1RH8A

Three-dimensional structure of the calcium-free piccolo c2a-domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
142
structure length
142
Chain Sequence
ASHPITGEIQLQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLMKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conformational switch in the Piccolo C2A domain regulated by alternative splicing.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
molecule keywords Piccolo protein
total genus 20
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2003-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1rh8A00
4ANVA 3ML8A 4LCVA 2FJUB 3TJPA 1YRKA 3W56A 1DJGA 1CJYA 1E7VA 2WXGA 1DJXA 3HIZA 2WXFA 4WAFA 2ENQA 1RSYA 1W15A 3OHMB 3JZYA 4DNLA 5EDSA 3APDA 3PREA 4AJWA 3LJ3A 4HLEA 4EZKA 2CM6A 3L08A 2CHZA 1UGKA 1UOWA 3F00A 2WXRA 3QK0A 2ISDA 4KZCA 2WXIA 3SD5A 4KITB 3L4CA 4F93B 2WXLA 5CCHE 2LHAA 2Q3XA 3IM1A 3M7FB 3NZUA 5G55A 3FBKA 3IBEA 2WXMA 3ZIMA 1DJIA 3R7QA 3NZSA 4FJYA 4G11A 3P2BA 2ENJA 3DPDA 2Z0UA 1E90A 4FJZA 4ICWA 4FHKA 4KZ0A 5T8IA 5JHAA 3L16A 2R83A 2WXHA 4QJ5B 4IQHA 4QJ4B 1UOVA 3L54A 1W16A 1QASA 4PS8A 4J6IA 4A55A 4URKA 2ZKMX 3N5AA 2Y3AA 2K4AA 3ENEA 2YRBA 4QAMB 4ANUA 1E8WA 2X38A 2NQ3A 2D8KA 3ML9A 4PS7A 4Y1TA 4Y1SA 4L23A 4NPJA 4TUUA 4L2YA 5H4YA 3HHMA 3L13A 3APCA 2WXPA 4OVVA 3DBSA 2WXJA 3FDWA 4XE0A 1DJYA 5CCJA 3OAWA 3TL5A 3B7YA 4FLHA 4OVUA 3QARA 2DMGA 1A25A 1DQVA 4WWOA 2ENPA 4GB9A 4BGDA 2CHWA 3F05A 3ZW3A 4MJJA 2RD0A 3RDJA 5H4ZA 1K5WA 4LDCA 2V4LA 3QR0A 3R7RA 4F91B 2FK9A 4XX5A 4WWNA 3QAQA 1GMIA 2WXQA 1E8XA 1BDYA 1TJXA 2K3HA 2QZ5A 2YOAA 4WWPA 3S2AA 2CJTA 2QZQA 1E8YA 3T8MA 2DMHA 4NS0A 3TWYA 2BWQA 3L9BA 2NCEA 1QATA 2N1TE 2NSQA 2WXOA 4F1SA 4XZ4A 4EZJA 2WXKA 2CM5A 2A4ZA 3HN8A 1BCIA 2CHDA 3L17A 4JPSA 4L1BA 5CCGE 1HE8A 4ANWA 3CSFA 2EP6A 4FHJA 1E8ZA 2UZPA 2CHXA 5JHBA 4ANXA 4FULA 4HVBA 4L1LA 4FADA 1WFMA 3APFA 4GNKB 1RLWA 4IHBA 1E7UA 1DJWA 3MJWA 3F04A 3GPEA 1WFJA 3PYCA 3W57A 3CSTA 5KJ7E 4BFRA 1TJMA 2KI6A 1RH8A 4DK5A 3PRZA 2K45A 3F01A 4F92B 4EZLA 4V11A 1DSYA 2CJSA 2B3RA 4QJ3B 1DJHA 3PS6A 4AOFA 3ZVVA 4LT7A 4NPKA 4ICXA 4FA6A 3KWUA 1V27A 3KWTA 2A5UA 2K8MA 2JQZA 2WXNA 4WEEA 3QR1A 4NP9A 1DJZA 4PS3A 4TS6A 3NSJA 3PFQA 5G2NA 3RPBA 3QJZA 1BYNA 4TV3A 2Q0ZX
chains in the Genus database with same CATH superfamily
4HKXA 3QUZC 4IU2B 1UCTA 4ZD3L 1LMIA 1NGYB 1OGTA 5E8NA 3MBXH 4KHXH 3NCJH 4Y5YA 1M3IA 4F1ZA 1MH5A 3EYOA 2VE6B 3PREA 1A4JB 3GSQA 3V4VH 1GIGH 1CUOA 1X5JA 1TCRB 2XBZA 3A47A 2TAAA 3HLKA 3LN9A 5IMLA 1U33A 1C5CH 4KGLA 4AEIL 1AO7B 4UF7C 4LCWE 4X80L 4GRWE 5E7FA 1TZGH 2A9NL 3BGMA 3FTSA 5I6PA 4EZMA 1AKJA 3LIZA 5IMOA 3WLWD 4JO8A 4KMTL 2VLRA 2Y1AA 2YLHA 3ZK0A 4Z7UA 5IJCC 4P3CL 5F1OB 3WIFA 2ATPA 1FG2B 3NJFA 1FL5A 4DO6A 2YHGA 3DLQR 4XCEA 4IBUA 4HALA 2E9GA 4EUPH 3MR9A 3EGSA 1EUUA 2FJHB 5IOKA 2AABH 3JTSB 2RTTA 3X3GH 5I1CH 1LK2A 4N1EA 5DJAB 3TBSB 5JZ7C 1KWKA 3A0OA 2XWCA 3QDMB 2FJFA 1I7ZA 2BHZA 4UQAA 1QOKA 3TV3L 4EEEA 3M1BB 3ERXA 5DTFB 1TZIA 3L2LA 5JDSA 3IJEA 1CLCA 4MJJA 4MWFA 1IM9B 5HYIA 1WEJH 2HYMA 4ZAKC 3FO2B 3CDFA 3V10A 3CQPA 3A4AA 4KKNA 2VDPL 3QIUB 4KTEL 1OARL 3MNWA 4N0FA 4I3RH 1ZHBA 1UYWH 2BWQA 4AXWB 1MAML 1CXHA 5I0VA 5EU7E 3S35H 4L4VE 4DT2A 4JHAH 4QF1B 3ZTJG 1MWAH 2DD8H 2DYPA 3HS8A 3NSCA 1FH5H 1JK9A 2R1WA 4N22A 4PJIE 4Q14A 5AYUL 4IMLA 4HX1A 4X9BA 2L7UA 2Y22A 3D85B 4AWJC 1G7QB 2CLVA 5FW8A 3VD2A 1AXTL 4EI5D 2ADIA 5HDOA 1YQVH 4OR1A 2PYEB 4XHQA 3RHWK 1XR9B 1QRKA 5FHAL 1WZLA 1TF4A 4F2ME 2ICWJ 1U8NA 1YECH 4U6HB 4UWQB 4KKPA 4IBVA 4QXGL 2PYFA 2FLRT 3W38A 1DFBH 3LH8A 1QLEL 1VAHA 4GI8A 3NAAH 4L3CA 3ARYA 2ZX5A 4OLWH 2R7EB 1MFBL 3UGEA 1QKZL 5DHDA 4TSBL 3UG4A 4TV3A 3VI4A 4FABL 2H2SC 1YMHA 2Z8VC 1KBVA 2XQYG 4LNRB 2GSGB 2AK1H 5LJYH 1A2YA 2C9XA 1JPTL 4YDLC 2YZ1A 3IJEB 2WC7A 3LIZH 4OZHE 2C3XA 5EPMB 4BGLA 4HHAB 4IBZA 4WDIA 3ZX1A 3X12B 1ZAGA 1OHQA 2C7UB 3SPVA 1NGPL 4O9HH 1CFBA 5D4QA 5L4MA 1P4LB 1NFIB 3AM8C 2EUZA 5IFJB 4G6FB 4NN7C 4RZCB 3OMZA 5I8OH 1NANH 3DPDA 3QFDB 2B1HL 1JGVH 1TG8A 5EO0B 3TESA 3IMVA 1UH3A 4PJEA 2Y7MA 4LP4A 2BP0B 3JTTA 2V3FA 3HA0A 1W16A 4Z7NE 5BS0E 1JTTA 1U3HD 1UFUA 3L1GA 4B9FA 3O9WB 1BZ9A 2WZAA 1YYLL 1ZA6B 3CZLA 1U91A 3KWWA 3HAEA 4PJBB 1NINA 3LIUA 4IDLA 4JQIA 2XQBL 3OSVA 3SDDB 1E30A 4UM9A 4AGOA 3MMEB 3HR5B 1U4FA 4FC3E 3HN5A 5F7UA 1ANUA 1DVZA 1NAML 4ZTOL 3VYPA 3U6RB 3UBFA 5T5FA 4G7YH 5DR5L 5BUPA 4XNYH 4YX2L 1LE5B 2OULB 2QQLL 5B7EA 1BWMA 4LSQL 2F5AL 2R0ZH 2Y7NA 3LNFA 5HYEA 2UXFA 1I1YB 1M05B 5FAAA 1U8IA 3JWNC 4FQCL 4XCFH 5BZWA 4MCMA 3AM8A 1ZOXA 5IVOA 2Q86B 1X4ZA 4HBCH 3D3VD 2CJ3A 5DYOB 1A7QL 1OK8A 3D2TA 4JPSA 4LDLB 2ICWI 3IK2A 3RWCA 1N7MH 1L0QA 2CHXA 3CSYB 4I5BA 5E2WH 5HDBB 5E7BA 2G3NA 4FYRA 1WFMA 1IAIM 2BP5M 2WLYA 3F58H 4K3DL 4PRPE 2WTPA 1B0RA 1F3DJ 4JO1H 3T3PE 3GSNH 4JMNA 5AYTA 1JK8A 3FSVA 4NAQA 5EHFA 3U4EA 3HG3A 3UJJL 4M5ZL 1KCBA 3G6DL 5DQ9B 3TN0D 2W91A 5D1ZB 1NC2A 4OZFA 4UTAA 1DDHA 3VFSB 4KK5C 1BW8A 2YIHA 2B1AL 4POYA 1Z6JT 2FJSA 1H5BB 1NC4A 5LHDA 1YVLA 3D33A 3QCUL 2UWEE 5F96L 2HP4A 5D55A 2F08A 3DMMC 1EXUB 2FATL 4X9HA 3RL2B 3BEWA 3JWNH 4OUUB 2D4DA 5DS1A 2A74B 2R4SH 2YFOA 5ICXA 1K2DA 1HWWA 1XIWD 3EYQC 2X0WA 4W6YB 2J6WA 3Q5YA 4J3VA 4XP4H 5F0LB 1D6EA 1U95B 3C9NA 3RHWF 1J1XL 2WO2B 2LT9A 4NKIH 2ENQA 4ZS7H 3SIKA 4R4FL 2R0KL 5DA4A 1T89C 3U1QA 2LE9A 3WJLA 1GL4B 4HJ0C 1S7TB 7TAAA 3U46B 3BZ4A 2CBPA 4IOFC 5IR1B 1ZS8A 5C3LD 3CDGB 3SCMB 1I85C 2WVVB 3S36L 1G9NL 1CDYA 1GC1H 2NY6C 4Y9FA 3WY2A 1R4XA 3E7JA 3P77A 4PD4K 3SE4C 1AZUA 1JP5A 3EF7A 2VE6A 3O6FA 4O51A 2OZNA 2IBGA 3BWUC 3IDMB 4P2QD 2V7NB 1PJWA 3AUVA 1QASA 4OAWB 5IB5B 4OV5A 1FE8L 2NR6D 1NICA 1OQXA 3TEXA 1YEJH 1YEDB 4EQ2A 2XIDA 4Q0XL 1SMAA 1NIAA 4PLNC 4U2ZA 3P4MB 1ZA3B 3KHQA 4DP7X 4NPJA 2O61A 1QSEB 1DVSA 2BIPA 4LHUB 1D9KA 3DMMA 2Y23A 1F86A 5CZRA 5T3ZE 5F6IC 3VI3F 3JWDH 3UYRL 1DN2A 4X7CC 4YWGH 1HZKA 2VDKL 4BGDA 2IGFH 4NQEA 1C7SA 1I9RL 3BKCL 1R5IA 4EF3A 1DCLA 3CFQA 2VXQH 4NB7A 3KHOA 5CSBA 4XB7A 4UU9A 2NUTA 2MWCA 1USZA 4DF9A 5A43C 3QB7C 4ATWA 1BM3H 4K3GA 1FO0B 1I7ZB 4IYKA 4Y9EA 3VXUB 1FP5A 2W9DL 4A7SA 1NKOA 1UJTA 2Z1KA 4QWWC 1I85A 4WI6A 3B56A 3EJUA 4WFHD 3W9EB 5LGJB 3GXMA 3ZT5A 2WXKA 1PNCA 1KN2L 1W6LA 4CC4A 1BBDL 3Q9PA 4Z7VA 3SE4A 1B3JA 5DRXA 4UUJA 5A3ID 3TLRA 3IJ9A 1MFUA 1UXWB 4N0YH 1LJMA 3TT3L 2YARA 2X1PA 4A7UA 3RIAK 1NWPA 1OW0A 3NJNA 1FAIL 3QYCA 4XO5A 5I76B 1WBYB 1JNNH 1AKJB 1ACXA 1VPOH 1S7SB 4ZUWA 1CTMA 4P3DA 5EA0H 4JM4L 1YAIA 5FV1L 1E4WL 2JF1A 3PIQB 4GW1B 4KI1A 1WBZB 2RQEA 2X1OA 2D7MA 4EDXB 4CC1A 4KNQA 2P46B 2J88L 1NMCC 3IMRA 4GO8A 3EJZD 1CIUA 1DQJB 3U4BH 3UXFA 2E8ZA 3IFOB 3A6CL 4IBTA 4F7CA 1MEXH 3O3BA 3MOBL 4XT1C 5H94A 4FTVA 2AQPA 4L48A 3TO2B 4PJXF 5ICUA 1PZAA 5FO7B 3LMJL 3TVMD 2IFFL 3RG1C 2BFGA 3VXMA 3B4NA 3ARFA 5DS2A 4KFZC 3HMXH 2ZICA 3L95B 2COQA 2X2UA 4OQ1A 1RZ8B 5EB9A 5D7EA 1M7DA 5D5MB 3IU4H 1UKSA 3MNMA 2CM6A 1KB5A 4NKDA 2XTJD 1MN4A 4NSKB 4CC4C 4OLVL 2GITB 3FCUB 1MSPA 1T04A 4XVJH 4TRPH 2AC0A 3V4LA 4YXLH 3U9UB 4GKZA 4OT1H 2D9QB 4UQIM 3ZE2F 3FTGB 1UFGA 3ROLB 4XXDB 1ZLSL 3R19A 3SD2A 1TETH 2DWEB 3VGAB 3PWLB 3M45A 5KYUA 3SKJL 4Y1AB 1BVOA 4M7JL 4HZ1A 2AW2A 2NYYD 3O2VL 3BWSA 3N85L 2X6CA 3CE1A 4H1LA 5FUOH 2Q10A 5SWSB 3NGBC 2CO3A 4EOWH 2MKWA 4XR8C 2IBZX 5H4YA 1YY8A 4YLQT 4UQDA 3AMKA 4KKBD 1IFHH 4Q58C 5CU5A 3LTVA 1KJ3H 3OX8A 3OKYA 4P5SA 3ZE1E 2WNGA 2KLRA 5LGYA 2F53D 3DVGB 3D39D 4OB5L 1KBPA 2FE0A 4QXTB 4PLKD 1SXBA 3BDBA 3TA3C 4PRPA 5DEGA 2VSDA 1K8IA 1EX0A 1IC4H 2ZX8A 2C9VA 3QG7L 4ZPTB 3OAYK 1EFXD 1IL1A 2TRHA 5LNGA 1CDCA 4JRYE 2IDCA 3NIGF 4NQDE 4PIBA 4P23A 4G43B 4PLKC 2K8QA 3B9AA 1P6WA 3QUYD 1MCWM 3TNNA 4NXKA 4FQ2H 1IEBB 1UWEL 3MRNA 1LO4L 2VXSL 2KLSA 5H2BB 1ACZA 5C07B 4Y2DC 3F12A 3V6FB 4PRHA 4HS3B 2UY6B 2BP3A 2BNRA 4FADA 4A66A 5EO1A 3UJIH 3ABLB 1TSRA 4HT1H 2YEQA 3CDCA 3T04D 5TQ2H 1CDBA 1CZ8H 3QUYB 1MFVA 4XMUA 5IJVB 5GZND 1U8IB 4MAYC 5KVFE 4ZFQA 4GKZB 4CBZA 7FABH 1NDGA 2JK5A 4TTGA 2NY2B 1P84J 1QHPA 2H1PL 3HZYA 3K80A 4QTHA 4D7BA 3K0WA 1KIUA 2CNYA 3V4UL 1LP9E 3CH1A 2HZHA 3SJVE 1DQJA 4K9EC 1NJ9B 4QRBA 4ICXA 4XNXH 2FO4B 4TLSA 4YVNA 3V6ZA 5C86A 2ZCLH 1JDCA 1ASPA 1BD2E 3VJ6A 1YN7A 4UV7L 1E2WA 2W80C 5F72S 4QTIL 4N90D 1A66A 3ILQC 5LCVH 5DRZB 1QPPA 4PHZA 4BWTA 4KK9C 4AEHL 2ZCZA 3LRSB 4G5ZH 1VGKB 4P23C 2O61B 4MDIB 5EN2B 5L0QB 4JQIL 5FYJE 2FX7L 4ODXA 2WJ5A 4IGBD 3APDA 4QO1B 1Z9PA 4M7KH 5B3JF 5I19H 1E9OB 4LIQL 1K4DA 3EJTA 5E4AA 2H7WA 3CX5K 2OW7A 4GLRI 5CCHE 3UTSA 1B4JH 5I1JH 3SQBB 3AS0A 4IKLA 5KS9A 1MFAH 3LEXB 2SODB 1RFDH 1ORQA 2N7SA 3FS9A 4ZMWA 3US9A 4TN9A 4XX1E 3K74B 2V2XA 1J0IA 2C26A 4MAYA 1SM3H 2MJWA 4JDVB 4F57H 1FNSL 3INUL 5BUGA 3GMLB 3TP4A 1T5WB 3MRJA 3UIYA 2VKXA 2F7QA 3CSBA 5EEVA 2CUIA 3ZKMD 1TQBB 3L1EA 2XZAH 3UTZB 4CILA 4TUJA 3RZCA 1Z5LA 5B4MC 1KXHA 3FOMA 5IW6A 4FQQB 3AUWB 4EI6B 5L9DL 3Q1EA 1SUHA 4GFTB 4TQIA 1MCPH 1NUGA 4Z7WA 3EJRA 1LO5A 1OF2A 4XRCB 4EE2A 2YPLB 3P2TA 1T6WA 2XHNA 4OCMC 3NCJL 1DBBH 4GRMB 3CH1B 4JPQA 2C9QA 3IETB 4LLQA 4WTXA 3RPKA 4AQZA 1ZXKA 3V0IA 4MHHI 2OJEA 3ILDA 1UT1A 5C0CB 1XTLA 5F88A 4KVNL 1JV5B 3NDYE 3NJGA 3AFLA 3P0VH 5JHMA 4XMKL 3WN6A 1RUQH 4HS6A 2AVFA 4I8DA 4JFWA 3MRRA 2NQCA 3L2NA 4PAZA 4IMLB 3U46A 4OV5B 3DUSB 1XB3A 1LEKA 5I1IH 3C6LB 1XCTA 4N2DA 4QOKB 3WTVA 4HVBA 3OBAA 2VR8A 3OB8A 1J5DA 5DWPA 3MRIB 2VMFA 4B9PA 5ECGA 3KPOB 4Q9QL 5LCVL 1TTFA 1TEFA 2NLJA 3GHEL 5LBSL 1C5DB 2K45A 4YNYB 4LRNH 2DQJL 2OJZH 4CN6A 4G5ZL 4UV4L 2XA3A 1CFNB 4KPHL 1H5BA 1JNHB 2UZIL 4P5RA 5I19L 4KI5D 1UD5A 4P4KC 4P99A 4KKAD 2XV0A 2BVYA 1BAFH 2AQRA 3V0JA 2NY5L 4IOFD 1WEJL 1MFAL 1K2DB 4GSUA 4YLBA 4PYGA 4NQUA 1KFAH 3LVEA 4U1JA 1MZZA 5FDYA 3O0RL 1MG2C 1NPUA 2QVIA 4EO5A 4NRZB 1PD1A 4OIIL 2W0KA 1KPRA 4ODSH 3EADA 5B1JA 1ZANH 4OZIF 1U8MB 4GQ9H 3S2CA 2EEXA 3MLYL 4GBXC 1TVBA 1U3YA 5D1QC 5IF0A 1Q90A 4H8HA 3Q1SL 2CO2A 5KSBE 4NC2B 2G4GA 1WIOA 1EAQA 4JM2B 3DOSA 2SEBB 2OMYA 3ELAT 4I2XA 3M17B 3X1EA 4N68A 4F8LA 1X5AA 5I6NA 2NY3C 3K4AA 1TKWA 4NO0B 4ZZFA 1QQDA 3MRFA 3MX0B 3S8FB 5EUOF 1ZV5A 5F9AC 5FM4A 1KPUA 4URKA 4QHKI 3P11H 3I02B 3LQAC 1NIFA 1H5BC 3DXAA 4CUCA 2GI7A 3BIKB 4PJ6A 1DFBL 4JFXA 2HX7A 3HW7A 3RGVC 1XR9A 1QYGH 1G9MC 3P73B 4KO7A 4X8GA 1QKZH 2Q6WB 4ERSL 3PAUA 3ATEA 3RU8H 1IAOB 4UT9L 4JPVH 5JOFA 5DD3L 2LVCA 1DQVA 1FHGA 1O7DC 1KTLA 2WOBA 4J1UA 2BVUA 5K9QI 5I6OA 1J5CA 1PY0A 2QTEA 5T3ZH 5B1JC 1GIGL 1U42A 2KPWA 3LIZL 5SWZD 3FUJA 1F3DH 2AI0L 2ZJSL 4XXWC 4ZXBD 1NGPH 3KYMA 4DKFL 4GIAA 4Q6KA 1TZGL 2A9NH 3ZDZE 4GO6B 1N6VA 4OQTA 4HIIB 1RZFH 3INOA 1MHEB 2B1HH 3S5ZA 4HS8L 4WDIB 1KLFA 1QBMH 1L5GA 1LP9A 2CM5A 4UUJB 2H6UA 5EIQA 5K39B 5JHBA 3MUJA 3EDJA 4GG8A 3QQ3B 3OGCA 4IU3B 5TDPB 1NCBL 3QQDA 2WUCL 1NBZA 4G70B 4JO4L 4JY5L 1KEGH 5L0QC 4MQXD 4R84A 4PJBE 3D09A 3QNYB 4OGXH 5CN2A 3GLEA 5KVEL 1LM8V 4X5WB 3SPVB 2DM4A 1XWVA 1I9EA 1SXAA 3WXVL 1FNEB 1NL0L 3PJLA 1K8DA 4BUGA 5I15H 3FHQA 2ADJB 4NFBA 3U0WL 1PG7H 1A14H 3E1F1 3PDOB 1NGXA 2NNCA 4LNRA 4G7VL 3ARED 4HETA 3PAZA 1KYAA 3V55A 4E9RA 1OD9A 3MRKA 4V2CB 3K71A 3OAZH 4X0KA 1BFOA 5CKAA 1A7NH 1ID5I 4JEGB 5KOVC 1AJ7H 4AIZA 4M6MH 5DA0B 2YXVA 5IB5A 1OK0A 5IUCA 1DTUA 1B6DA 4Z3EA 1BQLH 3V6ZB 1IGIL 3RY5A 1R34A 3US1A 1EWHA 2A73B 2J20A 1U8OB 5DRNB 4X6DF 2CK0L 2X6BA 5E4EB 4LP5A 4GBXD 3FN3A 4EN2A 2NNAB 2X4PB 2XZCL 3GPSA 4JKKA 3V2AR 3G5WA 5T1MA 1IBGH 3QO1A 5ABZA 2X4QB 4X4ME 5MEOA 3UJJH 4HPYH 4J3OD 1G7JA 5F44A 5J6GB 1OP5H 2HUHA 2HRGA 4BSVB 1U36A 4U7KA 2XXMB 4G83A 5LGHH 4DN4L 4L3EA 4NQCA 1DVQA 1ED3B 4OKVA 1ND0A 3L3DB 4OLWL 5E4EC 4F9LC 4X5LA 5IM7B 2DTMH 3FHEA 1DVFA 5EO9A 3N06B 2NSXA 1JGDB 3P0YH 3CXHK 1S3RA 1DFXA 3VRLE 2YSSB 2L7JA 3C60A 4L9LB 5L4IA 4JHWL 4NDMB 4K7FB 2HG0A 1XH1A 3AQDA 4NKIL 1VGEL 2ZYSA 1Y07A 43C9A 2QFRA 2J2ZA 4WV1B 1AGDA 4Y4KA 1AZBA 4NP4H 1CU4H 1NAMB 1WITA 3E8VA 1SLXA 3K6FA 5I6XB 3BP4A 2TSAA 3HVDA 1QATA 1YEEH 1NC4D 2R15A 2IGTA 3VXMD 4RETB 4DP9X 3NSYA 1AANA 1BCIA 1JUFB 4OD2B 2CRYA 5BRZE 3U9PH 2CA3A 3JZ7A 1R33A 3N9GL 2Z31B 3D0VA 4HKZB 1ADQL 4MJ5A 3Q3GB 3JV0A 2NW3B 1DHKA 2BWDA 5GJSL 3KS0J 2V2TA 1EMTH 2ZUYA 1DANU 5IMOB 1YMMA 3GJEA 4PMEA 4E0RA 4U1SA 2PTUA 5C08B 1A7NL 4HUVA 2B0SH 2H3NB 2YA2A 1NCGA 5AZEH 1VDGA 2HJFB 4S1QL 5J3HD 5A2AA 2HPOA 2N1KA 3QORD 4ABWA 1UUNA 4NSKA 3U2SA 2GIYA 2DQCH 2HT3D 3H2WA 4TNWF 2WP3T 2CLRB 4PGCA 5CHNA 2FD6L 1FORH 4KDVA 1SVCP 4AK2A 3ZKNC 5IT2L 2GBVA 5G2NA 5DMGC 1JAEA 2A38A 3ARGB 3LXCA 2AERT 4BA0A 3QJOA 5CJQL 1DJGA 4YXHL 1FYTA 4ZX5A 1AQDB 5HGAB 1KN2H 1BMZA 2WB1A 1C1EH 1ETZA 3PFUA 1JHTA 1RK1A 1WGOA 4NC0B 1SJEA 3K72B 3OC8A 4WHDA 5GRXG 4G9DB 1QSFD 5IMMB 2J44A 3PHOB 1EIBA 3HC4L 1JZIA 4ONGL 2X4OB 4LHUD 3BH9B 1OF2B 4XRCA 5BUAA 1XL4A 4LPYA 1WAAF 2ESVA 2BHFA 3KPSB 3QWRA 4LEXH 4Z7NF 3EJZC 4AYFA 2EE9A 2IWEA 5EC2A 3U1SH 1KLUA 3SYOA 3G6AB 1EZSA 1FGVH 2F7RA 4XPFL 1BGXL 3UIZA 2AQ3A 2VKWA 1EO8H 3MJ8B 5CJBA 1E65A 3B2UD 4PW3A 1BMWA 3N5AA 2VZVA 2OLDA 2DIBA 3BUYA 4JKNA 4N26A 3NJHA 5A2JH 2X5PA 4E5XB 3BE1H 1MCFA 2NLJB 4POZC 1DL7H 2QQKH 1PEWA 3GM8A 4HPOL 4PJ5E 4AZ8B 3L4XA 2HFEB 2JB5H 1TR7A 3L5HA 3ES6A 4WK2B 4PCYA 5DJZB 4Z0XB 4M6OH 1P5UA 3LNEA 2CMRL 5DZOA 3KWXA 5DK2A 5D1XD 4N0RA 3E8UH 3F5WA 1UWGL 3QAQA 5K9KB 4R5XA 1OTSC 4MNGB 4L4TE 2QZQA 2ZTBA 4LEEA 5C0GB 3COOA 3Q6GH 4U6YB 4BH8A 2Z7YA 3KG5A 3PCYA 2QKSA 5HYSA 2OJEB 4P04A 2BOBB 2ICCA 4FQLL 2CIIB 3T2LA 3TYGL 1BD2D 5EORL 4D2NA 3ARDB 4HEPG 2K7PA 3CN3A 3MOAH 4YFLI 4UT6A 1HHHB 1CICD 3SO3B 4I89A 3SE3C 1MIML 1U8CA 2FIKB 3DRQB 4MMXC 1LO5B 4YO0B 3TVMB 5I6KA 2Z91B 2F1EA 3ZT6A 2ADFH 1J86A 2ZOTA 3NSFA 3LV3A 1XZ0B 4X6FA 1AHWA 4OLZL 3CVHH 1F4YH 4CSSA 3T65B 2DS4A 4UM8A 1BQHG 3NH7L 4KHTL 3RTLA 4OFVA 1JD7A 4G80A 3RTQA 4P2OB 2WKLA 4PP1C 1YEKL 1NCIA 4QXUH 2MFNA 3VXTA 5DJXA 3KYKH 4HK0A 1WT5A 2AXFA 3ZPDA 3DO7A 1ETB1 2BVOB 2VNCA 3RTQD 2Z8RA 4G6JH 2EDDA 1IVLA 1U41A 4Y4KD 4YSOA 2IAMC 3H2QA 2ZXDA 2EIBA 3K3QA 4PWIA 2VR5A 4JDEA 1FN4B 1UWEH 4P07A 4Z6AT 3S3DB 5C07E 4AYGA 4N5UA 2VLLB 1DQIA 1JWSB 3QUKB 2ZAGA 1G7MA 4UZGA 4AM0A 1T7WA 5JXAH 1SXZA 1OD7A 1PCXA 1MRFL 5KYWA 5CR1A 1JNLL 3OJDB 1IGJB 4CSTA 1JYWA 3BAEH 3SPCA 1E42A 1LTXA 2PPFA 1J8HD 1GJWA 3MV9A 5E99H 1QBAA 2XWEA 4ICWA 3I75A 5HHNA 2AXWA 5SWSA 4QHMA 5E95B 1AHWC 1U3ZA 3S3JA 1B6UA 2J88H 2I85A 1U58A 2WZPA 2OSLA 3CZFA 1F97A 3NEEA 3U25A 1ZDSA 1LDPL 3QUXB 1MEXL 3DX0A 3POCA 4K8RH 5BW7A 5GGRB 2HWZH 1FZMA 2OXGB 2YAMA 3QCVL 5DD1L 2X87A 3FQXA 1E5YA 4UQCA 5EF1A 3QYNA 3N0AA 3LV3B 5B7FA 1S7RB 2JLPA 4PJCB 3NG5A 1W0VB 3KWVA 1VFMA 4YIQB 4FQLH 3UADA 4OW6A 1V3JA 4ZMYA 3GXFA 3MRPB 4EN3C 1WHOA 1MF2L 3CQQA 4BEIA 3D4ZA 1S7UB 4FNSA 4JFFE 4JMXA 3VA6A 2WXQA 1A8ZA 5AWNH 3CN1A 4BFNA 1R3HB 1RIVH 3LPFA 2YMXL 1JF1A 5JMRA 4POUB 2WXOA 1X5GA 2R2HB 4PRIB 4PUBL 2J57A 1LD9B 4AW4A 4DP8X 2OR9L 1ZD6A 4KV5F 1PTZA 2YBGA 3QXAB 1WVZA 2E27H 5J1AA 4PJEB 3FRUA 1NM9A 4GAJH 4GRWF 4XCYA 1NCDH 3TTSA 3A6BH 2DOCA 1YNLH 2Q3AA 4LVOC 4R4ND 5DHXB 5CZXC 2FGWL 4V11A 4W93A 4MB5A 4ODTL 4IGBB 1E9PB 2G60L 5EU6B 2VLJE 1OAYL 2BSCA 2X6VA 3MBEA 3K8MA 4R7NB 1DBMH 4RSYA 3ZN6A 4E9QA 3O3EB 3P3RA 5HD8D 1IAKA 4HXAH 1CLZH 3HMXA 4BBWA 2DF3A 4PS3A 4XN4A 3H8NA 4QY8B 3QSKB 5IQMA 4RGND 3ALXA 3FRPB 4H5SA 4KUZH 4MYPA 1QRNA 5EU6D 3BYYA 1ZHLA 3I9AA 4LB8A 4MFHA 5DUPL 2DQHL 2ZCKL 1BF5A 5ADPH 3VXPB 2YC1A 5BO1H 5HSFA 4GG6F 1I3UA 2NY7H 1GZQB 2CLRA 4PGCB 3MRPA 1G6RH 1U8NB 3EFOA 1BJ1J 2R69A 4AT6B 4OZHA 4C54A 15C8H 1HJCA 4XBMA 4ZSOA 3WTUA 4M4RB 2YPLD 5CUSH 2JVUA 5IB1B 3KMDA 2DQUL 4EXPX 4LRNL 5CZKA 1M1SA 5EBMB 5K59F 1X5YA 4OBRA 2DIEA 1WWCA 2ED6A 3ZHLA 1RHHB 4HU2A 2WXHA 4NZTL 4HCIA 4OM1L 2OSLB 3CZFB 3CHRA 1KV3A 3E3QE 4RQQA 5CO1A 3ZUNC 3OPZH 4XMZA 3HPLB 3HE7C 4RWYL 5EEYA 4LSVL 4W9IC 5JTWA 2X2JA 2LU5A 4HUVB 1PKQE 2XDHA 4KV5E 1JYNA 1T83C 2XWTA 1KTDA 1RJZA 4FQIH 2E7CA 5DJ2A 4OIIH 2Q7NA 2YZ8A 2P24B 3D4CA 1Y6NR 1A9VA 3BT2H 4UIMB 3VWKD 4WKZB 1OLLA 1J9SA 2BVEA 3WKML 2F54A 4FZEH 2LU4A 2PCXA 1CI5A 3HUJF 4RAVA 1OP9A 4KDWA 1ETJA 3KCWA 4WO4A 4PBDA 4AYFB 1FO0A 3V4PH 3KXFE 1A6AB 3QDHA 2EDYA 3NFPA 2MKLC 4DPCX 3ZSSA 5TH2A 1G9MH 2RH0A 3B2XA 1SOQA 1AE6L 3GSVB 3MUY1 8CGTA 5EF2A 4OQTL 5FXCH 5EZLA 1SRDA 1TT6A 1DBML 2GI0A 3L3OB 1WFIA 2NY4D 3CMGA 2VERA 4DGVL 5CEZL 2V2WA 5E8OA 5MP6L 4PRNA 4TNEA 1SBSL 3GINA 1MFNA 2YO3A 3FQXB 3IDUA 4AEEA 2VXQA 3VXOA 1RD6A 5JR1H 4XMTA 1ZLVK 5D1QE 3BGMB 3MVSA 3A22A 1N4XH 1TZHA 2NX5E 1O7VA 3TO4D 5JOPE 2DV6A 4KJYB 3D3VA 3NIDE 5ETUA 3QO0A 2X9WA 4KH2A 3VI3B 3OR7A 3P77B 1UD2A 1IEAB 4KVNH 5J6GA 2W1NA 4U1NA 4BCYA 2X4QA 3ARZA 2FBOJ 3L4ZA 1UHVA 4K3JL 1U2CA 2HKAA 1KIPA 3HZMB 4PS4H 3O6ML 5CR8A 2I60L 3HAEB 4FABH 1AD0B 1KENH 1U8HA 1GOFA 3C75A 3L9RB 5ANMA 2NW3A 4WFFD 2VDQB 3W0WE 5DK2B 2XWZA 4ZTPH 3F00A 4Z7QB 2EDXA 3EHBB 4WLCA 1U6AL 3FUDA 4ONHA 4HU8A 4UNVA 4LSVH 2FYYB 2K3TA 3NZUA 4ORGA 4KNTA 1KMGA 1YDPA 4ISVA 3ZIMA 3C60D 3RKDD 2R4RH 4IOIA 1YY9C 3Q13A 3KGRA 1SDYA 2BINA 2R1YB 4YUEL 2YA1A 4RAUA 4CSZA 3I6GA 3BT2L 4Y9BA 4ZUUB 1U8KB 1HEHC 3L3GB 3WKNA 1TJGH 1I9IH 5DLMH 2BP0A 1QR4A 3E80A 4ZXBB 1A2YB 4GAYA 1QFHA 3W9EA 4XPAH 3WMPA 2YSSA 3C60B 5D8JH 4H8VA 4NNPL 3RUGB 4BK5A 1FDLH 4FEMA 1XZ0A 2ZE0A 1N5YH 4Z9KB 1IV8A 4MBOA 1B88A 2D3VA 1UATA 3RJQB 4LAQL 3O6LL 5B38B 2ADYA 2EQDA 3FC8A 1E2ZA 3PWUB 3HS0B 4PG2A 3GI8H 3QIWD 4NQDD 5IROC 1FG9C 3FN9A 2EO7A 3L1FA 1KJ2A 5EV7A 1H8LA 2NOYA 1HDMB 3QVAA 3UAFA 1BZOA 1QFWI 2NY3B 2QQLH 3ZTEA 2CBQA 3QZMA 1IBGL 4L0PB 3QIWB 4XN8A 5F7KC 1MFEH 1FO0L 2YRLA 2R29H 3A4DA 5CJXA 4DP1X 5I23A 4HEMA 4D7PA 2I7SA 3RVXC 4JFEE 4MQ7A 4Y0GA 1YG9A 1TDQA 1RVFL 4FL4B 3BQUB 2GTZA 4NYLB 2G3XA 5DLLA 2ZNXA 1KDIA 2FGZA 3Q2LA 5I74C 3VACA 1TYJA 2Q20A 3HC2A 1HINH 4KMTH 1KENL 1HFUA 2BM3A 3VU1A 4Q6IB 1YY9D 2QADB 4OIBA 2O1AA 1BBJB 4Z95L 3THMH 4N20A 5F89B 2DYPB 1AYRA 3FZUC 1NUNB 1OTTD 2DPKA 3CFCH 5FGCE 2Y5EA 1CU4L 3BYTA 5KSAD 4H13C 5JW4Q 3OXRB 4MZ2A 4DKFH 4AXWA 5JOPD 1T5XB 1H6EA 3QJZA 2GB2A 1LL1A 4NHUA 4H0GA 5FYLE 5I74B 5IGXH 2JJWA 1R3LB 4XO8A 5DC2A 5L8KB 2AHIA 4XNUH 4RX4A 2WXGA 5CEZE 4ZPVB 1HL8A 3T0AA 3OTTA 1IM9A 3GEWB 3TIEA 4HFWA 5GSVA 4FDWA 4ZQTA 1KYDA 2ZKHH 1UC6A 1S5IH 3EW3B 4BDVA 1NGQL 2D7NA 3FONB 2LAGB 2GYSA 3EO1B 3KJ4B 2Z31D 4IHOB 1B9KA 5E2JA 4XPBL 1NCWH 4YK4C 3QXUA 5JPNA 5JQ6H 3P02A 5EH1A 5C0DA 2HFGH 1E50A 4KVCH 3WHXA 2VLRE 4PB9L 4OJEH 2GAZA 2ZP9A 4L8CB 3WFCL 1FG2A 5E4OA 1HI6A 1WC7A 4NFCA 3UZVA 3KLDA 3SKOB 3W1ZA 1E0OB 4LVNB 1B0WA 1UA6L 2EC8A 3ECVA 1A1MB 1G7QA 4AENA 4UM9D 4A04A 2GW5A 1O9ZA 2WWOA 4WU5A 1AQ8A 4MD0B 3MRDA 3BQVA 3BWUF 1MLCB 3LB6C 3QZBA 4OM0L 5G5DB 3IMWA 4N2MA 3B7TA 5AG9A 1GH7A 3UAJA 1YECL 3KGSA 3WFDH 4F7EA 4R0LC 1A47A 4M7ZB 1WCBA 5F3HA 3R1GH 2W07A 4UDUA 1AQHA 4LSTH 5F3FA 1IGCL 2XNAA 3IDNB 2QZ5A 2X2HA 3KBPA 2R29A 4J27A 5C08D 1KPVB 3SDDA 2YKLL 3SZKC 4CVXB 2D9CA 4PJ7E 4PJ5A 4Y5YC 4YHIB 3X2QB 2I9TB 4PJAA 2NSQA 3D25B 4XAKE 1LO2L 2C7FA 3DETC 3L17A 5H35B 3MRGA 3RDTB 5HPOA 1O5DT 2BP8A 1O0VA 2FT8A 3V5KB 4XN9A 3WMSA 1KJVB 1TEGA 5IESL 2ADJA 4Y16C 4GKLA 5LGHL 1BFVL 4G8AC 5C0EB 2ZG2A 4WWKB 2LTQB 1P4IH 3GMLA 2OCCB 4U2YA 1G4RA 3FKUS 3VG9C 1JI1A 1LWHA 4FNRA 2JCCA 2A77L 1ND0B 3L3DA 3VFGL 2QELA 4ELMB 3KDPB 5INDA 1NMAH 5CU9A 5IW6B 4KY1H 3H9YA 2X6UA 4UIMA 2B3RA 3OQ3B 4U6XB 1VGEH 1SGKA 1ROCA 1N2RB 1MHPH 4ZUUA 3ZJAA 1KZYA 2OMTB 1GPOH 4APQC 4G7SB 5I1KH 1V3MA 1A6UL 3WIIL 2E9JA 1EO5A 3IU3B 3BPNC 4G9FE 4EIUA 2AQNA 4HC1H 1TCRA 1FYTE 4L8DB 2NY6D 4BINA 1W15A 2PCPB 4YS4A 1MY5A 5AW4B 4AJWA 3SEPA 4BFEA 2ITEA 3JQOB 3PWPD 1T1ZB 4KITB 2AJ3A 1KACB 2ZOUA 2P80A 3O6KH 2DH2A 4KRLB 1JPSL 2CLVB 5ALCH 1G6RB 2XPGB 4WW1B 4YXLL 4IK6A 3ARBC 4QRSA 4WEBL 3BPNB 4OUOA 5T1LD 3MRCA 3ABMB 2R9HC 2PWGA 4FG6D 4U31A 3O4OB 1QEXA 2VH5H 5E5LA 1QRNB 1ZHLB 5J13B 1BVNP 3SDXB 4LL4A 4CVZB 3LZRA 5IQ9B 3B5HA 4HLZG 4LGRB 4M00A 3PV6A 4RGOL 1XGUA 2ZYIA 4KJWD 1JI2A 3LKRB 3HR6A 4XNDA 5EZIH 4Q9RL 1UXLA 2XN9A 2XYCA 4M62L 5J1SC 3WTWA 4LDCA 1PLAA 4G8FA 1Y7VA 3QDGA 5I28A 1SJXA 4YPGA 2E7LC 2K3HA 1FZJA 1R3JB 4Q6YA 5TJWK 4UTAH 3NFPB 4PVMA 3E6FA 1FJ1A 3IXTA 3ESNA 5KSBA 4LXFA 4G1EA 1IIKA 4XVTH 4RESB 4F1SA 4X4KA 1CGWA 1HVXA 1IC5L 4FFZL 1G9NC 1W9XA 2CHDA 3OJ2C 4KMLB 3RA7H 4OGYL 1MCOH 2YLKA 4QHPA 4LASL 2WPGA 5I8KH 4YSDA 2ZZUT 8FABA 2WTRA 4P46A 1XEDA 5JXEA 4H40A 3EYVA 4IRSB 3FTGA 4MVBC 4NGHH 5I30L 1YN7B 4V1DE 4NUQA 2HT4D 2W88A 2OTUB 2V8MA 5DD0H 5DQDL 3ARQA 3FQRA 2NSMA 3EIFA 4QRPB 3QISA 3GGWA 5MHSD 3ORJA 4DEUA 1FVEB 3T4YB 3MJ9A 3MLVL 1CG9A 3AGWA 3T6ZA 3ROLA 1AS6A 2ATKA 1KNOB 2DI8A 2YMXH 2N0KA 2FRGP 4ONFH 3QUYA 5ABDE 5IJVA 3O2DA 1CJYA 4WU7B 4YDVB 3D30A 4FQPA 2KLTA 1DJXA 2XIBA 4AH2A 2GJZA 4JFHE 5E9DA 1JN6A 3TYGH 3QQ9C 4AT6A 5J8OA 2YN5A 4L29A 4Q2ZB 3P2DA 4MD5A 4ALAH 5E5MB 4OCLC 1U8JA 2YUVA 5JDJA 5C7XL 4Z8FH 1DQDH 4YE4L 5EIIB 5IWLA 2GJRA 4MTMA 1MI5B 5G55A 5ENWB 3BJLA 3FB5A 1HN1A 4MAZA 4FHKA 4UQ3A 4YHPA 5F9WC 2IDUA 2JI1A 3NIDB 4IDJL 4KKLD 4F57L 3AT0A 4M03A 4XOAA 2WLLA 3O11A 5DRWA 5EOCL 2Y1VA 3Q2CA 2XWBA 5F7EL 1IQWH 4Z76A 1E4KA 5FYKE 2BX5A 1BWWA 1A4AA 3FUFA 1EZVX 3LRMA 1BZQK 4XMXA 1KB3A 2BNUB 4ZMQA 3N6YA 2Q7YA 1LYQA 4AMKL 3FB6B 4RGNB 1HU8A 1KWGA 5HTSA 4PRAB 3ZW3A 4WI2A 4JG0L 1TQUA 1WZ1L 4K5LA 1YJDC 2J8HA 3VRIA 1EEQA 1M56B 5IZ7A 3BISA 4NKOA 4PB0L 5E9AA 3DIVA 3KD4A 1ZT7B 5LAXB 2QGDA 2Z91A 1BECA 4LPWA 3IDGB 2K4WA 5A40E 5FF6A 4HUNB 4O2FA 5DJ6B 5I17B 1IZJA 2WVSA 2XWRA 3MACH 3SDAA 1BZ7B 3ME0B 1QSFE 2DEYX 3VXPA 2CUMA 4PJXB 2G2RB 3QC6X 5JHDA 1ZSDA 2CXGA 1FVDB 4D0BB 3BSZL 1RH8A 4G82A 3PRZA 4L18A 1UCBH 5E2TL 3Q2NA 1AH1A 2FH6A 3PNWA 4MRCA 1E4KC 1G6RA 3GK8L 4OJFL 4ZMPA 4U1LB 3KLHC 1UXMA 2I5YL 3MJ9H 3OXSB 5GRUH 4PGBB 3BLKA 2FBRA 5ISZE 4TUKH 5FKAB 4WI4A 4DN3L 3K1KC 3MBED 3PGCA 3LX9A 1I8LC 4YHYB 1DQDL 2IOOA 4NP9A 3GUFA 1D6EB 2XZQH 3C9NB 4UAOC 1M9WA 1MFCH 4WZ9A 5GGQH 3NABH 4EDWL 4GKSA 4LKCA 1IKFL 3CFKB 4OLXL 3WXWL 4JRXE 1IGJA 1EFQA 3DKHA 1GGBH 4MXQC 5IR1A 1LHZA 1N2RA 4K7PH 1IGFH 4PUBH 1R0AL 3S0PA 1MQKL 2CHZA 1SEQL 5FB8B 5CEZH 2AJYH 4ATTA 4IS6A 1BVKB 3H7BA 5AKRA 3DX6A 1CXEA 3GRWH 3C5ZA 3TC9A 2A6DB 5DQJA 1EGJL 3U1PA 3OR6B 1Q9KB 2OZ4A 4E9YA 1ROWA 2QTVA 1VCAA 2WBJD 4FQJL 5E1AA 3SN6N 1WJ3A 3SOBL 3CDYA 2VDNH 1J9CT 1FLTX 2P5EA 1NJ9A 3L3JA 3SGKC 35C8H 5KVFL 5CEYA 2ZKMX 1HSBA 4RGNE 3V0HA 4JPWH 5T33H 1KTJA 5E6ID 5DD5H 3ZTNH 4WUUB 32C2A 3AREC 4JQVA 3I3DA 3KPRD 3T65A 2HJKB 3MGOB 5E1GA 2HH0H 2ICWA 1CG9B 1N5AB 2ZSWB 5E70A 4YR6B 3IGKA 4KXBA 2OR7A 5FCUH 2OCFD 1GCFA 1A6VH 3RFZA 1IARB 2EDLA 3EGDB 3PWJB 3QEQD 1YEDA 5EU3A 3U36A 2P4AB 2GJ6A 2NY4B 3NN8B 4LSUL 5DU7A 5E56A 1X6NA 5GRZA 4DPRA 4Z7UE 2BERA 5K9JH 3TBYB 4PJGA 3KPRB 2GT9A 1KCSL 2X3AA 5EC1A 1AGFB 4FQXC 3PQYA 2HJFA 3MPCA 3WGUB 3GTNA 3MRDB 5G5DA 3WAJA 5HHQA 8FABB 3NPSB 4JKPL 5D2LF 1CLOL 1J8HA 3MV9D 1A3QA 3LS4L 3MRLB 3TO4B 3UGXA 4PJFF 3X14B 3C5JB 4H26A 2A4ZA 3IBOA 1OCCB 3FU6A 2LAAA 5DUJA 4HG4J 2QADC 3NCYS 2YPVH 3KAAA 3ILEA 3PABA 1DZBA 2Y07H 3P4NB 3JTBA 4JFDD 3WV0A 4NPYA 1YY8B 4TVPH 2OPCA 5D7LB 2W5PA 1S7VB 2IV9A 3ARUA 1FNSH 1BLNB 3T2QA 5A6MA 5LBSA 4I1PA 2EJ1A 3DX2A 5L7XL 4EIBA 2XA8H 2ARJB 4G8FB 3WLBA 1T4WA 2W9EH 3EJYC 2WAHA 5IJKA 4X2UA 2DLIA 4IBWA 3KWUA 5IOPA 1BFTA 1CICA 2JXMB 2F58H 3VFOA 1D5MA 3W81A 5BQ7B 4AL8H 5KSVB 4BZYA 1FNAA 2B2XH 3Q8AA 4FMFA 2P28B 5DC0A 3GRWL 4XXDA 2EEFA 5AVTB 3TWCH 5J57B 2NTFB 3VH8G 4AZUA 2Q0ZX 4FQXA 2DQEH 2VL5B 3JUYA 4OKVB 3MRBA 1RK0B 1GGCH 2BSED 2I27N 6FABH 4N0UA 2V5SA 4GFXA 1Y1UA 1YQVL 3TA3A 1AJ7L 3H0TA 2VGLM 4LVHC 1I1RA 1RSYA 2VDLL 4IMKC 3VXRE 2WQRA 4E9XA 1HQRB 3M86A 5LCVA 1BJMA 3UEQA 5IKCA 1A02N 1T0NA 4P49A 3DRTA 4KZCA 1JDDA 3DROB 3HZ3A 4G42A 4WW1A 5AW0B 3PDDA 2W81C 3BVTA 1TJHL 2AEPL 1OP4A 2COVD 2I7OA 4LRIC 2D7QA 4OKDA 5D71H 4ZFZA 4N4YB 2NNAA 2CE6A 3J7HA 1D5XB 4FJZA 4Y2DA 3PL6D 4AYEC 1S9XB 3D8MA 2AJ3B 1DBKL 4RZKA 1MCLA 5DD6A 4ILDA 3U6RA 5C8JB 4XH2A 3AREB 3MN8A 3MYJB 4HA1A 1JYVA 4GSRA 4X5RA 1OT1A 2MTPA 4Y1TA 1LWRA 3US0A 3BKJL 3B9DA 4J23A 3LZOA 5DMIH 2PYEA 3VE0B 1TUPA 3MRKB 1JZJA 5E2VH 1W0WB 4YGVA 1ZXQA 3FTXA 3LD8B 1KGUA 1YMMB 3O45B 2A9BA 4X6EB 2QDWA 4P3CH 1X5MA 3E0GA 1I3RA 1BXVA 4PG9B 1QSFA 2WUBL 4L4JA 1ITCA 2Y24A 3BAXA 3VO0A 3LHAA 4XPGH 5B39A 2PCFA 4NP4L 3G5YB 3WG7B 4HCGA 3S2AA 5GS0D 1OSEA 5E2UL 4WNQB 3CXDH 4LVEA 3SE9L 3O0RH 1M1XA 4ABUA 3KVQA 5C0EA 2MTAA 1Z1WA 3FYEB 1XFPA 2UX6A 3ZHDA 3TOPA 1AY1H 3IJYA 3D2UD 3WFCH 1GAFL 2R1YA 2NW2B 3UP6A 1AQDA 5HGAA 1AHKA 2X6MA 3AB0B 4FS0A 4BZ2A 1FZKA 4PJ5B 4HV8B 3VI4E 4QMEA 1Q0XH 2MCAA 2DLEA 1I1AA 3MODL 5D1XE 1QR1B 5LKNA 1DVFB 2AMGA 2FJGA 4PWJA 4UDUB 1WDAA 3CPUA 2XNAB 5AB0A 1IQDA 2FWOA 3D2UB 4KFMA 1UWFA 2E5EA 3FH5A 3TV8A 3U7YH 5HDQL 3D0LA 1X5IA 1FIGH 2DJUA 3D51A 1VFBB 6PAZA 4TL5A 3EYSH 3UO8B 1YSOA 5KVMC 1OGTB 2ITFA 1TFPA 2EIJB 4XB3A 5DEFA 3RPBA 3ZL2A 4DGIH 3GSNL 3NCWA 1RIUH 2X4PA 5DC4B 5MERB 3ZLQC 5KBDA 3MXWL 5ESAA 3K6OA 2EH7L 2XG4A 1GGTA 1ACCA 4M5ZH 5IMLB 4GP4B 1COBA 4KUCF 4MBRA 4XTRD 4ZAKA 2F19L 3QJQB 2PO6C 4CKVX 3HHSA 2B1AH 2JCWA 4P2YA 4R90L 3WHXB 2BOLA 4RISH 3EYFA 4K5OA 3VWKA 5E8NB 3PJNA 3VNZA 1OB1B 4OZGA 4UM9B 4FA7B 5ICXB 2PN5A 2DQIH 2VJXA 4AY0A 4YR6A 4KI5C 1IKOP 3L81A 2SEBA 4AYBA 2EXYD 2QSQA 4YL9A 4M1GL 4CA4A 1X5ZA 1P7KA 4OJCA 4C47A 3KDMA 4MJ4A 1E6JH 4PJEF 2L8AA 3D69B 1UOVA 3SBWA 4W81A 2ARJA 4HGKC 4ZS7L 4NQTA 4HPHA 2IH9A 3N43F 3IJYB 4NUJA 2PO6B 3L4UA 4JO4H 2KPNA 2F2HA 1N59B 3N42B 5EO0A 4N2KA 5I1KL 1L9SA 5BO0D 2DLFL 2A3TA 1DJYA 4PJ7A 3CVIH 3E1ZA 4OTXL 4OVUA 2VR9A 3EGSB 2C9SA 4I18C 4WSJA 2CR6A 2GHWB 4PJAF 4BYHA 1W8NA 4OCRH 3GIVB 5KVGE 1I3RB 4FFYL 4G1MB 3OHXB 5BRZB 2YUWA 2YD9A 1QSFB 1JWUA 3EGXB 3UBGA 4W4NA 4M1DL 4MJIB 1PMYA 2GSGA 5EEZA 3JT2A 2L3BA 1ZGLP 5DZ9A 4XC1H 1C5DA 1UWGH 4FQ1H 3KPSD 1M05A 3D18A 4W9GC 2BNQB 3QO1B 5E9NA 2X41A 3CFKA 3VB8A 3CSGA 5ALCL 2HX9A 4X7FC 1MRCH 1S6NA 5BRZD 1MCSA 2EXSA 4X4MA 4GBXA 4F2FA 2IDFA 1L7IL 3PWNB 2JWYA 3AB0C 5C8JA 4OGZA 3DI2B 3ZTDC 3IDXH 1E7UA 3TJEH 4D3CH 5SX4I 3MLXL 2CCLA 3D52A 3FQTA 2DWSA 2XG5A 3OAYH 3B6SB 4O4YH 3WO4C 2WWMD 5DT1L 2R0LH 2XN1A 2WCGA 4N0UE 5A2LH 1L6PA 2G2RA 4PN6A 1HSBB 5JHDB 1DSWA 2CO7A 3VWJA 3NZ8A 3WJJC 1A6WH 3GKWL 2ZYHA 1BFSA 1N7ML 2OX5A 4MMZB 4RH4A 1KYOJ 4YFDB 5I9QB 2I32A 1HQ4B 2NXZB 3JVGA 2LABA 3HNTH 4XNMA 4EUPB 1N64L 2BLFA 4GRLB 5C0RL 1WYJA 2IAMB 1ZLDA 4X8JB 5E94B 1B4LA 2YD0A 4D9LH 3L5WB 4XZUB 2YK1H 2GY5A 4QY8A 1KIQA 1JPFB 3T8VA 4EUPG 1J0JA 1P2CB 4LARL 3RX5A 1J5OH 1CICB 1XL6A 4RRPG 1E2VA 2BFVL 3NIFB 4HIHB 1MVYA 4JX0A 4QHUA 5EF3A 1TZIB 3WUZA 5HVHC 3WNLA 3WL9A 4RFEA 1AXSA 4DSYA 5JXAL 3LEXA 3E6HA 4JHBA 3FBKA 4BWUA 4TNFA 4Y19A 5E4IA 3MA7A 1THAA 2ED8A 2TSBA 2ROYA 1OSZB 4HEPA 3PWVB 1SHMA 2EDQA 1D9KD 3A3YB 5I1LB 2VDML 2R39A 3PABB 1PU0A 4GIPD 5TE4L 1HYSC 5CKGA 2NNRA 2VLKD 4Y4FA 1B0GA 2NNFA 3A21A 5GZNC 4L3EE 2UY7A 4A68A 3VWJC 3WJJA 2BHUA 5GJSH 1XGYH 4WHTA 4XVJL 4E9TA 4M29A 2CK2A 4J28A 3RUGE 2MRYA 2H26A 3A4EA 1M6OA 1I8KB 1TFHA 3TZVA 2ID5A 2PABA 3CFNA 1IBHA 2IDSA 1IU1A 5D9SB 4QNPF 4K94L 2IMMA 2N0MA 2Y5TA 3EOAB 3OKLB 2ERJB 4FN0A 4PJGB 1E3XA 1G1YA 3QXDA 5CSGA 3REVA 2BVPA 1FE8H 4KTDH 1ZVHA 2WKOA 1U2YA 3NZHH 4PREB 2QKIB 1TZHB 2J8UA 4Y7MA 3ZDXE 2FBJL 4W6XB 3OVUB 1BIIB 3FULA 5KN5B 1NDGB 2JK5B 2YEZA 1DN0B 4NS0A 5I71B 5TE6L 2BSEA 1WE5A 2DM7A 3UEZA 4HJJH 5HXMA 1XIWA 1T89A 3OLGA 3GI9L 1X9LA 1KB9J 4HUXA 4HKJB 2VDKH 3L5IA 5FYLL 1PF3A 2BIOA 2Z4QB 2E56A 3Q01A 4Y4FC 2X4TA 2BPBA 5ID1B 1U4EA 4XMPH 1ADQA 1OKEA 2VR3A 2X4UB 3DVFA 2CKBL 5GIRA 1BA9A 2BSTA 2FJHA 4KRNA 2GSIA 1V54B 1INDH 1DSYA 1YYML 2GBUA 4XB8A 1VFAB 4UTBA 3VD0A 4IKJA 3HPJB 1N26A 2ZUTA 4XP9L 1JWSA 2XTSA 1O5PA 2NXZC 2Z34A 4KGJA 3RY6C 1WV7T 3CFDB 1MI5D 3OKDA 4UTCA 5KJ4A 3T0BA 2Z3FA 1R3KA 5MENA 4YDZA 1EHKB 2ZAIA 3BLBA 2VYRE 1FAIH 2KKQA 4BSJA 2A6IA 1AO7A 1PDKA 2K9UA 5LNDA 2RALA 2G5BB 5EZOH 4HXBL 3W9DB 3QJSB 4YH6A 1TZOA 2ZUQB 5KJRH 2C1PA 4YHLL 3ULUE 2ZXGA 3JZYA 3QNZA 1ADWA 3OKEB 1CF8H 4Z78B 1A4CA 1J10A 1XGYL 4P59L 2A0LC 1FFPB 2AFNA 2MQCA 3MOBH 2ZCLL 4ZFOB 3VQ2C 3VRJB 3AT8A 1AGEA 5F7LB 4DKAA 3EJYD 4HH9A 4CN4A 2XOTA 3WYRA 1ETA1 5IK3B 1I3VA 1LK3L 4ZSOB 4NGHL 4NQCD 2Z35B 1YUHB 2ICEB 4FHBD 4X7SH 5TPWL 4BQ6A 1T04B 3IEAA 4YEFA 5GRUL 4HZLA 1DE4B 3DV6B 4CRPA 3NZ8B 4DK3A 2K4AA 3VVVA 4ZQKA 5B3SB 1G4MA 4YDIL 1JZ3A 3QJFB 3LN5A 4M7LT 4U6YA 2GBAA 4AGPA 2WZ6A 4EVNA 4Z7OF 5IHHA 3EBGA 1RLBA 3NABL 4PP1D 4ZNEE 3B8SA 3UBXA 1AGEB 2Q2EB 1KFGA 3QUGA 4F7CB 1NBCA 2WVUA 3QEHA 4OJAA 2KZWA 4GUPA 1DQQA 3UAEA 2EDBA 4Z7UF 2CDEB 4OH2A 4F8TA 2UZYA 3L7FA 2G2PA 4ZXBC 2QMKA 4FXGB 4DP5X 1HZHL 4Z3GA 1HXYB 4FQHB 4WWPA 4TL4A 2J3SA 1TTBA 3FT0A 3WIHH 2Z93B 3FSAA 5ICZB 4WENB 5FYJL 3Q06A 5D7IA 1GYCA 1MCJA 1TPXB 1R9FA 4HLZH 5BMFH 2NZ9C 2YQBA 2BW4A 3LNGA 1TIUA 4H44C 1GS7A 1I8UA 1P2CA 5D72H 1OP5K 4L1HA 2PXYB 4MDJA 4ZFOL 2KQNA 4K23H 1A1NA 5LGJA 5D1XC 2ZUVA 5EUOB 5BRPA 3P0VL 5LXVA 1IBYA 3BAEL 1JF1B 1HYSD 3CZKA 1CFSA 3J27A 2N56A 3WEXA 2A9ML 3AWFA 3DHUA 3OZ9H 4P57A 5L4FA 1XBRA 1SJEB 3K72A 4UOJA 3V6BR 5JW4R 1LO4H 1NC2D 2NYZA 2VXSH 4G9DA 4NZUL 4BSWB 5IMMA 2GJ6E 4JPKH 1JN6B 1GA2A 4JM0A 1OM3L 1SXSA 4A7QA 2YJLA 4I9XA 2G4EA 1YCSA 4ZFFB 2YGNA 3QR1A 1CDJA 3AY2A 4PVLA 5FC9A 3EDDA 2OV0A 5DZAA 3B2UC 3HUJA 3PFQA 4HK3J 1G7LA 1TU2A 3KVDD 1BIIA 4Q9QH 3U7WL 1P5UC 4OFDA 2CR0A 4PJFA 1SOXA 1M7XA 3S3SA 1HEZA 3QH3A 5MEPA 1XCQA 2OJZL 5DJYA 2X1XR 3ISRA 2OQJB 4ZUSA 4F2EA 2AK4D 1J87A 3MJGX 4WUUD 3VDBA 3VFPB 4ZG1A 1ET7A 2YPVL 3JWOH 3V0EA 1HH6A 3CFJB 3BVUA 3O2DH 4PRPD 5EZPA 3L95A 2AEOA 4JE4B 1T22A 1BAFL 2UXGA 2IWFA 2VR6A 4KDTA 4NZJA 3ZHKA 4A1RA 3K2UL 4G8EA 4AYDC 2DQGH 4UB0L 4C4UA 1ULVA 4P9HH 3G08B 1ZHNA 3HE6B 5FYJD 1BPVA 1X3DA 1K8IB 1GCYA 3SJVB 3BVNA 4M93C 5FGCB 3MNVB 3VFRB 4N2BA 4JAMB 5B1BB 1U95A 3CDZA 2A4EA 2BXZA 3CCHB 4QAMB 4Y7OC 2A9DA 1XGZA 2XY1A 2ZWYA 4Y1SA 1TQBC 5HYFA 2B08A 3BPCB 3KYOA 3V95A 2B2XL 3TWCL 3JT0A 2I25N 3C5SB 5H37G 5HPMB 5F6IB 1INQA 1RZ7H 3SJVD 5LVEA 2AV1A 4KTEH 2KUTA 4CDHA 1U3HA 1SJVA 3RL2A 1OZTG 4W9EC 1U8PB 2W59A 3RDJA 1GS8A 43C9B 1GYUA 3LH9A 3D0AA 3DPBA 3UZEC 3PE9A 4F91B 5D7LD 4XWGH 1HX0A 3C5ZD 4X8JA 5E94A 1O6TA 2X4UA 2IAMA 5LB1A 1ZHKB 1QFWM 2PW2A 3BVVA 3GS0A 5CEXA 4XMWA 2FB4L 4KZEH 4FG2A 5AEAA 3DTUB 5DD3H 3KPPA 3V79C 2O5XH 4MA1C 4MX7B 5EF0A 5IIEA 2J71A 4WJ5B 3V4PB 1A7PL 2VQ1B 4GNKB 1I75A 3G6JA 4S1SL 4NQEB 2AZUA 4UT9A 1NOAA 3EO9H 4QXGH 5IFHH 1U93A 3LDBC 2YEZB 2BSRB 5ACZB 1WAEA 4F27A 1ACYL 1HHIB 1QLEH 1T20A 4FNLL 1ID2A 4JFUA 4MA3B 3VSVA 1CWVA 4YEEA 2OL3B 1QTYT 3GBMH 3OM3B 3OL2A 4PRDB 1GYVA 3RDTC 4LT7A 4MZRA 5JZ7D 4CDGC 3D9AH 3D6GA 1AC0A 5KBMA 4YPJA 2IOMA 4YDKH 1M6OB 3PJSA 1OSZA 4YQXL 4OSUH 3LSOA 5IEKB 5F3BB 1XH2A 1KC5L 3UZEA 2BSDA 1P5VA 5E2UH 4ANKA 3TBCA 2WMPA 1EJ6A 3LS4H 3ZR5A 3Q2WA 4HV8A 5FHBL 3WGVB 4XO4A 1G7IB 1EBPA 2DQTH 1F3JB 1UZ8B 1JRHI 1RULH 2X1QA 5C0BE 4Z7QE 5AAPA 1MJUH 1PG7L 2OTPA 3OKOB 4FZEL 3GBDA 1CE1H 5SWZA 4WO0A 1JGUH 3BAJA 2ZKHL 3NIGE 4AVJA 5HHPB 1P4LA 1QEWA 1HKLL 5ESQB 5IFJA 4M8VA 3LS5H 1KCVL 3G7TA 3QJXA 3ULSA 3GZQA 5FDWA 1E5BA 1G9ML 1IGTA 3HJ0A 4N2CA 1BZEA 1K5NA 3QQ3A 4ZW8A 4FXGC 4KJQC 3T3PF 4JVPA 5J6HA 1JV2A 4PVBA 3C2SA 1NWOA 3V5KA 4B9ZA 4KO6A 4XOCA 4JGNA 4X6EA 3MRGB 1ZJBA 4K9EH 4NKMB 3RDTA 4AL8L 3ULUC 4TUUA 2J5LB 2NX5B 3APCA 3UTOA 1WA1X 2VITB 3SPGA 1E6OL 3IDIA 3IGLA 2QVTA 4ZMXA 3LQZB 2V0AA 1TZAA 4IKNA 3TBTA 2TRYA 2AJZA 1FV1A 1T6VN 2HLEB 4TQPA 4X99B 1N70A 2DIAA 5F97E 3RNQB 4DVRH 3G5ZA 4NQXA 2IH8A 1RPUA 2NPLX 4WWNA 5DZPA 3SBRA 4BFOA 1CMOA 5JOFB 1U92B 3MV7E 5IY5B 1BX2A 1Z32X 4GKNB 2IANA 5EG6C 4EIGB 4ZMNA 4KROD 3BKML 1SEBB 5E8EA 3K4ZA 3VFNB 4ERSH 4NN7B 5HGGS 2A9AA 3ECQA 1F58L 3MC0A 4OI9A 4UT9H 2VN6A 4ZMOA 1AG0A 4B5EA 4EN3B 2WN2A 3I02A 3U0PB 3VI3A 3BIKA 2AJVH 4JE0A 5I2IA 5F1NA 3T8XA 3V4PA 2NXYB 4X99A 1V8HA 5AAMA 4LSRL 2ZUQC 1KCUL 4YFLF 3FUMA 4HUKB 3QIBA 1EEZB 3BP4B 4DH2A 4Q6IC 1OAKH 2E7HA 4EN3D 3MLRL 2VM9A 1E5CA 1KV7A 4BKLA 4PV1C 4TM9A 3IXAA 5FHBH 1C5BL 1YN6A 2PTTA 5JIKA 2ATAA 2W0LA 3GMQA 1O9VA 4YBQC 4B9YA 3QWOA 2CJSA 1T21A 4L4VA 3HNSH 3BO8A 4K7PY 4J2QA 3LY6A 3GUTB 3VX1A 3TIEB 2Z7ZA 3BVDB 3RJOA 4AE0A 3WY3A 1JGDA 2F8IA 3I50L 5H37H 4DP0X 1HNGA 2EILB 3X3FL 4W70A 4JHZA 2K78A 1AIZA 3JTSA 1CE6A 1SMOA 3IF1A 3NACL 1EVUA 5HPMA 3G5YA 1YRKA 3VVWA 3TCLB 5C0AA 1JERA 4MNHB 1S9YB 3CN0A 1N0LA 4HC1L 5SX5K 4XGZA 2Q3ZA 1MCIA 4NQCE 3D39A 2YD7A 2F7PA 4I5BB 1SMDA 4L05A 4OD3H 4JAMA 3TVMC 2HXAA 3EH4B 1A14L 1T21B 4XXWA 3EOTH 2FTAA 3HJEA 3L08A 1CFNA 5EU5B 2HN7B 3IB4A 3TTYA 2X44D 1T0MB 3MRLA 4KAQL 3QIUC 4YHOH 3ULUH 4QRRE 1NFAA 1VLXA 1DJIA 5LBVA 3TBVB 2EC9T 3I74A 5E1IA 5KAQF 1YZZA 2VC2B 2ZYRA 4PV8A 3STZA 5E8DL 1MCHA 1JXJA 2Y25A 3SQOH 5I2IB 2D03L 4QI3A 5K5YA 2OMZB 1NGYA 2FATH 3FHAA 3ULVL 5IB2A 2X4SB 1FBIL 2VLJB 2X09A 1HL4A 1Y6KR 2N3JA 4C56D 3CLFH 1MHCA 5BV7H 1ZVNA 1N5AA 2ZSWA 4XNZC 4CMHC 4Q8BA 4YSPA 1HHIA 1UZGA 1AHMA 4R4FH 2D7TH 3UC0H 3DYMA 1OAZH 4X4ZA 2AQ1A 2OL3H 3B8YA 3W39B 5BZDB 2JKSA 3MBWB 2IQ9L 4Z95H 3NCEB 3RWIB 2VQ1A 3FK3A 3MUZ1 5AOKA 1NCCH 2BVQB 3IMUA 4GAGL 4GRMA 5KG9B 2E46A 5TQ0L 5G4OA 1BP3B 5TH2B 4GAAA 4UTBH 3SQRA 3F7LA 2X28A 2O6EA 5TDNA 4DUXA 4XCCL 1PX4A 2KQMA 4NT6A 5F9OL 3FRPA 1JGEA 4B50A 2WLMA 4C83B 4AQAA 3QIUA 3CQFA 3U0TB 4NKOB 2WSPA 3OKKA 4AIXA 2F54B 4FF9A 3EZ8A 3QQDB 2QV4A 3FQ1A 5DWUH 1H3PL 4M6OL 1JPST 2K1MA 1CL7I 3OKNA 4NJAH 4DO4A 5ESVB 2X70B 4AITA 4PRAA 2KZBA 1FNGB 1HWHB 5JDSB 1HZLA 1LP9B 2Z6FA 4HIIA 4FCAA 5IQOA 5BOJA 3GLDA 2W65B 2YGVA 3CSTA 2AV1B 5A6LA 5IROD 1CFQB 1GSMA 5AAWC 3OQRA 4R7VA 3CVIL 3BRFA 3G04B 4KJQD 1Y0LB 2CIKB 4K2UL 4MCYA 4PB9H 5SX5H 4MXWL 5H37A 2M8XA 1BVNT 2NQDA 5AVRB 1EA9C 4FFYH 4N9OB 3MKKA 1JVKA 3FB8B 4AVIA 3KVPA 2D73A 3IU4L 1DQQB 3ARVA 1XXDC 3HB3D 1KLGB 3FU5A 2B7DT 1SDAB 2E4TA 2YAHA 2CO4A 4H4NA 2K0RA 4YHMH 2IXQA 4YXKH 3RFRA 5KUKA 2QVFB 4L5FE 5EIIA 3GHBH 5CS7A 1E7VA 2VUKA 1TETL 4ZFGH 5ILTH 4JHVA 1MCBA 2ZD0A 2CA4A 4LNVA 2DBLL 4IKIA 3WE1A 4B7LA 4RRPM 3IT8D 4K3DH 4PGZA 4NQDA 1JZ6A 1HEZB 3KYKL 5MEPB 1N19A 1RP9A 1HCFX 2UUDK 2IPKA 3ZE1B 4JGUA 4IGBC 3RVTC 4G7QB 1JZGA 3FU8A 4JN2B 5CP7B 1IC7H 3AS2A 2D7TL 2VXTL 4PGEA 2GEQA 1RUPH 1ZT4A 4M43L 1PLBA 5AAWA 5SWSE 3DPBB 3TN0C 2GC4C 3ABZA 2OYMA 5IW1B 2WWMC 1TEYA 4M6NH 4W68A 5CJOH 5HJ3B 4YZFE 5LG6A 4OB5H 3EH3B 1OAXL 3NBNA 2ITDB 4L5FH 1Z0MA 4RSVA 1H8SA 3HC4H 1UJ3B 3P3TA 4ZUTA 4C56A 5CEXB 3MLPA 1A3ZA 1MJ7H 3MXVL 4IOSD 1YNTF 1MWAA 4HJEA 3DX6B 3TO4C 3PGDB 5BQ7A 4A67A 4ODUA 5CD5C 2HSIA 3DC0A 5DFVC 3ZBMA 4WW2F 5IEHB 1CDHA 1XF2A 1DUYB 1E27B 4XPFH 4N9GB 1IGML 4U1IA 4FQ2L 2IG2H 1VRSA 2ATPB 5GGVL 3RIKA 1AZCA 4Z3IA 1ZTXE 5KBKA 5KZCD 1F6LL 1XAKA 3QCTL 4M3JA 1HNYA 4XI5D 4Y4HD 2BNQE 3BZEA 3LH2H 1KJ2L 2PUQT 4GI6A 2EECA 3NJXA 5D70H 5ITBH 4L4TB 4Z7OB 3IN2A 3CDZB 5FWQA 1Z9LA 3CZUB 4L4VD 2W60B 2XN9B 2GJ6B 2LV4A 3NN8A 1F18A 3TN0A 4X6DE 4ZAKD 4ZO9A 3LRLA 5AB1A 1A64A 5I75C 1DVUA 1YLBB 5CWSA 3GC3A 3GJFH 2W94A 5C09D 3QZWG 1OPGH 3VSQA 2XN0A 1UACH 4QCIA 3L2MA 4X5XA 3CFEB 3GBLA 4TSAH 4BH7A 1NLBH 4DVBB 3JWDL 4ZFFA 3DA0A 3RNQA 2G9HB 2GUOB 3VG0H 3VXSD 2BIHA 2EXYC 3WJMA 3GMRA 5EOTA 3JV4A 2R56L 2Z92A 4J8QA 2Q8BH 3HE7D 2AKRA 2JMRA 1C8QA 1YPZA 3MQIA 4O2EB 3ZSTA 5TGBB 1E43A 3DK2A 4LCCC 3TURA 1S9KC 5FK9A 5I6MA 4FFWC 1AS7A 2MHAB 3ROOA 4JFTA 1ZT7A 1GGYA 2KYIA 4PBWD 2I07B 2DDQH 3QDMD 2G5RA 3AG1B 4ZFOA 3TIDB 4JN1L 5FUZH 1T1ZA 1CT8A 4F8QA 2C8NA 4M62H 5BOPA 3TJHD 5E0FA 3SD5A 5MEQB 2I9LB 5D7IB 1SEQH 3CC5B 2YD1A 5ESQA 2ED9A 1RXLA 3U30B 3IBEA 1FHNA 1ORQB 2ZG3A 1EDHA 3QORC 2CKNA 1I7UB 2CLZB 3MV8B 5E6IA 1ZGLM 4YFEA 1FF5A 3SBPA 1HSAA 2UUDH 4Y16A 1ESOA 2V7HA 5J1AB 2IG2L 2MCG1 2HJLA 5BVJA 2FEJA 1PLGL 4ZOAA 3O4LA 2GPZA 3B2DC 3HPJA 4UM8B 4GUPB 2K9FB 5CILL 3T4AA 3F7RA 4M7ZC 3X11A 1KLUB 3D05A 1T7YA 4JL2A 3GKZA 3MZGB 4GSQA 1ORSB 5IQ9A 4Y8DC 5MI0B 2QPFA 3TL5A 1BG1A 1DYZA 1N8ZA 2B1OA 5TD4A 5KVDE 1WS8A 5IHWA 4YMPA 5FCUL 1M7IB 5DD0L 4UYQA 1G9EA 1KEMH 4HFUL 3KGTA 1PFCA 1DBJH 1WT5C 2ARWA 4LVNC 5EOTB 2BOBA 2F1BA 1R5IB 5D7JD 2YBRB 3H54A 3NFNA 5EUKA 5B3NA 2EKSB 1S5HA 4APXB 1H3GA 1BOGB 2ATKB 3RVVC 3K2UH 2JKWA 4PJ9D 1F41A 3L9BA 3P4MA 4UMGA 2WLHA 1QSEA 3G6JB 2F5BH 3LKQA 3RL1A 2CUAA 1I31A 1N0XL 2VZSA 3L3KA 4FQIL 2W07B 3QORA 5D7JB 5HGBB 3ZE2B 1I53A 4JW3A 3IDMA 3HE6D 4OZIB 3QI9C 1WWWX 3CU1A 4OAWA 3S9DB 3Q8EA 1IEBA 1O6SA 3PUCA 3MA9L 4PJ9B 5K9OB 3QQXA 3EYVB 4IRSA 5KJ7E 3CGTA 4M02A 2H0PA 1IL1B 5E1HB 3IJHA 2C3WA 3HC3L 2Q76B 4IBSA 2XRAL 2IPUG 4J8RB 5ES4B 2HN7A 2G30A 3AACA 4OQTH 5BW7C 3AS1A 1S7TA 1JUFA 2W9EL 4LKXA 1U3HB 1XSOA 3VGEA 4PRHE 1NQBA 3O9WD 3QDJA 4PPTA 5C2UB 5JQIB 3NSJA 1IM3D 2NR6C 5C0JA 3WNOA 3BZEB 1PJ9A 1RURH 1L9PA 4HK0B 3DO7B 4PIRF 4JKMA 5FFOA 2DYSB 1MAKA 3DDFA 4L29B 5BJTB 1S7XB 4J8RA 4N9GA 2MQ0A 3BAKA 4RGNC 3VYOA 4JFDB 3QK0A 2D31A 2ISDA 1FNHA 1ECYA 1MW2A 3QI9A 2Q3XA 2PTTB 4I48B 3QFGA 4K71B 3QDGD 2GUYA 1MHHB 5ADOH 4ODWB 3FCBA 5HI5D 4IRSC 4Z77B 3QUHA 4X6BA 1RZJH 3BAYA 4YO0A 4QHKJ 4JFOB 3RI5F 3GBML 3B1TA 2PCYA 2BS9A 3FCGA 4J6IA 3TCXA 5IBTH 1JVLA 3Q9QA 5JW3L 3D9AL 2WD0A 2CWRA 1S7QB 2NQ3A 3ML9A 4R3SB 5JXEC 5HHMB 3ATAA 4R2GC 3UG3A 5IW3A 4UV7H 4AENB 4NUMA 1S78D 4GQ9L 4L3ED 5I0DA 4LOEA 2WANA 4F33A 5DJDB 5DFWH 3HG2A 1U92A 4AK1A 2ORBL 4JQIH 3PGFH 3KJ4C 2WSDA 4JGMA 1PX8A 1K5WA 5KYYB 4BFKA 2P8MB 1YEHH 4JFZL 4KK8C 4KC3B 4N8CL 5C9JA 5J13C 3QRBA 2V8LA 4DETA 1OTUC 5JIPA 1YYCA 3G04A 1NCBH 4JY5H 3GIZL 2DQGL 4UB0H 1S7SA 1IKFH 3P3UA 1XGRB 4PH8A 3ZDZB 1MCNA 5T1DL 2XVKA 2BIQA 4O02L 2J1YA 3NMEA 3P30H 4OFYA 4NZRH 1GGIH 4XBGA 4JHAL 3D06A 3O9WA 3LNIA 4LOVA 1OTSD 3GIVA 1N6QL 1DANT 1IUZA 3U4KA 4P4KB 5AZ2H 4YSSA 4K9EL 2EEDA 5JHDE 1K5NB 3U0TA 2IANE 1Q0XL 2ZUWA 3SCMD 2W0PA 3VXUA 2EH8L 3QZLA 4F7PB 4EZLA 3C2AH 4IJ3B 2CCWA 1U8QA 3KH3A 1BVLA 1XH3A 1PQZB 3IRPX 4F2MA 1UT2A 2YD2A 3ZRCC 2R23B 4MJ2A 4N24A 1C16A 1CD1A 2APSA 3WN5B 4OV6F 1DO5A 4PJ8B 2A5UA 4U3SA 2JIXD 3UBXB 3H55A 4PGEB 4FP8H 3KS0H 5DFAA 3DMMB 3HBGA 4Y5XC 1YJDL 1B9ZA 4NNXA 4TSBH 4O58H 1HQ4A 2WQVA 1ZLVH 1OB1A 4OZGB 1TITA 1EUTA 3GEFA 1WZAA 3W2DL 1NA8A 2N01B 4OFYD 4CBPA 1RY7B 4ZYKA 3RP1A 4C55A 4PJ5D 5KTEL 3DMMD 3KEDA 2IXQB 1YEFL 4K3EL 1IAMA 1U8HB 4KKAC 2BIIA 1NL0H 2I24N 5JIQA 4X6CA 4XVOA 4YSQA 2BIMA 4P23D 3K5RA 4MJ6B 3EFDH 2H0JA 4KPHH 4WI5A 5EU5A 3KJ6L 3OR7B 4F15B 3E3QC 3A67H 4KZDH 1UB6A 2CXKA 3L54A 1TTGA 4NQSA 4RBPH 1HQRA 3D0LB 2ZQKA 4HGWB 4XP5H 4P3WA 1IILE 5EFIA 2VW6A 4DEPC 3LRKA 1V7MH 4XPTL 3E9UA 1WS7A 5JPNB 3FU9A 3QC5X 1YC8A 4G72B 3RVXD 3I6KA 2ZUSA 4A7GF 1OGPA 3Q6FB 4UMSA 4O02H 5GISH 2FX9H 3FT4A 2R2CA 4GAYB 2FQEA 5ESVA 3GO1L 4XAWH 2IADA 3BAWA 3FL7A 3TS8A 4F15C 1W2KT 4JANB 4EPSA 1K6QL 3ETBF 1LE9A 1ML0A 1MW3A 1CXFA 1NAMH 2PKDA 3CLWA 3EOTL 4ZTOH 3SODB 1M2VB 3MDJA 4IOIB 3W11D 5TF1L 4P2OC 3PAYA 4PV9B 4MA8H 4RGMC 4E2OA 3MU3A 5D93B 3WTTA 5HGHB 1EEZA 3T09A 5JORA 3DYPA 1BG9A 4PJ9C 4QRQA 1WAAE 1DDTA 4JFQA 4U3HA 4BZ1L 3SQOL 3H42L 3ZZSA 4Q7DA 2I69A 1JGLL 4XBEH 2AEWA 1FGNL 2N7BA 1FBIH 2XTJB 4TVPD 2DI9A 1CYWA 3I6LD 4G8GD 5BZWB 1IGCH 4MS8C 4D3CL 3B9KD 4KI5F 4O2CA 3KPLA 5D71L 1NMBH 2EUWA 4U1NB 4PY8J 2X4SA 3EDFA 3BQUA 5D6DA 3GSOA 4PW4A 4HIEB 3KLQA 2MOGA 4PJHF 2R29L 4WCYH 1EBAA 4PJ8C 3AREA 4JQVC 3VMOA 1C1EL 3GKWH 2LQRA 1RHHA 3V8OA 4Y9CA 3GHPA 1SFDA 3B7SA 4FX5A 5FFGA 1D5XA 1YEEL 1PYWA 4Y2DB 1FQ9C 1G1CA 2EIZA 2E6PA 2FECL 3SPJA 1RZFL 4LEOA 4PLJC 4HUCA 1MUJB 4I85A 3VFGH 1XF3B 3KJ6H 3UPRA 5C0AE 3GSNA 2H2SD 4LSSH 1T0NB 3BUQA 3AXHA 2EACA 5DDHB 1K8DB 1JV2B 2X0UA 3FQUB 3UO1H 4L0YA 1J0HA 3GSVA 2BZDA 3HHRB 3ESPA 4LFHG 5DO8A 2VM4A 4KJPD 3M7FB 1NFIA 1SYVB 3LQAL 1EFXB 2FAUA 3QXTA 4Z3JA 2X3CA 1DVTA 2DIJA 4YC2C 2Q2LA 5DVMA 4RCAA 4FXKC 1CQYA 1XQ4A 4OJYA 4J3OF 5BJTA 4PJDE 5IVXE 4MVBD 3QA3B 1IO4C 5I15L 2BW5A 3NP3A 3RWJA 5TE4H 2FD6H 1YEGL 4FFWD 4J3OH 1ZTMA 5GGSY 5IQ7H 1CI3M 4CAGA 4QRUB 4KOCA 4ANUA 4O02A 3SPIA 3GBEA 4S1RL 5DGQA 3UTPD 2EIMB 4OCYH 3KYNB 3HNVL 1XGRA 4K4KA 2ITCB 3R06A 5JQ6L 3U7YL 1V7NH 4UT7H 4G6MH 2FHBA 3PAVA 5E6RB 4R4BB 1WUZA 3FXIC 3O81A 1Q9LB 3SKNA 2AEQL 1FGNH 3ECBA 4NO3A 3I84A 1AD0A 3STBA 4JR9L 2E75C 4XNYL 3BJ91 4KAQH 5L6YL 5FA3A 1FI8C 4XVSL 4YAQA 1RZPA 3GRBA 4DGIL 2HMIC 2EIZB 3TEWA 3CFTA 1B4TA 3VQMA 3P73A 3DX7A 5JUEL 4OZIA 2C3HA 5DSCB 1NGZB 2P8MA 4ANWA 1E8ZA 5IIEB 3PWPA 1KPUB 2ZXBA 3ULVD 3ULVH 3OWEA 1OAXH 1HH9B 1ZHBB 1OZUA 3MRBB 1MKFA 2FQDA 5EA0L 2AJXH 2BNQA 4KXDA 2LLGA 4ODWA 1FL3A 3DOSB 3EBHA 3NRFA 3K6IA 4RMRA 1E40A 4TQHA 7PCYA 1VPOL 1KGCE 2OP4H 3K2KA 2WN3A 1LO2H 2WLNA 1V5JA 4OGAC 2EDWA 5DJCB 4M8UA 1P6FA 4WWID 4Q52A 1YA5A 3Q5TA 2J1KA 1SOSA 5F0JB 1AAJA 3F7VA 3I3EA 4R97B 1LILA 4PI2A 4N0UB 3UTTE 2BSSB 4U6VL 4BFIB 3LQAH 1A3LL 3GNMH 4IEFB 5AVQB 4F7PA 4G43A 4OCWL 5CGYD 2VZOA 4L9LC 3V0WL 2GK0B 3D1MC 3NJJA 3GBNL 4PJIB 5E99L 4WAFA 3JSSA 2D7OA 2YUXA 4JFDA 5E9DE 1UD4A 1UZ8A 5TFSL 4I88A 4JFFA 1XSIA 4DUVA 3VXNA 5D5ME 3GSRB 3SJVA 1FFOA 1UM5L 4C56E 5C0CD 1NFDE 1A6TA 4P59H 1AGBB 1MPAL 4ZK8A 4W9ZA 4UOZA 4TTDC 4FNQA 4LPUA 3S36H 2LTQC 2X89D 1NCHA 4HIJB 2X0VA 2B0SL 1IFRA 1XGTA 4LAJH 4ODHH 4RA3A 2ZOKA 1YEKH 3VH8B 4H1LB 2FO4A 3VW3H 5DCCA 2LR4A 2DL2A 4NWTL 1HEJC 3N85H 5GGUB 5KZCB 1BZDA 2EADA 3B83A 3FU0A 3BVWA 5ANME 5F21B 1I1AC 5ISZA 4NRXB 3I2CH 1Z9NA 4H1LG 1QAWA 5I24A 4IU2A 2H47C 3MLXH 2CG9X 3O6KL 5A2FA 4M4RA 1IEAA 2ARJQ 3UYPB 5KN5A 2ZG1A 4NQQA 4ZFGL 2XV2A 4GB9A 5EN3A 5T3XD 3VFWA 2EKSA 2VRAA 4A6YL 3EDKA 4PJDA 5IVXA 4APQA 5ACLA 1JCVA 1T1WB 3BVXA 4BSWA 1A9BA 2J6EL 1VADA 2V4LA 5HYQA 4ZOCA 3RZWA 4FTVE 3BW9A 5A16B 1A9EB 4LEBA 2IWGA 1K85A 6TAAA 1HZHH 4UI2A 1T7XA 4CMMA 1KIRA 3PP3H 1NDMA 2BJML 3NJVA 2XV6B 3GS7A 1U21A 3BMWA 5DEGB 1NTDA 4MKMA 1EK3A 4NN5C 3DOIA 2JTDA 3QP3A 2G60H 2BFVH 2B14A 4ZW3A 1SHWA 4L5FL 1DJWA 3BWAA 3MUUA 3ZR6A 3QPQC 2XWJB 2EYTA 4KKCD 5CLTA 1M4KA 4R2GB 4ZI8A 2DEXX 1HXMB 4G8GA 4UILL 1AGBA 3FTUA 1IE4A 3BAIA 4F5CE 2CRMA 3SKMB 5FOBA 1MIEL 4FQHA 1NUDA 5J6SA 1QSEE 5HI3C 7FABL 4TLTA 5JW4N 5EWIH 4NBZB 5I0WA 2HVJB 3K91A 4A7VA 4U1GB 1NSNL 2A9MH 1IGMH 3S37H 3O3DB 5CBAA 4OCSH 1R24B 5CGBA 1DO6A 3LPOA 4FYQA 1G7IA 4R2GD 2DBJA 1AP2B 4QHNA