1RH8A

Three-dimensional structure of the calcium-free piccolo c2a-domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
142
structure length
142
Chain Sequence
b'ASHPITGEIQLQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLMKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Piccolo protein
publication title A conformational switch in the Piccolo C2A domain regulated by alternative splicing.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 20
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2003-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1rh8A00
1E90A 2KI6A 3TWYA 3ENEA 4IQHA 2WXFA 1QATA 4WWNA 4BFRA 1HE8A 2QZ5A 1DSYA 2Z0UA 4MJJA 4DNLA 4J6IA 4OVVA 3L16A 4AJWA 4NS0A 3S2AA 4AOFA 4FADA 4XX5A 2YRBA 4LT7A 4TS6A 4ICWA 4ANWA 4L2YA 2WXQA 3F05A 4JPSA 4EZLA 1W16A 2WXIA 2K4AA 4G11A 3ML9A 4LCVA 4F91B 1DJHA 4EZJA 4LDCA 4NPJA 4DK5A 3W56A 4QJ4B 1DJYA 1E8XA 4KZCA 3ZIMA 2ISDA 4FA6A 1GMIA 2WXHA 3F01A 2A5UA 3PRZA 2WXRA 4FHJA 4Y1TA 3PREA 1YRKA 2K45A 3QAQA 3KWUA 4HVBA 4V11A 4XZ4A 1UGKA 3CSFA 3QJZA 3R7QA 2Q0ZX 1BDYA 2RD0A 4FJZA 3L4CA 4NP9A 1WFJA 3QK0A 4F92B 3OHMB 1BCIA 3IBEA 4ANXA 3L08A 2BWQA 2DMGA 2V4LA 3APDA 4QJ3B 3APFA 4KZ0A 3W57A 1E8WA 4HLEA 4F93B 3R7RA 3ML8A 3APCA 2LHAA 4A55A 4WWPA 2ENJA 3ZVVA 4OVUA 2WXKA 3DPDA 2WXLA 3DBSA 4L1BA 4WEEA 1DJWA 3L17A 2CHXA 4FULA 2CM6A 2CJSA 4XE0A 2CHDA 4WWOA 5T8IA 2WXGA 4BGDA 3NZSA 2N1TE 3M7FB 2ENPA 2DMHA 1CJYA 2Q3XA 2UZPA 2ENQA 4EZKA 4KITB 2CHZA 3HN8A 4F1SA 1UOWA 2FJUB 4QAMB 4PS3A 2NSQA 2WXPA 2ZKMX 1E8YA 2CJTA 2WXMA 2WXOA 2X38A 5CCGE 4WAFA 3MJWA 3L9BA 5JHBA 2EP6A 4NPKA 1W15A 1UOVA 3P2BA 3F04A 2D8KA 3F00A 3FBKA 3OAWA 1V27A 2QZQA 3B7YA 1A25A 1TJMA 4FHKA 4FJYA 1DJIA 5H4ZA 3IM1A 5G55A 2NQ3A 3N5AA 2JQZA 3QARA 4ANUA 2K3HA 3HHMA 1DJXA 2WXNA 3PFQA 3JZYA 3PYCA 4L1LA 3RDJA 1DJZA 1BYNA 1RLWA 2R83A 3ZW3A 4IHBA 2Y3AA 3NZUA 3TL5A 4Y1SA 3GPEA 4URKA 4PS7A 3SD5A 2YOAA 2CM5A 1WFMA 3LJ3A 4GNKB 4TV3A 2FK9A 3CSTA 4QJ5B 1DJGA 3PS6A 4GB9A 4TUUA 3TJPA 1E7VA 3RPBA 2NCEA 1K5WA 1DQVA 1QASA 1RH8A 5CCHE 1RSYA 2CHWA 5CCJA 5EDSA 5KJ7E 1E7UA 3FDWA 1TJXA 3NSJA 3QR0A 4FLHA 5JHAA 2A4ZA 2B3RA 3L13A 3L54A 3QR1A 3HIZA 5H4YA 3KWTA 2WXJA 4ANVA 4PS8A 5G2NA 3T8MA 2K8MA 1E8ZA 4L23A 4ICXA
chains in the Genus database with same CATH superfamily
3X3GL 2WYIA 1L9MA 1OP3K 1RQ5A 1CE6A 3COOA 3JTTB 4MNQB 3Q7JA 1OM9A 1EMTH 4NYLA 4NX0A 3E9TA 4IBQA 1RZ7L 3QO0B 5AVRB 2PO6A 3G5VB 4NM4L 1ADQL 3IKKA 4KK6D 1KGYE 3AG1B 4Q9BA 4P2QB 3LDBB 4XBPA 3MLXL 1FVDA 3RGVA 4IGBA 5HPMB 2XWRA 2EE0A 3WKQA 1LYQA 1MCPH 5H37A 5LDUA 1QFUH 3CQQA 2XKUA 5AVXB 1HYSD 3NP3A 1LO2L 1BZDA 3HC3H 3OHXB 2NY5H 1QI5A 2JLPA 2V2XA 4JM4L 4WFED 2DLFH 3C6SA 5LXVA 2NNRA 4XVTH 1JNNH 2ZXEB 2PP9A 4Q4EA 2IBGA 1QMUA 1RUQH 2AITA 1LDSA 2EAEA 3E3QC 4FMVA 4POYA 1JZEA 4ALAH 3SPIA 2B14A 5HVHB 1T21B 2R8SL 1QLFA 2EZ0D 5EU4A 1LMIA 2OMWA 2WVTA 3HHSA 3SOTA 5DEFA 5B38A 4CC4C 2X12A 3SE4C 3FTYA 2CRYA 5C08E 1EXGA 3KPTA 1XMEB 2VLKA 3CBRA 5DR5L 3UX9B 3P9WB 2DQJH 4PJ5A 3TBYA 5C2UB 5D72H 4OFYD 4PJGE 5CP7A 3B8YA 3MV7D 1IFRA 3M1CA 4QRQB 1OGAA 4LARL 5CEYA 5LJYH 1AR1C 2NSQA 4HKXB 1E8YA 1P5VA 4GKSA 2MNWA 2V7NB 3PJLA 3EJZD 4JM2C 4PJ7B 3ARDD 4YUEH 4Z0XA 3S5LA 1CFQB 3NJXA 3HC0B 3VYPA 3CFJB 3EG9B 5I71B 4L1SA 1ZLSH 4I1PA 3FW6A 1E4WH 1NM9A 4MBOA 2YXVA 5DJCA 5MEND 5AZ2H 1LEGA 4ZMQA 1BV8A 5ACZB 4JDTL 1AXTL 2AXHA 4GAYB 2CLZB 1WLHA 2R2BB 5IJKA 3A5VA 3PNWA 3WL9A 5J11B 4M61A 2ED6A 3K5RA 2DQDH 3LRMA 3BRFA 5MERA 2B59B 3MV7B 3KGTA 4AT6B 1ZTXL 1T7WA 3E8UH 1AGBA 1DBAL 1D9KA 3BKYH 4K5OA 5C0BD 1A6WL 3ARDB 3HRZB 4IJ3C 2XBDA 3UPRB 1ILUA 4H26B 5EF3A 1OSEA 1UASA 5D71H 1CI3M 4YBLB 4XVJL 4YDJA 2OMBA 1MRCL 2W91A 4X7EC 3WN5B 3D0VB 5MENB 2M1KA 1I3UA 1EO8L 2IGLA 1EQWA 4NC1C 3D9AH 1F58H 3BGMB 4NQQA 5CBEB 2JH2A 4MJ5B 1CDBA 4Y4FD 4CGUB 4MMZC 1TITA 3ZLQC 3LNDA 4UU9B 3BSGA 4LCYB 4YSOA 5CUSL 1G6RB 4LBEB 2B16A 5FB8A 4NFBA 2FIRT 3NRPA 4UIKL 3ZE0F 3IDMA 1FE8H 1GMIA 2CALA 1HZHL 4ORZC 5BRZA 2NZ9D 5C0BB 5BV7L 3L7EA 2VUOA 1CBVH 3HE7D 4LGPB 4I48A 4MB4A 3RIAF 1QBBA 3MUZ1 5H35B 2XSKA 3FFCA 3TH3T 1JPSL 2IJ0C 3KEDA 3MV8D 4OLWH 3VFPB 5KUKA 1UH4A 3DNKA 4JFDD 3A4DA 4I9WE 4RBPK 3KMDA 4TQEL 1J86A 4PGCB 4F93B 2Y06L 4HKBB 4PJDE 4HUKB 5DD1H 4Y4FB 3ZTNH 5JYLA 1EZSA 1UWFA 4OIIL 2BNRA 5K9JL 1NDMA 4IOSD 2I9TA 4JFSA 2CM6A 5IBTH 5KBKA 1T0MB 2VWEE 2CKBB 3WO4C 4AUJA 2R1XA 1J05B 4LCCC 3DVNB 1XZWA 5ERWA 4ODHL 3ZKND 5DMKB 6FABH 4GG6B 1G7LA 3D39D 3HE7B 3V79C 3ATDA 2ED7A 1EDHA 2F7IA 3T0DA 3HR5A 3OKEB 1KELH 3J7HA 4OT1L 3VH8G 3C6LD 1LEKA 4GAGH 3MV8B 3O3EB 2IPUG 4IDJL 5DVKA 3VXQA 4JFDB 4Y5XC 1HZLA 5EUKA 4ETYA 1YEKL 3HPJB 3PYCA 4LLVB 5T1MB 1NKRA 1RZFL 3MNVA 3GD1C 2YBRA 3NZUA 4RAUA 2FEDD 2YSTA 4TV3A 1U8MA 4IRZA 1A9EB 2GIMA 2CNZA 2OCJA 2X3AA 1H3PH 4NZTL 1AZNA 3RPIA 2JXMA 4UUJB 3BFWA 3FFOA 3LCYA 2PO6C 4XHQA 4UMGA 3CUPB 3MU3A 4CADB 4G7VL 3OJDA 3U1SL 4G8IB 4KDVA 1DZBA 3D39B 3TT1H 4R8WL 2P5PA 3T3PF 3RGVC 1RIUH 2NW3B 3KWVA 4IGBC 1TTRA 3UTTE 1RY7B 2ORBH 1F02I 1TT6A 4E41E 1O9WA 3C6LB 3L4ZA 3TBVA 4F37K 2WY3B 3MA9L 4PRID 5A2JH 4A04A 3FO9A 4ZMOA 4AOFA 4Y19E 3VRJA 3SY0A 1LDPL 5EZPA 3LB6C 2EYSA 4WUKH 3T0EA 4LAJH 4DKFH 1F4XH 1FPTL 1Z9OA 2RH0A 3IAQA 4G11A 4ZS6D 2OCCB 3U46A 5HYJE 3BC9A 4KKZA 4I8DA 1NDGA 3T9WA 3RVWC 2VT0A 4TQ8A 2X4OB 4JN1H 3P9MB 4X99B 3RDTA 1QWNA 4S10A 4UT7H 1I1FA 3GNMH 1VZGA 3FQ2A 4DQAA 4NP4H 2DPKA 3TH4T 2QTEA 5F6IB 1AIFA 4RSVA 5EU5B 2IO5A 3EOAB 4U1LB 3F3HA 5HJDA 4ZTPL 4JX0A 4AEFA 1JDCA 5FYKU 2E7CA 3KXFE 1A14L 3MUHL 1WT5A 2MRYA 3MMEB 1XFPA 4PRIB 3ZK0A 3P2DA 2VDNB 1J48A 1JN6B 3UGUA 4NO3B 3HA0A 4JM2D 5DHYB 1WF5A 2VCOA 1AAJA 2F5BH 1DSFH 2YIHA 2HG5A 4ZSOB 3X12A 1TJIH 4YHZL 4LPUA 5HHNA 4HYTB 3H4HA 4M7JH 1QLRB 5F7DB 2OYLA 4K8RC 2IAND 4M9PA 5IHUH 3VFSA 5JQ6L 1INQA 4PG2A 3T04D 1NFDA 1W72H 5INDA 3LN4A 1VZHA 3RBSA 3VXRD 1NMCB 1H3VA 3VU2A 3AS3A 2EDDA 2IOMA 1UGNA 5IJKC 4ENZA 4HWZA 3TT3L 2FECL 4N9OB 3GUTB 4JKPH 5SWSD 1ZCRA 2HZHA 3BFOA 2IF7A 4UQ9A 3Q3GA 2KC0A 2YA0A 4G9FA 4HHAA 4NI3A 1I3GL 3MNWB 2JF1A 1AZVA 5B7MA 3DRQA 1EX0A 1IMHC 4HSCX 1D9KC 1EJ8A 4JM2B 4Y9BA 3BKCL 3D33A 1U8KB 5L7XH 5FOJA 4BH7B 1GVIA 1U3JA 1UENA 2XTJC 3UPAA 1IV8A 1MVFA 4OTXL 1K6QL 2B1OA 1D5ZB 2P46B 3OLDA 5DZPA 4P46D 2IANB 2OXGA 5IMLA 4YBQD 3DK2A 1KEML 1LO3L 4EI0A 1JWMB 3TFKD 1BG1A 4PI2A 3VXRB 2K9FB 1LO5A 2LFEA 1BFVH 3ZHLA 1NEZG 1TQCC 4JGUA 3C09C 1IC5H 5C6TL 1DBBL 4FQIL 3EHBC 5SWSB 2A9ML 5EN3A 1A6TB 2Z64C 3WEMA 1EAPB 1RJCA 5FYKH 1YEHL 2EO7A 5C0EA 1YEGL 2XA8H 2VDQB 1ZAGA 1ES0A 5CWSA 2BSTB 2OX5B 4HWBA 4DUWA 4LLYA 2QELA 1SOQA 4JRXA 5C3LD 2CHNA 1U58A 4JJ5A 4HFUL 4GW1B 3QO1A 5MHSE 3GHBH 5JW5A 4NUGL 3S35X 4D7PA 4YSPA 3D18B 1U92B 2WVUA 2FSEA 4P46B 5F1IA 1KSRA 2P47B 4GRWH 4S1DD 5E8NA 2DQUH 3MLZH 4K7PX 2ZOKB 1DN0A 2DQ6A 2XWCA 4KHXL 3GJFB 4DUXA 3BVNB 3UAJD 3IAGC 2AJXL 1IAII 4FE9A 1T1WA 4P5MB 1BQ5A 1PS3A 4FNLL 3D2UA 4M6OH 1UB6A 3IFPA 1IAOA 5E56A 2EEAA 1JVOA 3D2TA 2BSRB 1C7SA 2P9RA 3WHE1 2NUTA 5C09D 4JNXA 2OYKA 3U30C 4HSAC 1U91B 3EZJB 1DVFD 1H8NA 4X5WB 4MD5A 4PY8I 4PLJC 4MS8D 4QPEA 1KCKA 2N1KA 4HV8B 2F1AA 2WKOF 3FB7B 4G2AA 5DWPA 4QHMB 4ODWB 1VKXB 5E24E 5T3XL 2IQ9H 5FC9A 2AQTA 4HOWA 1X7TA 3V10A 4OZIB 3VFMB 1BMZA 5AG8A 4PP2A 4XBEL 1E3XA 5LBVA 3V4PA 1L7TL 2DL9A 3DV4A 1V3KA 2HH0H 2BCKA 4MMXA 5CJOL 3S96A 2LU3A 2G0LA 4DGVL 1IAIM 3FQ1A 1QSFE 4BZ1H 2UZYB 1BXVA 1PZBA 1A4CA 1OHQA 2O5XH 5F0MB 4P3CH 1R5WB 3UBHA 5C09B 3TIDA 4DKEH 2ENYA 1DVFB 1JGLL 5LGHH 4L1LA 4U1NB 2H1XA 4WCYH 3N0PB 2R83A 1T1XA 4IGBD 4DO5A 5BO1H 5EBMA 1BQKA 5C0GB 3D4ZA 3RWDB 5KJRH 3NCXA 4NT6B 5DEZA 3B7UX 2X3BA 4Y5XB 1E7VA 5IQMA 2K7PA 4NZUH 5HDBE 3TBBA 5CEZH 5H37H 3IVKA 4NGHL 3PF2A 5C0DB 3LB6D 1P84K 1EO5A 1L0YA 2K0RA 4W9FC 3S35H 5E00A 4NYLB 15C8H 1U6AH 4OD3H 2P43B 4M1CC 1TZAA 3RDTC 1QFHA 5G2NA 3WE6A 3OQRA 4EIBA 5L6YH 1IO4C 4LXFA 4IRSD 4OAWB 4K7PH 1A3QA 3QWQB 3O4OC 3VD5A 4X6BA 2VITA 1DVSA 3ZIYA 4BK8A 1E9OB 1FVDB 4F7TA 4IGBB 3OKLB 1ZANH 1GGBH 5GGTA 3S9DB 4XMPH 1CD8A 1WT5C 5C0NC 2B7DT 4AEHH 3RJOA 1HI6A 3ZL4L 2C9AA 1OSZA 2AJUH 2GJPA 3DIFA 4PGBA 2F9BT 3RVXD 2J8UA 2EO1A 4FFZL 2HX7A 1NGQH 1KBPA 2D2CC 3O3DB 4J3TA 3GZOA 2BW5A 4KH2A 3F8UB 2NSMA 3G6JF 3VGGA 4APXA 4YHIB 1D5IH 4HK3N 4IW4C 4PG2C 3VH8A 3EYOB 3G04B 5EU4B 5I76B 3CDZB 3V52H 2R29A 3B5HA 4JKLA 4LMQE 1BFOB 4IRSB 4MAYD 4X8JA 1YNLH 4JPQA 4GKOA 5DEGB 4QRRA 3NJMA 4M7LT 2VLKB 4TQPA 3LNIA 2WVVB 3W57A 4OFIA 2X3CA 5ID0A 2OULB 1N6QL 4ADJA 1TYJA 4MXVF 3UAAA 5I15L 3JYBA 5I1IL 1P5VB 5DRWA 1KTLA 5AB1A 3HAEG 3EJJX 4O2CA 3STBA 1F3JB 2YRPA 4P5TA 5IHLB 2DMHA 5JHDE 5IJVA 5EUOE 2K6ZA 2CDFA 3CDCA 4M5TA 1DEEA 5E94A 4HU2A 5SWZE 2H3KA 2DQGH 4QRTB 5JR1H 3OMZA 3BDYL 2ZJSL 4HOXA 1UADC 4HPHA 2W0FB 4JO3H 5DQJB 1WBXB 4MAYB 5I9QC 1NAMA 1B3JA 3L48A 1CK0H 3MFGB 1OTUC 3PNWB 2G5RA 5HGHA 4G3YH 1JXDA 1WIUA 4KNQA 1KLGB 1YY8A 3AG2B 4JFFD 4MNGB 1DQTA 2K1MA 1TJHL 4XTRC 1CZ8H 1MHPH 4OFKA 1PZUB 1AGBB 2FO4A 3LH8A 1D2PA 2X4NB 5TD4A 3L3KA 1NBVL 3MRKA 1IARB 3FN3A 5DUBB 3NA9L 3DJ9A 4YE0A 1SJHB 4FG4A 4WFGE 1EO7A 3EGDB 1MCQA 2VXVL 5DJAB 5FGBA 3CLWA 4YDJB 4Z7UB 4OB5H 1A21A 1JGVH 3L13A 2VXTL 2A83B 1HILB 2UZIL 3VFWB 3RWHA 3MVSA 1CIDA 1MRFL 2YMTA 2YS4A 2BSEA 3BEVA 4RAHA 4ZOCA 3KBFA 1RPKA 4Z76B 2HRGA 2Q7AA 4HC1A 4WWNA 2C3GA 2NX5D 2XRAH 2GJRA 5F96L 3T2QA 4JFFB 5HHQA 2A9BA 2WBXA 2RQ8A 3AFLA 1R3IH 3GBMH 3FUNA 3HC2A 3I84A 1XF2A 4TF4A 1EANA 3V0HA 3LPGA 1MRDL 5BQ7B 2XWJA 1WAPA 2MTPA 4E0RB 3HMXA 1TTGA 4FQHB 3EYVB 4ZYKB 1P6WA 3VXME 1I31A 3A21A 4LCVA 2CUMA 1VFUA 3MRJB 4XNUH 3WJLA 3FB6B 3L7EB 3HMWH 4LASH 4BDVB 1GZQA 2ZPKL 4GY4A 5BV7B 3P40A 1JGUH 4ILDA 2AQQA 4OZGA 2AV7A 3D6GA 3QFDB 4Q6KA 2W81C 4XOCA 1FFOB 2AJVL 3CDGA 4GO6B 4WHDA 4XC3L 5BZXA 1RJLA 3V95A 5EEXA 2YD7A 4M43L 3IGFA 4D2NA 3ZJAA 4AL8C 4XXCA 4XMUA 3VXUE 4RMVA 2Z3FA 1ML0A 2KDGA 4IU3A 5L8JB 1PMYA 5C1MB 5C7ZA 5GHWH 3ROOB 1TKWA 2Z31D 5DK2A 2V6HA 3L4UA 4HULB 4YEFA 2BNRB 1JZ2A 1V05A 2YAPA 2NX5B 4XO4A 4LFHG 4P4RA 3BGFC 4MMXC 2QV2A 3WFCH 4PRDA 2J6EA 5E08L 3NFNA 3SYPA 2VM9A 1NGPH 5HY9A 5JOEA 4YSCA 4G71B 1F4HA 2WMPA 2FE0A 4YHPB 1CDIA 4IRZH 4XMKH 3FTGA 3KPSA 2ZWZA 3V7AE 3QHFL 1XGTA 1S5IL 2BY2A 4HJJH 1ZLWK 2I7SA 4IBWA 1ED3A 1CU4L 1Q1JH 3PGFL 2ALAA 5F72S 5EZIL 4U3SA 3R06B 4KNTA 5GRUH 1IRAY 5EUKB 4FQCL 4AKQA 3M1BA 3F04A 1S7XB 2ED9A 2X2UA 3BKML 3UTZA 2Z31B 4HIHA 1VADB 4ZFQA 3FC8A 3GMNB 5TE4L 3IXTB 1AD0B 2OJEB 2Z91A 3IMUA 1NCDL 1GJWA 3BP5A 2WHVA 2R0KL 4TVPD 3TYGH 4JHZA 4YDVB 5B21A 4ZFGH 3QZMA 4H2AA 3D06A 1T04B 5AUMA 1BD2D 1A3LH 1GC1C 2L7EA 2Z4QA 3U83A 1KC5L 2GKIA 5CGYD 2AAVA 2ZYRA 1EFXA 1E28B 1I85A 3ATAA 12E8L 3O8XA 3CLEH 3U2SB 2CPUA 2WJ7A 4XXDA 1JE6A 5I1HH 4B9IA 1UACL 1ITBB 1YQVH 2VLRE 1CR9L 2AEQL 5GJTL 1HKLH 2YSSB 3FDWA 2KQNA 3L2NA 3ZDZB 5F3HA 1N3NA 1SEBA 1IC1A 2PCFA 1JHTB 3P9LA 3CMOH 4YDKH 3DPBB 2RIKA 2CBOA 1WZMA 2Q5BA 5HYFA 4U1GC 2WXFA 3T4YB 1NPJA 2EEDA 3EZ8A 5JQHC 2MTAA 3AS0A 3EKCA 4PU2A 1BD2B 4H7VA 5HSFA 4AXWB 1KBVA 4YFLI 3EGXB 3LKPB 4UTBL 4ICWA 5DLLA 4C47A 1I1FB 4L2YA 2HKAA 2I60L 5MEPB 2TSBA 4R90H 1H3GA 3AU1B 2E4TA 4KX7A 3DVIA 2PNDA 1L6ZA 1Q9OA 3FQNA 2B3IA 5E8EB 1A1NA 1DBJL 1DEDA 4WTQA 1T1ZB 5IW6A 3WAKA 4KUZH 2F68X 3QUYA 3EYUL 2B8OT 1Q0XL 3N1QC 3U36B 1I8UA 2QSQA 2LABA 1LWHA 4AYFA 1ET8A 1CG9A 2L0DA 1M6OA 2EDWA 4XZ4A 3FK3A 4OJFL 1LD9A 5HHNB 1W0VB 1JVLA 4XGZA 2V5MA 4O58H 1CF8L 2V4LA 4JO4L 1KJ2A 4TNVF 3REVB 1A7OH 2N0MA 4OD1L 5HDQH 5H8DA 4BQBA 5E9DD 3P4MA 4AIOA 4KVNL 3RL2A 5B3JE 2VAAB 5F7HA 1B9KA 5K1VA 4EZMA 4YH6A 5I28A 4LLMB 4G5ZL 1QHOA 1DVYA 1PQZA 2ZG2A 1XQ4A 4L4VA 1AXIB 1I3VA 1T0PB 2V17H 4H88H 4L4JA 2MQGA 2NR6D 1RIHH 2CHZA 2HP4A 2XQYA 4KC3B 4U05A 4XTRD 5FWQA 5DA0B 4I87A 4ODSL 3G08A 2GJ6D 2BS9A 2V9QA 3DV6B 3TFBA 1U8PA 3E8VA 3WEBA 2D3LA 4JQIL 3X13A 3DX6B 3BRGC 5D7IF 3LHPH 5J89A 3MR9B 5FGBC 1YEIL 4LSRH 3WUWB 1ZS8A 3O4LA 3REWA 2V8LA 4HWBH 5D1XA 1FZOA 2BIIA 1YA5A 5E6IA 3IDXL 3OB0K 3L45A 4WGKA 1MEXH 1T2QH 1H0DA 5E9DB 3G5WA 3US1A 3OGCA 3DOSA 1OAXH 3ISWA 4XP9L 1G94A 2VLMD 3K2UH 3QDJE 4OFDA 4TOYH 3WGVB 3DKHA 3FN0H 4IS6B 2X1XR 4ZTEA 2X9ZA 5IT2L 1QRKA 3PS6A 2VO5A 2IFGA 4HP5A 4OZFG 1AIZA 5DVPA 2Y4SA 3PDGA 2BMKB 1FUNA 3KS0H 4HLJA 5CR8A 5IHHA 2GJ6B 1RJZA 5F9DC 2J57A 5CWSB 4JVWA 1CXFA 2J25A 3NSJA 3QSKB 3WJLC 5J12C 2YPKA 3RILA 3LMJL 4YZFE 3RTQA 5AKVA 5DI8B 1UCBH 2AJSH 2XV0A 5AB0A 4WV1B 1OLZA 2PYEE 5EFIB 2NZ1A 3OL2A 5TE7H 3MUUA 3O2WH 3WDHA 3D8MA 8CGTA 4XXCC 1QFUL 2UXGA 4X7TB 5D7LD 1KGIA 5T3XD 5H2BB 3TONA 3HC3L 1PLCA 4AQOA 3HAEA 5C8JA 4GW4A 1IAIL 1BQRA 5JLZA 4HW6A 1BPVA 1FLTX 3OG6B 4AL8H 4YDLB 4XVTL 5EO9B 5JW4N 4GG8A 2HX9A 4Z0BH 3SE9L 3IFPB 2R0WH 3DX4A 3MJ6A 4QJ4B 3B2PA 1RUQL 2W59A 3GSWB 4ALAL 3OG4B 3WI9A 5M94B 1ACZA 1F3RB 5EZOH 5CKGA 4OLZH 3V4PH 4R4FL 3EH1A 5AZUA 5CKAA 5ICYA 4GIAA 5BS0D 4H1LB 4LNVA 3OZLA 2JKXA 3A3YB 1FDLL 4KK5D 3HBGA 4XCYB 3MAWA 3MRDB 2RR3A 5EDXA 3TWCH 3U9UB 1MHCB 3OKNA 4PY7A 5D72L 1FF5A 3PDOA 1UD4A 2H8PB 4IOIB 1R47A 5D7LB 3RZCA 4LIQE 4UQAA 3V5HA 3QFJD 1IEBB 2AK1H 4MJIE 1OZUA 3WLBA 1N8ZB 2XOTA 3Q6GH 3BPCA 4BUGA 3EJYC 2F5AL 3ECQA 4YUEL 1DJWA 4OV6F 5IB3B 2LTQB 3DV4B 2ICEA 5FM5O 1ZHKB 3S96B 3SDYH 1M71B 1GGTA 1MCFA 4BGDA 5F8RC 1ZLSL 9PCYA 2A0LD 1QUNA 2CR6A 4R4BB 3HOGA 1E4WL 1LNUA 3VFGH 2ENQA 5GGRY 4AEEA 5EU7C 3BHBA 3V8CA 1U3YA 3PPEA 4JANA 5BS0B 1P7HL 1I85C 3AB0B 3GEFA 3O8XC 4AQAA 1SNRA 4A2HA 1UEMA 4LKCB 1T1XB 4BXVA 2B5IB 4GT7A 4R83A 2Z7YA 4U3XA 4POZC 4OUOA 1KYOJ 3RKDC 4J7RA 4LCWD 5DJ8A 2DICA 4J3OG 1NCUA 1ZSHA 1TQTA 2Y22A 2IADB 4Y1SA 3RUGE 1S78D 2HT3D 2OR7A 3BKYL 4Y16D 2Y07H 1AO7E 1SVCP 4JB9H 5PCYA 3QQXA 3NTCH 2JIXA 2HVJA 1J8HE 4WTWA 5D71L 5L8LB 1FIEA 3IDJA 3QXVA 1JIBA 4JZOB 5ILTL 5E8DH 2DM7A 4OZ4B 5BRQA 1FA4A 4NZFA 1T20B 1DFXA 1FG9C 1W9XA 4BKSC 2UZXA 1X5IA 4TLKA 3D9AL 5ADPH 1TOXA 2JKSA 4WWKD 4HMCA 4Z7AA 3KLQA 4PRBB 2V2TB 1OVZA 1A1OA 3JTSA 3OV6A 1KGWA 2AHIA 3LPPA 2R29H 3G5ZA 4N2DA 3BN3B 1WBZB 5HDRA 5SX4I 3QUYC 2GK0A 4YSSA 2A73B 2NTFB 3BAYA 1HI6B 4JM2F 2VH5L 1OSZB 2X1QA 2AXGB 4L0PB 3DIFB 3N0AA 4LCWB 3BUYA 2NQCA 2OMZA 3INOA 1CGXA 2X53A 3VRLE 2G4GA 1CC3A 2OL3B 2YD0A 1JK8B 4QRPE 4YSAA 3UABA 4Y16B 2IWFA 1FZKA 1CBVL 2DAVA 3F64A 4U1GB 1ASPA 1YPZE 3KPLB 1UTDA 3W56A 4M1DH 1UFUA 5FKPB 4OLWL 4JREB 4PJXA 4X8JB 1R4XA 8FABA 1ZMYA 4I89A 1UM5L 2BP8B 3I9AA 3RIAK 4BWWA 1Z9NA 4WWKB 4YE4L 3ETBF 3B9KA 1PG7X 4IHOA 1MHEA 3MBXH 2W1NA 3ZTNL 4ACPA 5D93B 1UGKA 1NAMH 5CSGA 5HD8C 4Y1AE 1FZMA 5IBTL 5KG9A 1ZDSA 3VFVA 3PGCA 2JE8A 4S1SL 3JWOH 4K3EH 1MCCA 1TNMA 3L5IA 2APBA 3VX1A 5F1NA 4B5EA 6FABL 5IJVB 5LXGH 1BOYA 4APXB 1UZ6E 3SGDH 1C1EH 2VR4A 5D1XC 5MEOA 5E6IC 3W9EA 1J18A 1KELL 4HUNB 3TIEB 3AAZB 4JCMA 4GAGL 1MNUL 4H0LC 4N68A 2HCZX 1KIUA 3M7FB 4XBMA 5DS8A 5GGVH 4JDVB 1WK0A 4ZZFA 4PJAE 1MWOA 1JNLH 1KTCA 4KUCF 4RVBA 2VL4A 4NQEA 4OF0A 5E7FA 1KDIA 5IGXH 1IFHL 3IB4A 5F7LB 1T5XA 3VTAA 1H8SA 3HUJE 1FO0A 1L4IA 3AGVA 2LV4A 4RAVA 4WQOA 3L4XA 2YRLA 1MFMA 1TJMA 1XGYL 4YFLF 1RUML 2P8LA 1H3PL 4GRWF 4HC1H 4R9HA 5DFWH 1KCSL 1PDKA 5IF0B 3INUH 3SPJA 3UROR 3VG9C 2P1YA 3RTQC 1XR8A 3KW7A 3C87A 3NBNA 4G6KH 4HZAA 2GEQA 1FAIL 3HMXH 1CD9B 3L3DA 1MJ7H 1SQMA 5EEYA 4AW4A 3CXDH 3QWOB 3TPUB 2OZ4A 3U0PB 1C7TA 2WCSA 5IBLC 4XNDA 3BAEL 1KGCD 1J12A 1OEZW 1G7HB 3WYRA 4YHLL 43CAA 1RHFA 1SXNA 3BEVB 3BT0A 4LMQI 4FX5A 5CJXA 3UBXB 2PUQT 1MDTA 5BZDB 1E2WA 1XF2B 4WUKL 1A3RH 1EH9A 3GMPB 1CFMA 4Z5RA 3D4GA 1F4XL 2CJUH 3EYSH 3H8NA 3QUXD 2HMIC 2UYLA 2DQMA 1T5WA 1A9VA 3T0BA 3CHPA 3KPNB 4JN1L 3CVIL 4FKEA 5D2NB 4C4BA 1NQBA 3H53A 2J6EH 5AVVB 2OI9C 1OAQH 4R84A 5FW7A 4PGEB 2BVTA 1ROWA 1IX2A 1BXXA 1PG7H 4XH2A 5KSBB 3F05A 3GLEA 3OPZH 1KB9J 2WJ5A 2DJMA 4HS6B 4JY6B 4UQCA 3KCWA 4BA8A 4D0CA 3S8WA 3RZCC 4G6JL 4ZODA 4KY1H 3HNTH 3PWVB 5EOCL 2XTSA 5FUOH 5PAZA 5DK2B 4F1ZA 4HCGA 4JAMA 2F5BL 5EWIH 1S9XB 2ICEC 1DSFL 2K45A 1T89A 4FERA 3JWNG 1TJIL 3T0VA 3T6ZA 3QUXB 4I3RH 4M7JL 1TU2A 3GPSA 2HB0A 3KAAA 5DFTA 3F12B 1A6ZA 1MJJA 1ZV9A 1W72L 3Q6FA 1MCJA 1JWUB 5I1DA 4PJEE 1R3JB 3O8XD 5I0DA 5E2VL 1GGCH 2W07A 4NZRH 3H42H 2X87A 1W0WB 4POZD 4OZFA 4ZAKD 2XN9A 4U3SB 3KYNB 2CJSA 4C56D 1KXHA 3HI6H 1UB5B 3M1BB 5FYJU 1L0QA 2OMUB 4D9QD 1BFTA 2FDBP 2GTWA 3MCG1 1IGCH 1Z5LA 1NMBH 1E2VA 3N41F 3LKQA 4QOKA 3WNIA 3DJZA 4UM9A 4E9RA 4FQJH 1RZKC 2N59A 3V6OE 1B88A 4NENA 3KD4A 1T6BX 3P3TA 2WAHA 3DJRA 1IEAA 2NY3C 1INDL 2JB6A 3L95A 1A1MA 3QI9D 1IKOP 4Y7OC 3ZZ1A 3FUDA 5I73C 4MJ4A 3O8XB 2X2YA 2YXFA 4BZYA 5DDHA 3BUDA 4XXDB 1BFVL 1DJZA 2XFXB 3ZHFA 4CVZA 5T3ZE 1FVCB 2YA1A 4PRHA 1JZDC 2Y7LA 4ZAKB 5I18H 4C56B 3O6FA 5IVOA 3H6JA 4L8CB 2XA8L 1E3FA 5I1LB 5CU5A 3QXDA 5C70A 4NQXA 3TO2B 2WLLA 2F8OA 3S97C 4PH8A 5F88A 4PBDA 4Z7OE 1MELA 3VG0H 4FLHA 1AOZA 4QXTA 5I0WA 4GQPH 1T3FB 5ACMA 1I7RB 4HKZB 3QI9B 3LZQA 2FX8L 1YN6A 2OXHA 5ESAB 2X89A 2DQUL 3MLZL 4TL5A 3QG6A 3MN8A 2EC9U 3B9KC 1KJ2H 2E86A 1H15A 2PR4L 1U8OB 3EADA 3QPQC 3MX0A 3WEAA 3ZYOA 1MXDA 3NSXA 1JTTA 4QT5B 3QQ3A 4M6OL 1W16A 2G75B 2K4AA 2FO1A 3SDXA 3A23A 3MLRH 3VGEA 2H26B 3ATBA 4Q2ZA 5FYJH 3H6AA 5B22A 2CAKA 3GMQA 5AW8B 5HYIA 5AVYB 1VHPA 2WTRA 3DJTA 5IVXA 3SQBB 3NIFB 2BHUA 5C0CE 3CSFA 3AU0A 4MSWB 4BHUA 3CDYA 2DWEB 2BNUB 4UYPA 4PJ8A 5FGCB 5AD0B 2IQ9L 2YR3A 3MREA 1BLNA 4JG1H 3T6VA 4GW5A 1IGFH 3Q9QA 3AQYA 3QUMH 1CXEA 3GMMB 3L2LA 5EG6C 1FSKB 3RI5F 4N3UA 1A4KA 4YXKL 2FHFA 1EPFA 4ZUSB 2HH0L 1NC2A 1R46A 2JQMA 5KBDA 4K5MA 5K9QG 2OTUB 3X13B 2BHYA 4I0PA 3K72B 1I82A 2O5XL 2YAHA 4P3CL 5DD5H 1M05A 3QUZA 2SEBA 4DKEL 2VLLA 5LGHL 3FU9A 4ABQA 1AOHA 2CBMA 4JG5A 1QWHA 4WCYL 1Q4NX 3ARGC 3LQMA 1IC4L 3LRGA 3P2BA 1S7UA 5KJRL 3HZYB 2PW1A 3DOSB 4BD4A 2OSLA 1W0YT 3C2SA 5CJXC 5C97A 4NZUL 3SDDD 4R7NA 2OYMA 1XZ0A 3AG4B 4OF7A 4ZUVB 2P49B 5L0QC 4AVIA 4L8SB 3RHWF 3L3GB 2BOCB 1JK9B 1Q94B 1Z6JT 4J8RA 4JPIA 4X6CB 3S35L 3HAEH 3UBFA 2DIBA 1N4XH 4WFFD 1TLMA 4Y9FA 1U6AL 4OD3L 5DS1A 1Y7VA 4AWJC 4WI8A 1JL8A 5JPMB 1CLOH 4LSVH 1FNGB 1QEWB 3BIBX 2YD2A 1JZFA 2QLVB 4WUUD 3M86A 2DIJA 1YMMD 5GIRA 4DN4L 1W91A 3QEQA 2V2WA 3UH8A 1ZANL 2BSBA 2TRYA 1CLVA 2WP3T 3T4AB 4AEHL 4Z7WE 1UXMA 5DO2C 2AJUL 3KPQB 1E8ZA 3BYYA 3GMRB 5D5MB 3EFFA 3HG4A 1Y07A 1GJIA 1TMCB 1I1AA 3QJHB 5EIQA 2QPDB 5JMOC 3MLWH 2YMOA 4K9JA 3BQUA 3KDMB 3IF1B 1T89C 2VE6A 1G4MA 3OJMB 3BO8A 3LKSA 1UT1A 4B7LA 3H0TB 4GI8A 3NSCA 2XWBA 1D5IL 3CG8A 3HE6D 3MRRB 4FXGA 4HS3A 4X9HA 3SKJH 5J8OA 5C9KA 3V52L 2PCXA 1TUPA 1YNLL 2OI9B 1YMMB 4ELMB 1X7SA 4FQQA 5BXFB 4ZNCD 1SJXA 1U8JB 5GGQH 5F7MC 3BUQA 1F6AA 4Y2DD 1CL7H 1A8ZA 4K0OA 5DC2A 3D0LB 3MV01 2NRDA 3TEZA 3BPCB 4NQSB 2V5YA 1QSZA 1S7RA 1QO3B 4PWIA 3U4EB 3L1OH 1E4HA 5J5EA 3M17B 2WLIA 4YOKA 4CDHA 4FCAA 3SKOB 1HIMH 3H9SA 1BF2A 1CD1B 4JMNA 2NY3D 3RNKB 3GSQA 5ID1A 4R7DA 1PEWA 4FJ6A 3BHBB 4DKTA 5MP6H 5JOFA 1CK0L 1KPRB 3Q8AA 2Q7YB 1U41A 3AC0A 4WNSA 4N2MA 4G3YL 1OCCB 3BEWB 4NO2B 4F57L 3WXVH 4Y4KD 1UOWA 1UXSA 3NJJA 4QAMB 5D8JH 4H8WL 3D3VD 3PUCA 2H9GB 4Y2DB 3C9NB 2WZPA 3O6FC 4ADGA 1CZ8L 2GK2A 1MHPL 1XF4A 3U82B 1GAFH 2KZKA 4EI6B 3MRNA 4N2LA 2L8AA 2Z92A 5F97E 3VTTA 3RWIB 4X80H 5D4IA 2XBZA 1NFDF 5JHLH 2XY1A 4PREB 1MIML 2WO3B 3MFFB 1F2QA 2NY3B 3BWSA 2V9UA 3SPCA 4HWNA 4OB5L 4XVSL 1JGVL 3AITA 4GRLD 1A5FH 5B8CB 4H8VA 5I73B 1IL1A 2VZVA 2R2HA 4PJBB 2DJUA 2XRAL 3Q13A 1HHKA 4Y4KB 2NOYA 3GBML 3M1OA 1R3IL 2G2RA 4GKLA 4W1TA 3D3VB 5FM8A 4UAOC 1NLDH 1PG7W 3KPMA 3ZL2A 4YGVB 3QR1A 4XO5A 3MRQA 2I26N 4M03A 4O00A 3FO2A 4XP1H 2VLJA 3WIHA 3OWRA 2EIJB 4H25B 4NRXB 4YX2H 5LQBH 4XNUL 1LK3H 1G5GA 3HMWL 4LASL 5SV3A 4JHVA 3VNZA 1JGUL 4DETA 4LCUA 4Z7VA 1DQLL 3ZDWA 4XHJD 3S8FB 4HBCL 3IJYB 5HHVH 3VACA 1XMWA 1AS7A 4PJ8C 2FZ3B 1IILE 4GRLB 5C0AA 3F62A 2ZCKH 1SJMA 4Y9EA 2AERT 1GZPB 2GC4C 1R3KB 2VDPH 4Z7QF 4YHOH 5ESVA 3MJ7B 5G5DA 2BSSA 5GHWL 2ERJB 2EKSA 4PV1C 3ASNB 1FZMB 3F7VB 4WNQA 4NQDA 5D2LA 4OJAA 3WFCL 1A4AA 4PVBA 4NO5A 2NY1D 4EI5A 2APXA 4LHUG 3VXSE 1UEYA 3UDWA 2B39A 2ZX6A 1FO0H 3T3MB 5IB5A 1I8MB 3ECBA 4I0PC 4LKXB 4XMKL 1ILSA 3SDCD 1BZ7A 3TJEL 3QUZC 3KBHE 4RMTA 2QSTA 3W9DB 2J56A 4YXLH 3GSVA 5A2AA 5I0VA 3O2DH 5EIIB 1M3IA 2AEPH 1HXKA 3FHQA 1UH3A 3OBAA 3OR6B 4HJJL 5E6ZA 3ZTCC 3K6SA 1P4IL 3ARGD 4W70A 4UDUA 1UXWB 1DVTA 5GRUL 3CFDB 3KBPA 3VFNB 2DKUA 2OZ4H 2FL5B 1P53A 4P2YA 3GIVA 3OKDB 1PZ5B 2WYZA 4CSTA 4NKDA 4N0UA 1J5CA 1Y6NR 3G5YA 1IGMH 5C08D 2RCSH 1H9VA 2WTOA 5GISL 2Q6WB 5A6MA 5FOBB 2UXTA 3DHMA 4OI9A 2P8LB 1VZIA 3TYGL 2BX5A 2FEEI 2NY1B 3TPKA 1X7QA 1A3LL 4X4YB 4HDIA 1AKJA 1XH3B 4X98A 3SDCB 4MLIA 3VWKD 2LAAA 4L9DA 2NLJA 3NK4A 5GGRA 4JGNA 3MJ8B 4X4ME 4EOWL 5I1HL 2CUIA 3ZZQA 2IH3A 3ARGB 1YQVL 4HPYH 4PW4A 3VSTA 1SXBA 4HIIA 2CXKA 4J27A 4JPWL 1HQRA 1H6TA 4QHLB 1MW1A 5GRJL 1I1AC 5FO8A 4HF5L 3DSFH 5ANME 1HOCB 3BQUC 4YDKL 4S2SA 3U48A 3WNMA 1A7NH 4D0BA 3WLWC 1DQVA 5C08B 3K71A 3MGTA 4PJHA 3U4KA 2GJZA 2UYLB 3HFFA 4FXGC 3OKOA 3N1PC 1JXFA 3P3UA 5F9JA 3GTTA 4PJGB 3CSYA 4KVPA 4Q9RH 2X6CA 1PY9A 4HIQA 2VXUH 3NMEA 1NH6A 4M6NL 3SBWA 4JDZB 1SRDA 4PIBA 5DGQA 3VWKB 4E9WA 4BFFA 2P4AB 1PZCA 1AP2A 1AHMA 2W80C 4K07A 3SQOH 1QATA 2CZNA 1YNTB 2YC1A 5KBLA 5JHDA 2H6PB 1TQWA 2VDRH 3HRPA 4ZJ9A 4FADA 1Y1UA 2QDWA 4LQ1A 1L0XA 4OZFH 3SPGA 4LRIA 3TN0D 2A4EA 1SJEA 3K0WA 5EULV 3FN9A 4AV4A 4CN1A 1GA2A 4DZ8A 4AGMA 2PMZA 5C9JA 4QYOB 2X6MA 4HEPA 5FK9B 5FECB 2BVPB 1A7OL 3PWNB 1K9TA 2WNWA 5K1NA 4KGLA 1YRKA 1E3ZA 4HFWB 3I02B 1JD9A 3FH8A 2CE6A 2CR0A 4TNVK 3LKRA 5B7EA 2J8UF 4EDXA 1BQHB 4WEBH 2DRUA 2JKRM 2V17L 1RIHL 1T6VN 1KLFA 2ZCLH 4LP5A 2BFVH 2O5NA 4EMZA 4HUVA 5CGBA 4PLNC 3RAJH 2ZG1A 3ZDXF 3TN0B 4I9WD 1FFRA 3ILQD 3LHPL 2R7EA 1IT9H 2Y69B 4M6AA 4WO4D 1OD9A 4XXWA 4ZTOH 3BZEA 4NENB 1LVEA 2I07A 3BKJH 4HWBL 3NIDE 25C8H 3VM7A 2F2HA 1SUHA 4X6DE 1SYSA 1MEXL 4LSPH 1OAXL 3ZE1E 4FFTA 5E5UB 3MJWA 4TOYL 3K2UL 2JKIS 2FX7H 2R2CA 4NAQA 1XR9A 3BPLC 5AW5B 3V9CA 4CBPA 3LZOA 3CNKA 3FQUA 1S8DB 3UACA 2GFBA 2VW7A 3UTSA 1EGJA 1J5IA 1QRNA 3FU0A 1D5MB 1QTSA 3ZW3A 2EE2A 2HTKC 4AYID 4YR6A 4OQTL 4A7QA 3W11D 5I6OA 4DOHE 1WGOA 4WO4B 3SKNA 1UCBL 5GRYA 4PJDB 4QXTB 5JORA 3ZPDA 4L9LB 3GINA 3O2WL 1DSWA 1NGYB 4DW2H 5I66B 3PAZA 1EHNA 2VMJA 2B9AA 1DVXA 4ACTA 1TF4A 4JG0H 2VZ1A 3K2IA 3RTLA 4ZZKA 3D07A 4DPBX 5HGDB 2HT4D 3NSDA 1BG9A 2JCWA 4NAJA 5B39B 4AM0A 4AL8L 1G7JB 3F6JA 4ONOA 5ALCH 3QIWC 2V3DA 2R0WL 4EI5C 4P2RE 3UDWC 3UTTD 3V7MA 5IQ7H 4E41D 3DUUA 4NS0A 5EZOL 4XNYH 4OLZL 3V4PL 2AJZB 3ARSA 4LT7A 4PV8B 5HGAA 1IE4A 3WHE0 4WHCA 4FTVA 1GHFH 1HT6A 1HXYA 2DKSA 2D0GA 2OBGA 4YPGB 4Y19D 3TWCL 2BNQE 1P9MA 1AQDB 1ACXA 3G3LA 2EE3A 3KR3L 3MV9E 3SD2A 4OBRA 5HYJD 3BLBA 1CL7I 3QUKA 3CFUA 3I3EA 3L3IB 3SE8H 4YDMA 5I26A 4GW5B 4ZNEE 3CU7A 3Q6GL 4WRLA 5KW9L 3IWVA 2VDOH 1EAJA 2DOCA 1DDHB 1YDPA 3VI4E 3BP6A 4OZGF 1THAA 1BZ9A 3D85D 4DFIA 4OGAC 5E1QA 4E41B 3KXFD 5EO0B 2X41A 1HSBB 3O6ML 1GRWA 2FWOB 3IFNH 1MCDA 3OKKB 4MCYB 4MS6A 4XP6H 3QUZB 2DBJA 2E9JA 3WMQA 3U0WH 2YD3A 2WXLA 4DGIH 3N43B 4I4WA 5GGUB 4Y19B 4XNBA 2BXYA 4NBXB 2ZUSA 3KPRE 1ET7A 1QI3A 2B1HH 3L81A 3PABB 4GFXA 3QZWG 5AOKA 5F3FA 4IEFA 4QWWC 3FT0A 1VFOA 5HYJB 2YJLA 4JFZH 1NGZA 3KS0J 3VE0B 2UY6A 1PGRB 5DLML 4V1DA 5H94A 1OAZH 1FP5A 1URLA 1UM6H 2B4CC 4FLQA 2DQHL 4KX8A 1KG0A 2F54A 2Y07L 2ZYSA 4UQ2A 4F33A 4F5CE 1IKNA 2J1XA 4M8QB 3PWJA 5EF2A 3UYRH 5I5RA 3M46A 5E8DL 3VTMA 3D85B 5BPPA 2XNAA 2YD8A 3KXFB 3WKMH 3SBWC 4U1IB 1NC4D 4M8VA 3DXAE 2W65B 2C7UA 2F8IA 4R0LB 5ADPL 9CGTA 2BC4B 2MPVA 4XB8A 4P23D 2V2WB 2YOAA 5AENA 1UFGA 1YMHA 4RQQB 2R29L 4G43B 3S5YA 3P77A 1E4XH 4AY0A 5B4MC 1AG0A 1DJGA 5C2BL 1AXSA 3BUIA 4L3CA 5IROD 5JDSA 3AM8A 3T0EE 1QASA 1KN4H 4K73A 3LQZB 5HHOE 5D7SH 1O5DT 4LHUA 4YO0A 2E7DA 2C8NA 1MFCL 4NDMA 2QJDA 2YPLE 4LRIC 4G42B 4LOUC 1NCTA 1XAKA 5D70H 2J4WH 3QGVA 1VENA 4AENA 2C1PB 3II1A 1AACA 4BZ2A 3QBTB 5HBBA 2XG5B 4ZFZA 4IYKA 4JG9A 5FKAA 4HUXA 3EDDA 3F7YA 4M1DL 1YN7A 3ETTA 4GRMB 1VGKA 2UV3A 3DC0A 4F7PB 4AEIH 1PFOA 1NC4B 1KB5H 1N5AB 2GCYA 1BVLA 1LJMA 2BOLA 5L4JA 3V0IA 4WZ9A 3D25B 4P23B 3IETA 3MBXL 2XV6B 1NAML 1VB9A 3G5XA 2R0ZL 3NH7H 3HVNA 4N8VA 4N85A 1ZWIA 5MHSD 4LAQL 4F2MA 2WB7A 3CHRA 3JWOL 1WBYA 4K3EL 1FZJA 1M7DA 5GS1B 4MQSB 3ZRSA 2CIIB 3W39B 3NFSL 3D69B 4HH9A 1CE1L 2OQJB 3P4LA 3PAYA 3QZPA 4UOQA 2DMBA 4XXWC 1PX8A 3S34H 2WLIB 4EIZC 1PKQE 4O4YH 5LXGL 3L1GA 3K5SA 3GRWH 3QDMA 5DHVB 5D1ZA 1GGIH 3MLUH 1HC1A 1JNHB 3C08H 2PW2A 1D7BA 1BF8A 5ELIA 3W3BA 2VERN 3BCFA 3IEAA 3WY4A 2X1PA 5AYQA 3HKFA 1JNLL 2JI2A 3FO1A 1ZLUH 2ADGB 5HGGS 5IGXL 3LQAH 3MXVL 1D7FA 1E5YA 2JB5H 1AI1H 1NGWA 3V4VA 2YXWA 3O41B 5A16B 1B2WH 1PF3A 5KJ4A 2OMVA 1XF4B 3KCPA 2VGLM 5DRNB 3DBXB 4N1EA 3MRNB 3QW9A 1PCSA 4GH7B 4XN8A 1JTPA 5EO1B 3PHAA 5GZOD 3JWNH 4NPYA 1KPVB 4Z77A 1ASQA 1QLEH 4ESKA 1ECYA 3HMXL 3TBCA 4TYUA 2FHBA 5E0QA 1MJ7L 2FBJH 3DJSA 3WIHH 1I7ZB 4P06A 1FYHB 3WFHB 5IM7B 1QSEA 1Q90A 4I0CC 3QAZB 2GITB 4XPFL 4N4YB 1CS6A 2YEVB 5EBWA 4BSWA 1QSFD 3MKGA 5AVWB 4JR9L 1U4FA 2G30A 4UV7H 3SYCA 3ZHNA 3SGKA 4URKA 4XP4L 5TQ2H 1A3RL 1S7SB 2F15A 2EIZA 3QIWD 2CJUL 3EYSL 3QXTA 1U93A 2Y7OA 1JGEB 3EO9H 2BLFA 3NGBC 1ETA1 3G6DL 4LIQL 1UZ8B 2J6EL 2XYCA 2JELH 5MEQA 1OAQL 3RIKA 2QGCA 4PG9A 1KENH 3T65B 1P9MC 1PG7L 3FBQA 2QQKH 4LVHB 3VA2C 2C9UA 3OPZL 3UO1H 4UV4H 1OAYH 2B0SH 5C0JB 4QO1B 1JXGA 5BVJA 5I75B 4KY1L 4QGTA 3HNTL 3QQDB 1KWKA 1QSFB 1MCSA 5G5DB 4B50A 5ESVB 2QVMA 5DJ0A 5EF0A 5GGSY 2VMCA 3EF4A 4ZMXA 3SO3C 3QCVL 4L4TA 3LIUA 4D8OA 2CBTA 5AVQB 2EO9A 3QIWB 2GBUA 2WXIA 4LOEA 3FCTA 4D0DB 4F58H 1KYFA 4I3RL 3HZVB 1IM3A 5FXCH 4EQ3A 1CFNA 1XL4A 3FF7A 5CM1A 4MQ7A 5ICXA 5GRVL 1UWYA 3Q44A 1RL1A 4KZDL 2A5UA 2E3VA 2VN6A 4PRPA 1JZ7A 4G7RB 4V2BA 3S4SB 4NZRL 5HDBB 1AD9A 4FFWC 4AV5A 3NCJH 1MFUA 2QHRH 4WW1A 1GSKA 1P7QD 1Z9LA 3I6LE 3RUGA 1FL3B 3ULSA 5C0FB 3IDYB 4X0KA 4CBZA 5DU7A 2W0LA 3R18A 5FO7B 2X42A 3LKOB 4ONHB 4RGNC 5CEXA 5LLIC 1OE3A 2RFXB 2BY0A 2FQDA 4QJ3B 1BQSA 1IGCL 2HKHH 1NBZA 4UNTA 1IKNC 4FQJL 4OJEH 2H0FA 2CCWA 2EABA 2FEEL 1U30A 4CVWA 4JE0A 3BZFA 3VYOA 3IGKA 3R19A 3T1FA 1GW6A 2YWYA 1IBYA 4BH8A 4DEWA 4H44C 2NY0C 4JHUA 4XBGB 4AMXA 1P7QB 2PF6A 3DGGA 3AM8C 1TO5A 1RVFH 5SWZD 5I18L 1LK2A 2ARJB 1IB5A 2L3BA 2WWMC 1S3RA 3QDGE 3F5WA 3MODH 4M4RA 2YGNA 4IBYA 2R4SH 2DN7A 2UXVA 4DUVA 4N28A 2MPAH 1UD6A 3O45A 4UT9A 3AY4A 5KBNC 3VG0L 4QF1B 1ZHBB 3LD8C 3U6XA 5HI3D 4EEEA 5T5NF 1YC7A 2MCMA 3AXIA 3BXNB 3UYOD 4Y1AA 3P0YL 4B9GA 5MI0C 4QHUB 4HJEA 4PJCA 4WKXA 5FUZH 1OQXA 1VJSA 1KJ2L 1AG6A 3KNBB 4BHUI 5F21B 5A2CA 3ZUNC 2OZNA 3DECA 4LDEB 3OSVA 4WFGD 3BW9B 5JHDB 1QZNA 1NCAH 2O26U 3II3A 5EUOB 1YNKH 2FNWA 5IEKA 1BM7A 5IB2A 5SWZB 2O4EA 4UTAL 2IWGA 4OLEA 3MLRL 4OF8A 2WANA 5EBLA 4B97A 1Y0LB 5FYJL 2XXMB 3MHZA 4HXBH 2HLEB 1ZDQA 3ROLB 2YPVH 4JRYE 3IGUA 4D7BA 3MGOA 3WSQH 4PVMA 3VJ6A 4F8OA 5C9JB 4OGXH 4XPHH 4PJFE 4TSCH 5F7NC 2WXQA 5DD6B 3VFTB 5JA9A 2W88A 3AT0A 4NJ9H 5I1GH 4P9MH 1O6SA 2GY5A 4P3DB 3GMOB 4NNXA 4PHZA 3DLQR 4OCSH 4JG1L 3VXMD 4GP4B 4L2LA 2VIRA 3QUML 2VR3A 1YUHB 2WGNB 4P49A 4XCNA 1DE4A 4LSSH 1BZ8A 1C12B 3MLTA 1R5VB 4G1MA 2HFFA 3RWJB 4BKLA 4OM1H 2ZG3A 4OUUA 4HS8L 4KI5E 1NIBA 4TRPH 4U4IA 3O0RL 3QDAA 3E6HB 3JWDH 1KGJA 1CLYL 2Z1KA 5T1DH 2XZQH 3RI5K 3VXUD 1HQ4B 2AKRA 4PJXF 2I5YL 3VD1A 1EGJH 5C07E 1AZZC 2ZF8A 3AADB 4RNRA 1G5AA 2APVA 2LHAA 4KQ3H 1N6UA 3VXOA 2ENJA 4ODVH 1G0YR 4OVUA 2WXKA 1OP5K 5IMKA 1YZZA 5FFGA 3T1WA 1ONQB 4M6MH 4CU8A 1GYAA 2VOTA 3NFPB 1T22A 1NCBH 3VXTA 5CHNB 2O6EA 2PCPB 5DJYA 4QXGH 3AGWA 1BMGA 1XR9B 3VXMB 3SGKC 2YN5A 2CK2A 2UVFA 3FQUB 2WZ0A 4MDIA 1MFAH 3QJVB 2P42B 3IMVA 4DERA 4BRJA 2ADIB 2IMNA 4WKZB 2VSDA 3RG1C 1KIPA 3PXJA 1CGSH 4DP1X 2O6DA 1CLOL 4LSVL 3R4RA 4OCXH 2FJFB 3VXUB 3WNKA 4HUUA 2W0PA 5DJZA 4FI7A 4NRYB 3PP4H 1E67A 4JW3A 3PUUA 3QFGA 1DQDH 4P2CG 3OC5A 5AW0B 5DA4A 3RVUC 4OW6A 1PSKH 4X4KA 1WIOA 4ODBD 5F3BB 3EJQA 3MLWL 4P57A 4DP5X 3U25A 4ONFH 5D1QA 1A6AB 4W9EC 4RIRB 5CN2A 2G5BA 4A39A 1MG2C 2VLRD 3SKJL 2Y6SD 1VA9A 3NCYS 1J9RA 4L23A 2XX0A 3GRBA 5ESQB 3EGSB 4HEMA 1CFSB 5FO9A 3DYOA 3HBZA 3F7KA 1W8EA 1SY6A 5GGQL 5AW3B 3E2HB 1CL7L 5F89A 3IMTA 3V6OA 4MCMA 1R5IA 2B2XH 2OPCA 3KHQA 4PBXA 4TNWF 2WCGA 4WSKA 2K78A 3DSNA 4FQ1L 1KXQA 5EU6E 4XPAH 1E9QA 4MZ3A 3IU4H 1ZK9A 1NIDA 3PAVA 3FOLB 2WUBH 2DBLL 3BP6B 3N42B 4IMLB 1C5CH 1N59B 2F53E 2QBWA 3RWGA 4MB1A 5JPNA 1RFDH 2VLRB 4GO8A 3HG1A 4QY8B 1N2RB 5L2KA 4JRFA 2DQIL 4HIEB 3CE1A 2C3VA 4YHKH 2Z93B 1I1CA 5E5LA 4ODUA 3RA7H 3WXVL 3BZ4A 1U95B 1RZIA 1VFMA 1HS6A 2DLGA 2AABH 3RWCA 1EJ6A 3QJOA 5DRZA 5H94B 5J9PA 1REIA 3QJUB 2ZTBA 4YBHA 4ONGH 2ITCA 1QFWM 3FUMA 3PWPA 4B53A 3FQXB 5GQBA 5K9KB 4X80L 4DP0X 3AY4C 4JFYB 1TJGH 5DRXA 5JHLL 3A4AA 4KXBA 3RGHA 3T77B 1M7XA 4FA8A 1NANH 2BWDA 4MD0B 3CPLA 3QORA 1LP9E 1QNIA 3PY9A 5DT1H 4BZ2H 2ZKHL 2OMYB 1RJYA 2PTTB 2OMTA 3T8XB 2ATKB 2Q1EA 2V8MA 1KBBA 2H1PH 2ROYA 2JQZA 4ZMAT 3ULVC 5FA4B 4GUPA 3MA7A 4P5KA 1U3HD 1WITA 4WSJA 1H6FA 1X5AA 2VERA 4XP1L 5FDYA 4GKNA 4KFMA 4YX2L 4YDNA 4X8XA 1LK3L 2MCG1 3PCYA 3QDJD 4Q58C 4PLOB 3UC0H 1C8PA 4EE2A 3SBPA 2NXZC 4ZOEA 1ZT7B 1WCBB 5EN2B 1QSVA 4B27A 5AOZA 3BWUC 4W4NA 1YN7B 2WWKT 3BP7A 5HHVL 1DCEA 1S7QA 3RQ3A 2F74B 1BXUA 3BUBA 2WQRA 5F9OH 3KWTA 1G7MA 2BDNH 4KK8D 5MI0B 5CD5D 2VRQA 6CGTA 2ADFH 1MCEA 1E5ZA 5KYUA 3KGUA 4YHOL 5EHFA 2A9NH 1J9SA 4A6YL 4HK3J 4UWQB 4N8VB 5DK3A 3DTUB 1ORSA 2Z0UA 4ES9A 2DTMH 1R24A 1VESA 1E0OB 1FFPA 1E6JH 5I16B 1WAAA 1JAEA 2PYED 4IRJA 1NCNA 1FZJB 1CICA 5IB4A 3KBEA 3V4VH 5FS5A 4KROC 1FO0L 1OE2A 2PLTA 1U3HB 3J2PA 5DC9B 5LWYL 1ZTXE 2BP0A 1HCYA 5DZ9A 3QDJB 3O2DL 2AEPL 4S11A 3B2VH 1SEQH 3OLGA 4OSUL 3ZE2E 4B9ZA 4U7MA 5EZJB 2CKNA 2DIAA 4ZD3H 5DMGC 5T1KA 2GIYA 2QEJA 2R51A 3WNNA 4RGMB 3FO1B 3I2CH 1UXLA 3GSRA 4IK7A 4H5SA 1N6VA 5E6SB 1UT2A 2R69A 1USZA 3SDXF 3FRUB 4NWTH 3TBWA 4YZWA 3X1EA 3IDGA 1I1YB 1IGML 1K8DB 3GSNH 2RCSL 2AC0A 1BQLH 2F08A 2EYTB 2PYEB 5JXEA 3WEXA 3PJSA 2CR3A 3LH2H 3KYMB 5J4MA 5IVXF 4N5ED 4NHUA 1OCOB 3E6FB 5DK0A 4HUWA 2VDMH 4N9GB 3VFRA 3D51A 3HLAA 2OLDA 2W60B 4JFUA 4WK0B 4MJID 3KVDD 4HQQH 4PR5A 2DYRB 1ZKAA 3ILDA 3I6GB 3CFIC 3NVQA 4P2AA 5BRPA 4UM8B 4CW1A 3IGAA 5FO2A 4HPYL 5IESH 2Y5EA 4JY4A 2NW2B 5DJXB 3FKUS 2X38A 3RVUD 1QR1A 1M9WA 3DSFL 1R3HB 3B6SA 1MQ8A 2H32A 1EAQA 5D1QC 4C55A 5F6HI 1GS8A 1HHGA 3IM1A 1A7NL 1GOHA 2XIDA 1O7DC 1HH9B 3IK2A 3QQ9D 5K9QI 2LAGB 1O7SA 2NY4C 1I7UB 1J10A 4NSKB 4R96B 3KH3A 4BXSV 1DN2A 3N43F 3NCFB 5D6CA 4WTZG 4NZ8A 3T2OA 5E1AA 3KL5A 3O6KH 2L7UA 2WV3A 3HN5A 4X4XB 2WINA 4Y5VB 5JZ7C 1AO7D 3DMMD 4LEXH 3PWUA 3BVUA 2P80D 3QEUB 2DYPA 5IEHB 2BW4A 4MASA 3V6OC 5FYLH 2VDRL 1J8HD 3MPCA 5FFOA 1YAIA 3D12B 3B3BA 3PQYE 3AQDA 5TDNA 3L54A 1OE1A 2ZUXA 5HHPB 3X11A 3ESNA 5I30H 5I6XC 1MCBA 3J27A 3CFKA 3QZLA 2R9HC 3FCTB 5CLWA 3STZA 5JPNC 1FYTA 4J6IA 3BPNB 5ICUA 4LCIH 1OWRM 5CD3B 5CNHA 4ES8A 3DX3A 3E1F1 4XCCL 2WIIB 3LN5A 3FT2A 4GLRH 3WIAA 1TEFA 1CFBA 2CGYA 1P4LA 2VMEA 3RNQA 4K3HA 1B0WA 3MBED 4N2EA 3Q5OA 4QRPD 3RUGB 1X3DA 1LE9B 1AO7B 4LEOA 3DMMB 4WEBL 2D4DA 5KAQG 3BT2L 4HGWB 1U3ZA 1J8HB 1XD1A 5CEXB 5E51A 4PTTB 4LPTA 3GMLB 5F93C 2LU7A 3K7UA 3I9IA 3RAJL 4PJIA 1RZ8A 1QP1A 3TYFB 4NAMA 4UIMB 1S7TB 1SDDB 2XZZA 4YJZL 2IDTA 1CYGA 4KTGA 3DYMA 2DQCH 5TF0A 4ZTOL 2W38A 1CT8A 4I2XE 2DI9A 3TBSA 1N5YL 5TE6H 2E5EA 3QORC 2PXYD 4Y1AD 2ZAHA 2BOBB 2EDRA 4UT9H 3F2LA 2WO4A 5IB1A 3CMGA 4LSPL 2IPUK 3TVMD 4DESA 3UZVB 3NYKA 2X4SA 2JCCA 3DBSA 4NKOB 4WEEA 5DJ6A 3O0LA 2HYMA 2FX7L 1JV2B 4LB8A 5TPWH 4QRPB 4WWOA 4BFEA 4N26A 1MWAB 4B95C 1YPZB 1U8LA 5LGYA 4Y4HD 4JPVH 4YSEA 1FJ1A 1BEYL 4LOFA 5KN5B 5JO5A 2O30A 3L9BA 1FWXA 3A67H 3GHPA 2H6OA 2D31A 2HJKA 2W94A 1XGRB 3F00A 3OAWA 4H8PA 4JBSA 2XG4B 5BNXD 4NBYB 3VRIB 5IQOA 1HINH 1PAZA 3MLYL 4WEMB 2AMUA 2PXYB 4Y1AB 3TNMA 4DW2L 1FNEB 4BQCA 5K59F 2PABA 3KPPA 3GSOB 4JG0L 4N8UA 3QJRB 3ZE0E 2I24N 4LVOB 5AG9A 3G6AB 4U2ZA 1PLBA 2GTZA 4BYHA 1X4YA 1KBWA 1XAUA 3SJVA 2DLTA 2IQAA 4OLYH 1DO6A 5ALCL 4JK0D 4PCSA 2ROXA 1CICC 1D7DA 1MVUA 3BESR 3HI1A 1I4FA 1JPFB 4Y4HB 1R9FA 3B7SA 1OTSD 5IQ7L 1BVKA 4XNYL 4A2MA 3CFEA 3VW3H 1ZHLA 2HLFC 7PAZA 1B4RA 1LXMA 1DUYA 3H4FA 4PJAB 3IXAA 1GHFL 2O72A 1PEZA 4KJYA 4G83A 1ETZA 1ZXKA 1INEH 4YNYA 2BVQA 3VI3A 5AYUH 2N0KA 2ILLA 3HUJB 4JY5H 2Y5QA 5DCCA 5I1CH 1M1SA 1BBDH 4GKZA 2JJUA 1C08B 1UVQA 4FI8A 2OTWB 4OIAA 4YLCA 4RGOL 4L1DA 2CUHA 3JZ7A 2VDOL 3C2AH 1DJHA 4WJ5B 1AGEB 3MLTB 4LDCA 4G1MB 2HFFB 2OK0H 2CO7A 2DYSB 1E43A 2X10A 1MCHA 1OLLA 2MCPH 4BFKA 5JXEC 1OTTC 1TZHB 3C5JB 3ABKB 3VXPA 2A6KB 3OJVC 4Z7VF 4GUQA 2D9QB 2ITEA 1OALA 1JSYA 2AKRB 3IFNL 1Z3RA 3U0WL 2QMJA 1KNOA 3W2DH 2PCYA 1X6NA 2EDYA 4YK4B 5D9SA 4IKNA 1LEIA 5IMKB 4QLRA 2YKLL 1CDUA 4JRLA 1A4JB 5DC0A 2B1HL 4K3GA 4DZBA 2H2SC 2AXFA 3P4NB 4JFZL 3NEEA 2C4XA 5D2LF 4Q8BA 3H9HA 3X14A 3IDNA 1OAZL 3OXSB 4MXQD 1ZSDB 1UM6L 3EJUA 3V6FA 5CP3A 4NJAH 3U7WH 2CDEB 1QW8A 2VABA 1J1OH 5G4NA 1F4YH 3T3PE 3UEQA 4ZMPA 3U6RB 1Q8MA 3EFDH 2EDKA 1NANI 3IFOA 2E7LA 4M48H 1E40A 4P2OA 4AZ8A 1SUJA 4LU5L 2FJUB 3WKML 4JJHA 5ALBH 5I74C 4HUUB 2GAZA 3NIGF 3R1GH 2FRGP 1OKEA 4JZJA 5IV2A 2HRHA 1RK1B 4K2UH 3I74A 4QCIB 5KYWB 4M93C 4U2YA 2BCMA 2DWDA 1FH5H 3R8QA 4XN7A 3ECUA 1KN4L 4EXPX 1D5BB 4POUB 5J6SA 3RIFF 2AK4E 2WTPA 3MNZA 2Q8AL 1YEDB 3BUTA 1SXSA 2K3TA 4OGYL 1IIIA 2FYVA 3ARXA 2J4WL 4YC2C 5D70L 5A2BA 4PJEB 1NCOA 4P05A 3IJHA 3US0A 4XVUC 3AW5A 4AQEA 1PZ2A 4ATTA 1FC1A 4RMUA 5T3ZD 3JV4A 3QXUA 5FF6A 5GSRA 1RSYA 1RZQA 1XGQB 4FQXD 1OGTB 1U8QA 2DDQL 3CVHB 3QQ4B 5D1ZI 1KB5L 4NERA 3LSOA 5K9OA 1TG8A 3NCWA 4K7PY 3OX8A 3P4OA 1G1KA 3GHEH 2E47A 4XCFH 4Z95L 3IU3A 1H6EA 3WU1A 1VEMA 2A77L 2JKJA 1R5IB 3H7BA 4TUOB 3UZQA 1OAJA 3MRFB 4PJHF 3I75A 2EDTA 3D50A 3L3JB 4UDTA 5EEWA 3DSNB 2NY6D 5CN3A 4LFHD 2MHAA 5ABAA 1E9QB 3BH4A 4QR7A 1UWXH 1ZVSA 2Y2TA 3S34L 3FCUB 3HNVH 4O4YL 4ZFOB 1RPUA 2EH7H 3GRWL 3L7FA 4FNUA 3OF6A 3QIBA 1EFQA 2KMWA 4YHNB 2YHGA 3QEHB 3MLUL 3C08L 4JO8A 4K71C 1WHPA 5DQDL 3UYPB 4TSAH 4FQXB 5A3IC 4PN6A 2ZWNA 4RWYH 1Q9WB 1H19A 3ARED 2G9KA 3MSPA 3LQAL 3N55A 4MB5A 2JB5L 1AI1L 1J0IA 3ARBA 4ODUB 2IAMD 2V7HA 2QKIB 2HVKA 3Q48A 2P5WA 3V5DA 1U3NA 1F41A 3RWCB 4Z3FA 4M62L 4C54A 4Y5YA 5C0CD 2J44A 1IVLA 5J0BA 2P26A 2NY6B 3OB8A 5KYYA 4KQ4L 1J1XH 4GXUN 1A6UH 1QLEL 3LYRA 3PGDB 2XC8A 1KBGL 2Y36H 5FA3B 3DO7A 4RFEA 1BZOA 2C9PA 2FBJL 4W93A 4HALA 3WIHL 1LWRA 3MYJA 1WAEA 2FSDA 3IMRA 3QULA 5DHXB 4W4OA 4PCTA 2FWUA 3WFDH 3AREB 4UV7L 1F56A 4L5FH 2WXPA 2ZKMX 2QVFB 4I1NB 4IBTA 4XNZC 2HAZA 3DETC 4WI0B 2IAMB 4YHML 2CO4A 2PTUA 4HJ0D 5IFJB 1FFQA 4HAKA 3WHXA 4O51A 3QWRD 4N0CD 2XQYK 4EVNA 2AV1A 2HUHA 3FUIA 4KKLC 5C0CB 3P11H 4P0DA 5DFVC 3PV6B 4F2FA 3B8SA 1D5XA 2Q10A 2P28B 4NXSA 1N64H 4AQ1A 2IFFH 3JVFC 1NM4A 3P02A 4OZHA 1CBJA 1IU1A 2J2ZB 1JVKA 2QQKL 2AXWA 4ODXA 3UO1L 4UV4L 2R15A 3FS9A 2B0SL 3RL1A 1BLIA 1G7MB 3D87B 4JFEA 4NN5C 2ZUQB 2XV3A 2QTVA 1OL0A 3EOBA 3JTTA 4QGYA 3V9EA 5IMOB 5AALA 5F7EH 3L4TA 2VMFA 3Q2CA 1UD5A 3RRQA 1DQIA 2AJ3B 3F7LA 3QO0A 4A6YB 1FFPB 3G5VA 2R69H 3VD9A 5IB4B 3WTUA 1OTTD 1DVZA 2ZAIA 2Z35B 1SVZA 3BAXA 4O2FB 4P2QA 4OBSA 3ZGHA 4XX1G 3MROA 1MCWW 5CGMA 1FL6B 5DHMC 2DB8A 5HPMA 3K91A 4GLRI 2V9RA 1YC8A 3KVPA 4JGMA 3FQRB 1BAFH 4LSQH 1XXFC 4ERSH 2GBAA 3OHXA 3T8VA 4HJIA 2VXQA 3LRSB 1ZV2A 1TCRB 2FNBA 4IKJA 2EICA 3FXIC 3LVEA 3GIZL 4QUOA 2WBJD 1RHHB 4GP5B 3BN9D 4UBDD 2BRRH 1T21A 3NABH 3DXAA 2HKHL 4U6HB 2MWCA 1NMAH 3L6FB 4HIXH 3CD4A 1E9PB 4PWJA 3LXCA 3PJSB 4FLSA 3WEXB 4HHGA 2H32H 2E7LC 4P2OC 4B60A 3ZL1A 5E2WL 1V8HA 4Z7WB 5GPRA 1SJVA 1KB3A 4JZJC 3L8QA 1AQHA 1S4IA 1J9TA 4WDIB 3IGAB 4NNYA 4PJ7A 1NBYB 1QUPA 3KLDA 2EH8H 2F58H 1CFQA 4OQ1A 3HC0A 3ZZLA 1RVFL 3IFLH 2CHDA 1IC7H 3EG9A 3EFOB 3B7RL 1G87A 2WBJB 3MODL 1DHKA 2R4SL 4IOFC 2MPAL 4LEEA 2HFEB 1L9RA 3C60D 1QD0A 2OCFD 2WXMA 5ACZA 1HHIB 3OXRB 4GAYA 2CLZA 5HI5C 1IBBA 2R2BA 1V27A 4C83A 3FOMB 1AY1H 2V3FA 5I74B 3L4YA 4OFYA 3L5WB 3GKWH 5D7EA 5FUZL 2B59A 3MV7A 5JXAL 1WTGT 2WZ6A 1TLKA 1X9UA 3CAFA 1SGKA 2GIXA 4JPKL 4X9YA 4KMTH 3ZT5A 4RCAA 4AQZA 5KSAD 3VQ1C 3UZEA 2MH4A 3NN8B 1NCAL 3ARDA 4W9LC 3UPRA 1YNKL 1W6WA 4H26A 3G6JE 2ZP8A 5HJGA 2XPGB 4O2EB 4P4KD 1UCTA 2VDLB 5FGRA 3WN5A 1PNDA 2MOGA 3D0VA 5MENA 2YPVL 1KXTB 3C60B 3QIBC 3WSQL 2HJFB 3B9DA 2DKMA 3BGMA 3LIZL 4OGXL 4XPHL 3HIZA 4D8PB 4MJ5A 1DUZB 4NN6B 3GZKA 1MVYA 2VQ1B 4UU9A 4LCYA 2K8MA 2KL6A 5DMIH 4KAQL 4NJ9L 1G6RA 5I1GL 4LBEA 3FHAA 2ZYIA 2AXJA 4G8GE 4IQHA 4MXVE 1MI5E 4OCSL 3ESUF 3ARBC 4LLWB 1JI1A 1K85A 3STLA 4WGWB 5IR1B 1F13A 4E9QA 4BSVB 5KSAB 2C4FT 4LSSL 5EEZA 4NQVB 5C0BA 4A68A 4Y5YC 4F8NA 5B7FA 4OM1L 2HX8A 4LZKA 4I3GA 1B4JH 1RV6X 2FD6L 5DJ2B 1K2DB 3MRLB 5FUCE 4G80B 3DDFA 3JWDL 4P4KB 3UJJL 5T1DL 3WIIH 4CDGC 2W9EH 2XZQL 4R5XA 3VFPA 1KACB 2QVKA 1CPUA 1EGJL 5JMRA 4PGCA 1RUPH 4HKBA 4KQ3L 4QKTA 4Y4FA 5DGRA 4W4OC 3Q1SH 4M6ML 1JPTH 4MX7A 4A2EA 1NCBL 2X0WA 1T0MA 3VXSD 4QXGL 3OHMB 2AQ1A 1VERA 4W9ZA 2CKBA 2DM2A 2MNJB 5F6HJ 3UTQB 3OSKA 5CAYB 4FQ2H 4JHAH 1J05A 3DVNA 2GB2A 2J72A 5DMKA 4GG6A 3HTLX 4J3OD 4N8PA 4I13B 1T66D 2XZAL 1FJ1B 5FHAH 1CGSL 4AV0A 3UJTH 4JFHE 2EYRB 3N44F 1YJDC 1IGIH 2HJKB 1TETL 2P5EE 4AQ1C 3MV8A 4U1KB 2Q3XA 5I19H 4JFDA 4X0NA 3LEYH 4K7FB 4ETQB 5B38G 2MIZA 2Y2WA 3KPOA 3PP4L 5B1AB 5JW3L 3HPJA 4LLVA 5T1MA 2VM3A 1DQDL 4XMVA 4YZFF 4IOSA 4AMWA 1A9EA 3JV6B 3VXSB 3BIKB 1JXJA 3I9GH 2GTZB 3AY2A 1YQ2A 3PP3H 4UUJA 4L48A 5FV1L 5L2JB 2IQAB 4ONFL 5HI4C 3CUPA 4XB3A 2WBKA 32C2A 4R97B 4CADA 3S88L 5LAXB 2ZF9A 3CN2A 4G8IA 1BVKB 3CK0L 3ECWA 1LE5B 1HAUA 4R4NC 1ZHLB 2NW3A 2QV4A 4O9HH 4PVLA 2Z9TA 4G8EB 4OCMC 3C6LA 3VM5A 2GSIB 4YHYB 3QEGH 3EO1B 3OHXC 4HCRL 1JP5A 5I17B 2X2JA 2FLMA 1ZVYA 4GKZB 1UVQB 1O0VA 1WZKA 4E9LA 2CH8A 3FSZA 5A2IH 1OSPH 1X9QA 5TDPB 4M1GL 1NCJA 5K5YA 4J3BA 3TBTB 4XN2A 3O2VH 4XPAL 2CG9X 2X4OA 1OY3B 3IU4L 3P9MA 4X99A 3ZHKA 3GBNH 3JT0A 4KK6C 2WUBL 4GIOA 3FU5A 3VXPB 4TNWK 1COBA 1WWBX 1C5CL 5J3HD 1NIEA 4RRPM 5EU5A 1HCZA 3EOAA 1RFDL 2E9IA 4U1LA 1P1ZA 1VFBB 3CH1B 2CRIA 2DI8A 2BRQA 2FX9H 1M3JA 3KM2A 1HYSC 4ZMWA 3BH8B 4YHKL 4PRIA 3MMEA 4KJQD 5ANMB 1X5JA 2O5YH 1LEIB 1HNYA 3RA7L 1JN6A 2YKKA 4NO3A 5DHYA 1S5HB 4DZBB 1HOEA 4LLDB 3CH8A 1TPXB 5E1GA 5HJ3B 3ZR6A 5I71C 4ZSOA 4U6XB 3EBGA 4HKJB 3VFOB 3OQ3B 1DTUA 1QLRA 2CD0A 4KTEH 4ONGL 5F7DA 4DVBB 2IALB 2EZ0C 1TJGL 3FU3A 3GK8H 1UD3A 3WIFA 1G7IA 2XXFA 1GPOL 2AI0H 2W95A 2EE9A 5J11C 5I8CA 1AVAA 4ZFFB 3GUTA 3RUGF 5L4FA 1S9WB 4G72B 1FNFA 1ZIBA 2ESVE 5AOMA 3LNEA 4EDWH 3B9AA 5B3NA 4WUUE 5IW1B 3MNWA 1ZK5A 4FI6A 4HD9A 4X50A 1TQVA 2H1PL 3FHEA 3EJZC 2DWDB 4UTCA 3UZEC 1L5GB 1G7PB 3ARDC 5TDOB 3LRHA 4C57C 4EUPA 1NINA 2H41A 1U8KA 5LNDA 4BH7A 4MCZA 3FBKA 1D5ZA 3WN5C 3VGAB 5B3SB 2EIEA 2IANA 3ALPA 3N9GH 4M5YL 2M8XA 1FV1B 5CMAB 1F18A 3GB7B 4OI8A 3G9AB 3VXRA 2XKNB 3HHMA 4M3HA 4AYDC 4AQEB 4L3EE 1PZDA 3CN3A 1TVBA 5FF6B 4ABWA 4OM0L 5I5MA 3HB3D 5DZOA 4NQCE 3VQLA 4CVXA 1H8LA 1T2JA 5SWSA 3TZVD 5F9OL 4F9LA 2BDNL 1EAPA 4JLRB 3ETSA 2ADFL 2Q3ZA 3ZKMD 3ARBD 1LQSR 2A9NL 2VN3A 4Z7NF 4HLZG 5CLXA 3QYCA 4NIYE 1P5UB 3IU3B 2OX5A 3EJCA 1L9OA 4ZXBD 1E6JL 1U8CB 3OLIA 4OD2B 3NIDB 3I75B 4GW1A 2R1WB 3V4VL 4X6DB 2TSAA 4XAWH 5DTFA 3D18A 2VTFA 1U92A 1R19A 4P46A 2JV6A 4GSDL 4R2GD 3ZE1B 4XC1H 1TZ8A 3U79A 1V55B 3GZPA 3UP1A 4PJCF 1PIFA 2ZOKA 4RMQA 3WNJA 3GJFA 3FTSA 4Y4FC 3HR6A 5I1KH 4XT1C 2FT7A 1SEQL 3WKYA 4A66A 4CSZA 5KVDH 3QXAB 4P2RD 4P5MA 3TZVB 4E36A 3ULVF 5DVLA 1HL9A 2L04A 2QQNH 2LU5A 3MRGB 1UZ6F 2D9CA 4XRCB 3SBRA 4LHQB 4W81A 4F8TA 3ARBB 4NWTL 4XWGH 4DIXA 2BSRA 3BQVA 1ZE3H 2ARJQ 5D7IE 4DOHB 4JEGB 3GSNL 1L0PA 1BQLL 4ZXBB 2A1WH 2BNQD 1U91A 4C4UA 4X5WA 3B5GA 3ULUH 4Z7IA 3LH2L 4UT6A 3BSHA 3MV9D 3P0GB 5DVNA 3VSQA 1JZ5A 4HV8A 1RZJL 3BWUF 3FB7A 4ELDA 3AUVA 3UAEA 4DH2A 4R2GB 4S0TD 4QHMA 3CFTA 1G1OA 2E7HA 4HQQL 4ODWA 3GXMA 4BSJA 4LLAA 4ENED 4NNPH 4ANKA 2BXZA 2OMXB 1V7NH 5AQ0A 3APDA 3MYJB 4OZIA 2IBZX 1YJDH 3UAJA 3VFMA 3F84A 5IESL 2XLLA 1H3TA 4P2RB 5EOQH 1NIAA 2YD1A 2VMDA 2N3JA 1K4DB 2EIMB 2UZYA 3ZRCC 3ZKNC 3TC9A 5A2KH 2FIKB 1R5WA 5C09A 1PJWA 2BNQB 4AK2A 2R23B 1DVFA 3KPRD 1W6LA 1XB3A 2R1YB 4U1NA 1ZGLP 1K5NB 4JUSA 3C6LC 3IJEB 5LDSA 3H54A 4G8AC 5C0GA 3RWDA 4ZG1A 5CZXD 2OS7A 3O6KL 4ZMTA 3ZR5A 1OD7A 3CZEA 4Q74A 4J1UB 4Y5XA 1ZA3B 3JVGA 2ICWI 4LEXL 3QG7H 3RL1B 1TMQA 4HJTA 5EA0H 1YY9D 2FEDC 3WXWH 5FYLL 5C0DA 3EOBB 4Y9CA 3VI4B 5AVSB 2VC2L 3VWJD 3CJJA 3SD5A 2VXQH 1O7VA 4AIZB 1O9ZA 2CM5A 1WFMA 5IFAH 3DXAD 4AZUA 2YEZA 5KS9B 1FAKT 4KKAD 1B4LA 1JF1A 2XETA 3MDJA 4OAWA 4ZQKB 3UC2A 3U1PA 3QJXA 5F6IC 1TVHB 4I77L 3NACH 3SY6A 1QOKA 4J8QA 4M8UA 3WUWG 3ZDYE 1E9OA 3MROB 4LCIL 5FX3A 3OKLA 3T0ED 4ZMZA 5HHOD 2B3RA 4W9IC 3W0WE 1TSHA 2YPLD 4HJSA 5CLTA 2O6FA 3TWYA 2P52A 1NGXA 3IJ8A 2X4RA 2AQ3A 4MJJA 4D9LH 3O3DA 5ISZE 4K9EC 2YAOA 3BP4B 3DOHA 3MCLL 2O61B 5CJ5A 3QH3B 1TQBC 3VWJB 4ZS6C 4YHIA 3ARWA 2R56L 4L8DB 3SODB 1I8IB 3DXAB 3EYOA 3G04A 1YEEH 3MYZA 5IBUB 3CDZA 1NMCC 4B0MM 2Y0SA 2ZKXA 4J3VA 4F7MB 1BFOA 3K6DA 4IRSA 4TUKH 1YYCA 4ELKB 1U8NB 5DEGA 3ZIMA 5FHBH 2QGBA 4CC1A 5TE6L 1AZCA 5FEBA 2WVVA 2ZCZA 1QTPA 4FF9A 2RMNA 4U6TA 4UT9L 3T0EB 4CUCA 3A24A 2OV0A 2EUWA 1Q9LB 3CTTA 2Q0ZX 2YPLB 3DHJA 4WW2A 4JQXA 3V0AC 2YD5A 4FOMA 3QK0A 1E42A 4PVNA 4BFGA 3E3QE 4NNYB 1UJ3C 5ITFB 1JDAA 3CIQA 4M7LH 1BVZA 3FQWB 1F3JA 2BWQA 4JPVL 1GKOA 4AM0Q 1A6VL 3MBWB 4HLEA 4JFQB 5T1JA 4WWPA 3PIQB 3LS5L 4QRTA 3S5ZA 2W0FA 5DQJA 1OF2A 1GR7A 1WBXA 3KGRA 4MAYA 2WO2B 2WXGA 1VPOH 1HINL 3RB5A 2ZNXA 2ENPA 5E5MB 4C83B 4DN3L 2YGOA 1KLGA 4MNGA 3TTSA 4F9LC 4LESA 4A7GA 3DX9B 1HHHB 3TO4D 5LG1A 4RDBA 3HS0B 4LHJB 1KPUB 2YMXH 2ADJB 2H5UA 1G6RH 2X4NA 3N40F 1PKQB 4OLYL 1Z2KA 5DUBA 2OW7A 2HXAA 1F1GA 1LHZA 3B56A 1SF3A 3ZMRA 1SJHA 5AOIA 1ACYH 3EGDA 4OKVA 5DJAA 4A7TA 4WI5A 2D7PA 5KOMC 4N3TA 2RALA 2LVEA 4Z7UA 4P46C 3W38A 4JRWA 4XNQB 4XOEA 3WNLA 3D48R 4YBQC 4Q89A 3ZTEA 5AKSA 3TFKC 3Q8FA 1AFVH 2A83A 3V4UH 2FK9A 1HILA 4ZO6A 3VFWA 4KK9D 1F1AA 3WFBH 4PJ9D 4JY5L 2XKSA 4V33A 4TUJA 2R4RH 1ZLUK 4Z76A 3J8F7 1Q0YH 1BBDL 5IG7A 1XIWD 1JGIA 1WUNT 4JFFA 5DD3H 4WVRA 5GS2H 1PD1A 2CRZA