 5CWSB 2ZQKA 4LPCA 3QIWD 1U2CA 4FFWD 5GSRB 3VXUD 4OI9A 3U7WL 1NC4A 4HJJH 5D5ME 5T5FH 1FVDA 2X3BA 1FZJB 2V7NB 3ROLB 3T2PA 3ULSB 4FQXA 3UGXA 4JFVA 2GB2A 2LVCA 3ULUE 4ELKB 1DP0A 3QH3A 1EA9C 4EI0A 3APFA 2CRZA 3NEOA 1YEDA 3U9WA 1KV7A 3CK0H 2VH5H 2Q8BH 3L3JB 1WUNT 1VRSA 3NZHH 3O9WC 3NIDB 4HH9B 1K6QL 4P9HH 5I1GL 2WO4A 1LEIB 1C16A 4LCWA 1RAMA 1PBYA 3S4SA 4FQCH 3TIDB 5IOPA 4N2CA 4WO4D 4U1IB 3L3OB 3S3SA 1CDHA 3PGFH 5C0AB 4NQXA 3A6OA 4MRCA 2I5YL 1PYWB 3HG3A 1GPOH 1KB5B 1JZ8A 3TEZA 4GAYB 4IBWA 4HIPA 5HGAB 1NPJA 1R5IB 1L9MA 2Z8VC 3ARPA 3GI9L 1L9QA 3MNZB 2CKBB 5C0BA 2W81C 1J11A 5KSUA 4FABH 2MNWA 2VZ1A 3IK2A 5EHFA 2WOBA 2RJMA 3RU8L 4L9LA 1OGAE 2C34A 2J4WH 1KBGH 2R0LH 4NENA 4HVBA 3NP3A 4PJAB 1E9QA 1MY5A 3QEQA 2P46B 3QXDB 2EUVA 1E5YA 1T0MB 1S5IL 2WYHA 2N0MA 3P9WB 4J3SA 1J1OL 3A4FA 4FJYA 3VI4F 4Z7QE 3EH3B 4LLQB 1NMBL 5FYLH 3KWWB 1TTRA 2VSKB 3WEXA 1XF3A 1DANT 4TXVB 5KVDL 1H0DB 1TTAA 3UTQA 3G6DL 2Y5TA 4YSSA 3ARGD 5CEZD 4GSDL 3MRMB 2CDGA 1RK0B 4IBTA 4MDJB 2YPVA 4MJIE 4HPHA 3F6JA 1HDMB 2J71A 4IRJB 3L1OH 5BRZB 4PRNB 4RZCB 3SKUD 4GO9A 2CA3A 1I9RH 2CAKA 2ZX6A 2Y1ZA 3IPEA 3ETSA 1KCWA 3LVEA 5CLWA 4Q74A 1MJ8H 1U95A 4G6AD 1UCBL 4DUVA 5DCCA 4ZPVA 3OLGA 5E8OA 4NQVB 4PJBF 3PE9A 4GG6A 4NKDA 1EXUB 3KR3H 2CLVA 3QRGH 2AJXH 1PNCA 3CFUA 3GDBA 1XSOA 4DUXA 4NFCA 1KGJA 2MPAL 5HI3C 4Z7WA 1JGLH 2WKGA 2Z34A 4XNXL 1OQOA 3FNKA 1Q9LA 3CCHB 4JRXE 5JIPA 4L3FA 5EF2A 4GLRI 3BAIA 3L7FA 4JFFB 1YY9C 2FEEI 3O4LE 5F96H 1F2XK 1WAAE 4RMTA 4YBLB 2FGWL 4QRRB 3VI3E 1XL4A 5C0EB 4F93B 1JI2A 2GG1A 1WLHA 3P4MA 3DYMA 3UO1H 3WJMB 1Z32X 1DE4B 3DHUA 1OP5H 1IIIA 4JDZA 4NAMA 2XY1A 1FN4A 5D2LF 3TWCL 5I74B 5CJBA 2AKRA 4HXBL 3IJ7A 1QNZL 2NY5C 3IBEA 4WWKB 4QTIL 4P3CH 3HMWL 1G6RL 4RGNB 3UAFA 3WENA 5T3XE 2G60L 3EH1A 5LBSL 4EKXA 1L6ZA 2ZKHL 3O8XA 2UX6A 4LSSH 2UUDH 3PXLA 5D93C 3FOMB 4OLZL 1ZA6A 3D48R 4ERSL 5JDSA 1NC4D 1O75A 4YLCA 1JGUH 1FJ1A 3WMQA 4XMPH 3W0WB 3GMMA 4GQPH 4FQXD 4KHTH 3E1F1 4Y5VC 3R8QA 3VGDA 3AG3B 2DWDA 4DIXA 2H3XC 3K81A 4KUZH 3WIHA 1D5IH 3OR7A 1PAZA 2F54B 4K0OA 1HILB 1BXXA 3KW7A 2VN4A 5E99H 1Y6MR 2PR9A 1NDTA 2OZ4A 2QPUA 4LCWD 3BZ4A 1X9UA 5E5MB 5CZVH 2EIJB 3U0TB 5JHDA 4XMTA 2VLJB 4WSGA 1KCVL 1U8MA 3KVQA 5DWPA 4K3DL 1RZ7H 3TCXA 2E7BA 3VW3H 4LF3A 1TCMA 2BVYA 4WW2B 4GW4B 5IK3A 1KPRA 5LGJA 5LQBL 1ZV5A 2JKTM 3PP4L 4HC1A 4JPQA 2WQUA 5HDQL 1NC2B 4D0DB 3BD5A 4Y5YB 4F7TA 3K8MA 2J6EH 4JG0H 1F6LL 4FP8L 5C0BD 5KJ4A 2CBMA 2QV2A 4PJGE 1DQKA 3GQFA 5E95B 1XF4B 1PLBA 2I9TA 5JNYB 1KN4H 1F3JA 3EYVB 2GIYA 2XETA 4FAAB 3V4PL 3C5ZC 4WTZG 3U2JA 4AEHH 2VC2B 3KPQB 1XMWA 2KYIA 2CO7B 3QEQD 5EUOE 1AGEB 3F5WA 1JE6A 3IJ8A 1MCSA 1OZUA 2O93L 4HKZA 2E4TA 4X99B 3QJQB 4OFPA 1HSBB 3OAYK 3PQYA 1P5UB 5BPPA 4WV1A 3I02A 1YJDH 2YD6A 3Q7JA 5JPNA 1D7BA 4FEMA 3QIWB 4AL8L 1I8IB 5CJXA 2DJSA 4YBQD 3OAWA 1ZT1B 2CM6A 2LAGB 2B3IA 4IKNA 3NDZE 3NJXA 5IHUL 5HGDA 1USQA 4W81A 4M62L 3ZRSA 1I31A 3ZGHA 2JLLA 2YBRA 3I75A 3QCUH 4WUKH 4ATWA 1V5JA 3CFBA 1JVOA 3WLBB 3P4OA 4KDVA 1HN1A 3ECQA 4X9BA 4G1MB 4MBRA 3AT8A 3C75A 4XXWC 3ZR6A 3O2DA 3SDCA 3VFNA 3JSSA 2MOVA 3FU7B 3P9LB 1J7VR 1TEGA 3LTVA 1H8SA 4WO4B 5ICYA 2V3DA 4A2MA 1PLAA 2VRKA 3HC2A 5TE4L 4EN2A 5M7QA 1FL5A 5HYSB 1A6WH 3T2NH 4YHLH 4NN6B 3DK2A 1LK3L 4RDBA 5FWRA 2WNWA 3WEAA 43C9A 3BE1H 4XX1G 3CDCA 4OFYA 1I7UB 5C6TH 2BRRH 3QCTH 5CEXA 1OE3A 3K8KA 1MCNA 3GK8H 4M93C 1OKEA 2W0FB 3IWVA 3QZWA 5C6PB 2A77H 3NACH 2H41A 4MDIB 1LQSR 3MR9B 4UF7C 3TV8A 1A14L 3SCMA 5IWLC 3CVHB 1T0OA 2ZUXA 3O8XD 5I30L 1YYML 1SHWA 5LBGA 1GOFA 3K80A 2AXWA 4ATTA 1ID5I 5IB4B 4NZUL 3DVGA 3D08A 3O6KL 4G70B 2AZAA 4F3FB 2Z1KA 1VIWA 1CZ8H 2Y07L 1ACXA 3VWJC 2AV1B 4KI5E 3ARGB 4RGOH 1P53A 5EN3A 3X11B 1YECL 1DQTA 3FRUA 5JZ7D 1FO0H 2Z93A 1UWXH 4RIRA 2LQRA 3AWEA 2D03L 3FTXA 3H9ZA 1RJLB 4PSRA 2H4EA 4E9XA 3H0TA 1IKFL 3ME0B 4AIZA 2XDHA 4OLWL 4QTHB 4CN1A 3MLTB 2DM7A 3L4WA 3M45A 5JHDD 4D8OA 3RWCB 1Z9MA 1AHWA 2VGLM 4FA7B 5KYUA 5ENWB 3GC3A 1ZT7B 5ANME 4RISL 2EACA 3K6DA 1OAKH 4K55A 4GAJL 2E3VA 3RI5K 5TDPB 4HHGA 2PW2A 2B0SL 1C1EL 1LP9F 5I1JL 1HH9A 1JGVL 3IRZA 3NABL 5IT2H 2UZXA 2ZYSA 2D4FA 3FCTB 4BFKA 1OAYL 4R26H 1N68A 4MNGA 4I4WB 5DVKA 4LKXA 4M9OA 1BVNT 4XTRC 3B9KA 4U1LA 3AITA 3SDXF 1PZ3A 3RTQC 3VMPA 5LG6A 2DH3A 4HUVB 1C5BH 1E4KA 1ZV2A 4ENED 2VDNB 4ETQA 1XGZA 3UZVA 4WU7A 2BVOB 1WPCA 5I1KH 1U3NA 3EJZD 4JPWL 4WEBL 2UZIL 3BFQG 3PQYD 4I3RH 1CXHA 2Y0SA 1G1CA 4F15B 4AOFA 4GAGH 4YAQA 4IMLA 3ILQC 3RPIA 3F8UB 4KK8D 2EO9A 1NC4B 1FVDB 5H4YA 3WXWL 1QA9A 1QUNA 3SPCA 4BK4A 5J57B 4FQXB 5EO0A 3QH3B 3INUH 4BZ2L 5GGSY 3UBXG 1YEDB 1ILUA 1JK8A 4PCSA 4OLXH 5CFAA 1IFRA 3D12B 3T0EE 5GGRY 1A3QA 1WZAA 2BVPA 2ED6A 3GEFA 1C16B 4KU1A 4LCWB 2TAAA 3MLXH 3KGRA 3S4SB 2EYSA 3L7EA 3SDCD 5IOPB 2CPUA 2DQEL 4MS8C 3TT1H 4AVHA 3HJ0A 4B7IA 4Z3IA 1CR9H 2ZIDA 3ZKMC 3TLRA 4J4PC 2VJXA 2GEEA 4Y16A 3P3TA 4NQXB 5FW8A 4YXLH 4KK6C 5TE7L 4AQAA 3TF4A 4X9HA 3A4EA 4J2QA 2PP9A 3CLEL 4BCXA 4OFYD 2F58H 5C0BB 3H6JA 1NLDH 4WFHE 5KSUB 3UO8B 2QADC 4M5TA 1BMZA 1ND0A 1F4HA 1L0YA 3NSJA 1U30A 4DESA 2QQQA 2PCYA 5D72L 1H8NA 3MOQA 4DK3A 4L9LB 1NWPA 2CO4A 4RGNC 3SCMD 5DHVA 2DICA 4LAQH 4PLNC 1QBLL 4WY7L 4AQ8C 2E0PA 4NENB 4LDLB 1BOYA 1E9QB 3QEQB 1H15A 3GS7A 3K6OA 2ZE0A 1DTUA 3QORA 1G84A 3BAKA 4MKMA 5KEZA 1KGCD 2B1HH 4KVNH 3VNYA 3BUIA 4HWUA 4TF4A 3PHQA 4TVPD 4C4KT 1F8TL 1TO4A 3WEXB 5C0IA 1UXSA 1XF3B 2DW5A 2Y4SA 3KM2A 3P30H 4LB8A 3RWJA 3UTQB 4B9ZA 2Y5TB 1UJ3A 1S7VA 1AOZA 2FNBA 3KPSA 2CDGB 4TNFA 1ZLSH 3GBMH 1WCQA 4S2SA 3T3MB 1L7TH 1OY3B 4YR6A 4HIIA 2A0LD 2ATKA 2FECL 3MCLL 5FGCE 5DS8A 1U95B 2I27N 3PYCA 4HT1H 1Z0MA 3DUSA 3LXAA 4ZPVB 1MHHA 4YHPA 5E8OB 2RACA 1DLHA 3U30C 5JW3L 5GGVL 4GG6B 3PPEA 3ETBJ 4NKDB 3TOPA 2CLVB 4X80L 4OIAA 4KK5D 3UZEA 2AABH 4FFVD 3SO3C 4Z7WB 4WSJA 3B6SA 3TBTA 3MLSL 1J86A 4GSUA 1Q9LB 3HCVA 4W4NA 4CMHB 4A7SA 5J7CC 1XBDA 3L7FB 3K6NA 4X6BA 4UILL 5ITBH 4XODA 4G8GA 1N4XH 3ZT5A 4CC4C 4AZ8A 2W91A 4XVUD 4X6DA 2Y7QA 2Z9TA 1LO4L 3P4MB 4IBSA 3LYRA 4CN6A 5BZDA 4N5UA 4GI9A 1LMIA 4FYRA 4JDZB 4NP9A 1X44A 2O6EA 1FN4B 3BMWA 3QUMH 3B9KD 5J13B 1C8PA 2Y72A 3WJLA 2AKRB 3H4HA 1SHXA 4U3CA 1N2RA 4XMKH 5E5LA 2J2ZA 5DMYA 3Q5YA 4BXSV 5TH2A 3NZ8A 1DJSA 2F7PA 3O8XB 5I0XA 1P5UC 2W65A 1AYOA 1Y18A 1N59A 3D0VA 3M1CA 3Q9PA 2MMXA 1W72L 1ZA6B 4OZGA 5T3XH 5JDSB 1IM3A 2Q86A 2YPLA 4KOCA 4Z3GA 2EUXA 1FJ1B 3L5HA 1A1MA 1FBIL 4XVSL 3GMMB 1TVHA 2GY5A 1WFOA 4RRPG 2KKQA 4NLHA 2DWDB 4E9VA 1UTDA 1QPXA 3WV0A 4ZMWA 1UCTA 2CUHA 3OR7B 4HXAH 1AR1C 2Q1EA 1EFXA 4S1RL 2XPGA 9PCYA 2G0LA 2H6PA 1XD0A 1JAEA 2HLEB 3BZ4B 3KLQA 4AMKL 4Y2DA 5IV2A 4X83A 4F57L 5JHDB 4LIQE 3TX4A 5IJKA 1KIPA 2I69A 2XIBA 1U8MB 4H13C 1TEFA 1V3KA 4PRPA 4BQ9A 4LF3B 4Y16D 2DI7A 3WELA 1NCBH 1WS8A 3IMRA 2WVUA 2B08A 5IK3B 1KPRB 5LGJB 3V0GA 3K71A 1UGKA 1IE4A 1U8JA 3LKRA 4YHYB 4R97C 4N9OB 4UM9A 4F7TB 4KZEL 1L4IA 2G5UA 4BIKA 4ETYA 1HYSD 2I9TB 5DZNA 1XO8A 1CYGA 3RVXD 2QSVA 3TEXA 1F3JB 1FFNA 1UZ6F 2X6CA 2HRLA 3N50A 3WE6A 3RWFA 3N9GL 3ISWA 2VLKE 5AG9A 4G42A 1QZ1A 1E3ZA 2X2JA 3ZE2E 2WGNB 3D25A 3GDCA 2X41A 5E6UB 3X3GH 3UMTA 3QORD 4XBEL 2RCSH 3F5WB 3IDXL 1XH2A 1R9FA 1FNFA 5AKTA 2FDBP 1JJUA 1MOEA 1HHKA 1L7IH 2J8HA 3DRQA 3N0PB 3U1SL 4JQVC 4HKZB 5FK9A 4G8EA 3PQYB 2KPNA 4WV1B 2BS71 3I02B 4X7TA 2P5EA 3FU0A 4ZTPH 5JPNB 3EH2A 1CFVH 3EH5B 3U0PA 4FRWA 3KPSD 3ZHLA 3ILEA 2Q87A 3MRCA 2KZBA 4P2AA 2CE6A 1NGZA 5CD3A 5IJBC 1IARB 4DP0X 2XQYK 4MCYA 5HGDB 4GMSH 2QLVB 5HDBB 4CMMA 3BVXA 3D4ZA 3GXTA 5IVNA 5AG8A 2YBRB 2YN5A 1VGEH 3I75B 5FDYA 1M7DA 4AT6A 4FQ1L 1OV8A 2VDNH 3CFBB 4M3HA 4OZIE 3P4OB 3B2UD 4FXLA 3QHTC 2L4OA 2NSXA 1A7OH 1MRFL 3SDCB 4P5SA 3VFNB 2C4XA 4RVBA 1Q38A 4PUBL 1WRFA 1O5DT 2YEQA 2H6UA 4M7JH 4B0MB 5ICYB 3MQIA 2VLRE 5HGBA 5L0QB 4O02A 4G8GD 3UEZA 1FL5B 1RUAH 3ILPA 2XRAL 1EGJL 4PJ7E 4X7DC 4OKDA 2D7TL 3BPLC 5IM7A 1SHSA 4HEME 1IGYA 2GSGA 43C9B 1AI1H 1RIHL 2BS9A 2BZDA 3TBYA 5CEXB 3WSQH 4EOWL 4ZI8A 1WE5A 3I50H 3QZWB 3LMJH 3VGBA 2CBTA 2YGOA 4ES8A 5I1IH 5GGQL 1MELA 2FE0A 3ASOB 3COOA 3JWDC 2GPZA 2D7PA 4IRZA 5D4HA 5JTWA 2R9HC 2A9BA 4LARH 1U6AH 3BYTA 3ARUA 5D1XC 3DLQR 3SCMB 4YEFA 3N41F 5C3IA 2BDNH 4NRYA 4HISA 2PR4L 4WNJA 1HE7A 3VTMA 3I6SA 4KQ3H 3GS0A 1RJZA 5AD0A 1OSPL 4MAYA 4TUUA 5IW1A 2HWZL 3JUYA 4YSTA 3KJ6H 1O6VA 1WIOA 1IM3D 3AWGA 2YPLD 3DVGB 1RULL 2IAAC 3U83A 4NUPA 1W16A 2PWGA 4QHKI 1EJFA 3TASA 3ZO0A 1MWAL 1EHLL 5LBSA 1AS7A 3ATEA 1LO2L 2YKLL 5L8KB 2GUOA 2CHXA 1X9QA 2ORBH 2IFGA 1AQHA 1QLRA 3ZTNL 5JW4R 1T04A 5F6HJ 3FRUB 3TBCA 3VM5A 1USZA 2Z93B 2B2XL 4RIRB 5EF0A 5ERWA 2BM3A 2O5XL 3UAEA 3H0TB 1EFXD 3APMA 2HUHA 3Q8BA 1HCZA 4AIZB 1F86A 8FABA 4Y2DD 1BLIA 4MA7L 1PQZA 2JXMA 5KG9A 1AHWB 2JFCA 2BNQA 4PRPD 5C09E 3PIQA 3V0DA 4M1DH 5KYUB 3UJJL 4ADIA 2N7AA 4PGBA 4N2MA 4Y4KA 1UA7A 3HAEG 3PF2A 1JYXA 2YD5A 1FYTE 2X5PA 1AHMA 3RWDA 1GOHA 4G7VH 3RKDC 1F41A 4ZG1A 2PW2B 4UM9D 4A67A 5JHLA 1UGNA 4B60A 4N2BA 5L9DH 3D50A 1HH9B 4BH7A 2E27L 1GGCH 2NYYD 3FTGA 1HZHH 2UZXB 3GZQA 2R29L 5FCUH 3S36X 4A1RA 2MFNA 2QGEA 4MNGB 5HYFA 4H0HB 5IFHL 4LKXB 3ROOA 5AW8B 3B9KB 4U1LB 3IMVA 2F8VA 5HP5A 2CRYA 2ICEC 3HE6A 4FQJL 3PXJA 3BH9A 5FIEA 4ETQB 2WNGA 3EJJX 4L2LA 2MRYA 4WU7B 3UZVB 2G30A 5EU7C 3BUYA 3QW9A 1E3FA 1KEML 3JZYA 4MMZA 5AAMC 2EDJA 2P5ED 3U7AA 3V4PA 4YAQB 4IMLB 3RPIB 3QR1A 4Y89A 3AXIA 1G7PA 4FDWA 5GISH 5GZOC 1NKRA 4JRLA 4YBQC 5K9OA 5HJDA 2DM2A 1QA9B 1QUNB 3EJYD 1BJ8A 3FB8A 4DP1X 4JHUA 2K6WA 5D6DA 3B7TA 5DJAA 5EO0B 5JMOC 3QVAA 1B9KA 4ZMTA 1MEXL 2GTWA 3RJQB 2DEYX 2XVLA 1QHQA 1JK8B 1CMOA 4TQIA 2B20A 2YK1L 2BVPB 3VMNA 1MIMH 4MA8L 3CXHJ 3I9GH 4N68A 3E1ZA 4X4MA 2EYSB 3A67H 3L7EB 3KLHD 2GHZA 3INOA 2I9LA 1AQKH 4O4YL 1QR1A 1ES0A 3ULUF 2RTTA 3ORJA 4OQTA 3EFOA 1O0VA 1SYVA 4OFQA 4Y16B 5CJQH 4N2IA 2OXHA 3KD4A 1JYNA 1JIBA 4AQAB 1OP5K 4DK6A 3MXWL 1YYCA 5MEPA 2PTUA 1ZVYA 4QRAA 4EDWL 3ML9A 4D8PA 1CDUA 1H6TA 5CGBA 2OQJA 5LBVA 3JTTA 2J3SA 4N22A 5BUAA 1A9VA 1ND0B 4K5PA 5J13C 4AKQA 1JZGA 1NCDH 1T0PB 2RMNA 2UUDK 5DHVB 1JZDC 3APCA 2VMJA 3RVUD 5EEZA 3QORB 1ETJA 1H15B 4NAJA 1W0VA 3B7SA 2XWZA 1WT5C 3BZ5A 4MAYD 1QYGH 1FCCA 3QZNA 4NN5C 2KLSA 3QZMA 3Q43A 4LCIH 4CRPA 3PHQB 1TZOA 4JL2A 4IBVA 4HQQL 4W9GC 5C0IB 1UXSB 2VR4A 2P52A 4OM1L 4PP1C 3RWJB 4CU8A 4DT2A 2J57A 4ZNEA 2FBJH 3K6SA 1UJ3B 1S7VB 4HETA 5CKGA 1NTDA 1NSNH 3KPSB 1UUSA 3C60A 3PAUA 1BEYH 4FNUA 1ADQH 4G9FE 4S2SB 4P2OA 4EKJA 4F8NA 4YR6B 1HIMH 2WUBL 2ZCZA 4HIIB 2ATKB 5MP6H 4IKJA 2P47B 4LLUA 2WWNA 2FH8A 2WTOA 5DS8B 4WW1A 5I0YA 3DUSB 4P3DA 1LNUA 1MHHB 4PRBA 4P0DA 1T7VA 4YHPB 5CAYB 1DLHB 3N3EA 2YMXH 2V3EA 3B3BA 1QOKA 2BNQD 1BCIA 3FHAA 1LTXA 4KY2A 4MRBA 1XF2A 3IE4A 2VAJA 4Y4KD 3B6SB 3TBTB 4MYPA 4TSCL 3HCVB 4GRWB 4DKDC 2HVJA 1XSIA 1KJ2A 3BGMA 4X6BB 4NQSA 4G8GB 4I48A 4D9LH 4CADA 4AZ8B 1A65A 3CU7A 5MI0B 3NCYP 4X6DB 5TF0A 1IVTA 2Y7QB 3BZFA 3BPOC 4BE5A 5BZDB 5J8OA 1AE6H 1GS7A 3CWGA 1OPOA 4KMTL 3SD2A 2VDKB 2GCYA 4ODVL 2WZAA 1KYOJ 4IYKA 1QTYT 4XX5A 5SWZA 1EANA 2VN5A 3HG2A 3PNWA 4WJ5A 1F4YH 3MJ9L 5C6WH 1P9MA 4PCKA 1N12A 1CFTA 1N2RB 4XPFH 3HE6D 1HNFA 2J2ZB 4ENEC 5TH2B 3ZTCC 1XH3A 3NZ8B 4UQ3A 1IGFL 1KCSH 4WKZA 1X4XA 1W91A 4YC2B 2Q8AL 2W65B 2NXZC 1Y18B 3BFOA 1N59B 2EVGA 3D0VB 3WKNA 4RWYL 2D9CA 3K7UA 3GLDA 2R4RL 4OSUL 4OZGB 4PJFA 1IM3B 2Q86B 2YPLB 1J18A 5LUMA 2A4ZA 2CLZA 3OJMB 1KXTA 2FQDA 2AERT 1A1MB 2BNRD 4OCYH 4PJ9C 4YHIA 4AGLA 1ZDSA 4ZW3A 1TVHB 3W1ZA 3VXRE 1BVKA 3L2MA 1J88A 4IBQA 4K5NA 3VB8A 2YRLA 2NY7L 1OAXL 1A66A 3SDYL 1FPTL 1RUML 1MSPA 2XQBL 3AFLA 3CHPA 3E80A 4AYSA 1EFXB 5SX4H 1I8AA 2XPGB 2Z3FA 3B1UA 2H6PB 4A2GA 1RFDL 5TDOA 5J0BA 2E9BA 4Y2DB 5IV2B 4K7PH 4ONFH 3S37X 2QL1A 1KIPB 2WZPA 4PRPB 3B7RL 3FSWA 3IU3A 3VQMA 1F45A 3HN5A 4J3TA 4OCXH 4BWWA 2AJYH 3BSZL 3KGSA 5I1CL 1QWNA 3OQRA 5FHBL 3H7BA 3GXIA 4JY5L 4OD1L 4LE8A 5EFIA 3K71B 2J8UA 1U8JB 2JTDA 3LKRB 4XP5L