1RH8A

Three-dimensional structure of the calcium-free piccolo c2a-domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
142
structure length
142
Chain Sequence
ASHPITGEIQLQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLMKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Piccolo protein
publication title A conformational switch in the Piccolo C2A domain regulated by alternative splicing.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 20
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2003-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1rh8A00
2FK9A 1E90A 3F00A 4GNKB 2A4ZA 3QR1A 4AJWA 1DQVA 4WWOA 3PYCA 4L1LA 4ANVA 3ZVVA 4Y1TA 3L08A 5G2NA 4XE0A 4F92B 3HHMA 2CHXA 1DJIA 4A55A 3T8MA 5CCJA 5KJ7E 3FBKA 1QASA 2NSQA 1BYNA 4FLHA 3QJZA 2NQ3A 1RH8A 3ML8A 4L1BA 3RPBA 1UGKA 3ZW3A 3L4CA 3P2BA 1TJMA 3CSTA 4PS7A 4AOFA 1E8YA 3F05A 4ICWA 1DJGA 2D8KA 4PS8A 2CM5A 3NZSA 4G11A 4L2YA 1A25A 3R7RA 2RD0A 3ENEA 2R83A 3OAWA 4OVVA 2Z0UA 2ENQA 4KZ0A 3QK0A 2WXKA 4J6IA 2CJTA 3QR0A 4NS0A 4QJ5B 4WEEA 5JHBA 4L23A 4LT7A 4QJ4B 3JZYA 2WXHA 5CCGE 1WFMA 2WXIA 4NP9A 2WXRA 4ICXA 4FULA 2UZPA 4FADA 1E7VA 4KITB 2YRBA 2Q0ZX 1BCIA 4ANUA 1QATA 3QAQA 3APDA 3QARA 4ANXA 4QJ3B 5JHAA 1DJYA 2FJUB 2QZQA 4DNLA 4FJYA 2CJSA 2NCEA 2YOAA 3IBEA 1UOWA 1E8WA 3TWYA 3MJWA 4ANWA 2JQZA 3PREA 3M7FB 4URKA 4DK5A 3NZUA 4XZ4A 4TUUA 2K3HA 3GPEA 1WFJA 3PFQA 3L16A 2Q3XA 4MJJA 3B7YA 2Y3AA 3RDJA 3PRZA 3HN8A 4NPJA 3OHMB 4WWNA 2WXMA 1DSYA 2ENPA 5EDSA 3L54A 2WXQA 4LDCA 1E8XA 2QZ5A 4WAFA 1GMIA 1RSYA 2CM6A 4OVUA 4LCVA 4JPSA 4IHBA 4V11A 4WWPA 3L9BA 3TJPA 3KWTA 1V27A 3LJ3A 3N5AA 1CJYA 1DJHA 2WXFA 4HVBA 3FDWA 3PS6A 3W57A 4HLEA 1UOVA 4GB9A 4QAMB 1YRKA 1DJXA 2CHDA 4FJZA 4TV3A 3R7QA 4F1SA 4EZJA 2X38A 3ZIMA 1K5WA 4BFRA 4IQHA 2EP6A 3L17A 3ML9A 2A5UA 3CSFA 5H4ZA 4KZCA 3S2AA 1HE8A 2ENJA 2K45A 3F04A 3APCA 3W56A 2B3RA 2CHWA 3F01A 4PS3A 4FA6A 2DMHA 4FHJA 1W16A 1DJZA 5CCHE 2K4AA 1RLWA 3SD5A 2ISDA 2BWQA 5T8IA 4F91B 2WXNA 1E8ZA 1DJWA 2ZKMX 2WXGA 4NPKA 1BDYA 1TJXA 5H4YA 2V4LA 1E7UA 2WXPA 3KWUA 2KI6A 2WXOA 4TS6A 4EZLA 2K8MA 4XX5A 4BGDA 2WXLA 4F93B 2WXJA 3L13A 2CHZA 2DMGA 3APFA 3NSJA 4Y1SA 2LHAA 5G55A 2N1TE 3DBSA 3HIZA 3TL5A 3DPDA 4EZKA 4FHKA 3IM1A 1W15A
chains in the Genus database with same CATH superfamily
1YDPB 3LEXB 3N9GH 1R46A 4U4IA 4GG8A 1A1OA 1PEZA 2R4SH 5CNHA 3RY4A 1WK0A 3KM2A 5IFAH 4GG8B 2DD8L 3HE7D 2J8UA 2BOBA 4HOMA 1EWHA 2BOBB 2J8UB 3C08H 3PQYD 2OSXA 2XA8H 3HN5A 4G82A 4LHQB 1QSEA 4JLRA 3KPQA 3WIHH 1QSEB 4JLRB 2OQJA 4EZMA 3KPQB 2V2WA 2OQJB 3P2BA 5KTEH 2NDFA 4LEXL 4IK6A 1P4LA 1C5CL 1BWWA 3V6BR 4KKNA 2MPVA 1P4LB 2OXHA 3VVVA 4WTXA 5DURB 4WQOA 8CGTA 1JGLH 1GS6X 2DM4A 4X6CE 4XPHL 5DC9B 1MZZA 4HS8L 2ODHA 3WFZA 1S7VA 3T09A 2VXVL 1S7VB 3HA0A 5DJCA 5LCVL 2F53D 4LMQI 5DJCB 2V3FA 1OAYL 5K9KA 5A3IC 4HAKA 4DUXA 2UZPA 4ZO6A 4NQDE 2DM2A 3NQIA 1I4FA 2NY2B 1SQMA 4QJ3B 4MMZA 2VZSA 1EJ8A 1I4FB 1AHWA 1EBPA 1ZVNA 2FJUB 2HT2D 2OX5A 3PWPE 4M03A 4MMZB 5B3JE 1AHWB 1U95A 2OX5B 2CE6A 2BVYA 5F6HI 1U95B 1SYSA 4U0RB 3RX8A 2EVGA 1SYSB 3F7YA 4MMXA 3UTSD 1IJ9A 5KBNC 4MMXB 3EYUH 3QJQB 2BX5A 5IBTH 3T0EB 3S2CA 5LQBL 4MAUL 3DX8A 3PE9A 1O5DT 5A2JH 4UWQB 3T2PA 1YEHH 4ZMXA 2OA9A 1BXVA 5KSBA 2WWNA 4AL8H 2TRYA 1RK7A 3ALWA 4XNQA 1A6PA 2IH3A 4XNQB 1A6TA 2IH3B 1UEYA 2E47A 1A6TB 4HFUL 1JFQH 2VL4A 1HEJC 3U9WA 4EVNA 3X1BA 4EVNB 5E03A 5I74C 3EFFA 1RVFH 1GIGL 2WVSA 3FTXA 3QNFA 3FFCD 3EFFB 1DQIA 3C60A 4CNIA 5I0DA 3JYBA 4Y2LA 3BVVA 3C60B 4CNIB 4XNMA 3CFDA 4XNUH 2VUOA 4XNMB 5AKTA 3CFDB 5C6TH 2IO5A 1M1SA 4K7PH 4L4TE 1UOKA 3AUVA 3NSXA 1FG9C 4HSCX 2JCCF 3SKJL 5T5FL 3F7KA 1M56B 4KHTH 3VWKA 3ULVH 1NCIA 3VWKB 4PWKA 3QDGE 4DW2H 5CWSA 5HHOD 1S3KH 5CWSB 4WI2A 1VACA 3X3FL 1E42A 4IKNA 2CGRH 1VACB 1QSFE 3M1BA 3UBGA 1XF1A 3M1BB 5TDOA 1T66C 3ATEA 2VAAA 5TDOB 2VAAB 2JIXA 1HWHB 4NN7B 2J1YA 4YHLL 2JIXB 3KDMA 4YEFA 5IHUL 4NWUH 3F05A 3KDMB 2IPTL 4JGNA 5SX5H 1BD2D 4OZIE 4PLKD 5IJDC 3LNHA 3HW7A 3QT2A 5EO1A 2CLZB 5E00A 4KQ4H 2WD0A 1PCXA 4G7SB 5EO1B 1SMAA 5E00B 2SEBB 4GAGL 4NENA 2RCSL 1SQ2N 2ZUYA 1JZFA 2Q7YA 4NENB 4I4WA 2JJWA 4XC1H 4R4BA 2Q7YB 3QYCA 4I4WB 2WW8A 1CFNA 4JO2H 4R4BB 1FVDA 5A6IA 1E4XL 1FVDB 3L7EA 5HJDA 1FH5L 4E9XA 3L7EB 4PWHA 3D12B 3VQMA 3D07A 4FI6A 4R84A 3MRMB 2RTTA 3A6BL 1TG8A 4G6MH 5A6LA 1MHHA 2ZZUT 1U3HA 2XWZA 4HJ1A 3WFDL 2W65B 4WV1B 3ZUNC 1U3HB 1KCVL 1VRSA 3GSWA 4ANWA 2C9SA 3GSWB 5FIEA 1A0QH 4HP5A 1E5AA 2CBOA 3C6LC 1DQDL 3CMOL 3BUBA 3EH4B 4M61A 4WW1A 3VXMD 4M61B 4PI0A 4NQUA 4WW1B 2ED6A 5B4MD 3W11C 1XVSA 2VERA 3E7JA 4YO0B 3GI8H 1KXVC 4P3WA 2OM5A 2YPLA 3NOIA 1H3UA 1THCA 4MZ2A 2YPLB 3E1F1 1KCUL 4RMTA 5DJ6A 5ICZA 4WCYL 3IGFA 5ICZB 5JW4R 3TH2T 3SDAA 4HKJA 4IHOA 2BY1A 2TSBA 5F1SA 2KT6A 3B9KD 3SDAB 4F37K 1T89C 4IHOB 3SE8L 5CCKL 4KQ0A 1H6FA 3DLQR 3NSYA 3NACH 3DHPA 1SXBA 4N2OA 5JR1H 5I8CB 3ETBJ 5CJQH 3ESPA 1CL7H 1JPEA 5JDSA 4G7VH 3X1GA 5JDSB 2WK2A 2XWCA 4E9WA 4BK5A 1SHWA 4HC1L 3GDBA 2DV6A 1WZ1H 3SDDB 1EUUA 2YUVA 4CBPA 4XO9A 3CFTA 4XPGH 5K33A 5I1EH 1OGAE 2YEQA 1A7BA 5EIIA 4M8RA 4YLBA 3AREC 2YXVA 4I48B 4YDIH 1ZEAL 1L6ZA 1UJ3A 3FQ1A 4NO2A 4AKPA 4XP1L 2P28B 2BOCA 1KBGL 1UJ3B 4NO2B 4TRPH 4DQAA 1WGOA 3QEGL 1FO0H 1WAAE 2BOCB 4BEIA 1FPTL 1CBVH 1JHLL 5KANI 3UH8A 5B38G 4X4MA 4RFOH 4QY8A 4BZ2H 2UWEF 4QY8B 4F80A 1UB6A 2VN7A 3FT9A 1UB6B 3MOAL 2ICWJ 1S4IA 3BH8A 3U25A 2HFTA 4ZMWA 4LHJB 3BH8B 3IMVA 4RQQA 1CBJA 4FXGC 1JPFA 4RQQB 2WOBA 4GXUN 1JPFB 3TTYA 1GGBL 3VXTA 3IDXL 5DZOA 1RHHA 5JHBA 3VXTB 1KC5H 3MXWL 1RHHB 2MTPA 4WUUD 3X17A 1DVFC 4NPYA 2QQLH 5JHDA 5JHDB 3WJMA 4JFDD 4W70A 3WJMB 1UKQA 2QZQA 5K5YA 1PG7H 2AGJH 5DVPA 4HIPA 5C2BH 5KW9H 5EWIH 1UCBH 2YD8A 4QRPA 3RIKA 3NP4A 4MA7H 5FYJH 5DMKA 4URKA 4N2CA 4MBRA 5AZEH 5DMKB 2YLHA 4P4KA 1W8OA 3BUQA 4P4KB 3ETTA 3LD8C 5T3ZD 2IH8A 2FX8H 1ZHBA 1ZS8A 4ZSOE 5TQ2H 1ZHBB 4X9FA 1EAOA 1ZLWK 1CD1A 1T0NA 3QFGA 1ZLVH 4Z7NF 4HHWA 5ELIA 1CD1B 1T0NB 4DP6X 5KZCB 1VF5C 3PU7A 4KPHL 2WXFA 4QGTA 3AS3A 4KHXH 1MCNA 1NJ9A 1F2QA 5JPMC 3ZKQD 3QUXC 4BZ2A 1NJ9B 5TD4A 3QEQA 5ILTL 1HAUA 2EP6A 3QEQB 3AG1B 1YEEL 1WZLA 1PMYA 3MOQA 3APCA 4YHYC 1HYSD 5K9JL 3PJSA 1ZVHA 3UYOD 1YAIA 3WS3A 3HE6D 3PJSB 4OJCA 3WS3B 1GW0A 1XF5A 3CVHA 3L5IA 4MHHG 4NQED 1HHGA 12E8H 1XF5B 3EJZC 1HHGB 5DWUH 4BELD 1M2OA 1ZLEA 2KC0A 2A3TA 4PG2A 4OLUH 1SXNA 5T3ZL 35C8H 3FQWB 4YHZH 4UTBL 2E7DA 4UTAL 2HPOA 3WTXA 3UFIA 4XCFH 4BWUA 4F58H 4KRNA 3K8LA 1E90A 2MCG1 3WFEH 5HYJE 2VCOA 4WFHE 4R7VA 4OGQC 3SKOA 5EIQA 3SKOB 3DJRA 1EHXA 2IBBA 5KVDE 4HULB 2J44A 1NGYA 3BH9A 3ARFA 1FE8L 2N4IA 3BH9B 1PLGL 3MA9L 5KS9E 3D52A 3H54A 3ARFB 4NC2B 3U6XA 1WIUA 4NUGH 4HLZG 3OMNB 2V17L 2XYCA 1F56A 2Y7NA 1UKTA 1DBKL 3WEXA 4R4ND 2GIMA 5LAPA 3WEXB 1AKJD 4NYLA 4NZTH 3DECA 5ESAA 4ZUVB 3N3EA 4NYLB 2OR9H 5ESAB 4AEEA 1RURH 2P5WE 4E9TA 3MJ9A 3IMBA 4LVNC 3KPPA 1A7NH 2NY3D 1AR1C 3K2UH 3KPPB 2AP2A 4APQA 2DWDA 2D3VA 4AC2A 1S7RA 4R7XA 2DWDB 4APQB 1DL7L 1GYWA 1KUMA 1S7RB 3APDA 4N2KA 4GQQA 4N2GA 1TVDA 3L3KA 5AW1B 1BWMA 1HHKA 3AQDA 3BAIA 3L3KB 4D9QD 2ZUXA 3EDEA 1HHKB 4HMEA 5EOQH 4GBXA 3CDCA 1WGVA 3KGRA 3DYMA 4GBXB 3S88H 5C0RH 4A7GF 1AS6A 4JMXA 2YJQA 3F7QA 2DDQH 2Y6SC 4JRYA 4KQ3H 5TE4L 1PD1A 2J3SA 2MSPA 4JMNA 2OSWA 2HPTA 4AH2A 4JRYB 3UEQA 3O6FD 1ORSA 1J1XL 3IK2A 4BQ6A 4UQDA 4J1UA 1QBBA 4NDMA 4ENZA 4GUQA 4WI4A 4J1UB 3ISYA 2ITCA 3BW9A 1QFWI 1LK3L 3PLYA 4NDMB 5IM7A 1N4XL 2ITCB 3BW9B 4HVBA 2K1MA 4GLRI 1JRHL 5IM7B 2B5IB 4JG0L 4MXWH 4QXUL 1NDTA 5J13B 1S9WA 3KLQA 4XMLL 3S37X 5BUGA 1S9WB 5C0EA 3NIDB 5CEZE 3B2UC 5C0EB 3ZKXB 3HFFA 4N3TA 1MHPL 4OGYH 1IM3D 3F01A 3FU7A 2VXSL 4LPXA 4J39A 4H1LH 3FU7B 1UUNA 1TQUA 1HKFA 1NAKH 3N1GC 3WU1A 1HE7A 3FOMA 3SOBL 3FOMB 2A6DB 4HSAC 3BEWA 5L7XL 3N55A 4U1LA 1ZGLM 3W1ZA 3MV7D 3BEWB 4U1LB 4ZO7A 5ICUA 5D7SL 3L13A 5HYEA 5ALCH 3MNDA 4XAWL 5E7FA 1OF2A 2CDFA 5AAMC 1SEQL 1MJ7H 1OF2B 2CDFB 3FNKA 4AE0A 1MIEL 3QQNA 4GW1A 3QI9A 3IS0X 4AYSA 1OLLA 4WGKA 2CJ3A 2NY7L 3QI9B 4GW1B 3IDUA 4D94A 3B3IA 2O6CA 2VMFA 4G3YL 4ANVA 2ZXEB 3N42F 4Y1TA 2EDYA 1RAMA 3CXDH 4NKDA 4NKDB 3U30B 3V0GA 5KAQG 3MFFA 4XBPA 3ZL4L 4TSBH 2BNQA 1G7PA 1UASA 1N8ZA 2YD0A 3HI6H 3QJZA 4XBPB 1F86A 1G7PB 2BNQB 1N8ZB 1RP8A 4JDVA 3INUL 5DJDA 4JDVB 5DJDB 3EJTA 3QRBA 5EA0H 2CM5A 1PIFA 3ELAT 1IIKA 2O1AA 3N44F 4BK4A 3A47A 3W39A 4S1QH 3NP3A 3ROOA 4CKQA 3J27A 4LPVA 3W39B 2VDKB 4HFUH 5D1QD 3NDYE 2BS8A 4ZMTA 5LBSA 4PRBA 4W4OA 4KI1A 4PRBB 2OULB 3RVVC 1P9MC 3GJFK 1PGRB 2X4RA 4TLKA 4H1LA 5EULV 3CU7A 2X4RB 4H1LB 5EBMA 1J7VR 3BI9X 1IV8A 5KBKA 2DWTA 4ODXA 4N22A 3QZWG 4ODXB 1PS3A 4BFIA 1T80A 4M43L 3P3YA 2VQTA 5J8OA 4BFIB 3IU4L 2IPUK 1LDSA 1PZBA 1JNJA 3CIQA 4TL5A 2RFXA 1U30A 5K39A 1TQTA 2P5ED 3ILDA 3AQYA 2RFXB 4GKZA 5K39B 3RILA 1NUNB 3FUNA 4KVNL 4N85A 4OCWH 3H9SD 3EUDA 1T5XA 3PQYB 2WLJA 1T5XB 5BXFA 3IN0A 4L9LA 3QXAA 1RZ7L 5CU9A 5BXFB 1AZCA 5EOCJ 3IE4A 3QXAB 4L9LB 5EU4A 4P8QA 5HJGA 3O3AA 3X3FH 2ZOOA 5EU4B 3ZT6A 1X7TA 4JPIA 4G8FA 3O3AB 1W72A 1QKZH 4IRZL 4JPIB 1F4WL 1KYDA 4G8FB 1ETB1 1JDAA 1BSIA 1JZEA 1W72B 4TN9A 5TK4A 3VB9A 3MLWL 3WG7B 1NAML 2QHLA 3EADA 3IWUA 3O8XC 4XTRD 1RZJL 3D39D 4K55A 1T7XA 3FTWA 1O7VA 1RIVH 3NFSH 2ITEA 4KV5E 3TEXA 4GSDL 2Y9RT 2ZP0T 4GUCA 3BZ4A 4PP1C 1MSPA 3BZ4B 2YAQA 1J1OH 1S78D 4OCMC 4GAGH 5EDXA 1N9PA 4XCEA 4QTFA 2KLSA 2RCSH 2IC2A 3V52L 4XCEB 4ZS6D 3A67L 3H1ZA 1NFDA 1TVHA 3QQ4A 5FGBC 3EO9H 1NFDB 1TVHB 3QQ4B 3NCEB 1ERNA 1INDH 3MACH 3B7SA 2ZG1A 3H4HA 3UTSA 4U1HA 2F8OA 1MVYA 3EG9A 4F2ME 3UTSB 4KNUA 4PY8I 3EG9B 4RGND 4NKIH 4MJ4A 1ETJA 3MCG1 2ADFL 2P1YA 3TIDA 3QWRA 4H0IA 3CMOH 3U83A 1KACB 1P6WA 3FT0A 9CGTA 4XVJH 4FGMA 4NQCD 5CJOH 2AEQL 1DN0B 1R3HA 4YDNA 1UWEL 5I6MA 2BIIA 5DHDA 4BBWA 1R3HB 5CGYC 4WVRA 3LRKA 4PN6A 2P46B 4OFDA 2YS4A 3QISA 3DUHA 4BZ1H 3KYMA 1LEIA 5EZPA 2J6EH 3V2AR 3KYMB 3B7RL 3QHZH 1LEIB 5FYLE 1ROWA 4PJAF 1X9QA 2DTMH 1DVQA 1F4XL 3F83A 3RI5K 3OHXC 4DKDC 1WS7A 4S1DC 3FQXA 4AYID 4GG6E 1LK2B 3FQXB 4YWGL 1QLEH 2VKWA 2R1WA 2R1WB 2VR7A 2COVD 5E8DL 1J10A 2D9CA 2DI9A 3NCWA 4AENA 3KW8A 4RBPH 4AENB 2YZ1A 3Q9QA 2WOYA 3PV6A 4YR6A 3TLRA 5I18H 5E56A 1X44A 3VI4E 1TJIH 4YR6B 5F3BA 3M7FB 3UAJA 5F3BB 3MCLH 4ZS7H 2W91A 1QI4A 4W9LC 2DAVA 4C58B 2XZZA 4L8CA 3M45A 4IMKC 3L8QA 2VW4A 5DD1H 4L8CB 1MLBB 3BAKA 3HAEG 3BISA 1CXLA 1HWGB 1KBGH 3P9MA 1FDLL 2DH2A 4MD0A 1TLKA 3SPGA 1SDYA 3P9MB 4OQ1A 4MD0B 3QXVA 3FDWA 2C1PA 2OI9C 2C1PB 4CU6A 1CDCA 2XQYA 1PZ5B 2D31A 1BD2A 3MYJA 4MCNA 4LP4A 2D31B 1BD2B 2PUQT 2A6JA 3MYJB 4EN3A 5L88L 2ENJA 1TCMA 2A6JB 4EN3B 3H85A 2YQ2A 1U8PA 2J6EA 4ODSH 2P44B 1G7IA 1U8PB 1YEGH 4N5ED 3LS5L 5D72L 3ILPB 5KVDL 4EI5C 1G7IB 5CBEA 4OLZH 2AXWA 5I8EA 3DX2A 3ZPDA 5CBEB 1EZLA 5I8EB 3ECWA 3X13A 4N8PA 2NY4B 3X13B 3H6AA 2VXQH 1E5YA 2DBLL 2ZOLA 3DBSA 3ME0A 3HEIB 2ZKHL 3ME0B 2MOQA 5MHSE 1XGYL 4X6FA 2YUZA 3KS0H 5CAYB 2R59A 2ZCHH 2WBXA 3VXMB 3ULUD 4GS7B 2F8XC 1GSKA 4PJFA 1IQWH 1QRNA 3VXRE 2PKDA 3PNRB 4PJFB 5AB9A 1J0KA 1KV7A 4ZAKA 4DKEL 4P9HL 2ITFA 4ZAKB 3ZL1A 3GBEA 2D4FA 2NNXA 4U1IA 2WGNB 5IQLA 3OZKA 4U1IB 1IC4H 1YY9D 3U4KA 4PJEF 3J8F7 4KO5A 4HG4J 1BFTA 3E3QE 3ILEA 4J12A 2MHAA 3MXVL 4OKDA 3OAWA 2MHAB 2PTVA 2W38A 4MYPA 1X9UA 3VI3A 2COQA 4WI5A 1UZ6E 4AI7A 3M07A 3VI3B 3NJLA 5GS0C 2VR3A 5JIMA 1GYVA 1CXEA 4A2GA 2QQNL 4U7SA 4KMQA 4Z3HA 1MRFH 3OD3A 4UT9L 4QGYA 4TUKL 1CI5A 3ULUL 3SQOL 3DTDA 1R0AL 2NXZD 4DKAA 1BQHA 3HNTH 2VXQA 1UOWA 4BKLA 5EOTB 4BKLB 1F5WA 5T3ZH 2JB5H 3ATFA 2J8OA 1MFDL 4TMPA 2AANA 4B9CA 1GTFA 3QZPA 1X5MA 4JFZH 4JZJB 1J9CT 4PCTA 3LTVA 5EDSA 3S34H 2Z31A 3TWCH 4ZUTA 1JZ5A 4OM0H 2Z31B 1VKXA 4KY2A 3KWTA 4ZUTB 2QR0A 4UT6H 5MENE 3IDYC 1DP0A 1VKXB 2WINA 2QR0B 2O5YH 1A7QH 2WINB 1QTPA 2XACC 1L9TA 2Y2TA 1WBXA 4JFTA 3TT3H 1WBXB 4NN6C 2IG2H 4Y4KA 3QUML 3UBHA 1CICD 3W56A 4NM4H 3K6OA 5JZ7D 3AM8A 3L2MA 5IJBC 2A74C 3GXMA 2CBMA 2PXYD 2LVCA 3P11H 3THMH 1A3QA 1RUML 4AQ1A 5E9NA 3V6OC 3O45B 1A7RH 1SUHA 4AQ1B 4OM1L 3CJJA 5FGCE 2E6QA 2IGFL 4WUUB 4X7SL 3MBEC 1QWUA 1I8KA 2WN2A 4TS6A 5BW7A 1I8KB 3IETA 1KF9B 4JFDB 4XN7A 3IETB 3LKRA 1PX4A 2R9HD 3NJKA 2JKXA 3LKRB 4FNRA 5EV7A 3T3MF 3TA3D 1DL7H 4BV1A 4YAQA 4YAQB 3ESNA 3AFLA 4A2LA 5I0YA 4NO5A 4NWTH 1SVBA 4AUUA 2ZP8A 3QIBC 2D2CC 2HUHA 4KH9A 4NO5B 3BP4A 3GIVB 2JELL 2NCMA 3GRWH 1JUFB 3OQ3B 1PF3A 3BP4B 1MRCH 4TNWF 4LAJH 3LKPA 1QR4A 3IDMA 4PB9L 3LKPB 2AEPL 3IDMB 4J6RL 4LHUA 5EBGA 4FLQA 3ULUF 2C1OA 1JYVA 4AV5A 1JTPA 2C1OB 3GM8A 2LU5A 3ZDYB 3RWJA 5I8OH 4UT6A 2LFEA 2JKNA 5GGRA 3RWJB 1CLVA 4NNPH 5GGRB 5T3XE 1G1KA 4HWBH 3QCTL 3CZJA 4JG0H 3BUIA 3L3HA 5CGTA 1J5OL 4OF0A 1MFEL 3L3HB 4X9GA 2X2UA 4EUPA 3QUZC 4ABVA 5B3NA 4PJDF 3S36L 2QQKH 3FO9A 4G6AD 3FO9B 1MI5E 3MV8E 1RU9L 3HE6B 4DP7X 4OUUA 1KN4H 1GKOA 4MSWA 2VXSH 3QFJA 4OUUB 3UERA 4MSWB 3QFJB 5E1HB 4H88H 4LPYA 3IJHA 1SNRA 4NO0D 4I1PA 2EUVA 4X8JA 3IJHB 5E7BA 4X8JB 3ZQWA 4HS3A 4OD2B 3N42B 5I15H 4HS3B 4K2UL 3B34A 3MNVA 3SDXF 3BKCL 1A3RL 2H41A 3QP3A 4XAWH 5F1NA 3MNVB 5F1NB 3UJJL 4FKHA 3PAYA 1SEQH 5INDA 3UP6A 1AGEA 2O93L 3OF6D 3H2QA 5INDB 3CXFA 1AGEB 3IPBA 2X7LA 5CU5A 1XIWC 3OKNA 2X7LB 2CJUH 1E8XA 1UWXK 3OKNB 4V11A 4X83A 4AZ8A 2FECL 4HUCA 5TPWL 3GRWA 4K3JH 1R3JB 4AZ8B 1J87A 2GK0A 1OCOB 3D0VA 4Q2ZA 2GK0B 2Y69B 3D0VB 2BRRL 4LIQE 4B9PA 4XMKL 4PBWD 3ZL4H 2Q8BL 2XKUA 2FJFA 1SJXA 4X8XA 1AKJB 4B60A 4Z3IA 2FJFB 3WDHA 4AW4A 4R26H 3UGUA 2Y07L 2VAJA 4BWTA 4HJEA 3CXHK 4M1CC 3L2NA 3OMIB 1BW8A 2CIKB 3Q0HA 4M5YH 3CC5A 3NABL 1G7HA 3UADA 3WEMA 1U3NA 1G7HB 2QVMA 4HWBA 4Z7UA 3V6FA 4QRRE 4XPFL 3SGJA 3V6FB 2NY3B 3PL6C 4CN4A 2ZOKA 1KEML 2WIMA 2ZOKB 4L3ED 3BPLC 1BVKB 5FOBA 1FN4A 2VZUA 4A7UA 4M7JH 5FOBB 2UXVA 1FN4B 2A4CA 5JQ6L 4BGDA 4QRTA 2JKJA 4JO3L 4QRTB 3QYNA 3TFKD 4FP8L 4Z76A 5C6PB 3O3EB 1AFVL 1BBJA 3VG9C 3KR3H 3CHOA 1ZKAA 1BBJB 4G1MA 5TTRA 3DK0A 3K2MC 4NQSA 1UJTA 4G1MB 4NQSB 1JZ8A 3NTCL 3O9WA 1LP9E 1MFCH 1I7ZA 4WY7L 5DVKA 4KGLA 5AAPA 1I7ZB 3LPGA 3O6FB 5IQ9A 3TO2B 2WBJD 5IQ9B 3UDWC 2Z8SA 1RH8A 3DI3B 4QIRA 5KVEL 5C7XL 3P77A 1UUSA 3N1MC 2VLJA 1WPCA 1QOKA 3MGOB 3P77B 5DHEA 2VLJB 4AUJA 4ADGA 4LZKA 3WJJA 5E23A 2JSFA 4ELMF 1IC1A 3LH9A 1IM3A 4PJXF 3S4SA 3W2DH 2R83A 4G6JH 1IM3B 3S4SB 2FR4A 4KK6C 3WSQL 3RBGA 3FKUS 2FR4B 4J2XA 2WXKA 3NYKA 2DQDL 4XB8A 1AZUA 2K7QA 1OPGL 1S5IH 5IT2L 2OXGA 2OXGB 3MV7A 4KITB 1DFXA 3MV7B 4KY1L 1BM7A 5BRZA 2I27N 2XWEA 4ANXA 5BRZB 5DK0B 2X3BA 2X4QA 5B39A 4YSPA 5B39B 4LCWD 2WJ5A 1NPUA 1SXCA 4NXKA 2Y6TE 1SF3A 4J8QA 3HS0A 2NX5A 4E2OA 3TS8A 3SE4C 2NX5B 3OLDA 3QDMD 5ECJE 4M5SA 5I23A 2Y3AA 2X4TA 1R34A 4FABH 2QFPA 1EFXD 2J88H 2X4TB 3KYAA 3ARXA 3BE1H 2DL9A 5I5MA 2Z1PA 4Z95L 1GAFL 3HB3D 5DT1L 4BHUI 3QZBA 3VD2A 4ODHH 4N2IA 2B7DT 4P5TD 4PJAB 4RIRA 4OR1A 5TE6L 4RIRB 4MXVE 5JXEA 3AGWA 5AYUH 4EIGB 4KTDL 1UWEH 4N26A 3VTMA 4H40A 5EZOH 5CBAA 3IFNH 4IBVA 4FQ2L 1KBWA 2APSA 5CBAB 2X3CA 3LHPH 3FTVA 2ZAHA 2ISDA 1NKRA 2FB4H 2F8VA 3PGDA 3C09B 1O9ZA 1MDAA 3KAAA 4L8SC 1JYXA 1J12A 3PGDB 3DBXA 3ZIYA 5I0XA 1UWFA 3OWEA 3VB8A 1BEXA 3DBXB 2DQFA 2WQXA 4NB7A 1LE9A 4OV5A 1RP9A 4FQLL 2DQFB 4X6DE 1LE9B 4OV5B 2C26A 5DQDL 3IJ7A 3L6FA 1DUZA 2BJML 3L6FB 2LLNA 2BC4A 2P5EA 3DXAD 1WT5C 2E4TA 1DUZB 2QSCL 1CLZH 4HKZA 2P5EB 4HKZB 2CBPA 3GHPA 3U1SH 2B4CL 5F7EL 2KS0A 2YQBA 3VCLA 4ZFFA 4UNVA 1DVUA 4MNQA 4PJ5E 3VCLB 4MNQB 4GRWE 1NLDH 2WCPA 5GGTH 3LCYA 3W5MA 1JWUB 2GI0A 2FATL 1AMYA 1V3KA 3GS4A 4Y5XC 4NLAA 5GRXG 3UJIH 3IJ8A 3LZNA 4L8BA 1T7ZA 2F68X 4L8BB 4XE5B 2JI1A 2Y36H 2QTEA 5FCUL 3VD0A 1JGUL 1HT6A 1YEKL 1HVXA 2A1WL 1LMIA 3N50A 2WB7A 4W6WB 1KENL 1NMAL 2NZ1A 1NGPL 3MV9D 2XZCH 4EN2A 1NKOA 4J6IA 1LO5A 1LO5B 1HZKA 4P2RD 2WXIA 3UYRH 4FQJL 5E5RB 3SJVA 4HCRH 4OZHF 2IOMA 5D72H 3SJVB 5CR8A 3F5WA 4RBPK 1P7KA 1NBCA 3F5WB 1P7KB 4NUMA 5TQ0L 3CGTA 2KZWA 2UUDH 2J57A 4QT5B 2GBUA 2Q86A 2D2OA 2OK0L 4KO6A 2Q86B 4PHXA 4Q4IA 2ZKHH 4OUOA 5CN1A 1IX2A 1GC1C 1B2WL 4AMKL 2ZP9A 3PWVB 4OLYL 5JQHC 1VPOH 1K6QL 2GHZA 4NQCA 3CHSA 5K1JA 1I9JH 4NQCB 5IVXE 5GGTA 3ASWA 4DKEH 4AEIL 2A7BA 2B14A 4CAGA 5AAWA 3BPNB 4UOQA 1SJMA 3KBEA 2NY0D 4Y4HD 4I9WD 5IFJA 1RHFA 2D0HA 4OT1L 5LBGA 5IFJB 1FL5A 1W8NA 1AIFA 1FL5B 2DMHA 5CR1A 1IBFA 5I73B 3C5ZA 2K4AA 4ELDA 1QFWH 3GIZH 3KPSD 3C5ZB 3MXVH 5F9OL 2LTQB 5EU5A 5D1XC 1B9KA 4NZUL 5EU5B 2NTSP 2AQRA 3L1OL 2GK2A 4F7CA 1KLUA 4HCRA 4F7CB 1KLUB 2VDNL 4OFYA 2R0LL 4PD4J 3WI9A 4TUKH 5IROD 2ADJA 1QVOA 1KFGA 3CDFA 3MRNA 5A2AA 5F0JB 2ADJB 1QVOB 4DGVL 1CR9L 1G9NL 4Z7QE 3MRNB 1SOXA 1BPLB 4DH2A 2DQMA 3HMXL 4KMTL 5DMIH 3KDPB 4CVUA 2IDCA 5T5NG 1D6VH 4J23A 1HS6A 4R2GC 3ZE0E 1E9PA 1UZGA 1E9PB 1BQKA 5D8JL 3HLAA 4HPYL 3VGHA 3ZE2E 3MRRA 1NCJA 5C07D 3HLAB 3ETSA 3I50L 4ZFOB 1VHPA 3MRRB 5IF0A 1NLBL 2D0GA 3MUZ1 4MNGA 1MJ8H 2OZ4A 3FU3A 4MNGB 1OPOA 4BE6A 5D7HA 2HWZH 3T04D 4YSUA 4I0PA 3CFBA 3CFCH 3I3EA 4I0PB 4HBQA 3CFBB 3Q2CA 1EGJL 2EXYC 4Y1AE 4Y2DD 3QUMH 1O9VA 4Q9RL 1ZSDA 5I76A 2HRHA 1ZSDB 3OSKA 1B88A 4HF5L 4YHKL 5HHXL 5I76B 4YSAA 3QUYC 3RY6C 3OG6B 2FTAA 3BAEL 2IGFH 2JJTC 3GXFA 2J72A 3JWOL 1JAEA 2JKTM 3WELA 2HKHL 2Y72A 1W91A 5HHVH 3KHOA 3BKYL 4HEMA 4XZ4A 5CEXB 2WAQA 1QFHA 3W0WD 2B3IA 2IAMD 4G5ZH 3HFMH 1N0XH 5DUML 4NBZB 3PXHA 2APWA 1UHVA 2QPSA 5E6IC 3PGFL 3GSXA 3GSXB 1XBRA 4YIQA 1DJXA 4JDTH 4HIJA 4YIQB 2AEPH 1J0YA 3OPZH 1L9MA 1I3UA 2CKNA 4OLEA 1J1PL 3V6OE 4U1GB 2H47C 4Y4FC 1IAMA 1LVEA 2YFOA 2ZICA 1J5OH 4DAGL 1NIEA 4BDVB 3SBRA 1P7QA 4OGZA 2MNWA 4P07A 4RMWA 2ROXA 1BDYA 5H4YA 1FNHA 1AY1H 3TO4D 2QADD 2XNAA 1IAOA 4Y1SA 2NXZB 2QMJA 3CDYA 1A7OL 1IAOB 3UC0L 3CSPA 3HIZA 5DD5L 1XH1A 4PLNC 1WCQA 4PRHD 1FC2D 3L3DB 2ESVD 2Q8AL 2X44D 3ALXA 1IGIL 1NC4A 2WO2B 3GXDA 3O4LD 1XSIA 4B9JA 4HJIA 2CHXA 1KN2H 1JNLL 4JX0A 3OKDA 5F7WC 3CZLA 3HZVA 3OKDB 1EZUA 3HZVB 5TK2A 5CZVH 2XWBA 5ABAA 5E5MA 2XWBB 3IJYA 4X7CC 1OAQH 5E5MB 3IJYB 1ZE3C 4K9JA 4MQ7A 3VGBA 3FU8A 1PX8A 1JXGA 4MQ7B 3GMNA 1HCVA 1SDDA 1MCWM 1TCRA 1CICB 2Y1ZA 4H8HA 3GMNB 1SDDB 1SFHA 1TCRB 2B20A 4ONFH 4N5UA 3MLVL 3H3PH 4UDTA 5FUOH 5HHNA 1E3ZA 4MB5A 4UDTB 5HHNB 1WD9A 1IM9D 2VXTL 3U9UA 2A9NL 3U9UB 3M8OH 4AYBA 5GRJL 1E4KA 2VSMB 2CSPA 3BIBX 5F6HJ 2DB8A 2E7LA 5CD3A 3T0VA 4HJJL 1G43A 5CD3B 1FNLA 3B83A 4JE0A 2ZPKH 2J5LB 2EACA 1GTNA 5D4JA 3VWJC 4N2LA 5F89A 2HX8A 5C9JA 3MTRA 4NN5B 5F89B 2BH0A 3ZHKA 4JM2D 4JO3H 3LNEA 5D7LD 4AG4L 3MRPA 5C9JB 3S8WA 4LVHB 1IILE 3FRPA 5F21B 3MRPB 3STZA 4GQZA 3DGDA 2HTKC 3FRPB 3STZB 4QRUA 2ATKA 4KDTA 4QRUB 3SDCC 5LJYH 1JRHI 2ATKB 3O3DA 1FJ1A 1OT4A 1FORH 5ADOH 3O3DB 1FJ1B 3VO0A 1F4HA 1K5NA 4DFIA 3PWLA 2IFGA 2XI9A 3SPVA 4A37A 1K5NB 4Q6IC 4LLAA 1T04A 4M9PA 3SPVB 4W6YB 1MEXL 1T04B 1IT9L 1QRKA 3IGUA 5F93C 5H37H 4YXKH 5MP6L 1XCQA 3D1MC 3QG7L 5KVEH 1XCQB 1TSHA 2OMBA 1EO7A 2P49B 2F61A 1NL0L 4LRIC 6CGTA 2ERJC 2VMDA 3VYNA 3P54A 4O58H 1BQUA 3DMMD 5DHVH 3T2NH 5HGAA 5C09E 1XWVA 4EQ3A 5HGAB 2Z4QA 4XO3A 3VX0A 4X9IA 2WXNA 3EJYC 1HL8A 2Z4QB 2DIJA 1PAZA 3NFPA 1WYJA 3LH2L 4NQTA 3V8CA 3NFPB 5JHLH 3BD5A 3E2HC 3LXAA 2DQDH 3QR2A 2FYVA 2RAMA 4NO0B 1EK3A 3AQZA 4ENEC 4N8CH 5EBWA 4N90E 5IT2H 3AT8A 5EBWB 4U49A 2J20A 4B3VA 3L81A 4KY1H 4UAHA 2I07A 5E1AA 2V9TA 2I07B 4AQEB 2APTA 5E1AB 1MPAH 4QKXB 4YXHH 1CFVL 3UG5A 2F54A 1V5JA 2IGLA 4IGBC 3Q1SL 4LPUA 2F54B 2HRGA 3CTTA 3NEXA 1AQHA 4NZ8A 3U4AA 3FO1A 1BLNA 1S7UB 1V7MH 2Y06H 4EBQH 3FO1B 1BLNB 1AQMA 2VDML 2WTPA 4G70B 1VADB 3HN3A 4K8RC 3QBTB 3ZDXE 5IBUG 1NUGA 3WNOA 4LGRB 3FU5A 3QZLA 4K0OA 1ZDSA 1RXLA 2WNGA 3WO4B 4IRSD 5GJTH 1JPSH 4DGIL 1X6LA 2PPAA 5DHVA 4FQ2H 5DHVB 3EBAA 4XNXH 5GHWL 1NOAA 1TLMA 1TQBB 5JIPA 3GKWH 2AKRA 5K69A 1GL4B 4A67A 5JHLA 4CVXA 2AKRB 1DJYA 1Z66A 4CVXB 4X2UA 1N26A 3NCYS 4CJ1A 3RX5A 4ZMPA 4KFMA 1URLA 3HI5H 4HJSA 2XICA 4CSSA 3R06A 5DQDH 1SMDA 3R06B 5BS0E 2VDQL 3FAXA 2X3AA 4JM2F 4UAOC 3RWHA 1PD6A 4PV9A 1OP3H 3CK0L 4KFZC 4NRXA 2WBJA 3ARGC 4NKQB 3NUKA 3RWHB 4PV9B 4A2DA 4NRXB 5JIKA 4CMMB 2WBJB 4UNUA 2ORBH 2XJKA 4YBLC 2AI0L 1HZLA 5FHAH 4JFEA 3NFNA 4XN5A 3ZDZE 4JFEB 3NFNB 4OJFH 1H8LA 2E9BA 3NJJA 1BGXL 1DQTA 4LSDA 4NEHB 3LRLA 3SCMC 4X5PA 3QQ3A 3AG3B 3U7YL 3QQ3B 5EUOF 5C97A 1JGUH 1YEKH 4DFHA 3BYYA 4LLVA 3ZRFC 2OCCB 5IESH 4LLVB 3FH8A 3MLYH 5EZIL 5AW9B 2BFVH 5HPMA 2B1OA 1NGPH 3OJDA 3QUHA 5HPMB 4KROD 1KDIA 3EOAA 3OJDB 4M3KB 3D9AL 5C08A 4C4UA 1GRWA 3OAYH 5FO2A 1UYWH 1PYWA 5G55A 3LNIA 2CIIA 5IQNA 2K9FB 1PYWB 3EYFB 3UZQA 2CIIB 3UZQB 4LCWB 2YN3A 3DHMA 4TQIA 1BXXA 1MN4A 1CI3M 1EQWA 2VRAA 1L4IA 4ZX6A 1J05A 5D1ZC 5I30L 1MF2L 3OLIA 4G8AC 1N6QH 3GPSA 2K70A 5KYNA 4F33A 5I6OA 1KEGH 2EH7L 4F33B 3ISWA 1UA7A 4WSGA 3FUHA 1OD7A 2IANE 4WWID 5E6UB 1FGVH 3ZE1E 4GI6A 1VB9A 3N85H 4WEMB 4BSWA 3NCXA 1BBDL 4P5TB 4BSWB 1N6UA 4CSPA 2CK0L 3EZ8A 5DS8A 4OCYL 2HKAA 1BIHA 5DS8B 4AEIH 5I1CH 1CIDA 2F5BL 5DO2C 1AH1A 4MS6A 5F9WB 2XQBH 3WKML 2EH8H 3QYMA 4TUJA 4MFHA 5I1GH 1TTUA 4K9EH 1YQVH 2VQUA 1Y07A 1AMXA 4WEBL 3TYFA 3UTQB 1OCZB 3TYFB 3B9AA 3VXNA 1DR9A 2AXGA 3VXNB 4M8UA 1FIEA 3CVDA 2EC9U 3QA3A 2AXGB 4OD3L 2XN9D 5DEGA 3DTXB 3F6IA 5IVZA 5BO1L 2CJSA 5DEGB 3SO3C 4CC4C 4ZMNA 3IJ9A 5IVZB 2ATAA 3L1OH 5AWNH 1BP3B 5T1KD 3DXAB 2B1HL 2QHRL 4AGMA 4LO9A 1INEL 4P57A 1ZLUH 5IOKA 4GP8B 4P57B 1JVOA 2OJ1A 3ZKND 1JPST 5EN2A 3UBFA 1RMFH 3S96A 4AVJA 5EN2B 1JDDA 3S96B 4MS8D 4LNVA 1J0JA 2FNWA 1N59A 5FA3A 1OE1A 4K94L 5FA3B 3HMXH 1LMKA 4LBEB 3SGDI 4R7NA 1NFKA 3E0GA 2BZCA 1WISA 4IOSA 4M29A 4XCNA 1BPVA 4R7NB 4PJGE 4XCNB 5KVGH 4HIEA 3PHAA 5FYKU 3BDXA 5IUCA 4X8CA 2XIIA 1Y18A 4QXWA 3NZHH 3RTQD 5H4ZA 1Y18B 4LSQL 4JGJA 3UBXG 3OLGA 1FP5A 4M93C 3DJZA 1ODAA 4Y16C 5D7JD 5KYUA 2KBGA 4U1SA 5D1XE 5KYUB 3DDFA 3MV9B 4CN6A 2AABH 4U1SB 4G8EA 3VJ6A 4P2RA 2XVKA 1PEWA 4G8EB 3VJ6B 1CD8A 3IMWA 4LASL 4Z7OB 4L4TD 4P2RB 1U41A 3MCYA 2HN7B 2DQIL 4TQEL 2NY6C 4XPTH 1CDJA 4TNWK 1WZMA 3ARZA 1JPGA 3NJHA 4W93A 1Z9MA 1HDMA 1HOEA 1JPGB 4EOWH 3WEAA 3QJSB 1HDMB 2X40A 1NMCB 3D3VA 2LU4A 3DPDA 5ID1A 1A6AA 5ID1B 4CU8A 5INCA 3S35H 1A6AB 2HSIA 5INCB 1IU1A 3FB5A 4LCUA 4OW6A 3U9PL 2HKHH 3FB5B 4HGKC 4LCUB 5GISL 4KX9A 3BKYH 5HDWA 4XNYL 5DD3L 1JP5A 4GAJH 1GYAA 3CSGA 3MREA 2C9XA 4M1GL 1UT2A 3MREB 1ACYH 4HJGA 3DRTA 3VFWB 4HJGB 1CGYA 5E2UL 3DRTB 1M71A 2YWZA 3TBWA 1OB0A 2JQMA 4FX5A 1M71B 3KCWA 3MJ8A 1USZA 1H19A 3C12A 3MJ8B 1DANU 1JXKA 1OWWA 4TQPA 4GAAA 4Y4HA 3VXSE 3EYVB 4WSJA 4Y4HB 1CD0A 1A1MA 4KNQA 1A1MB 1DFBL 2VYRE 4OFIA 1YQ2A 4F9PA 2NY1C 5E2VL 3V0VA 1GGTA 4YHIA 1TZOA 1FG2A 3V0VB 4YHIB 1HQRB 1FG2B 4ATTA 3MRQA 3RNKA 4HIXL 1ZD6A 3MRQB 1ZJAA 3RNKB 1DJSA 2P24A 1XH2A 3EF7A 2NXYC 4J3OG 2F9BT 2P24B 2OYMA 2XC8A 1YCSA 4UBDD 3BKJL 1KTRL 1GGIL 2FWOA 1U2YA 4KKAD 5E51A 4B96A 4BIKA 3BT2H 2AJUL 1UXLA 2FWOB 3O4OB 2DWSA 2ZXQA 2MJWA 4JRFA 5LNEA 1BQSA 1E40A 2VLMD 4M3HA 3A4AA 4U1JA 5DD5H 3B5TA 4M5TA 4U1JB 3DX4A 4K23L 1FYTE 4OLVL 5ISZE 1DSYA 2P4AB 1IGIH 2B08A 4M6ML 3IEAA 4OIIL 3L9BA 5A7EA 1NEZG 5FXCH 3RWIA 4FXTA 4KKLD 3RWIB 4L9DA 2AERT 1X7QB 3RFZA 5F7UA 2YXFA 1YEIH 3H2PA 2KHAA 4UIKL 5CN3A 4JB9L 4ERSL 2K45A 4KXCA 3C2AL 3VD1A 5AW6B 4K71C 4Y2DB 2FEDC 4HZLA 1RLWA 3FMGH 2BPBA 1JNHA 4HZLB 2YGVA 2DICA 5DF0A 5C0AA 4F57L 1HN1A 1H3WM 1IC0A 5C0AB 2UXTA 1FZOA 4I18C 2QTVA 2WXLA 4J4PC 1IVLA 5DS1A 5AVUB 4W9DC 4GMSH 3B2VH 1IE4A 5LCVA 4AQ8A 2DQHL 2O5XH 3TZVC 1NC2A 1P53A 3ZUCA 2FK9A 1IAII 2VDLL 2WCSA 3W0WA 4KOCA 3W0WB 3B7TA 4P2OC 3L08A 2B2XH 5B7FA 2DQJL 4PJBE 3RU8H 4D9RE 4QRBA 2H2SC 1LWRA 4POZC 3NESA 4U6VL 2XOTA 4C57C 2NSQA 3N04A 1EPFA 4OCRH 4B95C 1WF5A 5EIVA 2BSTB 5L0QC 2J6WA 3CSTA 3WS6C 1V54B 3WY2A 4DPBX 5DFVC 2PCXA 3NRQA 3LZLA 3S36X 3BT0A 4BRJA 4EI0A 3FXIC 1PLAA 1E6OL 4GH7B 4DTGH 3H4FA 3ARRA 3LQZA 1KGJA 1XGTB 3QJRB 4IIZA 1DBML 3GTVA 4NP4L 3LQZB 4KI5C 5DMGC 4Q97A 1ZPLA 4UT7L 1M4KA 4RAUA 4X99A 2E7HA 4RAUB 4X99B 2E75C 3NBNA 1QFOA 4NNYA 3T3PF 1T22A 3MJGX 4JO1L 4NNYB 1T22B 4YDMA 3VNZA 1NKGA 3BVNB 2YD5A 5HDOA 3FQ4A 3RQ3A 1K85A 3A23A 3FSAA 2CQVA 3LH2H 4OJDH 4HUXA 2VSKB 3QCVH 4E42A 2NNRA 4ODTH 2WNXA 4G6KL 4E42B 2D7QA 1M3IA 4HUXB 4FQ1H 3OJMB 4ZQTA 1A14H 1MVUA 3MLZH 2CRMA 2KL6A 1MVUB 1VZHA 3NZUA 4PRHB 1T6VN 3OAUH 3ZLQC 3ZU8A 2KPWA 1I1AD 4C55A 4HK0A 1MG3C 5DUPL 2EINB 1MCLA 3RIFK 1BM3H 4HK0B 1S46A 3IRPX 3BDYL 4IRJD 4U3HA 1PL3A 1GYCA 4MZIA 4IU3A 3MLSH 5T5FA 1R19A 4R8WL 3NVQA 3OWRA 4IU3B 3C5XA 5HDBE 4IBYA 2DQEL 2WVTA 2X42A 1SXAA 1OL0A 3O6KL 3SQRA 1ZK9A 4PGBA 1EJ6A 3S5LG 5BMFH 1JCKA 1N68A 2A6KA 1M9WA 4OBRA 4P04A 5IR1A 2A6KB 5ECGA 5IR1B 2WVUA 2JWYA 2B3RA 3NGBC 4GW5A 2ARWA 3EJSA 2KDGA 3QNYA 4G8GD 4GW5B 1OT1A 4MRCA 1MCPH 4Y9CA 3QNYB 4A6YL 4JCMA 4ONHA 5FO9A 1OP4A 3FC8A 4ONHB 4MVBD 2P7TA 3BQUD 3KPRE 4PREA 5AG8A 4FL4C 5FO9B 1P84J 2P7TB 4PREB 4FFTA 4U31A 2WKOF 3BKMH 1EAJA 5DRZA 5F3FA 2PETA 4HAFA 4R4FL 3K5RA 5DRZB 5J3HC 3WKQA 5I9QB 3F12A 2O5ZL 3TH3T 3ATDA 4PY8J 5DZAA 4ZFGL 4WFHD 1AXIB 4OGAC 4ZI8A 3OKKA 5JTWA 3OKKB 1I8LC 5D7LA 1XTLA 4JM2B 4RFNB 4A2HA 5D7LB 1I9EA 4G83A 4PBXA 4KKBD 2NZ9C 2ZX6A 4XNZB 1FVCA 5F6IB 5I5RA 2P45B 5A40E 1RZFL 1FVCB 4PLOB 3B1UA 1U3ZA 2GFBA 5I5JA 4CSZA 5IHZA 2GFBB 3SYOA 3WMQA 5IHZB 2BZDA 3D51A 2VDQH 3N43F 3I9GH 5BV7C 3PP4H 4XOCA 1YYMH 3D6GA 4TULH 1MELA 2X0UA 2UX6A 2P5WD 3BD3A 4HIHA 4YDZA 4AQZA 4S1RL 3O41A 4HIHB 4ZZFA 4MA8L 4PRIE 1KYUA 3O41B 3NZSA 1RZKH 1BOYA 1P4IL 2IPKB 3TU6A 4L2LA 1S8DA 1GC1L 5TFSH 3UCRA 1S8DB 3DMMA 5I1KL 5DJ2A 3DMMB 2I24N 5DJ2B 4Y5YC 1LO4L 2CJTA 5CMAA 3ARBA 4JHWL 5CMAB 4MMZC 1OF0A 3ARBB 3CSYA 4JG1H 4UQIM 2JKIS 2C3WA 2Y1AA 1TSRA 3SKMA 1A6VH 4D7BA 3LS4H 3SKMB 3HVDA 3LQMA 3BUTA 3SBWA 1EHLH 2J5WA 2MMXA 3ARPA 3RAJL 4MMXC 4WWKD 3T0EC 3VSTA 5I1JL 1U8OA 1E0OB 5IFHH 1U8OB 2F74A 1JMZA 1A6ZA 4AIZA 4NI3A 2F74B 3WHE1 3NJXA 4AIZB 4N87A 4TUUA 4E5XA 3UTTD 1COBA 2R0KL 5FLUA 4E5XB 3LRHA 4JW3A 4YSCA 3RUGF 2PLTA 1TDQA 2FH8A 3BMVA 4QF1A 1I7TA 4QF1B 2GSGA 1I7TB 1BZ9A 2IPUG 2LQRA 1YNKL 2HTLD 1AYOA 2IWGA 2HLFD 2GSGB 1DEDA 1BZ9B 2A9BA 4MQTB 4XMPH 2XIDA 1A5FL 5CEZD 3N41F 1QFPA 4MB4A 2CHDA 3EZJB 4LL4A 4RETB 2MTAA 5MERA 4LVOC 3HG1D 1K4CA 4GP5B 5MERB 3CFIC 5LVEA 5CINH 5CGBA 1K4CB 3KJ6H 4M7LL 1IRAY 4FERA 2ROYA 1BMZA 5A2KH 4ACTA 5ITBH 4B53A 4D3CL 3N1QC 1NPNA 3PF2A 3RDTA 2NW2A 3RDTB 1NGXB 4LSTL 4UM9A 2NW2B 1G9EA 1CLYL 4Y19D 4UM9B 1QI3A 1PSKH 4HJUA 1S7SA 5D2LF 1MRDH 5FKPA 2B0SH 3OAYK 5FKPB 2JI2A 1L9QA 1NSNL 3EGXA 1ZPUA 4HH9A 1N67A 3CFNA 3IMSA 3NSJA 4RNRA 2WM0A 4HH9B 4NCDA 4RNRB 5CIPH 2FQDA 1YLBB 3QZMA 1QHPA 4NBYB 4RAHA 3DVNA 2GJRA 3DVNB 2XWXA 3K6IA 2D03H 2FHFA 2UX7A 3ZHNA 4F2FA 3QZOA 1L7TH 1FFRA 2NUPA 1NCHA 2R1XA 5CJ8A 4ZXBC 4NN7C 3S3BB 4EAEA 2NUPB 1A64A 2R1XB 2X1XR 1I8UA 3FU0A 4G59C 5F7YC 1EO8H 2IF7A 4OZGE 3MTXA 4Z7UE 4JS7A 4FQCL 1AOZA 1ETA1 2ZCLH 4TNVF 5BVPL 4K94H 3LQAH 4S1SL 4DZBA 3R4RA 2ED7A 1HNFA 3AMKA 4DZBB 4YVUA 2AJYL 5JUEL 4CL7A 4PYGA 5EU6E 4FTVE 1KWKA 2CCVA 1OTUD 2KYIA 3C6EA 2HRLA 3PWNA 2BP0A 4M3JA 2YJLA 3WD5H 5GS1A 3PWNB 3GQFA 2BP0B 2RB8A 3S48A 3VRLF 3P0VH 4WV1C 3IB4A 2GW5A 4MAYC 3MLTA 5GZOA 4NCC1 1V7NL 2LABA 4FADA 3WFBH 3HHRB 4KJQC 1G7MA 4FNLL 3WNLA 3FN0L 1G7MB 2O72A 2ZCKL 3EUUA 3SGKA 1Z3GL 4TQEH 3ULVC 5L8LB 2Q1EA 1QO3B 1J0ZA 5JLZA 3OSVA 5JLZB 4P23D 4LEBA 5L2KE 2VJ0A 3QIWD 1NWPA 3SE9L 3GMRA 5KN5B 2G0LA 3GMRB 1CGUA 4JFFD 1Q9OA 1C12A 1OAXH 2IVFC 2VWEC 2WC7A 32C2A 3TEZA 1PZ3A 1C12B 1Q9OB 1W80A 2ENPA 32C2B 4WAFA 4UTBA 1RSYA 1IZKA 3I6SA 3P02A 3BO8A 3JQOB 3OM3B 5IOPB 3BO8B 1XGPB 4FYRA 1DLFL 5AKRA 2VR4A 3PS6A 2WWMC 4K3DL 4X6CA 4AZUA 4XVUD 5I71C 4M1GH 4X6CB 2EDBA 4EMZA 3LNFA 4LARL 4LLUA 3FH5A 5L6YL 2HRPL 1TTGA 4LLUB 4B97A 1QWNA 2J1WA 2R0WH 3NIGF 4I7ZC 1WEJH 5CLXA 2WZ0A 1HNGA 5KUKA 4U3CA 2ZX5A 3SDDC 2ZUQC 4NQDA 2BP8A 2W5PA 3M46A 4JR9L 2MCPH 4FJ6A 4NQDB 3GLDA 4R90H 1SM3H 1DFBH 3SY6A 4M6AA 3G6DL 5GGSB 4ZD3L 5T5NF 3PWPA 1P7HL 4YK4B 5L4JA 4XMVA 3B7UX 3QB7C 2EXWD 3CVCA 3PWPB 3QXWA 4FZ8L 4DPCX 3QG6A 5ICYB 2KZ1B 4D9LH 4ZMZA 4Z7WE 3QG6B 4QNPE 1ZDQA 3HUJF 5IWLA 4NXSA 2CWRA 5JYLA 3US0A 4YFLI 3P2DA 4B9IA 5D96B 1TYEB 1NCUA 1T66D 4F15B 4ODVL 5E4EB 1E5UI 4E68A 2ZUWA 3NN8A 1Q0EA 1OIOA 3QE5A 1H9VA 4XN1A 4MCMA 3NN8B 4AJWA 1YYCA 3SEPA 2E86A 3M7OA 3TVMC 4C59B 4GW4A 5DZVA 2NMSA 2BWIA 4GW4B 3WLWD 1GZHA 4S2SA 2G9KA 3CH8A 3GO1L 4ONGL 4S2SB 3MR9A 3AWEA 3O2VH 1LO3H 2UXFA 3CBRA 5FEBA 3MR9B 3RVXD 4NQVA 3HG4A 4LRNL 1ED3A 4DP5X 4NQVB 4Y89A 1ED3B 4RMRA 5FYJU 3K4DA 3ZYZA 1HJCA 4LLYA 5FYLD 2XPGA 4GFXA 4LLYB 4MA1B 4QO1A 2XJLA 4F24A 4QO1B 5IHLB 4IBSA 3LOWA 4AUYA 2K9UA 1GOHA 3CU1A 3H6JA 2ED8A 4FFZH 4MMYA 4YZFF 5D7JB 4AGLA 3ZMEA 9PCYA 4MMYB 4YZWA 4UIKH 1BZ7A 1A7PL 1NBVH 1RJYA 2VDPL 5DA4A 3SZ6A 4WJKB 1BZ7B 1RJYB 4L4TA 3P3RA 1GJIA 5DCCA 1ACXA 3JTTA 4L4TB 3JTTB 4UINL 1EFQA 4PU2A 2H8PA 2F7IA 4KDWA 1OP5K 2H8PB 4L5FE 2BVOA 3WN5A 3QDGA 2BVOB 3WN5B 1RULL 3MNWB 4PJ7F 4AJVA 1AI1H 5KYXA 4EPSA 1M57B 1IEBA 2XTJC 3G3LA 5KYXB 4WO4A 1QSFA 1IEBB 3RVTD 3ZTEA 3VGGA 1TEYA 5EEUA 4WO4B 2DQHH 3GSNL 2UVEA 4KKRA 2PCPA 3MLXL 4N0UE 1A9VA 2PCPB 4L8DA 2ZAIA 3L54A 4PQXA 4L8DB 4LCVA 4P5KA 4DO4A 1X7SA 4P5KB 4OZIA 4IBLT 3GMQA 4NFBA 5KSAC 4S0HA 4OZIB 3GMQB 3EJQA 3AC0A 4BUQA 3UMTA 1BZ8A 1HC1A 4YBQD 1EDHA 1ORQA 3O6LL 3BPOC 5DRNA 4ZYKA 5C0DA 1ORQB 5DRNB 1SXZA 4ZYKB 5C0DB 2VH5H 4L18A 1OT2A 1K4DA 1FL3A 5I28A 1K4DB 1FL3B 1LDPH 2EE2A 4G9FE 4PJIF 5H35A 3ASOB 4FFZA 5H35B 2ZXGA 2W9EL 2DBJA 3LKQA 1AD0A 3LKQB 1ICTA 2H6OA 2NY5C 2WBWB 5MHSD 1AD0B 2PPDA 2MCMA 4AM0Q 2CHZA 4JO1H 4YC2C 2DMGA 2WZAA 5F71A 2BINA 3U0PA 5D4IA 2DQUL 2MIZA 2LU7A 3U0PB 4GJTB 1FIGL 4EKXA 4Z7VF 3ZTCC 1TFHA 2A4ZA 1DN2A 2I32A 3QR1A 3TIEA 1E9OA 3ECVA 4XMXA 4GXFA 5DK2B 3TIEB 3SOTA 1E9OB 1OW0A 4MJIE 4KRPC 5EC2A 3V9EA 4BKSC 2VQ4A 5HI3C 3QRLA 2WUBH 3V10A 2YD2A 5EC2B 3MX0A 4UB0L 5SWZE 3K81A 3MX0B 3NIFE 1TUPA 1DUYA 2TRHA 1SBBA 1DSWA 3HJEA 1FFPA 2O6EA 1DUYB 4YFDB 1I8IA 4ABQA 3NEEA 4J3TA 1FFPB 3QJFA 4LFHG 4X42A 2WHVA 1I8IB 4KI5E 2YC1A 3QJFB 4GI9A 4PJ6A 2VISA 2YC1B 2VISB 4Z18A 3IGKA 2AJSH 3REVA 4FXKC 3VH8G 1MCOL 1RD6A 2NPLX 3ZT5A 1GMEA 3REVB 4C56E 4JK0D 15C8L 1IARB 2HKFH 3L9YA 3MRFA 5CJBA 4AEFA 1CCZA 2EADA 3V7AE 2WMPA 3MRFB 3EFDL 2WMPB 1M2VA 3UJTL 3HMWH 5DLMH 5C0NC 1M2VB 1NAMA 1OGAA 1Q9LA 2EDTA 1BVOA 1XHHA 1NAMB 1OGAB 1Q9LB 4M48L 5AKSA 4KK5C 1HQ4A 4AGQA 3MKKA 1IC7H 4XVSL 2FLMA 1HQ4B 2DF3A 1ZLSH 2D7TH 4WDIA 2X6BA 1F4YL 4UV4L 4WDIB 1DE4A 1NCGA 1FFTB 4F3FA 1DE4B 3FW6A 1WAAA 1CXHA 1T83A 3F64A 1IBGH 3E38A 4HWZA 1XCTA 1PX3A 4HWZB 1XCTB 3AXIA 3I9PA 3BAYA 2HG5A 4H4NA 1HH9A 2ICEA 2HG5B 1ES0A 2P80D 1HH9B 2ICEB 4YE4H 5C6WH 4P59L 1ES0B 4PIRF 1CJYA 5A2FA 3ECQA 5GSVA 3RVWD 2VDRL 4HIIA 3T1FB 2XV0A 4HIIB 4N2AA 2ZF9A 4PV8A 1KGCE 1SMOA 4PV8B 2Z8RA 2B16A 3Q7JA 1X5AA 2GBAA 5EUKA 3KXFD 2MFNA 5EUKB 4Z0BL 1M6OA 1UC6A 1W16A 3SGDH 2IXQA 1HZHH 1M6OB 2R0ZL 2OL3L 5LGHH 4Y7MA 4QXGH 1O5PA 7TAAA 4UQAA 1KCBA 3FBQA 3LZFH 2QGEA 5CILL 4MZRA 3TN0A 4U1MA 2HT3C 3TN0B 4U1MB 4YDKH 4G9DA 5IMLA 3VFTA 4K3HA 1NEPA 4G9DB 5IMLB 1YPZF 4JE4B 2YAMA 3KGUA 5E4OA 1F0LA 4ZSOA 3RAJH 4PJHF 1I1AA 3KWWA 4OF6A 2ZWYA 4ZSOB 3HS8A 1I1AB 4NC1C 3INOA 3E6FA 3UG3A 1LO2H 2WYIA 2R29H 1Z9SA 3L4WA 5G2NA 4F8OA 3E6FB 4RZCA 4LQ1A 1Z9SB 1NBZA 1A9EA 4IRJA 4RZCB 1NBZB 1A9EB 2X5PA 4IRJB 1A02N 1TYJA 2WQWA 3W81A 1NCBH 1B4JL 5E2WH 1ZOXA 3RA7H 3MUGA 4LCCA 4L1BA 3UC2A 4GT0A 4ZTPH 4WGVB 4GXVL 4J3SA 4LCCB 4H20L 1Q0YL 2Z7YA 4O2FA 2CO1A 5C0IA 4UTCA 3B2XA 2ICCA 5KVFE 5C0IB 3MLUH 5JXAH 1U4FA 3QNZA 3CCHA 5GZND 3QSKB 1MI5D 3VXUE 1OAKH 3QNZB 3CCHB 3RRQA 2G2RA 2ENQA 4RWHA 1MFMA 1LQBC 2G2RB 4Y9EA 2K6YA 4YDJA 2YPVL 4ZTOL 5JHMA 2DOCA 4YDJB 4TVPE 3BQUB 1YA5A 3AS1A 4L48A 5DJYB 2N7BA 3T0EE 4P46C 2VZOA 3H3KA 2YK1H 4JO5A 1M1XA 5CFHA 3CFUA 3BOVA 3NPSB 4JRXE 1M1XB 2W92A 2YA2A 3L9RA 5HYJA 2QKSA 3F3HA 3L9RB 4WW2F 5HYJB 3S8FB 3RWDA 1U33A 3HE7C 5BQ7A 3L5XL 4K5OA 3RWDB 4IDJL 1OAUL 1ZHNA 4F8LA 4QWWD 4HJTA 1CGSH 5KS9A 2X70A 3D25A 4NBXB 2X70B 3D25B 1KIQA 2EIZB 2Q7AA 4I3GA 1KIQB 5CEZH 3WNIA 1XXDC 1AE6H 2R29A 4M6OL 2BSEA 3GBDA 2F58L 2P5WA 4PWGA 4HXBH 3DKHA 3G5VA 2P5WB 1MFUA 3B9VA 1YEJL 3G5VB 4M7KL 3VX1A 1Q38A 2IOOA 4KZCA 1HXYA 5IGXH 4IJTA 3FULA 3QJVB 1HXYB 1JDCA 1T7YA 3CIAA 3ZYOA 1U9KA 3ZQXA 5I1HL 1WTGT 1T20A 2WZPA 1EJOH 5JUEH 1BFOA 1QSZA 1T20B 2HT2C 2MPAH 1BFOB 3O0LA 3NPZB 5G4NA 5C9KA 1Q4NX 2C5DC 2Z8VC 3EYSH 2UY6A 1KB5L 1KBKA 3F7LA 1NCWH 4WWKA 3VFUA 4B9FA 1BVLA 1R1CA 1S9YA 2H26A 2UY6B 4WWKB 3ETBF 3HOGA 3VFUB 4D0DA 1BVLB 1S9YB 1OGTA 2H26B 2EZ0C 3LNGA 3TJEL 2CRZA 1OGTB 3KJ4C 3PWJA 4N0CC 4CC0A 4GUOA 4FNLH 3PWJB 2AEOA 2GI7A 4UQ9A 2V5YA 3ROLA 5JPNA 3QIUD 4JNXA 3ROLB 5JPNB 1DEEA 1DEEB 3ABMB 2Y5QA 4OD1H 8PAZA 2I69A 3D50A 4PWJA 2AK4E 1RUQL 4QHPA 4PJ9D 4X5WB 2R69A 5DYOA 3GMLA 2F7OA 1KDJA 5C86A 5DYOB 3GMLB 1NMBL 4JREB 3F6LA 4DGWC 5ESVA 2DYPA 3T6XA 5FYKL 3NK3A 1IAIH 2DYPB 5ESVB 1A47A 5D7IF 5F7HA 4JN2A 1YMME 4JN2B 4GPVA 5FM5O 3SDYL 1CDGA 4K3DH 1QFUL 3W37A 3I84A 1DQML 2CO2A 4TLSA 4YFLF 4DJMA 5D2NC 2E8ZA 3IBOA 2B39A 1WHPA 2J55A 3Q05A 1KTLA 3BMWA 1KTLB 2YUWA 1RZQA 4GQ9H 1G9ML 5EH1A 5FGRA 4A2EA 3V4LA 3AS2A 5DRXA 4DZ8A 5EFIA 4LSVH 3G5YA 3ULVE 5DRXB 4DZ8B 5EFIB 3IGLA 3G5YB 2FGWL 2A9ML 4XAKE 1ID2A 1RUKH 5D5ME 4Q58C 4M00A 5D9SA 3D30A 3DSNA 5D9SB 1QG3A 2GJ6E 3DSNB 4PJCE 3L5HA 4M7LT 2R4RL 3CNKA 1SRDA 1BQ5A 2VMJA 4EIZC 2OTWA 3S5YA 2J1XA 1PZUB 2VC2L 3OAZH 2OTWB 4AWJC 3ZHLA 4JKKA 3UXFA 1V27A 3BWAA 2YBRA 3LJ3A 4JQIH 1MXDA 4PLKC 2IJ0C 3IJSB 3BWAB 2YBRB 2WV3A 1ADQL 4GINA 4CW1A 3CPUA 1T1ZA 1SYVB 2X1PA 4GAFB 4CW1B 2EKJA 2VLKD 3HKFA 3WTTA 2VW7A 3ML9A 4MAZA 1KSRA 5EEXA 3IFPA 5FPIA 2JLPA 2ZX7A 3IFPB 4C4KT 3VVWA 2YAFA 3TV8A 2XXFA 5HTSA 4QI3A 2GSIA 4WKXA 5FB8A 4PS4H 4WNSA 2QLYA 2GSIB 5FB8B 2GJPA 1J5HA 1QP1A 3OKYA 1XZ0A 2OYPA 1Q72L 4Z7IA 4RAVA 3GD1C 1JD7A 2BVPA 4RAVB 2VDPH 4XX5A 2IWFA 3GBMH 2BVPB 4M8QA 3SHSA 3O2WH 3BLBA 4KJYA 1W0WA 2LHAA 4M8QB 2X05A 3WXVH 4J3UA 1W0WB 4UINH 5B4MC 4B0MB 3ZYJA 3VE0A 3AY4A 4H0HB 4PJ5D 4I3RL 3VE0B 3DNKA 3JTSA 1P1ZA 1RULH 3PHQA 3APNA 2CMRL 3JTSB 3QQDA 1P1ZB 4JKPL 3PHQB 2DEYX 3PJNA 2ZG3A 2N7AA 2PO6C 1OHQA 3MPCA 3QQDB 4W9EC 5GGVH 2Z92A 1YNLL 5AOJA 2Z92B 3B9KC 3B37A 3V55A 3LN9A 3GSNH 5I74B 3WEBA 5FYLH 5SX4H 2V5MA 3BZ5A 4NZFA 5T1LA 5HXMA 4J3OF 4JQIA 5T1LB 4L1HA 3NJVA 1T0PB 4PS8A 4TSAL 5C08E 3HBQA 1M7DA 4LF3A 1MHEA 1BQLL 1GY2A 1M7DB 5SV3A 4LF3B 5CD5C 1MHEB 1N19A 1UD2A 3K8MA 4A7TA 5IUSA 4KZ0A 3NAAL 1I8MA 1I8MB 5E8EA 5AVRB 3WTVA 3GK8L 1RZGA 2ED9A 3N40P 5E8EB 5GRVL 1RZGB 4BINA 1QSED 4GMTL 5LBVA 1QATA 2V7HA 2X0WA 1CLOL 1EHKB 1ZV2A 1PLCA 4JDEA 5HDLA 3MRIA 4F2MA 1OM3H 2XTJE 4F2MB 3MRIB 5BJTA 2EDJA 3UMNA 2XQ0A 4JZJC 5BJTB 3MLRL 3NJIA 4OLWL 3JVGC 3UAFA 1D2OA 3HJ0A 5DD0H 4DCQA 2EO7A 2V9UA 4DCQB 2G3NA 2ZYSA 6FABL 3MRLB 4B7LA 4JHAH 2ZJSL 4M7ZC 3BCDA 3QDJE 2WLZA 3G6JE 4QXTA 1CVSC 2D3NA 4XC3H 4QXTB 1K5WA 2FX9H 2VW6A 1G0YR 4GIAA 2EJ1A 1CZ8L 3GHEH 5EORL 3D87B 4KX8A 3S2AA 1Q1PA 3TV3H 4BSJA 1F02I 5TF1L 4ES8A 2O5NA 3M1OA 4GG6A 4PR5A 3NCJH 4E9LA 4GG6B 3K3QA 4PR5B 5DVLA 1IBYA 1HHHA 3F7RA 5BV7L 1HHHB 4FAAB 1NA8A 1UD3A 1U21A 3HC3L 2IDSA 2D9QB 1JIBA 2R2BA 1BZOA 3C6LA 4OCSH 3IRZA 2KI6A 2R2BB 3C6LB 1V3JA 2CRYA 3B9EA 3VI4A 2WXJA 1KCRL 4R9HA 4MWFA 1J0IA 2DQCH 4YSRA 3VI4B 1KXVA 2HB0A 2AJXH 4MWFB 4ZJ9A 1NCAL 4O9HL 1FH2A 3JWNC 5PCYA 1U91B 4GO8A 5KVFL 1UEMA 2BY0A 1DQVA 2ZUUA 4ZNEE 1PFCA 2QFRA 2J12B 1TJGH 3MVSA 4UILH 1ZA6A 3U6XS 2B9BA 1T89A 4Y8AA 3C60D 1P1VA 3PY9A 3R1GL 1ZA6B 5EOCL 4F92B 2FBJL 5F3HA 1T6WA 2HH0H 4N0RA 4A7VA 2FLBT 2ID5A 2LFGA 5F3HB 3CVIH 2J7LA 4Z1PA 3P73A 4L37A 2AXJA 2CO6A 3P73B 4L37B 4AYMC 4N3UA 1EX0A 3N9GL 2CO6B 3FK3A 5GS0D 4D8OA 1HYSC 3CFJA 1UWGH 3EJUA 4GYBA 2R4SL 4AOFA 5F44A 1TMCB 3CFJB 5IFAL 5IREA 3BZFB 2X1OA 2G3ZA 3W5NA 3HE6C 2QV4A 1YJDH 3VWKD 3C08L 3FQYA 4ADIA 5FF6A 2XPYA 4P0DA 5FF6B 2WYHA 2XA8L 4FNTA 2P8MA 2J73A 4ACPA 3WIHL 2P8MB 4AKOA 3L3OC 3TEWA 4UU9A 5FM4A 3H0TA 1L0QA 3AREA 4LQFL 3H0TB 3AREB 3HR6A 3TPUB 1ACCA 1WP6A 1JGLL 2R0ZH 2J8UF 3H7BA 1WUZA 2JIXD 1ADWA 4AXWA 1IBBA 3SPCA 3WCYA 4AXWB 1GHFL 1CU4H 5GS2D 4F8PA 1FNEA 1XXFC 1FNEB 2V5SA 1A6UL 1CQKA 3ARSA 1PLBA 2A73A 3U6RA 3VXRA 3U6RB 2EIEA 4LCYA 2A73B 3VXRB 3V5KA 5D7KE 4FG6C 4LCYB 3GPEA 2EEXA 4CKVX 2R1YB 4K5PA 3NSDA 4MJJA 5DO8A 4BXVA 4CBZA 1JNNH 4DKFH 2M83A 5J9PA 4ZMQA 4FXGA 2BDNH 2RACA 5T1DH 3S0PA 3TBCA 3PG2A 5J9PB 2EDMA 4FXGB 2W80C 4JHBA 5FW7A 2YA1A 4KKCD 1LWJA 2PWEA 3VD9A 5DJZA 4PJEE 1ZANH 2F6AA 2Y3NA 3TASA 5IBTL 3EYUL 5IBLD 1U3HD 1QLFA 1R3LA 1DVFA 2YRZA 2NY3C 2XG4A 1QLFB 1R3LB 2DWXA 3I02A 1DVFB 1VFOA 1NGZA 2XG4B 3I02B 2ZONA 5DS2A 5AEAA 1YEHL 1NGZB 1PKQE 1I1RA 1NOLA 4XP6H 3BUYA 5LXGH 4AL8L 4P48A 2JXMA 3AWFA 3S4SG 4R7DA 5B38A 2E6JA 2YPLD 5ACMA 1DQJA 5B38B 1JFQL 1DQJB 3WNPA 1FNGA 3L3JA 2ZSVA 4ALAH 1FNGB 3L3JB 4S0SD 2ZSVB 4WI0A 4Y7OC 4WI0B 3LD8B 5IW1A 1FNAA 3E8VA 4NHUA 5IW6A 1OANA 1RVFL 5E2TH 5IW1B 1TZIA 1GGCL 3DPBB 2CU9A 4NHUB 5IW6B 4EIBA 5KSBF 4F7MA 4NC1E 1TZIB 3T8XA 2F5AH 5FA4A 4F7MB 3O6FC 2G3XA 4EIUA 3T8XB 1XR8A 5FA4B 2IWEA 1XR8B 4XNUL 3L5XH 3QUXA 3ZVVA 4IDJH 1MJUH 3P3UA 1HNYA 1OD9A 2GQHA 3QUXB 4HBCH 4MCZA 3ZQ9A 4DK6A 3P4MA 4K7PL 5MENA 4MCZB 5MENB 3P4MB 3UCQA 4CRPA 2IH9A 4GQRA 4N0YH 2QV2A 3P0YH 2OZNA 4YHYB 5JW3H 2B1AH 1Y1DA 4KHTL 1PZAA 1HCYA 3LMJL 1QW9A 3ULVL 4DW2L 1B2YA 3FB8A 4ES9A 2JCCE 1X6NA 1S3KL 3FB8B 2YQ3A 2RD0A 2CGRL 3KYOA 2EVFA 1EJFA 2NYYD 2DKSA 1F6AB 1MNUH 3KYOB 1ROCA 2PWFA 4QCIA 4X9YA 4QCIB 5FGCB 3LPOA 5CM1A 5HYQA 3OB0H 1JF6A 5HYQB 4KGJA 2ADIA 5EU3A 2ADIB 4NWUL 5DWPA 4K7PY 2HMIC 5EU3B 5FECA 3HRZB 1QEWA 5FECB 2X0VA 2ZSWA 3HZMA 1QEWB 2ZSWB 3PQYE 3HZMB 4BA0A 2WO4A 1I1CA 5LG1A 2IV9A 3FUIA 5GRUH 1WA2X 1WITA 3WFCH 3IE9A 4XC1L 3QFDB 2Z7UA 4JUSA 4W81A 3U46A 3DO4A 3U46B 4JO2L 4LIQH 4R5TA 3R19A 4IJ3C 2E7MA 1T2XA 2PABA 2CBTA 3ARQA 4G6ML 5DRWA 4XP5H 1PG7W 5JHDD 4LVNB 2F53E 1HYRC 1A0QL 5D1QC 1TQSA 3PUUA 4ETYA 1RJZA 1NM9A 4WI3A 1CXIA 1RJZB 2V5TA 2VNCA 3L17A 4KWUA 4QRPD 2WQSA 3GI8L 2G5BA 1MI5A 3MV8A 3RLSA 3T9WA 3U7WH 1MI5B 3MV8B 4P4KD 1RZJC 5A2BA 3CQFA 1I1YA 3EOBA 1QW8A 1VZIA 1QWHA 1I1YB 3EOBB 4GIOA 4NHCH 1CGTA 2C7UA 4N90D 5MEOA 3KH3A 5KZCD 4XH2A 2C7UB 5MEOB 1MXGA 1OARH 2CUHA 4NQQA 1L0YA 2YGQA 2Z4TA 3NACL 4XH2B 5F9WC 1AIZA 4ZDHA 5JR1L 3BFWA 1G9MH 5D70H 4DESA 4ZDHB 2Q7NA 3NZ8A 4WHYG 3B2DC 5FK9A 1RUPH 3NZ8B 5CJQL 3QEQD 5FK9B 1CL7L 4W1TA 2EVJA 2JKLA 4KUZH 2A9MH 4G7VL 4KAQH 3QULA 3HLKA 2AQSA 3QULB 2E5EA 2XKNA 4PMEA 3QHFH 1WZ1L 2YO3A 2XKNB 1IGCH 3PP3K 4XPGL 4ANKA 5I1EL 2HA1A 3FFCE 4LK4A 2WWOA 2CO4A 2YAPA 1KYOK 3HBZA 1C9SA 2ZAGA 1TO4A 1R4XA 3STBA 5BO0D 4YDIL 2WUCH 3GHBH 1YEDA 1XX9C 4OFQA 3IF1A 4TRPL 5D2NE 1YEDB 4QRRA 1FO0L 3IF1B 5C3LD 4OQTH 3D8MA 4QRRB 1ZK5A 1DBJH 1BZDA 1S78C 3WY1A 1RERA 1CBVL 3L5WA 1KV3A 4HPOH 4RFOL 1MWOA 5AAMA 4BZ2L 2A38A 3B5HA 4N8VG 4ZS6C 3T71A 1AXTH 5FR3A 1NCDH 4L23A 1KZQA 1GW6A 1N12A 1XGZA 3KD4A 3IAPA 4FDWA 3MBXH 1Q8MA 2E56A 5HHOE 2UWEE 2AQNA 3V4PH 1N2RA 4N2EA 2JTYA 1N2RB 4RGNC 1LP9A 1JGDA 2JVUA 1LP9B 3EJCA 1JGDB 1SJEA 1SJEB 2PTTA 1KC5L 3RL2A 2BHYA 2PTTB 3RL2B 2DI7A 4BM7A 5F1KC 1QD0A 1KBBA 4JFSA 4YJZL 2CMRH 3TBYA 3QCUH 1PG7L 2AGJL 2Z8WC 5C2BL 3TBYB 5KW9L 5EWIL 1UCBL 4URTB 2BO0A 3MV11 4MA7L 5ANMB 2IDUA 5FYJL 5IJCC 4H8PA 4YDVA 1A4JB 1P9MA 3GFUA 5AZEL 3V4VH 4J3WA 3UZEA 3LB6D 4YDVB 5I73C 1MNNA 2RR3A 2EC9T 4GBXD 2FX8L 2F19H 2AFNA 5TQ2L 1CFSA 4DERA 4IDLA 5JOPD 1CFSB 2I7SA 4PI2A 4XBEL 2N56A 4OQTA 5DFWH 4HK3N 4CMHC 3KL0A 1G5AA 1NIDA 4JRYD 1EZVY 2EXTA 4KHXL 3CBJB 3F58H 4HEPG 4JM4H 2H9GA 3VXME 4Z7NE 4A7QA 2HFGH 3MJ9L 1UACH 1MCRA 4I13B 4F2EA 3FTGB 1X5XA 2C3XA 3OGCA 3K6DA 5DHXB 5DR5H 3SZKC 3OGCB 3V4PA 1WICA 3D2UD 3V4PB 2ARJA 1C7SA 4HXAH 3EYOA 1J0HA 5HGGS 2ARJB 1EUTA 3EYOB 4TLTA 4OFPA 12E8L 1C1EH 5DWUL 5KWYC 3TF4A 3O8XA 3LVEA 4OLUL 1H3PH 3O8XB 35C8L 3MRCA 3WYRA 3AROA 4YHZL 4P2QE 4Z5RA 1SY6H 3MRCB 1A9BB 3L4YA 3MA7A 5LB1A 2YUXA 4XCFL 4Z5RB 3QZWA 1D9KC 3MA7B 4F58L 2EUXA 3P30H 3QZWB 3WFEL 3L4CA 5IIEA 3SPIA 4HX1A 4CJ0A 4AT6A 4PG9A 4HX1B 4N5EC 2PN5A 4FA8A 2X6AA 3V0IA 3V4VA 4PG9B 3JV0A 4AT6B 3QI9D 4L2YA 2X4PA 3V4VB 4WNJA 2X4PB 1PIGA 5FGBA 4GO6B 4NJAH 4Q0XH 2QKIC 5EORH 4NUGL 1U3YA 1JD9A 4L3CA 4X6DA 4N28A 4L3CB 4GRMA 2BNQD 4X6DB 4NZTL 3BUDA 2D7MA 4GRMB 2OR9L 2PWGA 2V5RA 4ANUA 1RURL 2VMCA 4KZEL 3R8QA 3T65A 3HC3H 4FLRA 3T65B 3FO0L 3HG5A 4G1EA 1G5GA 3ULUC 4G1EB 2SODB 4B9YA 1A7NL 1KCRH 2RMNA 4PJ5A 3TA4D 3K2UL 1DANT 4PJ5B 5F7DA 5I1IH 1YN7A 4GRWB 4ZUSA 5F7DB 4FE9A 1F3RB 1FSKB 1YN7B 2ENYA 2ZXDA 1OTTD 3VMOA 2CUAA 1YY9C 2EDRA 5H94A 5JA8B 3H42H 4OAWA 2A77H 1CT8A 5H94B 5C0CA 2X2YA 1OOWA 4LKXA 4OAWB 1CT8B 2JNZA 4K73A 5E6RB 5I17A 1QZNA 4LKXB 5I17B 2ZKYA 3OHXA 3S88L 3L95A 1SY6A 5C0RL 3O2DH 4AE1A 2PYEE 3GB7A 3OHXB 3F2LA 3EHBC 4TVSa 1UH3A 3GB7B 4WKZA 1NWOA 2EDEA 5AZ2H 4KQ3L 2DDQL 4WKZB 4XXCC 5D1XD 2V7NA 2CRIA 4JFDE 1QNZH 3ZZLA 3QQ9D 1ZGLA 1MCFA 2V7NB 4LNRA 2DL2A 1ZGLB 2VN6A 4LNRB 1T4WA 4DVBA 1A1OB 3KYKH 2CDGA 4ZT1A 3ZTNL 5ALBL 4DVBB 3Q6FA 3GLEA 3X3GH 4I8DA 4M02A 3Q6FB 4KK8D 1T7WA 2ZKMX 3Q1EA 4MXWL 3RP1A 1DQQA 1XMEB 2P52A 4I3SH 1DQQB 4P5MA 1X3DA 3RTLA 3JWNE 4P5MB 5T3ZE 4NOBA 5LBSL 4LQFH 2K78A 2V2WB 4IMKA 4OGYL 1XB3A 1Y6MR 4XPBH 1KPUA 2OXHB 1J8HE 1WTLA 3PGCA 1KPUB 1NAKL 4D8PA 2VXUL 2D7OA 3PGCB 5DVOA 1T03L 4JO4L 1W0VA 2BSDA 1UM5H 3D05A 4R0LC 3T2OA 4D8PB 1GHFH 4YX2H 1W0VB 3A0OA 4Q4EA 3NIDF 2OI9B 2VL5A 4OCXH 1CD9B 2XN1A 3EJJX 1A6UH 2VL5B 3L3GA 1TVBA 5IVXA 3EOTH 3L3GB 1ZWIA 4XWGH 1TVBB 5IVXB 2ZNWA 5ALCL 1ZWIB 5GS0H 5K9KB 1CE6A 4RSYA 1AG0A 4YEEA 1MJ7L 1ACZA 3EYQD 2EXYD 1CICC 2WWKT 2WAHA 3ILQC 3VXSD 4EI5A 2DLGA 2PP7A 3LDBB 4NQEE 1KCLA 2IALA 4TKWA 4TSCH 4EI5B 2PXYC 4FRWA 2IALB 2YMOA 4BE5A 3CXDL 3F62A 3O2DA 3KLSA 5IB1A 3JVFC 4X7FC 5IB1B 2JTDA 2Y25A 5ANHA 3F7YB 4TSBL 3ARDC 3N2JA 3HI6L 1W72L 4X4ZA 4P5SA 1MCIA 1GS7A 3DX8B 2XSKA 5C71A 1D7BA 4JPKH 3HNSH 4UQBA 4JVPA 1K8IA 3QWRD 1BXUA 4UNTA 1K8IB 2EYTA 3OC8A 2E7CA 5EA0L 3TA3C 2NOYA 2EYTB 5KSBB 5GS2H 4KXZH 3V0JA 1ET7A 2FWLB 4S1QL 4AIEA 1JZDC 2GBVA 4Z7QB 2WKLA 3H9HA 4HD5A 1E27A 2VOTA 4JJOA 3H9HB 1E27B