1RH8A

Three-dimensional structure of the calcium-free piccolo c2a-domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
142
structure length
142
Chain Sequence
ASHPITGEIQLQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLMKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in the Piccolo C2A domain regulated by alternative splicing.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
molecule keywords Piccolo protein
total genus 20
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2003-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1rh8A00
3CSFA 2CHWA 2WXHA 4F1SA 2WXJA 3KWTA 3ZVVA 2Q3XA 1BCIA 4KITB 4PS3A 3HN8A 5T8IA 2WXKA 2QZQA 2B3RA 1WFMA 4QJ3B 4JPSA 4QJ4B 4NP9A 1V27A 2R83A 3L13A 2WXGA 3F01A 4V11A 1E90A 3PYCA 4WEEA 4ICXA 3L17A 2RD0A 2K45A 1GMIA 1YRKA 2KI6A 3R7QA 2WXRA 4DK5A 3HIZA 5EDSA 1RH8A 3F05A 1DJXA 4Y1TA 1WFJA 3QK0A 3B7YA 3ZW3A 2FK9A 2UZPA 4AOFA 2ENPA 2WXFA 3ENEA 3QJZA 3ZIMA 4A55A 2WXPA 2WXOA 5H4ZA 3LJ3A 4IHBA 4WAFA 4FA6A 3TWYA 4L1LA 2WXQA 2NSQA 4LT7A 3APDA 1E8WA 1DJZA 2ENJA 4OVVA 4FADA 3T8MA 3DBSA 3TJPA 1CJYA 4URKA 2LHAA 2JQZA 3FBKA 1BDYA 2A4ZA 3ML8A 3GPEA 3L4CA 5G2NA 4EZKA 1E8ZA 4BGDA 4WWPA 3JZYA 4L2YA 2K4AA 5KJ7E 2Z0UA 2WXLA 4WWNA 5JHBA 4ICWA 4XE0A 1E8YA 4IQHA 3RDJA 1HE8A 4ANUA 4L23A 3CSTA 3M7FB 3PREA 1DJGA 1E7UA 2Q0ZX 1E7VA 2NCEA 2CHZA 2FJUB 1DJHA 4FJYA 3L9BA 4L1BA 4ANWA 4FHKA 2CJTA 3PRZA 3QAQA 4F93B 2WXNA 3IM1A 1RSYA 3DPDA 4TUUA 4KZCA 3KWUA 1BYNA 4NPJA 5G55A 3RPBA 3PS6A 5H4YA 3TL5A 2NQ3A 2ISDA 4GB9A 3IBEA 4XZ4A 4HVBA 5CCJA 3F00A 3S2AA 2X38A 2YRBA 3OHMB 4QAMB 5JHAA 3APFA 5CCHE 3APCA 4FHJA 2Y3AA 1DJIA 1A25A 3L16A 2D8KA 3NZUA 4OVUA 4QJ5B 4EZLA 3ML9A 2A5UA 4WWOA 1W16A 4HLEA 5CCGE 3MJWA 3SD5A 2CM5A 2CHDA 3HHMA 2DMGA 1UGKA 3F04A 1W15A 4XX5A 1DJYA 1QATA 4PS8A 3NSJA 2DMHA 1DJWA 2V4LA 1TJMA 1QASA 4G11A 4NS0A 2WXMA 2K8MA 1UOVA 2QZ5A 3N5AA 3QR1A 4BFRA 4LCVA 2YOAA 4FULA 4F92B 1DSYA 4ANXA 2N1TE 3NZSA 3QARA 4PS7A 4ANVA 2EP6A 3FDWA 4TV3A 4MJJA 4FJZA 1DQVA 3PFQA 4TS6A 4FLHA 2CM6A 1E8XA 3W57A 3W56A 4DNLA 2ZKMX 4AJWA 1RLWA 1TJXA 2K3HA 4GNKB 2CHXA 3L54A 4KZ0A 4NPKA 4Y1SA 3QR0A 2WXIA 3R7RA 1UOWA 4LDCA 4J6IA 3L08A 1K5WA 4F91B 3OAWA 3P2BA 2CJSA 2BWQA 4EZJA 2ENQA
chains in the Genus database with same CATH superfamily
1P7QA 2NNFA 4G7VL 1A5FL 4P3CL 3QI9A 2MKWA 5A6LA 1SLWA 3GMMA 4E41A 2QMJA 1W72A 1S9YB 2P8MA 3LRKA 1HSBA 2HFFB 5I6XB 2PXYB 4LB8A 1EJ8A 1BVLA 5BZWA 3KBHE 4QRRD 3P4NA 2NUTB 5EO0A 1LWHA 4LEXL 3T3PF 4MMXB 1E2ZA 1RUML 2CR0A 2AQ2A 4ZZKA 3SPVA 1ZHBB 5I9QB 3NJJA 4OZ4B 4WGWB 1DJXA 1VF5C 3EG9A 4PCTA 3MLVH 1YJDL 3ULVF 1YMME 1PJ9A 4U1HB 1OTSC 3STZA 3ROOA 1EWHA 1JHTA 4D94A 1M9WA 3SZ6A 3UTSD 4PJ6A 2O1AA 3W3BA 4HH9A 1MCKA 1T0MA 1NPUA 4JQVA 3H3KA 5AB9A 4HCRL 1JYXA 1CLZH 5TQ0L 1N12A 2YD5A 4D0CB 5JQIB 5DWPA 3RNKB 4W9EC 2A9ML 3VW3L 5ADOH 5KW9L 2ATAA 3IU4L 1YEEH 4LDEB 2VITB 5CEYB 4P9HH 3QUYD 2CGYA 3GRBA 3W37A 4HOZA 1CD8A 4MCMA 3D85D 4X0NA 3FB5A 1MN4A 1NCHA 3DHMA 3EYUH 3H3BC 3MLUH 2K8QA 5CZRA 2ISDA 3MV7A 5JXAH 1DJSA 5HDWA 1XX9C 4BFOA 1RI8A 3FPYA 1MCWM 3L9YA 4W9CC 3H56A 4TSCL 3PWNA 1FL5B 2OZ4A 2VOTA 3N85L 3QFGA 3P30H 3QEQD 4W9FC 4FNRA 4UOJA 4PBVC 4N5UA 2D73A 2DMGA 1GJIA 1HWHB 4UT6L 2QGDA 4PJGE 2BIQA 1T22B 2QQLL 3MODH 2IOOA 3Q2LA 3O6FB 1WCBB 2V9QA 1A1MA 1WZ1H 4JQIL 1E3XA 1YHPA 4U6HB 2H2PD 3BH9B 4KJPD 1I9JL 2ERJC 4H20H 4K5NA 5GSRA 3JQOB 1DQVA 1IIKA 3DI3B 4QOKB 3V5KB 5L7XH 1JZHA 3U48A 1BZ7A 4RMSA 4ELKA 3IMRA 3GKZA 4R97C 1XEUA 1LO3H 3VXQB 1HXMA 3VGAB 3DGGA 5B8CB 3BIBX 1QFWI 2ZKWA 3GS0A 5JXEC 3T2QA 1AQDA 3MA7B 4R3SB 3P2BA 4X6FB 2NW3A 1MW0A 3IDYB 5ACMA 4QNPE 2ZXEB 4G8EB 2ZKXA 3KS0J 3NDZE 4JFTA 5KBNC 2W0KA 5DS8B 2CLRB 1COBA 1LO4L 3GS4A 3EFFB 1I9JH 4P4KD 1Q9KA 2YGPA 1R3IH 3KPRE 2NDGA 4M43H 1XGTA 3SBWC 2H1XA 1CE1H 4XVJH 5I1GL 3U7YL 3HZMB 1SY6A 3VRIA 3QPXL 1XSKA 5BV7C 2BIHA 1CLYH 2QJDA 3EYVA 3L3OC 2J1WA 2Z7UA 3ULUE 2B4CC 5IB1A 4ODWA 1G4MA 3P2DA 1S46A 4DCQA 1L7TH 1BLIA 4YSEA 1E8WA 2IH3A 1MXGA 4FYQA 4POZC 4BCXA 4G6KL 2IV9A 3MRHA 4NO3B 2C1OB 2VXVH 4EVNA 1UXSB 3X11B 1A9EA 4C54A 5JIHA 3BLPX 3OL2A 3A47A 3R06B 5I71B 1QI5A 3PNWB 4P2RA 4HIHB 3ZHFA 2BC4B 2XU9A 3G5WA 3C8KA 2JKSA 4N2GA 1F41A 1CR9H 3IXAA 4KO9A 3QI9C 4TSBH 1NMAH 5CEZH 3QJTB 1W72H 1M57B 3ZR5A 1B9KA 5D7HA 3FT4A 3SCMB 3BQUC 2APTA 3ZKMC 3VSQA 2VABA 2FGZA 4JFZH 5JPMA 1YEJH 3GRGA 4TL5A 4XGZA 2W0PA 3I6KA 3GMOB 5JHAA 2K1MA 4B53A 2LGNA 1GGTA 2VIRA 1IC5H 1XT5A 2Y2TA 3A67H 1QP1A 5LBSL 1ZLSH 2BJML 1L7IL 1GTNA 5AOIA 4HJJH 5IB4B 1KXVA 5EOCL 3MNVB 1CQYA 4U2YA 5I5RA 1J1PH 4P5TA 5I1EL 4HISA 1R47A 4YSPA 2QZ5A 5TDPB 4WO4B 1I85A 3GMRA 3OQ3B 5FGBA 1VEPA 5AW5B 4JDEB 4NZFA 3W2DH 1QR1B 3W5NA 1XL4A 3FDWA 3AREC 3RVVC 3MC0A 2D7TL 1CTMA 4NXKA 1W9XA 2BSBA 5A6MA 5E2TL 2YEVB 1L6ZA 2DLGA 1B4TA 1NCGA 1Y0LA 4LCIH 3S37L 3MLPA 1MLCB 1VACB 1VCBC 3BWAA 4ZTPL 3D0LB 3THMH 5LAXA 4NT6B 2X70B 3MAWA 3SQRA 4PCKA 3GI8H 1MNNA 4A7UA 5AB0A 5C7ZA 4OUOA 4G80A 5ID1A 1LEIB 1HS6A 1EHAA 3EGDA 3IJ9A 2WQAA 5KANG 2ZOOA 4P5TC 4RWHA 3MTRA 1G9MC 1GW0A 1KDIA 2HPTA 3HNTL 2HFFA 2C4FU 1MUJA 2EEAA 4EN3D 4DEPC 1NBCA 4QJ4B 3O6ML 4W9GC 1F6LL 3VI4E 4DP6X 4LLVB 2D03H 3EFDL 3ZW3A 1VZHA 1TTAA 2DI7A 2DMCA 3PAUA 3U1SL 5DD1H 4Z95H 5E7FA 3T3MF 1U92B 5HHOB 2VLKD 3LS4L 3A6BL 3WKYA 3ZZSA 4ONGH 5HGHB 1GY2A 1JNHB 2IALB 1QSFB 1SZNA 1UKQA 5MP6H 1M6UA 3RB5A 1VCAA 4GG6E 3QNZA 4ODUB 4CADA 3KPMB 3MRJA 2A9MH 3BN9D 3PQYE 3PU7A 4JQIH 2PCFB 3SKJH 1CXFA 3FBKA 1J0JA 2JWYA 3WTXA 3WJMB 1BM3L 2Q2EB 5I73C 2HRPH 5E0FA 3V4VB 2QL1A 1E5CA 1JF5A 2YPVL 5AFAA 5I5IA 2V9RA 4AENA 1P4BL 2A74C 1R3LB 3UTZA 2YUXA 4NX0A 4Y4FB 3V0AC 4A39A 1A1NB 2EKSB 3QYCA 2JCCB 3KEHA 1OT1A 3HE6C 3MR9B 4R0LC 5IJCC 5A6IA 1KJ3L 3ELQA 4JB9H 2FX9L 4JGUA 5L0QC 2CBMA 1U8LB 1KJ2H 2WQWA 4WCYL 4ZSOA 4EAEA 3FU5A 3HAEG 1KNOA 2NY7H 2OMZA 3C9NB 5DT1L 3D30A 3S2AA 3BKJL 3CHSA 3SKJL 7CGTA 4F8TA 1GYCA 1KEML 5JORB 3OHXC 3VH8G 4NC1C 3DGDA 4YBLC 5KZCD 1T83C 3ECBB 2WLIB 5B1AB 3B7SA 4IIQC 5GGQH 2ZYHA 5IFAL 1OP9A 5DLLA 1V54B 1V7NH 3TV3H 1AXTH 1EAQA 4PJAE 4XWOC 5IUSA 3KBEA 2IG2H 4LCWE 4JFZL 2O93L 3F84A 5DK0A 1KPVA 3WFCL 3C5XA 4D7PA 2YBGA 5IGXH 4QEGA 3STLA 4C56D 1FUNA 3N40F 4LPCA 4JCLA 3CLFL 4Z3GA 4ZMOA 4YC2C 5B1JC 2HYMA 3Q6FB 1UA6L 3GBNH 1LO2L 4LAJH 2Y06L 1GC1C 1PZ5B 5LGHH 5F97E 5TDOA 3WS3A 5D2LB 2PYFB 2YIHA 3BP5B 1MREL 3Q5OA 4L3EE 5CJXA 3G04A 1OAUH 3IJSB 3SPVB 2R0KL 4JR9H 4G6JH 4ONOA 4PLJD 1XH2A 5IBLC 43C9B 4PJGB 5DUML 2Q6WA 2GJ6A 4MBRA 4YZWA 2R2HA 1BXVA 4YEFA 2GJ6D 1KGJA 2WSPA 3GMMB 4NNPL 4LLYA 2YJLA 3X3GL 2CRZA 3P3TA 2ATPA 1O6VA 4RAVA 5FYLD 4LVNC 1KTKE 4KGJA 1IEBB 2CR3A 2XQYK 4N0RA 3CK0H 2V6HA 1FH5L 1JPFA 4D9RE 2ZWZA 2E9IA 2N7BA 3NABH 4HH9B 3GBNL 4P4RB 2ZSVA 4PBWD 4IU2B 3ALPA 1WYJA 1A6VH 3D85A 4RGMC 3PP4L 1BQKA 4MXQC 1Y18A 1UXWA 2YFOA 5DJ2B 5IKCA 1P5VB 4E5XA 5I28A 1XHHA 3GRWL 4OCWH 2UWEF 3QZNA 3IU3B 3OHXA 5FW7A 3SIKA 1LEGA 2JH2A 2NXZD 4OV5A 4LPUA 5BRZD 1A14H 4TNWF 4U1NA 3TP4A 4G8IB 4L4VA 1UM6L 4MB1A 3DC0A 1FQ9C 3QGVA 4GRLD 3G5ZA 3HMWL 4PJXA 3BAEH 1ZLUH 1FZMA 2BSTB 5C0IB 1G9EA 5JHDE 1IAOB 1BQHG 5IJDC 4HAGA 2ZKHH 5KSAC 1ZEAL 3SDCC 1T1ZA 1ZA3A 1VA9A 1MFDL 1AO7E 4HMDA 1PZ2A 3SBPA 5CMAB 1F90L 1Z7JA 4WNJA 3PGCB 5D9SB 3QUYA 1KXVC 3DUSA 4Z7OF 3CZNA 4DVBB 1OSPH 4P23D 1ZKAA 2UXGA 1JWUB 1DBMH 3EJRA 3QFJE 4AV0A 1C5DB 2QR0B 3QRGH 1HCYA 3VGBA 2B9AA 3BH9A 2OTUB 4QOKA 3V5KA 4GFTB 2IPKA 2ZPKH 4GQZA 3QG7L 3QO0B 5ESAA 3FJTA 3EDFA 4GW1B 4FULA 4NHUA 1M6OA 4N90D 4ANXA 3Q8BA 4G8GA 2FQDA 4U0RC 4P5RA 4CN1A 4R7LA 2OMUA 3THML 1KTCA 3UP6A 5CSGA 2HVKB 4M7LH 3GHEL 4S0HA 4H8WH 1WFIA 1QLFA 3DRQB 3OM3B 4WW1A 3VRLE 3D34A 4MNQB 3CFKA 3BIKB 2COVD 3QCVH 3QJSB 5IF0B 1MFCL 2Z91A 4HS6A 1LEKA 2KZWA 3KPNB 4HPYL 1Q9KB 1BF5A 3T2LA 4Y9EA 1IU1A 4CVZB 5C6PB 5DMYA 2AFNA 5J89A 4OD3L 4A7GF 4FC3E 2F58H 2ARWA 4NO0D 4P2OB 2VC2B 1MY7A 3GXMA 2F68X 4RRPA 3IBOA 2Z7ZA 2AEOA 1DEDA 4Y8DC 4EPSA 4M5ZL 4NUJB 3AAZA 1P69B 3FT0A 3BAIA 5DJZB 4HJGA 4HDIA 3WNMA 2YS4A 5L4IA 1XXFC 5IFHH 5GGVL 5LBVA 4HGKC 4XP4H 3EFOA 4DP9X 1SFHA 2OX5B 3F58H 1AFVH 2MCG1 1RPKA 1IGYB 4Q6KA 3TO2B 1OGAB 4FXGB 4ODUA 1TITA 4PGJA 4LSDA 5EU3A 1ZLWK 2EH8L 2VL5A 3LEYH 5DVKA 1KB9K 4HV8A 4K2UH 1FLTX 3R0NA 1BQRA 1S2EA 3D06A 4KUZL 3BPNC 3VVWA 1BOYA 3EJUA 3FT4B 4U1JA 1WITA 1KGIA 2C1OA 5GZND 2VDMB 2VABB 1IC5L 3S8FB 1ZV9A 4LHUG 1EO5A 1Y6NR 2K6ZA 1UUSA 1BECA 1KIPB 1PQZA 1XF5B 1HILB 2CCWA 1YEHL 4FNUA 1HJCA 1MH5A 4YQXL 3CFQA 4Q56A 4FZEL 5F7DB 3HLKA 4FMFA 4PJBB 3WTVA 3UXFA 4PB9H 4HVBA 2IG2L 2FL5A 3QFJD 4L18A 4GG6B 4B50A 4Z7AA 4OFYD 4ZYKA 3MNVA 3GXUB 5EIQA 1A64A 1IEAB 4BZYA 2R1WB 4QD2E 1PIFA 5JO5A 3KG5A 2X6UA 3GLDA 1N59A 1NWOA 4HIPA 1M71A 4GRLB 2CHDA 3P9WB 5HI5D 1W0WB 4F7MA 1QR1A 3AB0C 5BUGA 2Y1ZA 2AJUH 3W39A 5DQDH 4ZO9A 2MJWA 1AGCA 4IJTA 3ZZLA 5FGSA 3VXTB 5JHDB 4UUJA 2AV1B 2GBVA 3WIHH 3NZSA 3VFMB 1EEQA 2A0LD 1MCCA 1T1YB 2DQDH 2KPWA 3FOMB 4M1GH 3RFZC 3BT2L 3HPJB 3APNA 3OJMB 2Q87A 1SVZA 5KOVC 3RVTC 5KVEL 5C0FB 4G1MB 1J0YA 3DXAE 4PLOB 3ZDZE 3SBWA 4U33A 5GGRY 5CLWA 2ZOTA 4MA7L 3VX0A 5DZJA 4G8GE 3ARED 3OR7A 4FKEA 1KYOK 1G87A 5CN3A 5ECGA 5JQ6H 1PX4A 2CPCA 1U8MA 4F2MB 3HBPA 4V1DA 1QX1A 1MQKH 5HP5A 2WWKO 4CVUA 4AYEC 4Q6IB 4OBRA 3N9GL 5C1MB 4BFBD 1OM3L 2FD6L 1FP5A 4MLSA 1HSAB 2VLLA 5E8DH 1MUJB 5A7EA 1LL1A 2VLRE 3PL6A 4P3WA 4TNVF 1DQJB 4OLUH 4PJFA 4IBSA 4YLCA 2V3EA 3ZXAC 1K4DB 3LS5H 3AG3B 3D85B 5GS2H 2C3VA 3O2DA 4OY9A 3I9PA 3V0JA 3FAWA 1HIMH 2ZKHL 3LEXB 1CYGA 4URKA 4LKCA 4IRJA 3D39D 1YEEL 1TETL 4R83A 3OHXB 2NZIA 5BZXA 4PFEA 4MCYA 1I3VA 2WO3B 3S5YA 4D2NA 1XF2B 3ZUNC 3OWRA 2EINB 4NC0B 3GS7A 2LTQB 4FJ6A 4A1RA 4ZMTA 1J5OL 2GIXA 3LSOA 3RX5A 4IU3A 4LCYB 3LPFA 2ZUWA 4R4BB 4OQTH 5EF2A 1T66D 4HIXL 2XCMC 4ZFOL 3NDYE 1CK0L 1SHMA 2QADD 1BFVL 2NTFB 3PL6C 3F83A 3ZMNA 4P59L 2XN0A 4TQHA 3VXRA 1DVQA 4WFHE 3VFRA 2WN3A 4H1LA 1C5CH 3GSNA 5EUOF 3KW8A 1R5WA 3LZRA 3L5XH 4JUTA 2A9CA 4WNSA 4HH8A 1S7UB 5AAWA 4Y5YC 4NCDA 4AJVA 3Q3GB 3ULVE 5T33H 1U8LA 4BWTA 4YSRA 4KQ4L 4TUJB 5MP6L 1K6QH 2X1OA 3KPOB 3BP7A 3FAXA 1TQTA 1ONQA 3QUKA 1EFQA 5D4QA 1YYMH 2YGVA 4WTXA 3NCMA 2VJ0A 2X6MA 3CVHL 1KPVB 2BSEA 3O4OC 4NQCE 4RETB 1AYOA 3DXAA 2F1AA 5DRWA 2HX8A 3QDMD 5SWZB 3X13B 4YNYA 4AK1A 1G1YA 2V7NB 3GM8A 4JO1L 3N44F 2IPKB 3WY4A 3QO0A 2AABL 1GZHC 2AXFB 1IAKB 3FC8A 4G7QB 2EP6A 4N5EC 4WI8A 1UCBH 3T77A 5TD4A 3U83A 1E67A 1FCCA 3S4SG 1UHVA 3BUIA 2GBAA 3H9SB 4OB5H 2K7PA 4MS8D 3SHSA 4ELMB 4LNRB 3QDAA 1J0KA 1B2WH 3N0PB 3GSQA 2DN7A 1FN4B 3X3GH 1NJ9B 1JZGA 2VDQH 4G7YL 4G7SB 1KJ2B 4KKBC 1S7RA 4CVWA 2WXJA 4XXWA 5FYKU 1FYTB 1EDQA 3H1ZA 4M29A 4MWFB 5CIPA 5HHNA 4ZAKA 4XAWH 2X05A 2N56A 5KEZA 2JCWA 4GAJL 3CH1A 3S37X 1H3PH 2QFPA 4JN2A 5JIPA 4UDUA 4YBQC 2DBJA 4WI4A 4XP4L 3FTUA 2ZSVB 1BZ9B 3RP1A 3MV8D 4OM0H 4HIQA 4MSWB 4Q89A 5DJ2A 5IKCB 2ZG2A 4WI9A 1ZT4A 3VSUA 2IF7A 3C5ZC 2GBUA 1EMTH 1T5WA 1J88A 1XGQA 2F19H 3MU3A 4M93C 3WIHA 5KVDE 3G6DL 2GHWB 2CGZA 3WLBB 1IGYA 3S6CA 4PW4A 4NOBA 4X5PA 3AGWA 4JGNA 3TO2A 4AE1A 1FAIH 4LE8A 2EE2A 5E2JA 3AG2B 2KLSA 1QHQA 1WAAA 4P57B 5E2UH 3IFPA 2SEBA 2MWCA 4W81A 4AVHA 4XNQA 2FT8A 1DL7H 4MJ5A 4N25A 3DHUA 4DKEH 1H3PL 2DQGL 1RULL 3GBMH 1TZGL 4GKLA 2XV3A 2JF1A 1KPUB 3V6ZB 3V7AG 5I0YA 1F3RB 3F6JA 3P9MA 4WGVB 4LSTH 1NH6A 1E7VA 4XO4A 3SD2A 2FEDC 4ZUUA 2IANB 3OQRA 1UG9A 4A2MA 2QTVA 1Z3GH 4TTDC 1BXUA 4BQ8A 3G5ZB 2PWDA 3QXTA 1FNGA 4ONGL 2BHYA 5F6IC 4AKOA 4MAUL 5B3NA 3CDZB 2LOEA 1MCSA 1AG6A 5MERB 2MCMA 3WY1A 1RUKH 2A77H 2QDWA 2H2SD 1JRHL 3KGUA 4L4TE 1F3JB 3T3PB 2DD8L 4CILA 3ULUF 3JTTB 1Q9LA 2GT9A 1UKTA 2C1PA 3GMLB 4Y5VB 3SE3C 2HB0A 3BWUC 5KSBB 2OMUB 2K70A 4IMKA 5HPMB 3IWVA 1XGYL 3V0VA 3MLTB 4AYDC 4F8LA 3CX2A 5J13B 5T3ZD 5L2JB 3PWLA 1C5DA 1AGCB 2JMRA 1NC2B 1OGSA 4U1SB 4AKPA 1F42A 5FKAB 3RIKA 1HXKA 5A2AA 3VD5A 4DNLA 1D5IL 5T33L 3SYCA 2EDMA 2EXSA 5FYLE 4UM8A 5F9OL 5AVZB 1TJXA 4LCIL 1ND0B 4YHPA 4OQTA 2AMGA 2CHXA 2XFXB 4KZ0A 5I17B 3VW3H 1EXHA 1KY7A 3NSXA 4UU9B 5LGYA 3QAZB 1RUAH 4CKVX 1ZPUA 4QYOA 4Y16C 1CL7H 3ELAT 4GXFA 3QC6X 1IGJA 3U30B 4Q9BA 4UANA 1RLBA 1OM3H 3BIKA 4MA8H 1QSZA 2D03L 2G5BA 3AAZB 2ZUVA 2XWDA 3H9HB 2XWBA 4HEPG 4MJ6A 4L5FH 2A73A 2NMSA 3T0ED 4KTEL 5FA4A 1A4KB 2J72A 1VKXB 3HPLB 3VWKD 4TF4A 2BP0A 3SOBH 1TEGA 5CJ8A 2FH8A 2QQLH 3L8QA 3MODL 1QLEH 4J3OF 5E1HB 2AQ1A 2C9XA 1V3KA 4Z78B 1JZ8A 1IM9B 3UTSE 4LOUD 4OLEA 4CBPA 4X9BA 3U4EA 3JYCA 1RZQA 3AG1B 3JSSA 5I2IB 4S1DC 2DQEH 2Y6SD 4FFWC 4GAJH 4UM9D 3VFWA 2PP8A 3LZOA 3EOTL 5C09D 4IBYA 5LWYL 4MD0B 4FXKC 3FCSB 1EBAA 4WV1A 2XQBH 1NGQL 2UV3A 1HILA 4MCYB 4PRPE 3ZO9A 3FUIA 1AR1B 5H2BA 1MH5B 3JWDH 4W1TA 1BX2B 1AACA 5AW1B 4UOW1 3CN2A 3OF6A 4PRIA 5EBLB 3WTTA 2OL3H 1ZSDB 2IAAC 3QA3A 4WEMB 3TH4T 4A2HA 4MS6A 1AVAA 2CDGB 5JPNC 1PFOA 3B9DA 3P69A 4G9FB 2WBJA 2R2BA 2F7OA 2V7HA 2W0FB 4QF1A 3RPBA 4MMZA 4ELDA 2YUZA 4HW6A 4X98A 5E2UL 1MFEH 2AQTA 2B5IB 2O6FA 1ES0A 1J8HB 4F7MB 5I74C 1CLYL 3ESMA 5I71C 1ET7A 3DVGB 4OVUA 3C5ZD 1JXKA 1GRWA 4WWOA 4CVXB 5J3HD 4ALAL 5GGVY 4HUWB 4TUJA 4JKKA 1I7RA 3KLDA 2CM5A 4HUUB 3K6SB 3FO2B 2RALA 4YIQB 4P4KC 1E9QA 3N50A 3UAFA 1RMFH 5B4MD 4XE5B 3I3BA 2NRDA 5CJQL 5ANMB 4KUZH 4HJTA 1KB5L 3OAZK 1HQRB 3IJ8A 5IB5B 4G5ZL 2NSXA 5I1JL 1AKJD 4B27A 4XPHH 2V8LA 1MRFH 3RJQB 2VDOH 4C4UA 5C9JA 1TNMA 2Z9TA 4X6BB 5BXFA 2FUQA 1NQBA 4HKBA 3IAGC 1U8KA 1Q90A 2FJHB 2OMVA 4DEWA 5LGHL 5CS7A 1DVYA 1HKLL 3ALXA 2UVFA 4FTVE 3Q06A 1KACB 1XH1A 2H2PC 4OLZH 25C8L 3K4ZA 1HZKA 1OLZA 3BGAA 1DN0B 4G9FD 1MJJA 2J7LA 4UCFA 3WEOA 3QXVA 4JK0D 2GJZB 2LT9A 4KDTC 4Z5RA 3HMXH 3VWJC 1BGXH 3SQOH 4FL4C 3TJEH 5E4IA 4JFHD 4MXWH 3CFEB 3FFCD 5HDQL 1PU0A 2X4NB 5D70L 2YD6A 4ZOCA 3V4PL 3ATDA 3WFBL 2HT3D 3HE6A 1N64L 4LCWA 4ZTOH 3WIIH 4PW9A 1S7WB 3OLEA 4Y2DA 4YBHA 5I1KH 1I1AA 2CIKA 4XN7A 4X4ZA 2KPNA 4DT2A 5C6WH 5MEQA 2DWYA 1QRND 1OAXH 4CSTA 1K4CA 1B0WA 1NC4B 2DBLH 4YSTA 4HFUH 4OLZL 1WH0A 4LSQL 1HESA 1KCVH 3KJ4C 1P6FA 1ZV2A 3LV3B 3B6SB 4IGBD 2IDFA 4RRPM 3QJVB 5E5UB 3U2SA 3KJ6H 1SJXA 2R29L 3CHPA 4HPHA 3PAZA 4DHLA 1WJ3A 2ADIB 2VQ1A 2WZ6A 3LXUX 2Z92A 2CDEB 1CXIA 3IMVA 4IMKC 3DV6B 2R59A 2WYHA 4BQ6A 5C0CD 1N64H 2UWEE 4FHKA 3C09C 4IGBB 1JZ4A 3Q3GA 1JWMB 4P2OC 3LOWA 4DGIH 5K9OA 4QRUA 2LVEA 2OI9C 3TT1L 4CMMA 1G6VK 3EYUL 4IDLA 2MPAH 2ZUUA 4F9PC 1U33A 1N0LA 4CDHA 4XC1L 4NWTL 3ORJA 1WEJH 2AJVH 2ZTBA 3NZHL 3RY6A 3LS5L 5J6SA 5K9JL 2HJFA 4JO3L 1NCIA 2MOVA 5T5FL 5J13C 5KG9A 4PGEA 3TIEB 1HNYA 3NA9L 3S8WA 2EDWA 3QNYA 3TBWB 1BD2D 2WMPB 2V5RA 1T22A 2DWDB 3BP7B 5B38B 1D2PA 1IT9H 1YO4A 1M1XB 1Z9PA 5FDWA 3DVIA 1BG9A 3O3EB 4WJKB 3U9PL 2GI0A 3EH5B 3TVMC 3WDJA 1T5XB 4PRHB 1S3RA 4NM8L 2GBTA 1KIRA 1FG9C 3FT9A 4PB0H 1ICTA 2COQA 3FQRA 4JVPA 3SGEH 4YHPB 1IAKA 2BP5M 3HNSH 5DDHA 4PJGF 3VFVB 2YBRA 3FKUS 4PJHF 1G7JA 5E00A 2DTML 4OCLC 5B39G 3PCYA 1RSFA 5K1VA 3CNKA 1UUNA 1DDHB 4N9GA 5F6HJ 4J4PD 5G4OA 3BAXA 4MSWA 3SY6A 3NCJH 4Y4KC 5J11B 3MCKA 4LKXA 2EDNA 3M17A 2DQEL 1AY1L 1KJ2A 3VRLF 4OCYL 4NJAL 2ITEA 1FC1A 3WEBA 5GGVH 4H13C 4YHNB 1KJVA 4JQXC 1XF3A 3RY5A 3TONA 4Y1TA 2B16A 1TT6A 3RHWK 1XSJA 4Y1AA 3KLHC 1ZIAA 2VM3A 4XB8A 3UZVA 4WU7A 3LYRA 3U4EB 1S5IL 4B60A 2J8OA 5C86A 4OB5L 3N41F 1TTFA 3QUXB 3V4PA 2JKIS 1KPUA 3C60B 1KSRA 1T5WB 2N1KA 1P84K 3GPEA 3NQIA 1FIGH 1D6EA 4IBUA 2EIZB 1C7TA 1BVKB 3AXLB 3VM7A 3QIWA 4AUUA 3Q7JA 4EIGB 1E8YA 3UPRA 1HQ4A 2XRAH 1EH9A 1BQSA 3DI2B 5E95B 1Q0XL 2G60H 2R0KH 2JK5A 3DX0A 4JR9L 3VD3A 4JRYA 4LBEB 3TPUA 1P7QB 2A4CA 2XLLA 3K6OA 1AANA 1MQ8A 1IEHA 3WKPA 3VI3A 1DCLA 2XPGA 3P0GB 3FN0L 4MAZA 4XCCH 3KPSB 1FC2D 3L81A 1T5KA 1GGBL 5MENB 1JYWA 4L1SA 3IMUA 4YVUA 1DUZB 4P04A 1MCBA 3S3SA 4Z7WE 1YN6A 2H45A 1QG3A 5DGRA 2CIIB 3LKSA 4G1EB 3GPSA 1RJZB 3QUZB 1UWFA 4B5ZA 1DYZA 1OAJA 1FZOA 4LDOB 3W9EB 4CJ1A 2FJFB 4FQLH 5IMMB 1DHKA 4U1SA 5MERA 3VRJB 1PZBA 4ZQKA 5GRZA 3VWKC 1JYVA 1CD1B 1XGRA 4XVUC 1WUZA 4V1DD 1D2OA 4S2SB 5HYFA 5D7JC 3G6JE 5AKSA 4BE5A 1T4KA 3VFTB 4WDIA 5TDPA 4UTBA 5J6GA 1UWGH 5ESQB 3UEZA 3D07A 3T0XA 2JFCA 4DGWC 5K9JH 1WC7B 1K72A 2E7BA 1GSKA 2FT7A 2Y4SA 1AGEB 5AVSB 2EDXA 1HVXA 2L0DA 3A6BH 5FGRA 4D7BA 5MEND 5HI4C 3BKML 5C3IA 1CBJA 1JV2B 1LJMA 3ETBF 4HUMB 4YXKH 5LAXB 4I0CC 4K7PY 4JX0A 5C0AB 4ZFGH 4M9PA 1OIOA 1VJSA 5HDQH 3L9RA 2X2YA 4N2MA 1EEUA 4L2LA 3L4TA 4JO8A 5D1QE 4YHML 5SV4A 2DM4A 3OKKA 3VACA 1U36A 1FVDA 5CWSA 5IJKC 4Z78A 5FFLA 5DRZA 2XWCA 5HYJE 4BV1A 5DFWH 1KCVL 3C8DA 4BA8A 2X4NA 1L0QA 2AAAA 2F5BH 2P1YA 3LRHA 1U3JA 1F18A 2YFNA 1UWEL 4X8GA 5M94B 4EUPG 3A5VA 2CR6A 1CGUA 5FA4B 2EVJA 5C0JA 2Q3ZA 4RFEB 3SEPA 2QSTA 1XXDC 2NY2C 1IL1B 1BX2A 4PRBB 5HJ3B 2VMJA 4X4YB 1JV5A 2VKWA 1OLLA 3UTTB 3VXUD 2IQAB 4UV7L 3VXQA 4QRBA 4I88A 3FU0A 2QHRL 2XOTA 3MNWB 3QUML 3QUZC 4JDZB 4OKVA 1TKWB 4PMEA 4WFEE 5DJCA 5FGCE 1XF1A 4MCZB 3TZVC 1N2RB 4K8RL 1UQSB 5B1BB 4OI8A 4FJYA 1X5FA 5GGUA 4UWQB 5GIRB 3FO9B 1U3HB 4ONFH 2JVUA 4Z8FH 1I3GH 3IDXL 5IQ9A 2EXTA 4QXTB 5J7CC 2E59A 4J8RB 5BQ7A 4M7JH 1UA3A 4KO5A 3UAJD 3HS0A 1CFSB 1X4ZA 2UXFA 3FRPG 1QTSA 3LKOB 3QEHA 4YGVA 5H37H 5AEAA 3UC0L 2Q3AA 1QLEB 3IDGB 4JFQB 4E9XA 4LIQL 5CCGE 4XVJL 1X7SA 2F9BT 4JGMA 1INQB 4P46C 2EC9T 5KBKA 1DVTA 1ETB1 3BT0A 4F80A 5EO1A 1BVNP 4ZW3A 1NANI 2GK0A 2NX5E 3J8F7 1YNLL 3NK3A 1PX3A 2BNRD 1FHNA 2RFXA 1DSYA 1E4JA 4AQ8A 2GSGA 5BXFB 3T6XA 3H2WA 4CA4A 3IDNA 5EZLB 2YPKA 1EAJA 2HTLD 4N2BA 1M53A 1MVUB 2VXVL 4HHAA 3GF8A 4NQDE 3W57A 2X42A 4U05A 4B0MB 4HKXA 4KMLB 4EI5C 4XN4A 2NNCA 5KWYC 3LKPB 4BKLB 1NCBH 3I85A 1HQRA 5IB5A 3VFGL 1USQA 3KHOA 5I8KH 1CYXA 3ZE2F 3K71B 5GS0C 5C0GB 4AQEB 1W72L 4TYUA 4BH8B 2W81C 3L3DB 3WFZA 2APFA 4G3YL 4YQXH 5K9QG 4JPQA 3AY4C 1QSVA 4OCSH 3DMMA 4KI5E 4W9JC 4QXGH 3NSFA 1KBBA 4JDTH 4Z7UB 4YDJA 5F7KC 5F96L 1W91A 2BSDA 1UM5L 2JXMA 3CVCA 1KELL 3HZKB 2Y0SA 4NN5C 4X8XA 2P80A 1CE6A 3R7QA 1ZLVH 1K5NB 5I6OA 1EIBA 4AITA 4PS4L 2CPUA 1RU9L 5D7JD 2P80D 3HB3D 5KAQF 4JG9A 2HFEA 1LDSA 4AQAA 2BIOA 1K8IA 4WFHD 1R24A 2IDQA 2Z8VC 2WUCL 3IRPX 1A7NL 2JQAA 4N0YH 4NAJA 3PHAA 4NP4H 2ZP9A 3VDCA 3MXWL 1R3HB 1PAZA 4JFFB 1OGAD 4AMXA 5SWQB 2VXSH 4JMXA 3REVB 3S48A 4XN2A 4EZKA 2VXUL 1HJBC 5CEXB 3PE9A 2IADB 2V9TA 5TH2A 4FG0A 5M95B 3HKZA 1LEGB 2C8NA 1RVFH 3CDFA 1QD0A 5KJRL 1TO4A 4XE0A 4FNPA 4U1NB 3JV6B 4MQ7B 3S37H 4WUUD 2F0CA 1NCNA 2VDNL 5BMFL 5CZXD 2JK5B 5E2TH 5IHBA 2VDRH 3GHBH 1DCEA 1LK3L 4N8CH 1N0XH 2B9BA 3B9KD 4Y4KA 4G6FB 5FW6A 4RX4D 4ZFGL 5DEJA 2PWEA 4M4RA 4WZ9A 1S3KL 4KNTA 1C08B 5SX5K 2E8YA 1GYWA 2FD6H 5T3ZH 3CXDL 3S3DB 2EDTA 5A2JH 4OFDA 5F1SA 4MNGB 2HAZA 2HRLA 3PGCA 2VMEA 1BIIA 3L16A 5IBTH 4HOXA 1BD2B 4KI5F 1R33A 3BVVA 3IB4A 3AT8A 3VCLB 4FS0A 3GZOA 3OKYA 1O6TA 3ESVF 4Y19E 2QQQA 1KCUL 2NW2B 3T3MB 3V4UH 4EE2A 3O8XC 1QATA 1NDTA 2BWDA 3WMPA 1ZHBA 3SKOA 4CC4C 4FLSA 4FKKA 4LAQL 1NCCL 1QHPA 1UC6A 3KPMA 5ESAB 3MV8B 4MA3B 2VLJE 3VJ6B 4ANVA 1I9IL 1OZTG 5IHZA 4PJDB 1IGFL 1IGML 2EICA 3N06B 1GGIL 3B2PA 3S0PA 1Z9NA 2OTWB 1PLGH 2X87A 1YJDH 2CLZB 1TF4A 1IGIH 4MNQA 3VMPA 2W60B 1RZJC 4TKWA 1YUHB 4JM4L 5A2IH 4JLRA 4XCEB 1MWAA 1CU4H 1DLHA 5IHWA 3UGXA 4Z3EA 2MH4A 3BGFB 3IGFA 4AYFA 1KLFA 2A0LC 2LV4A 3E9TA 4AUJA 2CBQA 1L9OA 3BH4A 3OPZL 3UX9B 3G08B 2XG5B 3N0AA 3OGCA 4X5WA 4QRTA 4KKLD 3L3GA 4ISVA 5D7LA 4GP8B 3GBEA 4WSKA 4WF7A 4NP9A 1N9PA 1FVDB 5HGDB 1BJMA 3NFPB 4J3BA 4XP9H 3H7LA 4YUEL 5DYFA 2VLRD 3BP6B 3ARDA 3D18B 3O11B 5AB1A 3SKUD 4DGUA 3U0WH 1TTUA 2FZ3A 1DQLL 3T0EE 1NICA 4XP6H 5DYOA 2AI0L 2AQNA 3BXNB 4F9LC 3PWVA 1ACCA 4M7ZB 4PU2A 5EWIH 2VDML 3VXOA 1FORL 4BHUI 5ITFA 1RZ7H 5GRJL 1A6TA 2AJSL 1FL5A 3ULVH 4UMGA 3EFOB 2F54B 4NSKB 2PW2A 4PV8B 2WQUA 4DP2X 1N70A 2RAMA 4RMVA 3FU9A 4KKNA 5AVRB 3K81A 2NXYC 4PJ9C 2Z8WC 4YH6A 1QFWM 3LEYL 3TC9A 2J4WL 2K7QA 3D25A 4K5PA 1A7PL 5D1QB 5KJ7E 4O2CB 1S6NA 5AUMA 1VIWA 3PABA 1JI1A 4YSQA 1P7KB 2EO9A 3FZUC 1S7XA 1VDGA 5A3IC 2GFBB 3D2UA 5CSBA 1ED3B 1A2YB 3ARBD 1FBIH 4DWHA 3H9ZA 3D87B 2FJUB 3VFSB 1BZ7B 1YMHA 2AK4E 2QKIC 4BUHA 2J8UF 3NQKA 2GEQA 3MNZA 5ABZA 4JBSA 1SVBA 3OKEA 1AD9B 1JCVA 4H0HB 2EH7H 4L3ED 2QQKH 2R7EB 5FXCH 4BK8A 3QXDA 3D39B 2VR8A 1WF5A 3GXPA 3QW9A 3TCLB 4K94L 2ZF8A 3S5LB 5BRZA 4MYWB 2DL2A 4U7SA 4RAVB 3EO1B 1U8NA 4OZIB 5E6IA 1K8DB 3B2MA 3VGAC 4HWEL 4ZTEA 1Z9SB 3E8VA 4P2QD 4GRLA 4D9LL 1X6NA 1X7TA 2IXQA 5K69A 1Y1UA 4LF3A 3SGKA 4OGAD 1ZOXA 3RIFK 4PJXE 1U95B 3MYJB 4N8VB 4L8CB 1A6UH 5J0BA 4ACTA 3N41B 2VSDA 3FFCA 4UUJB 2IPUK 3D09A 1JIBA 1TFHA 2BHUA 3RVUD 5IB2B 5CBAA 3RWFB 1E8XA 3LB6D 2VXSL 4DCQB 3BQVA 4LL1A 1GSMA 1NDMB 3MRIB 2RJMA 3O2WH 3HNVL 4AY0A 3VUAA 2GPZA 5INDB 4X6DF 1A4BA 2FQFA 3L9RB 5IM7B 1M3IA 5ESQA 4KTYA 3ZT6A 4BFEA 1E4XL 5JIQA 2ED9A 4OLVH 4HCRH 5IEKB 1P53A 1U2CA 1BBDH 2BY3A 1MVYA 1IJ9A 4OV6F 5DRZB 1JDCA 2W88A 1I4FB 4L3CA 2RQ8A 4S10A 5I26A 1YQVL 4R2GC 3L95B 1Z1WA 3HA0A 4OZHE 4UMSA 5JQ6L 2D3LA 1DLFL 3HNTH 1AGDB 1RUKL 2A77L 2OMWA 1RUPL 2VXUH 5I75B 4PY7B 3HZKA 4F2ME 1IO4C 4QXUL 2XV0A 4NQCB 2DBLL 5BO0D 3HC0A 3E6FB 5CWSB 5BZDA 3QQNA 1S9XB 2K0RA 3F7YA 3V5DB 4X0KA 1LQSR 4HMCA 4UQ3A 5I8OL 3AU1B 3RWDA 1EFXB 2IC2A 2KT6A 3DBSA 4OF5A 5LGJA 4QCIB 2NQDA 3C09B 4AZUA 4ACPA 4HK3N 4JFOB 3GEWB 4LKCB 1WA2X 2OJEB 3D48R 5CEXA 2EE9A 5HHOD 5FECA 1IILE 4UNIA 1YYCA 5JHBA 4F9PA 3CFKB 3GMRB 1SOSA 1EFXD 3N9GH 3DYPA 4TRPL 1GZPB 2C7UA 1KPRA 3K4AA 5I9QC 1Z2KA 1NFAA 2AJXH 1MI5B 2YKLH 4KX9A 5D1ZA 1OALA 4I18C 5JW5A 3TEWA 3D0AA 3DBXB 4K5LA 3L9BA 2XXFA 2JKJA 3B7TA 1KLGA 3V0WL 2DKUA 4KH9A 3L5IA 2PXYC 3GSUA 5KYUB 3AGVA 1P5UB 4JDZA 4NQCD 3KBFA 4GI9A 2R23A 3MBWA 3EO0A 3MROB 2ZICA 5F21B 2VDKL 1C08A 1TXKA 3AY2A 3CU7A 3MV01 4XBPB 1FRGH 3BAKA 4HIEA 3U9UB 4WNQA 2XQYG 3WAJA 3NA9H 2DY2A 3LXBA 3P11H 3U0WL 5JMRA 4S1QL 3EOAB 3VCLA 5L8JB 1KN4H 1H8OA 2AEIT 3CZJA 1KIQB 2OZ4H 4I4WA 1W15A 4LNVA 2HJLA 2OX5A 4OCXL 1D5XA 3GXTA 3BKYL 1I9RH 3CZFB 4LHUD 2X6VA 1SN5A 3ZOAA 4BK4A 3F12A 4HF5H 1G6RB 4HX1B 3LKPA 4BKLA 5HXMA 4WU5B 5F72S 1WISA 2C9AA 3HVDA 4CBZA 2ZUXA 2Z31A 5ICXB 3FUNA 4PB0L 1MCNA 2IH1A 3QI9D 2H26B 4H7VA 4LQ1A 5IGXL 4BFGA 3WD5L 3TOPA 1PDKB 5E56A 4LNRA 4UILL 4Y1SA 4YXLL 1I3GL 3OXSB 5C6TL 5EZLA 3WJJC 2A1WH 4MMYB 1THCA 1PD6A 3R0MA 1GKOA 1LO2H 2PUQT 2IFGA 4APQC 3QWRD 1Q9OA 5AD0B 2DLIA 4Y9CA 1TZAA 2CBTA 3AM8C 3ARTA 1SDAB 4DVRL 5I1GH 5I30L 2GIYA 2VN5A 3G08A 3P54A 2DL9A 2JCCA 1FYTE 3FXIC 3MR9A 5KVDL 1Q1JH 3B2XA 2FAUA 5HVHB 4RQQA 4M6OH 1MJ8L 3DHPA 1NAML 3GKWL 3A22A 3MLYH 3HR6A 3ZDYF 4Z7NF 4L4TA 1BREA 3RGHA 3SDXF 3ZIYA 5KSBF 2AQPA 5E9NA 2ZX5A 3VG9B 5BVPH 3ULUH 2G5RA 5C0AD 5D7IE 4DP7X 2E9WA 4FNTA 2AV1A 1SM3L 3RY4A 3B9AA 3I6GA 3QRLA 2JIXB 1CWVA 1ZWIB 3R18A 3EZ8A 3MCYA 4GT7A 4K9JA 4JZNA 4ZUTB 3TN0C 2AQRA 4XHJD 4RDQF 4X5RA 3EJSA 5DD6B 1UD4A 4R5XA 1EO8L 5DHXB 1AR1C 1OXYA 3GM0A 5F9WC 1X7QB 1XGYH 4L3EA 1XEDA 2Y25A 5I8CB 1BBJA 1NEPA 1WCQA 1SJMA 2X3BA 3EGSB 4DAGH 4MNGA 2WTRB 2H9GA 4H40A 4Y4HC 4XOAA 1G9NH 1CICA 4GRMB 4HUCA 5FYJL 3QJHA 1YY8A 4F7PB 5D70H 1B0RA 1AD9A 3ZLQC 2VYRE 3WY2A 5D2LA 5JQHC 4WHTB 3O0LA 4K7FA 2ERJB 4ORGA 4S1RH 1J7VR 3HMXA 3C5JA 1QRKA 1ASQA 1E6JL 1BZEA 5GRVK 3T3PE 2B0SH 1EO8H 4BEIA 3GMQA 3G5XA 1FJ1A 5C08D 3DGCR 4PJDA 3T0WA 5C9KA 4YAQA 2X28A 3V0VB 4UIKL 4L05A 5F89A 3E3QE 5JUEH 2ATPB 1VRSA 5KSBE 3QRGL 4YJZL 3RNKA 1TO5A 1OCWH 2W9LA 1FZJA 3ZX1A 4AMKH 4WJG3 4ZUSB 5BS0B 4K23L 3RVXD 2EIMB 2X7LB 1IAIL 4BUQA 4ENED 4PP2B 4L1DA 3ULVC 4G70B 3BRGC 4TUOB 1LHZA 1GPOH 3FPXA 3IAPA 2EO1A 1F90H 6FABH 4OV5B 3MLVL 5F1OB 4KZEH 4E9RA 1JXJA 4AXWB 3LKNB 3TV8A 1IGJB 3Q2VA 1QUPA 2V33A 3MREB 3BP6A 1AZCA 2QPFA 4G6FD 3SDXA 3CH8A 3QNXA 4A66A 2KL6A 4PJXB 2X6AA 4S1DD 5F7WC 3BZ5A 1BA9A 3KPRA 4JN1H 4JPSA 1IC4H 1YSOA 1HHKA 4NJ9L 4EJ1C 4ZMWA 3T2OA 3LH2H 1KYUA 2QPUA 4PY7A 3RHWF 5KYWA 2FLBT 5E2WL 3X13A 1TQBC 1AXSB 2G4EA 2YXVA 3CLFH 3EYSL 5EZJB 1TOXA 1OP3H 2EUWA 3T04D 2G2RB 2J88L 3FTZA 1M7DB 2EVHA 3MZGB 4GO9A 1UFUA 3BUDA 3F7PC 5F6IB 5CJ5A 3U6RA 5J06A 1BJ8A 3AU1A 3RWDB 4IBQA 3QUMH 1CJYA 4HF5L 4MDIB 4OUUA 3VXMB 4X6DE 1JGVL 2WVVB 5FS5A 3D3VE 2AJXL 5ITFB 3SDCD 3MA7A 4R3SA 4E9TA 1V7NL 4J1UA 3TCTA 5GSVB 1A47A 2E76C 4ALAC 4JN1L 4NGHL 1EZLA 1ZVHA 3MNZB 1M05A 5JIDA 3GD1C 3NJFA 2AJYH 1DZBA 4FQJL 4FQQB 5DEFB 4RGNE 3ZSTA 4EF3A 2G75B 2VDQL 4N8UA 5F7YC 5DLMH 5AUMB 4PRIE 3F85A 4E41B 3MRFB 1GA2A 1YEDA 2GJ6E 5ILTL 2BVEA 1RZ8A 5IB3B 4MMZB 5D1XD 4GKSB 4M43L 2OV0A 1U2HA 1J8HA 4UBDD 5JTWA 2AXHA 4QYAA 4OZ4A 3H3PL 1KJMA 4TNWK 1JZ2A 1AI1L 1DQDH 4HUWA 4YL9A 2XBZA 4XRCB 4RWYH 1XMWA 5ANME 3N04A 3WXVL 2FR4A 4DF9A 5CBAB 1SMAA 5C0CB 2H41A 4NO5A 4PVMA 1KTJA 3GLEA 1P5UC 2A6KA 2Z4TA 5DEZA 1TTBA 2D3JA 5CAYB 2UYLB 3JV0A 5BO1L 3O45A 1FPTH 5E03A 5FPIA 2ZXAA 4UNTA 3TVMB 5FB8A 2SEBB 2CO6A 4CGUB 1BLNA 5CGMA 3NCYS 4JFED 3VWJB 5JOFB 4HMEA 1BQHA 5L8KB 2DWXA 2Q10A 4FTVB 4HCRA 4TL4A 2YARA 3RLSA 2VR9A 3ARDC 4HHWA 1YY9C 4HKBB 4KAQL 3B7UX 4DKFL 1AS8A 3OX8A 3SKNA 1IKOP 3VGFA 3MRIA 1I3RB 1MAMH 4I77H 5E4EC 5BOZG 3ILDA 1IX2A 1A3LL 4LK4A 1CXKA 5KVEE 1L0PA 2BSRA 2ZCZA 1G9HA 4FLRA 3PQYA 4F33A 4U7KA 4V11A 1NLDL 3NABL 1F1DA 5E8NA 4RZKA 5FYKL 5T1LD 4X0KB 4UV4H 2F5AH 2ALWA 2VZVA 5F7DA 4XPAL 4HWBL 2DD8H 4F15B 4Z77B 4UAHA 3GI8L 3M1OA 5LGJB 3RIAF 3NIDE 4NKOB 1RHHB 4W6XB 5HPMA 4LLWB 4TVPD 1YNTB 2JJVA 5TE4L 2WINB 2F7IA 5JO5B 2ARJQ 4J6RH 4F7CA 4PW3A 5CNHA 2QSCL 3VGGA 3W2DL 3HC0B 4JJ5B 1UM6H 4HGMA 4OW6A 3CFBB 4P2OD 6CGTA 5DEGB 2HFTA 4UF7C 4Q9QL 1H5BC 3EO9H 1A65A 3W39B 2NPLX 4NT6A 4DQOL 2A6JB 5DD6A 3LRGA 5IQ7H 1AS7A 1PX8A 1IE5A 2DB8A 2XT1B 3TBBA 4Z7OE 2ITDA 3TJEL 1LK3H 1AQDB 4I3RH 3O9WD 3SE8L 2CK2A 5J9PB 5C0RL 1JAEA 4P9HL 3DYOA 2WAHA 3JWNH 1RUQH 3Q1EA 4DUVA 4XBPA 5ID0B 4ABQA 4HK3J 3I9IA 3IFNL 3J2PA 4KK5C 2OLDA 3ZDXF 1NUFA 1KPRB 5H4YA 3IN2A 1KC5L 2GSIA 3G6JF 3MA9L 3LNDA 4OJFL 2MOGA 4HXAL 5KSAB 5D7IB 1XBRA 3DBXA 2KS0A 2UZYA 3APFA 2DQHH 4DTGH 1NMCC 4P99A 4MKMA 2ZYRA 3DTDA 1TQCC 1UA7A 3BEVA 3GXIA 4ZMYA 3QNZB 2HJFB 4OZFG 4XOCA 1UURA 5JDSA 5DVPA 5IB1B 4M62H 5CUSL 3GSVA 2N0KA 4KXZH 1MRDH 3QHTC 3QIWD 1L3WA 3ZPDA 3OR6A 2IQ9H 3OKNB 4XVSH 1QFPA 5T5FA 3FUEA 2Z4QA 2H5UA 2OXGB 1DTUA 3W5MA 4J4PC 4XCYB 4EI6B 3BIAX 5HYSB 3UAAA 1E5YA 3WTWA 3EJPA 1T5XA 4PRHA 1SVCP 3FUMA 1KGWA 1IGIL 3GTTA 3LAFA 2E6JA 4NPKA 5EUKA 5EU7E 4Y1AD 4ONFL 3L08A 4PVLA 1PTZA 1T0NB 4B7IA 5IJVA 2FEEL 2YD1A 1S8DA 2WKOA 3UADA 2IDUA 1KV3A 3FF7A 3FB5B 1UASA 1ZVSA 2ZUQB 4CMHB 4PG9B 5C07A 4G2AA 2RB8A 1UD2A 4IBLT 4M7KL 4ZODA 2YJQA 2V2TA 3BO8B 4YC2B 1A6AA 1BVNT 1FL6B 1WFJA 4BGLA 1R5WB 1QWNA 1U4EA 5BJTB 1CDCA 1AFVL 1WA1X 3UZVB 1R4XA 3H0TA 2H32B 4XNXH 1OKEA 5FDYA 2A4EA 2CK0L 4M8UA 2ZG1A 2XIIA 2BZDA 3P0VL 1VB9A 3QDJD 5D4IA 4JO5A 4U6HA 1X9QA 4NRXA 3QJFB 2VTFA 2WCGA 1R6VA 3AT9A 2YAFA 4PJHE 5TDOB 4IIQB 3DIFA 1JOIA 3DETD 2SODB 2KH2B 5CR8A 1MLCA 1ACYH 1HXMB 2F74A 1F4YH 4KX8A 4ELME 2R69L 4HSAC 2Q6WB 4FQQA 5DEFA 4ENEC 4E2OA 4PJ8B 4YDKH 3AS3A 3E2HC 1HI6B 1AJ7H 3MV9E 5HBBA 1SHSA 3UIYA 3L3JA 1J5DA 3I75A 5HI3C 4I77L 1P4LB 3T2PA 4Z7WB 2ZUYA 4V1DE 3GKWH 3JTSA 4WK2B 1NJ9A 2DQFA 1V5JA 4PV9B 3WG7B 2VZSA 3K8MA 3EJYC 4NBXB 4NCC2 3V6BR 5AAMC 1NAMA 3T8XA 2E0PA 2WBJC 4KRNA 3P4OA 4JFDA 2XXMB 1LK2B 2YD7A 3IRCA 4HZ1A 4TQIA 4UIMB 4Y16B 4AQOA 3NH7L 5HYQB 2FRGP 1L5GA 1RZIB 4PS8A 3L6FB 4C57C 4K7FB 4ORGB 2FR4B 3ZDZF 3S7GA 1CB4A 2XYCA 4X7EC 5KN5B 5DJ6B 3UYOD 4WTZG 5E08L 3EG9B 4F92B 5DHVB 5FYJE 3QZWG 2ICEA 3GMQB 3PV7A 4YMPA 1WS7A 3FFCE 5D2NE 5D7IF 2IAMA 3P9LA 5K39A 4J3OG 1MW3A 3NIFB 3UJTL 3ROOB 4R4FL 4NC1E 1OSZA 1S9WB 2DM3A 2G9KA 5ETUA 1R3LA 2QKSA 3UTZB 1FZJB 2ORBL 4APXB 5I1AB 1BEXA 1D9KD 2EVGA 4WUKH 3CFUA 3ATBA 3RPKA 3VA2C 3OMAB 4QRUB 2V5SA 3U7WH 2Z93A 3IU4H 4JRXE 1MLBB 3S88H 1QPKA 1C16A 1SLUA 2VITA 1F11A 4U3HA 1A0QL 1F4HA 3WUWG 3T65B 3G5VA 4DP4X 1VENA 3LDBC 2JJSA 5FYJD 2YD3A 1MCPH 2CLVB 2EYSA 3FH8A 4KVCL 2BIPA 4NN5B 1CICC 2I07A 5IOPA 3UMTA 1C1EH 1V8HA 2BVPA 5BCAA 4XR8C 1B2WL 4Y9GA 2ZUSA 4RBPH 4G83A 4QDGA 2D7QA 2Y2WA 4WO4C 4Y5VA 1ZANH 3PWUB 3O6LL 2J88H 3JV5A 3QZBA 2AS5M 3KCPA 1I1AC 5DCCA 1DEEA 4UT7L 1E8ZA 3QVAA 3L4VA 1FNEA 2PR4L 1NL0H 4GSDL 2WWNA 2EECA 2Y23A 4IQHA 1SYVB 3EOTH 1E27B 3RVWC 4XNYL 3GIZL 1NIDA 4M93B 5CF3A 3TA3B 5IROA 4MCZA 4MNHB 3R8BB 4I87A 4EKJA 3FU8A 3CMGA 3QRBA 4G59C 2FX7H 4P9MH 5CJOL 4DTGL 2EVIA 1FRGL 2YO3A 4F8PA 4W9IC 1SN2A 3VE0B 1EHNA 2CRYA 1KJMB 4PPTA 1IBHA 3IDXH 5KVMC 1NFIA 3NIGF 1QABA 2GSIB 5KSAA 4AIEA 4RAUB 2E7CA 4KJYA 4YHNA 1PKOA 4I3SL 4I48B 4RSVA 3DJZA 5E6ZA 8PAZA 1QWHA 1YEFH 4RGOL 3H9HA 4H8WC 3V6FA 4ODSH 4UTCA 1HH6B 2XN9D 3C2SA 5F6HI 5HPOA 3JWDC 3EFFA 4P4RA 4XVTH 2CO6B 4JRYE 1YN7B 3Q05A 5M7QA 3ZTNL 3ZDWA 1INDH 2Z64C 2AK1L 4RFOL 1I85C 4OCNC 5FGBC 5JOFA 4XBMA 5C0BB 3FRPB 3K2UH 4DKDC 1EGJH 3KWWB 2ZJSL 2DQUH 4ZMVA 4JZJC 2E9GA 3Q2NA 2O5XH 1P0SE 4GQ9L 3C6LA 2O5ZH 1VGEH 5B38G 4JKLA 3L2LA 4M6NL 4YSDA 3LZLA 3M07A 3QR0A 4WI3A 5F7LB 5BVJB 4UQAA 4L37A 3X11A 2P48B 5D7SL 3FFDA 1G7MB 2F5AL 2OL3B 3STBA 5CHNA 3FO0H 3PNWA 5IVXA 4OI7A 1U8PB 3RYMA 1OTTD 2ZCHL 3R4DA 3OAUL 2DYPA 2JKXA 3ZTNH 2QZQA 4EN3A 3GTNA 1CDIA 1D5MA 5CIPH 1AHWB 2KZ1B 1MAML 4AEHH 4RWYL 1V27A 3QZWA 1OCWL 2F08A 3QXUA 4R96B 4TNFA 2LU7A 5GRWA 3KL0A 2NY6D 2NQCA 5D72L 3BUTA 2DV6A 4MZ3A 5JHDA 4N22A 1FL6A 4Z3HA 5I24A 3A4FA 3DARA 4Z7QF 2OTUA 1J11A 3RIFF 5D7SH 3UBXB 5FO9A 3WIIL 4M7ZC 2D9QB 4L4JA 4PGDB 4HU8A 1JTPA 3S96A 4NOFA 3KPQB 3V5HA 5C0ND 2W59A 3TJPA 4UM9B 3OMIB 5L0QB 3UO1L 1IC1A 4LLDA 4N3TA 4ZTOL 5I0VA 1IRAY 1DDTA 3OKOA 4IOFD 1IM9D 2IADA 4JFFE 2E7DA 1AC0A 3AWEA 2XWEA 1IBGL 3IKCB 1X5GA 2WB1A 5KBLA 4IIQA 1TQCB 4UOW0 5HGAA 2NSMA 5CCKH 3PIQB 5LG1A 3MBED 4GP4B 3BGFC 1DJGA 2H1PL 2E75C 2QEJA 3M1BB 2WBWB 2IAMC 2AKRB 2FEDD 2VDNH 3PGFL 4GW4B 4JFEE 5J12C 3WELA 4R0LA 3B1UA 4IHOB 3WMQA 4PI0A 1J0HA 4GQPH 3IJSA 3ZTCC 1DUYA 4Y4KB 2VAAA 1PCSA 2VWEE 3PS6A 4HIIA 3WI9A 1LO5A 3WEMA 1MHHB 1IBBA 3JTSB 4OGYL 2VDOL 5TE6L 1JGUL 1YDPA 1XSIA 1SMDA 3L4ZA 4FCAA 3T0EB 4Z18A 4Z7NE 3T3ME 5CGYD 1AKPA 1DFBH 1FZKB 4X80L 4KO6A 3K72B 3SO3B 3UACA 2YD4A 1MCPL 2HTKC 3G5YB 4U6XA 1MJJB 2Q8BH 4HDIB 3RZCC 3C5SA 2VDLH 2FX7L 3G6JA 5CJOH 3M8OH 1SQ2N 2F54E 1OAKH 4PJCF 1PEZA 3VD2A 3RUGE 1HXYB 1DO6A 5GJSL 2H3NA 1AE6L 4XMPH 2E7MA 4O4YL 2O61B 4PJIB 4U6YB 3PWPE 1BGXL 3SQOL 4HWUA 4JKPL 4E42A 3QYNA 1F6AA 4PRID 4WUKL 1JG9A 3WTUA 1DZ0A 1JNHA 2JB5L 3BYTA 1IKNA 1AIFB 4KKLC 1MWOA 1N67A 5BRQA 4HG4J 5MEQB 3X14A 1XR8A 1JZIA 5DJCB 3MRJB 2AXWA 3VAEA 3VFRB 3WY3A 1XZ0B 5LQBH 3VFPA 3MRQA 5ECJE 1T1WB 2HRPL 4Y16D 1CS6A 1IM3A 3KL5A 2OCFD 3O4LA 2NR6C 1LE5B 5CU9A 3IFOA 5HY9B 4PQXA 1NTDA 1WAEA 2XY1A 3AW5A 1TTRA 1ZPLA 1C16B 3R19A 4NJ9H 1A1NA 2EKSA 1P7BA 1JHKL 2EEFA 5EOTB 2ZCKH 3G5VB 3IE4A 1Z5YD 2WD0A 3IDGA 1A7OL 1CTOA 1S8DB 2PPAA 4FHBD 4JFQA 4KRLB 4WEEA 1K6QL 5KJ4A 3S98A 5DRXB 4AX3A 4Z7VF 3MRGB 3U25A 1RURL 1ZT1A 1I9RL 4BUGA 5L88H 2CKBB 2ENPA 5C07D 3MJ9A 3FSWA 3DV4B 5J12B 4HCFA 1J1OL 3QCVL 1I8KA 3D0VB 1ZHKA 1BSIA 2VZ3A 4IBTA 5D2LE 5I66A 1AJ7L 2APSA 1MFVA 4NCC1 4JFHE 5DK2A 3WXWL 1T1XA 3RFZA 1NOAA 1XD0A 5EZIH 5ABAA 2DWEB 2L7JA 3ULSB 4X6EB 5FHAH 1GKEA 3P3SA 4FNLL 4YLQT 1NLDH 3BQUA 2CD0A 3LZPA 3AUWB 5F7EL 3VH8A 3D2UB 3LNGA 1R5VA 32C2B 5EPMA 5DHYB 3BVTA 4XPGH 4F9LA 5ICZB 2DQDL 4H2CA 1UB6B 2V2XB 1RJLB 4LSSH 2NT0A 4N2IA 3TNMA 2PNDA 1PY4A 1WAAF 1IIIA 3OKEB 1CF1A 1NAMH 4EI5B 1INDL 1UOLA 2YD2A 3QCUH 4H26A 4J27A 4QHNA 4M03A 3FO1A 3WXVH 2BVQA 3IGAA 5AW9B 1OT4A 1E5BA 4Z7WA 4ZAKC 5CEZD 3M17B 3ZE0B 2C3WA 2ZAHA 3WE1A 3HS0C 4QPEA 2FBRA 3M88A 4JG0L 3RX9A 1Z32X 2CUHA 4MRBA 5F9DC 1N5YH 1A6UL 2D4DA 4JCMA 3UBXI 4FQLL 4AI7A 3FL7A 1CPUA 2JCCE 2ZXWB 3MGTB 5HHVL 2WZPD 2VSMB 4WTQA 4QR7A 1AO7B 3NACH 4N0YL 4O02A 4WU7B 4JZJB 3DOIA 2JLPA 4AYID 4PJIF 3B3BA 5G4MA 2C5DC 4MYPA 2FX8L 1N5AA 3FULA 3HUJA 4PJXF 3IU3A 4M3KB 4S1SL 4FFYA 4WSGA 3MV7B 3V52H 4YFEA 3FFDB 3LQAH 3E1F1 2IDTA 4PWHA 1ZK5A 4QTHB 5CHNB 3FUHA 1KGCD 2VW6A 2X2HA 1PD0A 1C5BL 2DJMA 2KQNA 3ARGC 4UDTB 2DJ4A 4NM4L 1QA9A 5DO8A 5ADOL 1MRDL 1G5GA 5F9OH 5LBSH 2K9UA 4JRYB 2KLTA 1CI3M 3GXNA 3GJFA 4D8OA 5LXVA 4UAOB 1O75A 2R1XA 1BD2A 2XRAL 4ZYKB 4LHUA 5HDOA 2M83A 1NA8A 2Z93B 5JXEA 1GL4B 3BWUF 4OD2B 4DK5A 3O6FA 4KKZA 1A5FH 1QTYT 4YHYC 4ZNCD 4I1RA 1CDGA 3BKCH 4TQPA 2BCKA 4LLQB 4TVSa 4NQUA 3ARZA 2WTOA 5KOMC 1JERA 2TSBA 4Q0XL 4MHHI 3HI6L 3P77B 4PR5A 1YPZB 3CFJA 1E27A 5DURB 1C5BH 1MF2L 1NM9A 1KDJA 4TN9A 4DQOH 5C0RH 4J2QA 4MAUH 4JREB 4EI0A 4OIBA 3HRZA 5I1LA 4DPBX 1MI5E 3DTXA 2OZ4L 5E7BA 2ILLA 2Y3NA 1EO7A 1JMZA 2JJTC 3M7FB 4WUUB 3NP3A 2CLRA 3CHOA 5CFAA 5D55A 2HA1A 5IESH 5I0DA 2A73B 4NZRL 4E36A 4R0LB 4L1TA 1KLFB 4XPBH 2EDBA 5F3BB 4H0LC 4X80H 4BXVA 4OJFH 3OGCB 4X5WB 3QDJB 3HNSL 2EDDA 4JJHA 5IF0A 2IJ0C 2UY6B 3LDBB 4TLTA 2X1PA 4MX7A 3GWJA 4XVOA 3VVVA 1OCZB 4EIUA 2P5WD 1BZ9A 1KG0B 3ZDZB 2OMXB 5IVZB 1QACA 2CKBH 2NY4D 1UB5B 2VNCA 4RX4A 3K72A 3V7AE 3MBXL 3FRPA 4BZ1A 2VM9A 3QHFH 4KDTA 3EYOB 1X5IA 4JO1H 1E3FA 2F54A 4KVNH 4NSKA 3LRSB 3IGUA 1ZXKA 5AW0B 2VQ4A 2HT2D 4YHIA 3ME0B 1K3ZA 2YOAA 4FX5A 3QR2A 3BWZA 3ECVA 4I1NB 1ESOA 5A2FA 4P23C 1LO3L 3RNQA 5LGKA 1E50A 4JPKH 3UABA 2CJUH 3IXAB 2MCPH 1AO7D 3TJHD 4GAGL 1RLWA 3AQYA 1AIFA 2G4GA 4RFEA 4DEPB 2WB7A 2WVUA 5JHDD 3T08A 1MHCB 3QDGB 2M8XA 5HVHC 4BRVA 4LLUA 2VXQH 4JHAL 4FQCL 4Y2OA 1WD8A 5DT1H 3ZE0E 4LPYA 5E2VH 3ULAB 3QT2A 3UJIH 4MFHA 1VEMA 1FAKT 1W0VB 5F8QC 3ZKQD 4PUBL 3H3PH 3ZMEA 1QBAA 3QZLA 3SZKC 4YSUA 5DC4B 2YXWA 1QTPA 5TF0A 1J1OH 2YN5A 4POYA 4XXCC 1NFDA 1KGYE 1VAHA 2F18A 2KQMA 2XA3A 1GYUA 1R5IB 2EH7L 3RUGF 3EXJA 1VZIA 4PJBA 3SDAC 4EXKA 1R19A 1TQWA 3C75A 4LHQB 4UQBA 5E9DD 1HYRC 1NAKL 4LF3B 4A55A 1G6RL 5D7JA 1A1OB 4LEOB 3DXAB 1Q4NX 4LEXH 2A74B 5HVWA 5L2KB 4ZD3H 2FGWL 1SBBA 3FN9A 4O02H 4TUKL 3WUWA 3DX6B 2HVJA 3BWAB 2X88A 5HYJA 3LPWA 2E6PA 3V4PH 2DLFL 2O4EA 5E9DE 3K2IA 1TZGH 4WWNA 2DS4A 1LTXA 4UM9A 4F57L 3QEGH 2WO2B 1HE8A 4AGNA 1ZE3C 1LP9E 1U3NA 5TK2A 3CSTA 4YHZL 1FA4A 5HHMB 2DIAA 4N8PA 3QQDA 2BZ7A 1SYSA 3SGJA 1T6VN 4I85A 1G4RA 1Z0MA 3WU1A 1I4FA 4P2QE 2BOBB 1PEWA 3QI9B 2PWGA 1MG3C 1DR9A 2HKFL 1BEYH 3VDBA 3CFEA 4W4NA 3CFCL 3PIQA 2GJRA 5H35B 4IMLB 4PREA 5HHMD 1YC7A 4EI5A 1VKXA 1FH5H 2IBZX 4KRPC 2DI8A 1T6BX 4MMXA 4MD5A 5DR5H 2NY3D 2GITA 1U8QB 2GVYA 4LASL 4ZAKD 1IGCL 4F2MA 5I23A 3E6FA 5D1QC 3QORD 4LBAA 1RULH 2ZWSA 3GBML 2OXHA 4UTAH 2DQTL 3K6IA 4OT1H 4XH2B 4BWWA 4DN4L 2Y5EA 4XNYH 4JO2H 4LVEA 1HCVA 4RNRB 3U2SB 3K4DA 1ZT7A 3ZE1B 5CKAA 5KS9E 1BEYL 1P2CB 4TNEA 3UZEC 3WOVA 5D2NC 3A3YB 2ADIA 1ETZB 4ZMNA 3UYRH 15C8L 3DV6A 5GS2D 1K4DA 1KT2B 2PTTA 43CAA 2JTDA 2Z8RA 4JFFA 2O5NA 2YQ3A 5DK3A 1UOKA 1HOEA 3GNMH 4W9DC 2WJ5A 1GGIH 2OMZB 3HTLX 3MZTA 2ICES 5TH2B 1TSRA 1MOEA 1F6FB 1QO3A 1QUNB 2YRLA 3GSNH 2J71A 4X8JA 4XI5D 5IVNA 4E9WA 4X7TB 1HOCA 2VR3A 3AUVA 3HCVA 2JJUA 4UIKH 5JUEL 4JE0A 5IWLC 1B4RA 2BZCA 1HZHL 2WLIA 4NENA 5CLTA 2CKBA 3BDYL 2I60L 4K8RH 3OLIA 1NGQH 2NTSP 2B1HH 3INUH 2HLFD 1Y07A 2AGJL 3PHQB 2VRKA 1MF2H 2A9BA 4PP1D 3PWNB 3WSQH 3W38A 2I9LB 1AZZC 4NQDD 1TG8A 4Q0XH 5BRZE 4FTDA 3TO4D 4NFDA 3ZKXB 2F7PA 3DX9A 2NXZB 4AYGA 4Z76B 2WIIA 5KSBA 1TVHA 2KMWA 4RZCB 2BCKB 1NIAA 3RTLA 3U6RB 4I2XB 3PWLB 4FYSA 3QPXH 2OMYB 4JM4H 5K59F 4LPWA 3U7AA 5DJAB 1U3YA 2ZCHH 1RZGA 3BX7C 3TEUA 2ALAA 4KXAA 3IMWA 4R4ND 3G9VA 1ZHNA 4L5FL 3V4UL 3WNIA 2BP8B 4P5SA 4X6CF 3TZVD 3OXSA 1NBZA 5J4MA 3EYQC 4NQED 5B8CA 3B4NA 1CTNA 1RQ5A 3S3BB 4KKRA 4K7PH 4WUUA 3ZE2B 2GJ6B 4PCSA 4PMFA 4RA3A 4PH8A 3S35H 5BV7B 2ZUTA 3DVNB 1JHLH 4QHNB 2PYED 2X89A 3DPDA 3KM2A 4JPWL 4LCCC 1XBDA 3CLEH 3GSRA 1BWWA 2IMNA 3OKMB 3RWCB 3B3IA 3GSXA 3GSQB 1ADQL 1YUHA 3U36B 3P4LA 3TCXA 4FQIH 3C6EA 4FI6A 1JPFB 3L1OH 3NGBB 4CNIB 2W38A 4PG2C 5DHYA 5KVDH 3HPLA 4NRZB 1JF1B 3SDAA 4MVBC 4Y5YB 5E94A 3GEFA 3OLDA 3QUXA 3RGVC 4K3EH 3C6LC 4YK4C 1GH7A 1AO7A 1PCXA 4O02B 4ONHA 5EU7C 2HRHA 1L0YA 3QCTL 3DDGA 3ARDB 3D18A 2VM4A 3O11A 4ODWB 4OCMC 5ES4B 1PGRB 1KF9B 4NO5B 3EGXA 4P5MB 4QO1B 5DD5L 2A6KB 5FHAL 3FU7B 3X1FA 4G8IA 4L4VB 5AZEH 1TEYA 1NCBL 1KOAA 4J23A 2YSTA 4XBEL 1GGCL 2OBGA 1KZYA 3IXTB 1A9VA 3HZYB 5INCA 4MQXC 3C08L 1JPEA 2Q86B 2WUCH 4IBWA 5GGRA 4B95C 1E4HA 3S3CB 2CCVA 1R1CA 3V0DA 3HUJF 2BC4A 2XPGB 1K5WA 4OTXL 2BS8A 3IFPB 3DX4A 4Z3TA 1UADC 3P73B 2VLJD 3O0RH 4J28A 2JB6B 1R3KA 1MCWW 2BDNL 2R1XB 3NIFF 4O2CA 2VLJA 1SQMA 3LKQA 3O3DA 5DJYB 4ABUA 4POZD 4BFIB 1A6PA 3ETBJ 2WIMA 1CBVL 4QJ3B 1OP4A 4PJHA 1FPTL 3CBJB 1YC8A 2BVOB 5K9QI 3GBLA 4HA1A 4JE4B 2XETA 3DVGA 4HWNA 4IM8A 1GC1H 4PR5B 2W91A 1O6SA 4L3FA 5DZLA 2ITFA 2FYVA 2FECI 1JVLA 2AJZB 3GIVB 4XCNA 2ZSWA 3ARGB 4JJOA 5AYQA 5IQLA 3CFNA 4XWGH 2CDFA 1KMGA 4WO4A 3CUPA 4ODVL 1WBYB 4GUPA 4NDMA 5TF1H 2X7LA 2H1PH 4YDZA 1ZS8A 4NKMB 4N8VA 4L8CA 5C07E 5FC9A 1NCDL 3OSVA 4YEEA 4MD4A 2RR3A 4ANUA 1HWGB 4QUOA 1BYOA 3OAYK 2FLMA 5C70A 1H8LA 1DE4A 5DMGC 5GS0D 1NLBL 3QQDB 1JZ6A 2WY3B 3QRFM 4Z7OB 1CGXA 4MDJB 5E5MB 3HG2A 4H20L 1LEIA 5IM7A 4NPJA 2BNRB 3RWEA 5GHWH 3SGDI 1IARB 2R29A 2XBDA 3WFEL 4WFFD 2V37A 4WW2A 5E4AA 4DJMA 2JKTM 2P24A 1BPVA 4NUGL 2MOQA 2Z65C 1XIWA 2EEXA 2JCCF 3V0WH 1A6WH 1ZIBA 3RFRA 1NGXB 2ZAGA 3V95A 3VG0L 3JVGC 2HT3C 3O4LD 1BOGA 4HUXA 3QDJA 1WIUA 2XWBB 4TTGA 3I50L 1NCTA 5EZJA 5H37G 5GRXG 3ZDXE 3DLQR 2W07B 5FKPA 5DUPL 5AOLA 1XB8A 3JV4B 1YYML 4ZNEE 3ASNB 3D05A 1Z6JT 4KI1A 1JFQH 4AVKA 1MSPA 3ARBA 3VXUE 4XPGL 1KTBA 2BX5A 1D6EB 1N2RA 1KYFA 1DVSA 3O3AB 3SYOA 4UQ3B 5FA3B 3D8MA 1IC0A 4JVWA 4J3UA 3ME0A 4MAYC 4NPYA 5GZOA 3ULUD 3IJYB 1D3CA 1W0VA 2N0MA 3GJEB 5C71A 2JELL 1CFQA 4K15A 1GHFL 1TU2B 4MDRA 4XTRD 4Q9RL 5CZXC 3L5XL 1N6VA 3NZ8A 5IW1B 1EHXA 4GG6A 4LSRH 4UQ2A 3KWTA 2EILB 2HT4D 1DSWA 4PEEA 1MHCA 1N10A 1GZPA 1UATA 2C7UB 3BN9C 4ZSOB 4C56E 5DS8A 5DFVD 1OAQH 1M71B 4NENB 3P4MA 1CT8A 1F2QA 4FE9A 4EUPH 3L1GA 2E27L 4QKTA 1KBWA 5HHVH 2OR7A 5KS9B 4XZUA 5L88L 2AQQA 3DOHA 3SCMD 2V2TB 5B1JA 1ETJA 4X98B 3S5ZA 4XXCA 3T4YB 1U41A 1WBZA 5DO2C 4YK4B 4DK3A 1FNSL 1XGRB 4N8VG 3U9UA 3TIEA 4JMNA 3HPJA 1QRNA 3DJ9A 3DO7B 5ENWB 1MCQA 2HJKB 3ZK0A 2WKLA 4OD1H 3HS8A 4CU7A 4JM2A 2RCSH 3DK0A 2O5ZL 3VD9A 4BYHA 2J2ZB 1HINL 1G1OA 3R4RA 5B1CA 2AW2A 3BPCA 4WV1C 1PLBA 3PWPD 3CZFA 5DC9B 2JSFA 4MRCA 4BH8A 3AABA 5AW3B 2J1YA 3BHBA 3FZUD 1HHHA 5I76B 1WDAA 1LWJA 3ZZQA 4NKQB 3C87A 4ZW6A 4W9KC 2Y7QB 3ZRSA 4DO4A 1FV1B 2OMBA 1C7SA 1RFDH 4P4KB 2QQNL 4ZFFA 2Q7YB 1QFHA 3TEXA 3PGDB 4N9GB 4KZCA 3FN0H 1I7UA 3L5JA 3MLSL 5SWSE 3I6KB 2V9UA 3UPAA 4X4XB 5HTSA 5K1NA 4B5EA 3ML9A 1J86A 1JK8A 3ESUF 3IJEB 3RURA 3CC5A 3L3HB 1XGUA 2ATKB 3P4OB 4Y5YA 4PREB 4APQB 2K4WA 1NGWB 3LQZA 4PGCB 3O9WA 4U1LA 4URTB 1P2CA 5EZPA 4NEHB 4DKAA 5JPNB 3QEUB 1CF8L 3CZEA 2WINA 2DEYX 4O5LL 2WLJA 5D6DC 3RJOA 2CUMA 1U42A 4AM0Q 3OJDB 4Q14A 5E5LA 2XZAH 4PTUA 5ANHA 5DEGA 1RERA 4XWGL 1KYAA 4A7GA 1L6PA 3LSOB 2IH9A 2ADGA 4X7SH 1A4JA 1SEQH 4ZO8A 4GG6F 5GGSA 1AOHA 3CG8A 1HZHH 1HX0A 4X4MA 1U3HD 4WKXA 3U2JA 3E3QC 4R8WL 1YEWA 2OK0H 3UPRB 1I31A 3OV6A 3HOGA 4PRNA 1ADWA 2XV6B 5F1IA 1EVUA 4JZNB 1J9QA 4JRXB 3KVQA 4LAQH 3B6SA 4ZUTA 5FUZL 5I1AA 3SYQA 3QQ3B 2ENQA 2EDJA 3BC9A 4O2FB 2F8XC 4U1GC 3T1FA 3EKCA 4LVOB 3TYGL 5IV2A 5DJYA 2WKOF 3LIUA 4Y8AA 1ORSA 2EYTB 2Z92B 3BVDB 4MXQD 1FNFA 4XWOD 3VI4A 2CMRH 3EGSA 3N55A 2J25A 3NFSL 4YGVB 5IBTL 2EUVA 1PZCA 3QUYB 4MZIA 3PYCA 1TZHB 2H4EA 3GBDA 3EZJB 3DURB 2K45A 4G43A 3OBAA 3LX9A 4Y4FC 4BHUA 1TR7A 1NEZA 3B9KB 3WN5B 5HGGS 4N0UB 4U4BA 5GJSH 2W65A 2P26A 4I2XA 4BFNA 2I07B 5IOPB 2FJFA 3BMWA 3F2LA 4C4BA 3ZYIA 3KLHD 3UAJA 1QSFA 2VDLB 3KPSE 4TNGA 3HJ0A 4F1ZA 3RJDA 4CADB 3H9SA 4D9QD 3ARGA 1U8OA 3SPHA 2CLZA 2H6PB 3KL3A 3BCFA 5I1CH 3W0WA 2P5EB 5HYSA 1V3LA 1YEGH 5IG7B 2XQ0A 2LU5A 1OF2A 1N6QL 2WPGA 4XNUH 3ZBMA 2WMPA 1G94A 2TAAA 1I1YB 2I26N 5HI4D 4X6CA 3FQXB 2YAEA 4NBZB 4DZ8A 3QIUB 4FA7B 4ZX6A 4JRYD 5IWLA 1FDLH 4Y4FA 1YG9A 1EJ6A 1MFBH 3QPQC 4AE0A 4WQOA 4M48L 2XZQL 1OVZA 4PP2A 3JWDL 3QWNA 5AW7B 3IKKA 1T03H 5DVMA 2OR9H 5I18H 1H3TA 2EXYC 3BXNA 1RL1A 4PYHA 1G7JB 4IGBC 4X4KA 5I6MA 2XTJB 2BY0A 3RB7A 2YRBA 5KAQG 5KYXB 4H2AA 5TPWH 4BA0A 5JZ7D 4FHJA 5IREA 3D7PA 2QHLA 5EU4B 5EEYA 2A99A 3RWCA 4XMXA 3MBXH 2XC8A 4PV8A 3TLRA 1SF3A 3E80A 4W68A 1EJOL 1I1RA 1FFPB 3DK2A 3U46B 3PDDA 3IXTA 1UKSA 1NBQA 3GB7B 5F1KC 3S97C 3SOTA 4PTTA 1UM4H 4YPGA 2MKLC 1KJVB 2R56H 1Y1DA 1G7HA 3HW7A 5D7JB 4I0PB 3RX7A 1BPLB 5FKPB 5D1QA 2LABA 4XMKH 1JZDC 3PABB 5SWQA 1QPXA 4WWKC 1C8QA 3AXHA 3REVA 3LNFA 3JWNG 4PJCB 1QQDA 1ED3A 4FZ8H 1RK0A 3BZFA 2ZX7A 1HC1A 2IPTH 2ZZUT 5CINL 4O58H 3KPPA 4QTFA 4KV5E 4UILH 5F1NB 5K59E 2BNQE 3DX8B 3EW3B 2FUTA 2VL4A 4KK6C 3HI5L 3UJIL 5I73B 3DOSB 1NCUA 1PZSA 2QPEB 4MXWL 4Z7VE 2Q86A 3BT2H 5T1JA 3E9UA 5LN8A 3BP5A 4TVUA 3IF1A 2HKAA 1O0VA 3AXLA 1BVKA 1Q1JL 2APVA 3L3JB 4G71B 4ZBJA 2BVOA 5IVXB 5GIRA 2R69H 3FTYA 3D3VB 3WO4C 3FT2B 3TU6A 3BCDA 4FFTA 3RWIB 4BRJA 2XTJD 1BIIB 4KKAD 3F01A 1KLUA 3WFDH 1NAMB 3MCLL 1CFSA 3LD8C 2EJ1A 3MCG1 4OJYA 4ZTPH 5L2JA 1HFUA 2R1WA 3F05A 4E41D 4R7NA 3EOBA 3OKLB 1RZ8B 1A21A 3Q43A 5IB3A 4A7QA 1D9KB 5MENA 2OYMA 2CWRA 1WBYA 2ZQKA 4QRRA 5EIIA 1XH3A 2X3CA 1OCOB 3NJNA 4IDJH 4GPVA 2VLMD 2VLRA 1MIMH 1XL6A 2NX5A 5CP3A 1L9SA 3MLRH 3S96B 5IHZB 3TA4D 2RFXB 4GXUM 5F8RC 4R6UA 2BNQD 1ODUA 1T21B 5IBUB 4KK8C 3KCWA 1T4KB 3VFTA 5JNYB 3LQAL 2Y7LA 3BDYH 2A9NL 5E5MA 1IVLA 5FLUA 2FX8H 2VO5A 2BCMA 4PWEA 3A67L 7FABL 5CP7A 1DBBH 2ARJA 4HS8H 1ZGLP 1IAIH 4AQEA 2ZNXA 4AYFB 2CJTA 2X2JA 4ES8A 3RI5K 3H4HA 1E0OB 3S9DB 1BYNA 2BP0B 3N6YA 4LCCB 4O51B 5D1XA 3U79A 4JFFD 3ZKNC 2NQ3A 5I0ZA 5I16B 5D9SA 1UJ3A 2Z34A 3F00A 4ORZC 2WQXA 5TE6H 5FF6A 1LMIA 3ARFA 1SUHA 3K6FA 1VFBA 4XN8A 1DJIA 4FCHA 4OU3A 5LBSA 4IOSA 5CSZA 3V5DA 1FNHA 2ZOUA 4OGZA 3B2UC 3TBYA 1UENA 5GPRA 2QR0A 4UQCA 3HB3B 3TH2T 4GH7B 3MV9D 2AJ3B 2XZAL 4GY4A 2FVNA 4Z7NB 2WLMA 3SDCA 4QCIA 4TQ8A 1LNUB 3QZPA 4PJIE 2X0WA 4JRXD 3RTQA 3UCRA 4JQVC 2J55A 4G11A 4H5SA 5LB1A 5EIVA 3SCMC 5JIMA 3ZRCC 3IYLW 3L3IB 4I3GA 2KKQA 1MHPL 4OLYL 1RPQA 3AS1A 1F6AB 4OLXL 1G9NC 5EEXA 3DRQA 3GHEH 1CVSC 4F7CB 1U58B 1JGUH 1O9WA 5CD5D 5JHMA 3EYFB 1U8HB 1QFWH 5TE4H 1QFOA