1RH8A

Three-dimensional structure of the calcium-free piccolo c2a-domain
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
142
structure length
142
Chain Sequence
b'ASHPITGEIQLQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLMKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Piccolo protein
molecule tags Metal binding protein
source organism Rattus norvegicus
publication title A conformational switch in the Piccolo C2A domain regulated by alternative splicing.
pubmed doi rcsb
total genus 20
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2003-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1rh8A00
3ML9A 4EZKA 1RH8A 3QARA 3QJZA 4F91B 2K45A 1E8YA 3L9BA 4F1SA 4L2YA 1BDYA 4FJYA 3R7RA 3MJWA 1DJXA 5CCJA 4GNKB 4GB9A 5G55A 3RPBA 2RD0A 1W16A 1E90A 5T8IA 3F04A 2YRBA 3M7FB 4IHBA 1BCIA 5JHBA 2QZQA 2WXMA 2DMGA 2WXPA 4ICWA 3R7QA 5JHAA 3APCA 1DJYA 3FBKA 2CJSA 4ANVA 3N5AA 4DNLA 3HIZA 4PS8A 3L54A 4LCVA 3TJPA 2Y3AA 2WXGA 1K5WA 5CCHE 2QZ5A 1DJIA 1DQVA 2KI6A 2WXKA 2ZKMX 1DSYA 1RSYA 4MJJA 4G11A 1DJWA 2ISDA 4AOFA 5KJ7E 4EZLA 4KZCA 3PS6A 3IBEA 3NZSA 3APFA 2NSQA 2CJTA 1QASA 4KITB 4NPJA 3OHMB 1YRKA 4FHKA 3PFQA 4BFRA 4HVBA 4OVVA 3ZVVA 4KZ0A 4TV3A 2CM5A 3W56A 2WXOA 3APDA 4FULA 2NQ3A 4WWNA 1TJMA 4IQHA 1DJZA 3IM1A 4L1BA 1DJGA 4WEEA 5CCGE 2JQZA 3QR1A 4WWPA 1TJXA 4FLHA 1WFMA 3ZW3A 1W15A 2DMHA 2ENQA 4URKA 2WXRA 1DJHA 2CHDA 2ENJA 2A4ZA 4JPSA 3S2AA 3L08A 4NP9A 3L17A 4L1LA 3KWUA 4V11A 3DPDA 2LHAA 3ENEA 4J6IA 4NPKA 2UZPA 3NSJA 4F92B 2Q3XA 4LT7A 4ANXA 4HLEA 1E7VA 1E8ZA 4WAFA 3W57A 3ML8A 2A5UA 2K8MA 2CHXA 3PREA 4LDCA 3QK0A 3HHMA 4XE0A 3F00A 1BYNA 3B7YA 1GMIA 4BGDA 3L4CA 3CSFA 2R83A 3OAWA 3PRZA 3T8MA 3HN8A 3JZYA 3L16A 4Y1SA 2ENPA 4OVUA 1UOWA 3SD5A 4AJWA 5H4ZA 2Q0ZX 2WXIA 3P2BA 4XZ4A 4L23A 2NCEA 1QATA 4A55A 1E8XA 4ICXA 4FADA 2BWQA 3PYCA 2WXQA 2Z0UA 4QJ3B 2N1TE 4DK5A 1HE8A 2CHWA 4FA6A 3F01A 1CJYA 2EP6A 2FK9A 1E8WA 4FJZA 4PS7A 3CSTA 4TUUA 4FHJA 1WFJA 4Y1TA 2WXLA 1A25A 4NS0A 2V4LA 4WWOA 3DBSA 3TL5A 2YOAA 3LJ3A 3KWTA 1V27A 2D8KA 3FDWA 3ZIMA 4XX5A 1RLWA 4ANWA 4PS3A 3F05A 1E7UA 5EDSA 2FJUB 3GPEA 2K4AA 3QAQA 2B3RA 3QR0A 4QAMB 3L13A 3TWYA 2WXNA 1UGKA 5G2NA 3NZUA 4F93B 4QJ5B 2WXHA 5H4YA 2WXJA 1UOVA 4QJ4B 2X38A 2K3HA 3RDJA 2WXFA 2CM6A 4EZJA 2CHZA 4TS6A 4ANUA
chains in the Genus database with same CATH superfamily
1BV8A 5GGUA 3GTVA 3LV3B 3EJYC 4HD9A 4MNQE 3VUAA 2AEIT 2V5YA 1DQIA 1RJCA 2ZE0A 2JELL 1Z1WA 3P3UA 1DQKA 5IT2H 2Z34A 2HJLB 5DXWA 5D7IA 5D7JA 5T8IA 1MWOA 5DHYB 1A4BA 4P2QD 3JYCA 4FL4B 3S3CB 2AXJA 1U8MA 5TFSH 4FRWA 3AY4C 2B2XH 4KXZH 2MQ0A 2XACC 2PABA 4NUJA 3KYNB 4X4KA 1AIFA 4A7GA 4XN4A 2L7QA 2O4EA 3GUTB 3RI5F 1R3HA 4X9YA 1DJIA 2PP7A 4PS4H 1H3XA 3NJFA 2IMNA 2M2DA 3ATEA 4PJ9B 1DVFA 3CXDH 1P9MA 4KJWC 4I1PA 4FQ2L 4KFZC 3B56A 5E56A 1UGNA 5EORH 1VFBB 4UV4L 3QI9D 2Y7QB 1E9OA 1CT8B 1D3CA 3OPZH 4JHWL 1YNLL 4L4VA 1VPOL 3IDMB 5DQJA 2E59A 1TF4A 1BMGA 1USQA 4KMQA 4Y1AA 5MP6H 2DWDA 3TH2T 4EJ1C 1T1XB 2AK1L 5HHMD 4ZG1A 4RWHA 4P2RB 5LQBL 4OCYH 3IT8D 1IGCL 5F3FA 4LPWA 1XGUA 3CX2A 5GIRB 1HNYA 2GBTA 5T1DH 3T0WA 4RDQG 5F7AA 1X7TA 4OV5B 2EC9U 3HZ3A 1GKOA 3HC4H 3NCWA 1JGVL 1XF4A 2VLKB 1U3HA 4QGYA 5F3BA 1XH0A 4KMTL 3T3PE 3PFUA 2WKOA 4F15B 1DCEA 1RI8A 3HNVH 2YGQA 4FYSA 5AZ2H 3VVVA 5HSFA 3D69A 1I8AA 5B22A 2EEFA 3D25A 3NJHA 2H2PC 2QL1A 5DU7A 4BQCA 1CLZH 5I6OA 4KK9C 1B6UA 1ZT1B 1ZK9A 3O8XA 3N1PC 3LDBC 4NRYA 1GGUA 2A4EA 2HKHL 2N1TE 3RWHB 1K8DB 3S37L 3MZGB 1ZXQA 1CQYA 4JKPH 3JWNH 2V2XB 2PPDA 2VDRL 3P11H 1E3XA 5T3XH 3GRWA 3LN5B 2VLRB 2BW4A 3QAZB 4JFEE 2X2YA 3OR7B 2J21A 4NO0B 5BMFL 1WUZA 1EFXD 3VX1A 4XVJL 3Q5TA 4K5OA 5DJDB 4E41B 1JNHB 5C0CD 2XFXB 3I3EA 5E2WL 5EPMA 3RVTC 3NGBB 3A47A 2OP4L 2OM5A 2BNQD 1Z66A 3FT2A 3N3EA 1MFUA 5C0RL 4U3XA 4IRZH 3KBPA 1FJ1B 4KVNL 4GW5B 4AX3A 2AEQH 3OAUL 1ED3A 4IIQC 4KZEH 4WUUB 1YEJH 4N1HB 1A1NA 2AEWA 3VFPB 1A7NH 1BQLL 3SOBH 3CE1A 1P5VA 3N40F 1S9YA 3MV8B 5IV2A 3X3FH 3QDME 5JQIB 5IFAL 3H3BC 4YN3A 2DW5A 4UTCA 2E8ZA 5F9DC 3EFFB 4NRXB 1HZHL 5GZNA 3I75B 2GJ6A 4BFNA 3GNMH 5ELIA 4UDTA 2XYBA 1FV1A 4WV1B 3PPEA 3OVUB 4AXWB 3U0TA 4W9HC 5TH2B 2QZ5A 1KEML 4M7LL 3KS0J 4BCYA 1F3DH 3NP4A 4AGOA 3VB9A 1NFKA 2BMKA 4M56A 3TIEB 1QUNA 3D05A 4CKVX 3UERA 3VXMB 2J20A 2OMWA 3DUUA 1T66D 1IJ9A 4R7LA 5IJDC 3WTXA 1X6LA 4UBDC 5EH1A 2GJZB 3G6AB 4GIOA 4PWFA 5AVZB 2YPLA 3EO1B 2AXGB 2I32A 1HIMH 1RZJC 1KCUH 2NRDA 4QXTB 4XXCC 4NQEB 5HJ3B 1OGPA 1E5CA 4G8IB 2GEQA 1DJHA 3EYFB 3PGDB 3SKJH 3GIZL 3F8UB 3ZHKA 5BRZD 1ACXA 5ILTH 1H6EA 2B39A 5E5LA 4MMZB 3QSKB 3P73A 1S7TB 4L4TA 4J6IA 1UASA 1ZWIB 4ZBJA 4HXBH 3GZKA 4ODBD 5JUEL 2QGDA 5FB8A 1MCEA 1ID2A 1NIFA 1J1OH 1LNUB 1OE3A 3DJTA 3MVSA 4P4KA 2W65A 4HLEA 2PKDA 4LSPH 1F1DA 4Q2ZA 1BIIA 2HT3C 4GRWF 3I6KA 4GKOA 3QCUH 4QHNA 5JZ7D 3TH3T 4KMLB 4YL4A 3VRJB 3EDFA 3V4VB 2BIOA 1MVFA 1K9TA 4G8GB 3RTQA 3FL7A 4G8FA 3SD5A 3TNMB 3ULSB 4H1LH 1I7ZB 4L3CB 3W1ZA 2NYYC 1V3JA 2IFFH 4UTAL 2QV4A 3T65A 1A0QL 3V8CA 4YSAA 4PLJC 1N4XH 4PV8A 1FVDA 4P4RB 2XQBL 3MNVB 3ZLQC 1G0YR 2C1PA 2A9BA 2BNQE 1FSKC 4ABWA 2HT3D 1CFMA 1JZFA 2VDLL 3CX5K 1P84K 1XT5A 3MGOB 3T0BA 3TV8A 5KJ4A 2OTWB 4KAQH 4JFQB 2GJ6E 3MJ7A 5AZEL 1P7HL 4NN7B 2NPLX 4PHXA 4RGNC 2ZYRA 4WO4D 2BNUA 3RY6A 2QKIB 3L95B 2IH3A 4I9WD 3PHOB 1VDGA 4JRYA 4R0LC 4UILL 1SLUA 2LAAA 3VNZA 2NY4D 4ANWA 4ANUA 5D96C 3CHRA 4R4BB 4YDJA 2HX8A 4PGCB 3U6XS 4HCRL 3T4AC 2DQUL 3IXTA 4MMXA 3CZFB 2EYTA 3JV6A 3UZVA 3ZE1F 4YBQC 3BUTA 5CJQL 2QGEA 3A67L 3ZU8A 1FQ9C 4OAWA 1OE2A 5KVFE 3RKDC 4HU8A 3PHAA 3FB7A 5CJXA 4KI5E 4N8VA 2N56A 1FORH 3KDPB 1EJOL 1LE5B 4LL1A 1UA6L 2PYED 5CINL 3ZDWA 1U2YA 2BPBA 2WW8A 2R29L 4WRLA 2EDKA 4GPVA 3MBWB 4XN1A 1KULA 2NTFA 3CSYA 4IRJA 3LIUA 1KBKA 4TNWF 4FNLL 5DJ2A 4JO1H 4NZTH 1A65A 4ZXBB 3SKUD 2WAHA 2A74C 1AR2A 4Z5RB 4QTHB 1NPNA 2HT2C 3IETB 3IDUA 4LLYB 4AKPA 5BPPA 1LP9A 5I8OL 1MFAL 5FUZH 1KBVA 3AAZB 5FYLE 1JK9B 2ZOKA 5KBPA 4N8PA 4XWGH 1BQHA 2XT1B 2AHIA 4XXWC 1TJMA 3P0VL 1S7UA 4O9HH 1JRHI 1NGQH 1KGUA 1HZKA 5J1AB 4P2QA 2R59A 4PMEA 5BO1L 2BO0A 2CKBB 2AJUH 4AH2B 2QKIA 1KIUA 4IGBB 2KLTA 2P5PA 3GKWL 2P28B 4AUUA 5AW6B 3MJ7B 1P1ZB 2XQ0A 3CFNA 2GITA 4JFQA 2VC2H 5INDA 2OSLB 3B4NA 4JJ5B 1DO6A 1S5IL 4N3UA 2UXTA 4YBHA 5EOCJ 8CGTA 1TQCB 5HDLA 4PBDA 1BX2B 3BWSA 3OXRB 3QFJB 4U6HB 1BBJA 1MRFH 2VB5A 4L8BA 2UY6B 3VMPA 5DUBB 2J5WA 1SBSL 3KYMA 4OD2B 2O61B 3BVDB 5AG9A 4F1ZA 1BZ9B 4KJPD 1KB3A 4Z7VB 4W9FC 3L1FA 1EA9C 4AIOA 1L3WA 4ZUSA 1MVYA 1A25A 3QFDA 1BF5A 4K5MA 4RESB 4DUVA 1TJGH 1WBZA 5HYSA 1L9MA 5AVWB 1A7PH 1HTYA 3C5ZB 2YEZB 1A1OA 5D4QA 5F72S 2XA8L 4JUTA 1I8MA 2H9GB 5E7FA 1J9QA 3UYOD 4L4TB 1BA9A 4ZNCD 3FBQA 3OAYH 4ZFGH 5BZDA 5GGQL 4QJ4B 3OHXB 4ODVL 2LQRA 4MNQB 3GMRB 3QDGB 3O45B 1F18A 4HLZG 1CLOH 2XOTA 3LKOA 4JKLA 3V0FA 2PCXA 1JYNA 3QUYD 1PTZA 3HHRB 1BXVA 3GC3A 2AABH 4NOBA 4L5FL 4FJYA 3K6DA 2BSSB 3DX1A 1A14H 3QZWB 4I4WB 4XPTH 3V10A 5FWQA 1GY1A 4QRPA 2BMKB 2IGFH 3TIEA 3TJEH 4KZDH 4B5ZA 2X9XA 3C09B 5I5IA 3EJYD 1D7BA 3MNDA 3L8QA 4K3JL 4K71B 3NIDF 1KIQA 3FQ1A 2AQQA 3OXSA 4PTTB 2FDBP 4L5FH 4YDVA 2JXMB 2VMCA 2D31B 4X8JB 5HBBA 3NCXA 3T3MF 2WLHA 4NRXA 2HTLC 4YDMA 1AGCA 1FYTE 2VMFA 1II4E 1MCFA 4NN6C 1KB9K 2UZXA 4PLJD 1WH0A 1WITA 2NW2B 1K85A 4S2SB 2QSVA 4KZ0A 3FO9B 6TAAA 4KK9D 1MHEA 3N6YA 4GAGL 5IBTH 2UVFA 4KJWD 2A7BA 4G6AC 4MDIB 4XNMA 4OLZL 2OAAA 4NNPL 1TVDA 2XQYA 4OTXH 2MNUA 4JHUA 1CE6A 2QDWA 3H9SB 3TVMA 1JPSH 2AAVA 5KYYB 2AQRA 2V37A 4Y5YC 3REVB 4U4IA 4GRWH 1IUZA 2G0LA 5MEQA 2XV6B 4MZRA 5IESL 1FIGH 3KLLA 4XCYA 3V5KB 2CO3A 1PYWA 2PYEB 3SGDH 3RA7L 4BZ2H 3ILQC 3DNKA 4LOUD 4OZGA 2EDTA 1HHKA 2WUCL 4IRZA 1IGTB 2ZUYA 3WL9A 5FM5M 4D9RE 3IWUA 4PJXB 5B7EA 3TCLA 2VYRE 5D6DC 4EI6A 2IAMD 4FFYA 3J8F7 3O3BA 3HC0B 2UZYA 4E41D 3SD2A 4EZMA 3GSVA 1NBZA 5I71B 1PZAA 5C0ND 1N8ZA 2DMBA 2GTWA 1QSEA 2GQHA 3BD3A 4WI0B 4DKFH 2J4WH 1GSKA 2D2CC 4X5QA 1WRFA 4O5LH 2VKXA 2VLRE 3HBPA 2HLAB 2YAMA 4B7LA 4PJBB 3FUIA 4G8EB 4FMFA 4QHUA 1DQMH 2FT8A 3OB8A 4GRLA 3VJ6B 4LHQB 4I8DA 3O4OC 5I6XB 2ZP9A 1W8EA 1TETL 3HG1E 5JOPD 4ZFFB 4TKWA 4IOIB 1UXWA 5HHPA 4KHXH 5IQOA 4JZOA 1M6OB 1XF2B 5KVDH 1BD2D 3EUDA 2A77L 1NAMH 5IIEB 1G7IA 3LKSA 3QIWC 1X7QA 2WYIA 1YEIL 2VR3A 3F6IA 5EO0B 1WT5A 2AQNA 3Q43A 3PNWA 1SUJA 3VFVB 4QOKD 1OCCB 3JZ7A 2W88A 3UYRH 3HW7A 1XBRA 1AOHA 2BNRD 2O6DA 4JFWA 5HHOD 2P5WA 4ODHL 5TDOB 4M5ZL 2FWOB 4WW1B 1NDTA 1N12A 5F1NA 4J8QA 3VFTB 2DQGL 5IB1B 1XV8A 1MIML 5CILH 1KCRL 1R3HB 2ZXEB 2KQMA 4JPVL 3T2LA 4KZEL 1BYPA 2ZKMX 5DEFA 2NYKA 1RSYA 5FAAA 4FAAB 3QE5A 2FL5B 1ZEAL 4HGWB 1GGYA 1CU4H 2FUTA 4CNIB 5F1OB 4HXBL 1R3LA 1N18A 3RQ3A 2Z9TA 1W0VB 4N2EA 2IDQA 2A74A 2DWTA 4NPJA 4IDLA 2CO4A 4PJGE 3VAEA 5GSRA 4LSTL 3DTUB 1ETB1 2VR5A 4P5TD 1IAMA 4NAJA 4AEFA 4K0OA 4QHLB 2J55A 2AI0L 5DMGC 4LNVA 3ZDZE 4RFOH 4JDTH 3AWEA 2Z7ZA 3A6CH 3WKNA 3WIIH 4MXQD 4GT7A 1GPOH 3BWAA 5DURB 3U0WL 4KY1H 3TTSA 4MTMA 1QYGH 3BIKA 5JR1L 3FCTB 2K3TA 1TJIH 4L4JA 2AZAA 4UDUA 4JY4B 3HFMH 4E5XA 2A73A 2FX8L 2Z6FA 1PAZA 3KPSE 3SKMA 2A6DB 2H0EA 1BFOB 4F9PC 1SVBA 5GPRA 3WKYA 1W0VA 3GRWL 4RGOH 1ZTXH 4XXDB 4CNIA 5M7QA 1T1WB 3RFRA 2OZ4H 4UAOC 4AQAB 2OMZA 1MPAL 5E1AB 3STZA 3QG6A 4E5XG 1U2CA 1J1OL 1EO8L 1S9WA 4AQ1B 5E4EB 1DLFH 4W4OC 5AW0B 5KVMC 4HKJA 2DQEH 1HI6B 1O9ZA 3UPCA 4PW4A 4OLUL 5L4IA 3V0AC 1U92A 4JGJA 4WY7H 4U1GB 3F05A 4GKZA 5IMKA 3OM3B 3SGEH 4HUMB 2QSCL 4UNTA 4EKJA 5IJKC 1U8HB 1ETZA 2QVIA 1HXYA 4WCYH 5G2NA 3MOAL 2BHFA 5A2IH 3V4UH 3LSOA 4LKXB 4AJVA 4YFEA 2KT6A 2QVFB 2BOBB 2OL3B 2WXFA 1WFUA 1WFTA 3FB5B 4HMDA 1NCNA 4PRHA 4D0DA 2EVGA 5JW4R 1ZCRA 2RGSA 4Z7WA 4KUCF 3PXLA 4JANB 3T3MB 1EMTH 5IF0B 4MZ2A 3D30A 4RMTA 1RZ7L 2YEQA 5I26A 3RL1A 3CFCH 3BWUF 3NIDB 4XHJC 1W6LA 3GJFH 4QRSB 2MCAA 4P9MH 3KXFE 4JFFB 4LSVL 1FGNL 1RK1B 4CU7A 1XR9A 2VDQL 3UTSD 3QYNA 2EABA 2EDXA 3MRFA 2GCYB 2V5TA 3QUML 4JRFA 4Q9BA 5FM5O 3KYKH 2WNXA 5K9OA 2DD8L 4H0LC 5TQ2H 1YEDA 3K2KA 3R0MA 5FEBA 4EZLA 1OM9A 1UD4A 5IOPB 1JYXA 1MAKA 1UVQB 3HAEB 3L9EA 5AB9A 3U9WA 1GSMA 3RWCB 1BLNB 3JWNC 3K6NA 3LMJH 3ULAB 3UMTA 4MNGA 4PGBA 4LCCC 1C16A 1FGNH 3KHQA 4WO4B 3AREC 3AITA 4D9QE 4P9ML 1I1AD 3BPCA 1AZVA 5AUMB 4H1LA 2C4XA 5CINH 1Q8MA 5E9NA 1AACA 3GS7A 4HKBB 4NKMB 1NOAA 4Y4HC 5FO8A 5EU6D 4WW2A 3K6OA 2NR6C 1FGVL 2D2OA 1NUDA 3PP4L 3OKEA 3V0VB 3WJJC 3P77B 4HS3B 1H3TA 4YVUA 3APNA 1A9EA 4M5ZH 4KK6C 1K72A 4PHZA 4P2QE 1U95A 1RPQA 3MRHA 1Q94B 2AXHA 5DUJA 4JDZB 3GSNL 3O3EB 4EDWL 2CR3A 1WAPA 4FQCH 2NX5A 2H3KA 5BVPL 4RZKA 1JTTA 2PPAA 3PRZA 3W37A 4O2EA 4PB9L 4HA1A 1OP9A 2XG5A 1EXGA 2H5UA 1JK8B 3LKNB 3WNJA 1S7VB 3X3FL 2Y1VA 3K3QA 4I3RH 4G1EB 1XSJA 4OLWH 1KGCE 4Y1TA 1ZTXE 2CGYA 3AUWB 4MJIB 1TQSA 3LDBB 3PPSA 4ZUUB 4MRCA 3HG5A 2Z8RA 5DR5L 1UUSA 5HDRA 3UTPE 3VGBA 2V7HA 5HDQL 2AABL 3BH9B 4Q0XH 2R1WB 5KVFL 2ZONA 4PJEA 4I3SH 1A6VH 1ZANL 2WQUA 4KJYA 3VI4B 2YRLA 4Y89A 1MCOH 4A37A 5T33L 2VLJA 3QDGA 1MELA 2XWTA 3KJ4C 2E6QA 4MMYB 5EWIL 4KRNA 4PR5B 3QQ3A 3B2XA 4M00A 4U1JB 3OJDA 3GBDA 1XBDA 1WCBB 1HIML 3FU5A 4FYQA 4QMEA 3OGCA 3HZKA 1QLFA 2FGWH 3GSUA 2WHVA 2JB5H 4KROC 1V3LA 1BWMA 2EKJA 3CPLB 1LO4H 2VMJA 2H45A 1F3JA 1SFDA 3MDJA 4KO7A 2IFFL 4UTAH 3CBRA 4IMLB 1KCVL 2Z92A 3BFOA 3WS3B 4MA1C 4JRYD 4DCQB 2VR6A 9PCYA 4JM0A 1UC6A 3C8KA 4F57H 1GY2A 3EDJA 1EAPB 4U6TA 3F7VB 2PP9A 4OZ4B 5GHWH 1CZ8H 1MW3A 4AJ0A 4PJHF 1MW2A 1UM4H 2BHZA 4L8DA 1NCGA 4PAZA 2WZPA 4HUVB 3IBEA 2HTKD 4O02H 4CMHC 2VZ1A 3RUGF 5GS0D 1QSFE 2BZCA 4YOKA 2VKWA 4IOFD 3OXRA 4KNQA 2K9FB 1KLUA 2F2HA 4JO4L 1S7VA 1KGYE 4W70A 3FRPG 4RWYH 2WTOA 1SEBA 3QQNA 1XTLA 2DQ6A 1T0MA 2ZWYA 4P99A 2DQEL 3FMGL 1CE1L 4YHPA 5GISL 1M56B 2QQNL 4PRIB 2EAEA 5BOZG 4U49A 4Y8AA 3S98A 2J8UE 5L2KB 1MZYA 2ZUXA 3MRHB 5C0GA 5BOPA 1YNTF 5I1JH 4P49A 1JWMB 3GXTA 2W9DL 2YXWA 4JFHE 5I82A 2PYEE 1C8PA 2J6EA 1WUNT 4GYBA 5LXGL 3FCUB 3KPMA 2VR9A 3SBWA 1A3ZA 1I82A 4CU8A 4Y9BA 1QOKA 2VRAA 4WW2B 4XVUC 2FT7A 5TJWK 4NKMA 4YSPA 1G7LA 1JHKH 4LLYA 4N6RA 4OY9A 4Q7DA 5GGVH 3QWOA 2NSXA 4JUSA 4EUPH 1F4XH 3FW6A 3JVGC 1LEKA 1G1OA 3FCSA 3GBMH 1NUGA 5GRWA 3EHBC 1AE6H 3VXNB 3ZTCC 1VADB 1QA9B 1FBIL 2VN6A 4YFLF 4PP2B 3LNDA 1EHXA 1ZV9A 1G7HA 3CDFA 5JOEA 3QGVA 4PJCE 3EOBA 4R2GD 5KSBE 3FB7B 2W59A 2R8SH 3JSSA 2P5ED 3O9WB 4WNQA 2YPKA 3QXUA 4N2HA 1LEIA 2EYSB 1VEMA 3F6JA 5IB4B 1BQHG 4RCAA 4NX0A 4UNUA 2WMPB 3QXWA 5H4YA 2MCG1 3RL1B 4EF3A 1ZKAA 1U6AL 4JRYB 2HFGL 4MQ7B 4BFGA 2XTSA 2DM7A 5DDHB 2VUOA 4HX1A 5CGTA 4U7MA 4EZJA 2DM3A 5CP7A 2OSWA 5BUAA 4PSRA 3E2HC 2WLLA 3WDJA 5HYJE 1TZIB 4NQTA 4MJ4A 5EULV 3RBGA 1KEGL 1BQKA 4APQB 1HVXA 2MJWA 1ES0B 5DFWH 2DKSA 3CDGA 5IHWA 5ABDE 4CC4A 3T09A 3ZL2A 5CZKA 1CXEA 4EPSA 4F9PA 4NQDB 5IHUL 2YMTA 3H42L 3MV7A 2VDOH 4HKJB 1DJWA 3MNMA 2X0VA 4KZCA 5IB2B 2FSEB 3O3UN 2E9BA 1URIA 3OQRA 4Y2DB 1QI3A 3BVXA 4KPHL 8FABA 3ZHDA 2NNFA 3MJ9H 3AXHA 3V6ZA 4KITB 1S2EA 2ATAA 5E08H 4MJID 1F6AB 4L8SA 5E9AA 3X14B 1UADC 4QXGH 1NGPH 5C7XH 2AJYL 15C8H 1XMWA 1AXTH 2I60L 3VWJC 4KX8A 2G5BB 2MKLC 4ONFL 2VJ0A 5FB8B 1BFOA 2PWDA 3KBFA 5SWQA 3P73B 3QI9C 2GK0A 2OJ1A 3EOAB 2CLZA 2CLRB 1C7TA 3D4YA 2EXSA 4OLVH 5FO7A 1ZT7B 2KC0A 3HC3H 1FH2A 2OQJA 3PLYA 3B8YA 3SDAC 1T2XA 3B2VH 4GG6F 4LOEA 4ZOAA 1TZHB 1T4WA 1IGIL 2P47B 2ZNWA 3ZDXF 2F54B 1JDDA 3V0EA 5JPMC 1Y0LA 3ZE2F 4YFDB 5I24A 2QTVA 2VSMB 3QJFB 1SN5A 3VFOA 4WTZG 4OF6A 4EUPA 3HCVB 3KVQA 4TLUA 3G08B 4FXLA 3AB0B 3IRPX 3IN2A 1K3IA 2XPZA 3E6FA 2A74B 1VRSA 1MJ7L 3D39B 1DEDA 3MRRA 2EH7L 2UWEF 2Z91A 4I2XB 3QULB 3P54A 3RBSA 5B7MA 3EFFA 2YBRB 4U2YA 1OLLA 3CFJB 1GH7A 1NUNB 1ZVYA 4TVPE 3V5DA 3S4SG 2UWEE 1UUNA 1CLYH 2BK8A 2VW4A 1MQKH 3LQAL 5FGBC 3TO2B 3VH8G 3U46B 1CWVA 4EBQH 2JKRM 3EHBB 1A1NB 1IX2A 1MHCA 1RZIB 3L3OB 3UG5A 2J6WA 2CPUA 4OF5A 3T8XA 4AE1A 3KAAA 4TTDD 2A6JB 3KPQB 2K3HA 2OS7A 3KS0H 3U36B 4DVRL 5AOLA 1EBPA 5J3HD 1Z5HA 3HNVL 3TO4C 1UT1A 3FT2B 1KGWA 2HJFB 2FJHA 2VSDA 2P3YA 1M6OA 2WZ5A 4WI9A 3UJIL 4G8GD 1XF2A 1JTPA 1SFHA 1TSHA 4BK5C 2MNWA 2QR0A 3LN4A 1WA1X 2FEDC 1J1XL 5KW9H 2M26A 4X6CA 5AVQB 1D7DA 4F37K 1OCWL 1XVSA 2V2XA 2K6YA 4G8EA 2YAPA 5CJOH 5CNHA 4KGLA 3D0AA 3CHXA 1WAEA 3K72A 3EYUH 5BO0D 3BZ5A 2Q2EB 2OI9C 3IU3A 3HNTH 5E2UL 3MV7E 2FATL 4GG8A 4Z78A 1TENA 2QMJA 1TLMA 3WE1A 3HG1D 3D4CA 4GAJL 4B9FA 4M3HA 2Y1ZA 2UZYB 5CEZL 4FNPA 3A4AA 5IFHH 1P69B 3SODB 2GJRA 1P6AB 1U3HB 1M7UA 2NY4B 2R69A 3FU8A 3VI3B 1EEZB 1JZ3A 5L88L 1CBVL 5LN8A 2K9UA 4DEUA 5I16B 4QIRA 2BVUA 1PQZA 3FAWA 4Z3GA 1AKPA 1ZGLM 4WJ5A 3ZZSA 5A1AA 5HP5A 1Q9LA 2JTYA 4AC4A 3N43F 4P2RA 5I0XA 1ZLUK 1MHHB 2NLJA 2VO8A 2GABA 3QZPA 4L4VB 2AV7A 1CE6B 4HJGA 3WHE0 4A2DA 4M1GL 1IKFH 4Z7NF 1DUZB 4S1SL 2FE0A 5JXEC 1J5OL 4YPJA 3MA9H 5DCCA 5SWZB 3QZWG 2QLVB 1BW8A 3L4CA 3FSWA 1C5BL 3SBWC 4AJWA 1JZ6A 1JVLA 4NQQA 3MUGB 2NW2A 3TEXA 5EOTA 4D2NA 4X0KA 2O6CA 5I1CL 3A4EA 4QRAA 3F01A 2RCSL 3GUTA 3VGGA 3ZT5A 5F0JB 5TD4A 3SJVA 4OZHE 1IC4H 3N55A 1MCSA 2OI9B 2C26A 2F7QA 3NTCL 1T7ZA 4LSRH 3U4KA 4N2IA 3ZIMA 3C9NA 1NANI 1EGJH 1HHGB 1RLWA 3ULVD 4JM2A 4W9GC 4NJAL 3KL5A 4HEPG 3US0A 1TR7A 5BNXD 4OFVA 5EU3A 1AQ8A 2A2QT 4DF9A 3BPNB 3T6VA 2X10A 3UDWA 2IGTA 1A7QL 3H4FA 4ZW8A 2WANA 1A3RL 2HX7A 2YHGA 4N0FB 3BSZA 4HIQA 2DJUA 4ZMOA 1BZQK 1BG9A 1M05A 4JFPA 3DARA 1K4DB 4IIZA 5ISZE 1PZCA 1PD1A 3MCKA 2J8UF 3OMIB 4G9DB 4YAQA 2BY2A 2BCKA 2EDEA 2CKBL 3Q2VA 3V6ZB 5T1LD 3LYRA 1RPUA 1F56A 3NEEA 5J9PA 1KNOB 3MX0A 1A3RH 5IB2A 2ZOWA 2VDOB 2VLKD 3J07A 4ZO8A 1NIEA 3E9TA 4Y1AD 5A3ID 2C9VA 3GJFA 2Y7OA 4AQZA 4CC0A 2E7BA 5EIIB 1E4XI 2Y3NA 5EFIB 4CRPA 1F02I 4X42A 5A6LA 3ULUE 4JFZH 1RSFA 4MNGE 5DFAA 3W11D 5L0QC 3E8VA 1AO7A 3F7RA 4NQSB 2OMXB 1UM5L 2AEOA 2DQIH 1D5IH 3IK2A 3JVGA 1RAMA 4EUPG 3OB0H 1LQBC 1MG3C 2B9AA 4PWJA 5F96H 1JI1A 2VSCA 3LKPB 2AXFB 2EVJA 5DUBA 4KFMA 1CLVA 4XE5B 4KRPC 4FFWC 3CFTA 2WXOA 4OFIA 1AGFA 2BC4A 3ULUD 2JJWA 3QFJA 4WDIA 4WWNA 4QF1B 2KDYA 4JCMA 1YQVL 1LO0H 2HVKB 3KVPA 4OLUH 1FF5A 2YAQA 1AO7D 2F58L 3SDCA 5HD8D 3MRKA 4NYLA 3IGUA 3GBNH 4EBQL 2GUYA 1VSCA 4GKSB 4O02L 4R0LB 2D7PA 4R96B 3MNZA 5HHOE 5D96B 5E8DH 1X5ZA 4IGBA 2R4SH 4PGZA 4LDLB 2H32A 2BVYA 2NQCA 1MJJB 4QLWA 4KC3B 2YPVH 3FTGA 5PAZA 4DFIA 1JMZA 2YWZA 4NNYB 3MRMB 1VADA 5JPMA 2VZTA 4LOUC 3AJ7A 4AEHL 5CJBA 3U82B 3QJFA 4LVNC 4QLRA 2CUAA 4WWKB 3MGTA 3SCMC 2YD1A 5B1JA 2E9WA 2ZAGA 4KVPA 3IPBA 1HL5A 4PJ5B 1FSKB 3O0RH 1PKOA 1P6FA 3ZDYE 4MD0A 4MKTA 1CCZA 2GVYA 3NJVA 4QTHA 3L3KA 1EAOA 2WKGA 1ILUA 1JXGA 2XZQL 5LCVA 3HS0A 3CTTA 4K3DL 4ZAKA 1AHKA 2YKLL 4HAKA 4FG4A 5SWQB 4WTQA 4IS6A 4N8VB 2EIZA 5EUOE 1CD9B 1AXIB 4I85A 1ORSB 5EA0L 5F1IB 2CUIA 3BFWA 3NG5A 2XNAA 4DZBB 1UOVA 3AG3B 2PO6A 2VZUA 2EYTB 5E6IC 4F33B 1E4KC 4FG6D 4R4BA 2OYMA 4Y2DA 3JVFC 1EH9A 3G6DH 3LS5L 3AUVA 4LEBA 1B0GB 3ZHFA 3FFDA 3BSZL 1DP0A 3B6SA 2FEDD 3JV5A 3FN0H 5AYTA 4X7CC 4Q97A 1HCVA 1ADQA 3T4AB 3RURA 3DO3A 4O02B 3ZXAC 1AR1B 3LPGA 4FQLH 4PJ8A 2Y5EA 2HT2D 3LOWA 1B6DA 1WAAE 2OR8A 3FBKA 5C2BH 4HU2A 3MTRA 3QEHB 3SDDD 1RQ5A 3F64A 2XN0A 1I53A 3WMPA 1L9RA 1RVFH 2WXGA 4APQA 4Z3IA 5AW4B 2KI6A 1SHSA 3HVDA 1FLTX 4BKLB 3C5ZD 1YLBB 4JVPA 4XWOD 1MWAL 1NWOA 2WLLB 1CGTA 2IAND 4OCWH 1A6ZA 5CP7B 1IM9D 3EXLA 4OKVB 3OHMB 1BZ8A 4NZUL 3VCLA 3JV4A 2ZX6A 2APSA 2FQDA 4LF3A 3ARWA 3QCUL 4LGRB 4AQEA 4NQEE 1TFHA 3WFCH 4QRQB 3MRCB 3OKNA 4WNQB 4OB5H 1LEIB 3LIZL 4HYTB 4HLZH 2ZJSH 43CAA 4A2MA 1TJHL 1DBJL 3VI4A 1ZWIA 1UJ3C 3QPQD 3WLWD 4MMZA 1OF2A 4GG6B 3VQ2C 2Q7AA 4Y5XC 4Z9KB 1QVOA 4MAUL 4OB5L 4Y4FB 2F68X 3ETBF 3TFBA 4YSUA 1A4AA 3EF4A 3H4HA 4PV1C 4YUEL 1Y6MR 1G7LB 3QYMA 1B3IA 3U4BH 3RL2B 1C12B 1FO0A 4PP1C 1IAKA 2SEBA 3VFNB 4XODA 1KJVB 4XVSL 1OEZW 4UQDA 5CR1A 4WWID 2VXTL 1LO3H 4OCSL 1CIUA 2ATPB 2NUTB 4XMTA 4XC1L 1CFQB 5AAPA 3DTDA 5C0GB 3AREB 3MREB 4F7EA 2AQPA 3UJIH 4NNPH 5DMIH 1AQKH 2X2JA 4F2ME 2GUOA 2AERT 2FJUB 5CIPH 4H0IA 3D87B 1QSZA 2CJUL 3BPLB 2VXSL 3MRJA 3QQ9C 4M7JH 2DJMA 3Q3GB 4HS3A 3KPSA 2IOIA 3BQVA 5C0BD 4ERSH 2BP0B 4UUJA 5F96L 2YUVA 2C9AA 4HWEH 5F7HA 5MI0C 1E28B 2V8MA 4XP5H 1XFPA 5D5MA 3RVVD 3HB3C 3BGFB 5D7LE 2LGNA 2ZPKH 4TSCL 4N86A 2DYPD 2GTQA 2AP2A 4AEHH 2YXFA 5G55A 2F53A 1ZLEA 1PZUB 1KBGL 1JZ2A 5I1JL 1BCIA 1KLGB 5DLLA 1B2WH 2FX7L 1GZPA 2QQLL 5DSCA 3UBXA 5I1LA 1JCVA 4IMLA 3WS3A 4NO3A 3BVNA 5CLTA 2YLHA 4O51B 2W0LA 1G4RA 3LN5A 3CPLA 1JWSB 1G6RB 2A6KA 4L48A 4Z7VE 1KBPA 1VACB 5C0JA 1LWJA 4CVXB 3S4SA 4ALAC 4YBLC 1I8IA 1ZLSH 4JVUA 2PR4H 4KI5C 1WG3A 4XX1E 3NAAL 5EHFA 1DJSA 4P2OC 4EIGB 2NMSA 3L7EA 3H7BA 4QEGA 3VI3E 1FBIH 2J1YA 2OTUB 3NJMA 4JM2C 3A23A 2JB6A 4XMWA 1PZ2A 2WUCH 4Z7WB 1OQXA 4Z1PA 1N2RA 3FUMA 2ED7A 4RH4A 3N91A 4KJYB 2C3WA 3QHFH 3LSOB 4LKXA 5HGDB 3AZUA 2J1ZA 1IAOB 5D2NE 1KYOK 2WVVB 4C57C 5KAQG 3VMOA 1I3RB 4WU7A 1ETZB 2MOQA 4TNGA 3FTSA 2APVA 3UDWC 4GKZB 3NIFF 4W81A 3PAVA 2R4RH 1JZ7A 2Z7UA 4FI7A 1FGVH 3QEUA 3TBVA 1PY4A 3WJLC 4KTYA 2WLZA 5D4IA 2VDOL 3OAWA 4AMXA 4AQ1A 2J44A 4HV8A 2IPUG 4XB7A 3BKJL 4RIRA 2ED6A 3D5OF 3EFDL 1XEUA 3OHXC 4F15C 1JFHA 4J3OD 4A55A 1NCHA 3NN8A 1IC5H 3JWOL 1XGTB 3CVHL 5KANI 5C0IB 3K6SA 2CIIB 3GMPB 4FEIA 3QIWA 4K7PX 2AKRB 5AVUB 1Y6KR 5IW1B 1KV3A 4K5PA 4UQAA 3QQDB 3DBSA 4MQTB 1IC7H 2IOOA 3KWWA 1KB9J 5IMLB 1QACA 2PTTA 4A2GA 2IDUA 2ZNXA 3K8KA 4KKCD 4NUJB 4ELMA 5EUKB 5GGRY 1LO5A 1X5HA 4OZIF 4XO5A 3LX9A 5ESVB 4JN2B 1TTGA 5FO8B 5LGJA 3BWZA 4I48A 1DN0B 3BPCB 1C5CL 1DL7H 4HUWB 4FTDA 2MIZA 2JKWA 3T04D 1GC1C 4YWGH 4K5NA 4QNPE 1WIPA 35C8H 2D7MA 2XZAH 1IC7L 3DOSB 3RIAK 4EIUA 3QZBA 5AOMA 5CEZD 1HZLA 2DYSB 2C3GA 4XP6L 2WD0A 1WBXB 1UYWL 3BYYA 3R19A 1W16A 5K9KB 1CI5A 1N5AA 3D0LA 1FCCA 4NHCL 1E65A 2A9ML 4MS8D 3MFFB 3QFJE 1UCTA 2Y2WA 2BDNL 4IHBA 1IZJA 3MRIB 4GS7B 4F7TB 4C56E 4G2AA 2FL5A 2ICWI 4HMCA 1H6FA 1F6LL 1OSPL 5KVEE 5FUOH 3AQZA 3U83A 1Z9MA 4P06A 5CEZE 5D1QB 1BAFL 5IMLA 4PJ8C 4JREB 3DYOA 3QDMD 1QO3A 1CB4A 4OCMC 4PBVC 1BYOA 1AIZA 3QA3A 5J12C 5JIHA 3SDXB 2AKRA 3VXUE 5C0CB 2VWEC 3UGUA 4QWWD 1YY9C 1YAIA 3RDTD 3B1TA 2TRHA 1LEGB 3QDJE 4G6JH 3BO8A 1XGPB 1L7TH 4XR8C 4EXPX 2BVQB 4XRCB 2ODIA 4JVWA 1KFAH 3U7YL 3B7UX 3UEZA 4LK4A 3H0TB 2CBQA 4X6EB 3B5TA 2JQZA 1U8HA 5I71C 1RZFL 1KBBA 2R0LH 1NEZG 1OVZA 2ITCA 3BE1L 1NGZB 3PIQA 3GSNA 2CJUH 1UWGL 1SHWA 2XTJE 1N4XL 4JM4L 5C0FA 1J8SA 3O8XD 4GRLB 3UTSB 1KXTA 2WZPD 3DV4B 2N0MA 5DFVD 2YN5A 3X11B 3ARFB 1JXKA 3II3A 1M7DB 3GSOA 2FBJL 3QG6B 3WS6C 5D72H 1JZHA 1KT2B 5B38G 4OKDA 3KHOA 4XXDA 4WW2F 2GTWB 1ZLVH 3B8SA 1T2QL 1ZJAA 4XMKH 2OMYB 1A22B 3H7BB 2WPGA 3WI9A 3HB3B 4POUB 1MFAH 3Q5YA 2DI9A 4B9GA 1SOXA 4N0YH 2BNQA 2WLMA 1XAKA 5C0EB 1MCBA 1UQSA 3WL9B 1S78D 2OV0A 2UZIH 5EG6C 5CEXB 1EO7A 2XN9A 5JIDA 3ECBB 1GR7A 3KWTA 1PYWB 4FD0A 4OF3A 4JHAH 3NJXA 3QXAB 5ICZA 2MCPL 3TO4D 3BHBB 4IKIA 5KSAB 1CLZL 2XVLA 5C2BL 3DGGA 3MI6A 3QZLA 4GO6B 4UZUA 1IFHH 3VDAA 3FQYA 4XOAA 1IAIH 2H1PH 4OT1L 2CHZA 5I8KH 3HE7D 3NIGE 1S78C 4HBCL 1PU0A 3TOPA 3S8FB 1ADWA 1GGBH 4S2SA 4NQVA 2FLBT 1NMCC 1F97A 2SODB 4NQXB 5A16B 4AL8H 4Z3JA 1WO2A 1S9XA 2VIRB 4MXVE 4NO5B 5FM4A 2VDKB 1CXLA 4JDVB 2IWEA 1CFNB 3O2VL 1PG7W 4TQPA 4YDVB 4GW4B 2ZUVA 2MFNA 5T1KD 3T4YB 1J10A 5DJCA 2NUTA 3RJQB 1YEJL 1T22B 2C3VA 1RP9A 4XMVA 3MRBA 2DEWX 4HCRA 1X7QB 5FR3A 1GC1L 2SEBB 2KPWA 2Q3ZA 5DO2D 2NY0D 1P7QD 1L0YA 5C09A 1FO0L 2YD4A 2OULB 2CMRL 4NJ9L 1KPRA 4FI8A 1W0WB 4R83A 2IWFA 1DBMH 1G7PA 4P46D 1Q9WB 1B0WA 4NM8L 3KG5A 4LAQL 5HHVH 1JZ5A 4WJKB 3LQZA 4FG2A 4JPSA 5D6CA 4Z7AA 5BZDB 2YAFA 2BS8A 1HAWA 4L1LA 4R8WL 3B1UA 4NZUH 4K73A 3GMLB 2IGFL 5I8CB 3U30C 3NSJA 2WBJB 1THAA 4HH8A 4OLXH 4H7VA 4Z7VF 4HWUA 1LYQA 3N9GL 1TO5A 4K2UH 4LQFH 4NBZB 3RIFK 3JBG7 4GMSH 1NBZB 3ARBB 1G9ML 2JKIS 3AADB 2Z8SA 3QFDB 4WEBH 1NMCB 1T6VN 3ZQ9A 4LEEA 4N0CD 1EDHA 4DEWA 3HN8A 1ZA6B 4N2CA 3OLGA 1IGTA 4NFDA 4L9DA 3KYMB 2O61A 3ZIYA 3Q6GL 2ROYA 5C6PB 1A6ZB 2Y1YA 3D12B 2DKMA 4KK6D 1R6VA 2H6UA 4I0PC 4K9EC 5K1JA 5KVEL 1DBBH 5I0YA 2FR4A 5FUCC 4F57L 4G1MA 4OZHB 3STBA 3SPCA 2BNRA 3T0EC 3X1FA 3MN8A 3KLHC 4PJFE 4GS7C 5T1JA 2XN1A 4Q4EA 1R3IH 5AL8A 5GISH 5T5NG 3QEHA 5FECB 3UC0H 2DBLL 1VEPA 2AF2A 1RUQH 3V4PL 4XP1L 1J12A 3BZDA 3GMOA 1ZLWH 3CMOL 3QR0A 1IBYA 1CGUA 1AGBA 2NCMA 2K6ZA 2FUQA 3UBGA 1V8HA 5LGYA 1CLYL 3LQAH 4NKOA 2UX7A 1ACZA 5KSBF 5DVPA 3KCPA 3QXVA 3ZYIA 1RU9H 1DVUA 1H8NA 5DC9B 1I8LA 1RZFH 3NQIA 5E2UH 4FNSA 4FQXC 5GGVL 5E2VL 3MNWA 4DZBA 3WBDA 2ICWA 2VWEE 4KDTA 5D1XD 3AT0A 4RWYL 5C92A 2IQ9L 4IU2B 4IYKA 1QWUA 3CCHB 1S6NA 4YIQB 3D51A 3ECQA 1DJYA 1ZHNA 4JKNA 4KDVA 4S11A 5GSVA 3STLB 4JPIA 4XMPL 1A9BB 5INCA 5HHNA 3ZMNA 3VXRD 1U8CA 2DL2A 3O6FC 3Q5OA 3PP4H 2BSSA 1DQML 1CLCA 2JK5B 2Z65C 2P8MA 3EYOA 3GMMB 3LNHA 3LQAC 4UINL 5FC9A 2C9PA 4HULB 3KPNB 5I0VA 4MNQA 4WWKA 4YHYC 4TXVB 1CTNA 4HUXA 1NCCL 3MROB 5FYJE 2WKLA 3L6FA 2HFEB 1G1YA 4YHML 4OGAD 4IMKC 1PG7H 2CXKA 2NQ3A 4BCXA 3ROOB 4KGJA 1A5FH 4S0SD 3FTGB 5F0LB 1C5BH 3K4ZA 4AQ8C 4ZI8A 4D3CL 3NK3A 3RWFB 4UZSA 4LEOB 1F11A 1A1OB 3X13A 2UUDH 2WSPA 4GAJH 4IK6A 1IM9A 1G9MC 2BNUB 3BCDA 2CALA 3EGSB 3QUXC 1QMUA 4PW3A 1WBZB 2XKUA 2EADA 2FATH 4X80L 3WNOA 1OM3H 2CRIA 1WC7B 3D85B 4YS4A 3C6EA 2E7MA 3D34A 2ESVA 3SGKC 2F1AA 3EDEA 2CHXA 1RIUL 4ABQA 1SDDB 3V9EA 5LCVL 1HL8A 1ULVA 4NQCA 2OL3L 1NGQL 2X3CA 3UIYA 4ZMTA 2DQHL 4PGDA 3QI9A 5D55A 3RZCA 3V0WL 3GD1C 4W4NA 3KGSA 1OM3L 2YOCA 3S35X 4PREB 3SE4A 1IQWL 3MUZ1 3N04A 3OWEA 5CD3B 1MEXL 3ULVL 2GJJA 4MCZB 1V3KA 4NI3A 2Y0SA 3QXDA 3FQNA 4HH9A 5DJYA 2I7OA 5E99L 4L0ZA 3DURB 3Q6FB 4M1GH 4OUUA 4KVNH 4PB9H 4QHNB 5DQDH 3NEXA 3VW3L 1FVCA 1JV2B 2OPCA 3KW8A 3EOTL 4PCYA 4Q2ZB 2VABA 4PJHB 3CN0A 2A77H 3NCYP 1PX4A 3ETTA 3QUYA 3MRDB 4KUCD 5IROA 5GS3A 3HHSA 3UTPD 1S7UB 4UBDD 3GXNA 1SBSH 4UTBH 3SE3C 4OJEH 1UB6A 1ZT4B 4NPYB 3RFZC 4ZOBA 4G8IA 4WGKA 4QXTA 5FA3A 1CZ8L 2M1KA 4PJAF 3TBSB 1N3NB 2AJVL 3HUJE 2B15A 2J8UA 7CGTA 4LGPB 1INQB 1KN2H 1E8YA 4OM0L 2FCBA 3OV6A 3L5XL 2ICEB 4D0CB 4K9EH 2OMWB 3DUUB 4Y9CA 2RD0A 4ZXBA 4HIPA 4XTRD 1SYSA 4K7FA 4OM1H 5I1AB 1H6TA 2DF3A 3EJCA 5C0BA 5LWYL 4JPIB 3BQUB 1MCOL 3FFCB 4HT1H 2DTSA 3G5YB 1H3UA 4MA7H 2AK4D 3EH5B 4CVUA 3Q05A 4XNZC 4MWFA 3FH7A 1C1EL 2HKFH 3L5XH 3N2JA 2QQKH 5C07A 3IE9A 5DZNA 3K2MC 2R2CA 3ZE1E 1YECL 3ZOAA 1AHWB 3FRPA 3TN0C 4CAGA 5B39B 5J57B 5J1TC 1F58H 4RFOL 5CF3A 1WD9A 4PGCA 2WIMA 4FTVE 3D39D 1XGRB 3OX8A 4FNUA 4HUKB 4YLBA 4EQ3A 2O93L 3OKOB 5L7XH 5IK3A 1PGRB 4MA7L 4GIAA 1WZ1L 3QO0A 1U3NA 5IBUG 3DHUA 2R1XA 1EMTL 5GGTL 2EECA 1MCCA 2X70A 3RGBA 5LAPA 2VAAB 3W81A 1F2QA 3ZDZB 4HIJB 3I6SA 5EORL 3PWLB 3QCTH 4P2OB 3MGOA 2F7PA 1PJWA 2YA1A 4PRAA 1MHHA 3BC9A 4OZHA 2G60H 2UZPA 5H94B 5FW8A 4EIBA 4JFUA 4E41A 3NRPA 3BN9D 3B2PA 5T1KA 3SGJA 2XV2A 3QPKA 5EUOA 4M1CD 2VLJE 2MTAA 2NNCA 1FC1A 1J5CA 5JXAL 4M6MH 1Z0MA 3EJPA 1NL0H 2OX5B 4PWIA 1ZA6A 3RP1A 5IMOA 1KC5H 5D8JL 3U4EB 4HETA 1RIVL 3VD4A 3WTWA 1QSEE 1SXBA 3CQPA 4G9FD 4Y19D 1GGIL 3GSWA 1P0SE 1ZA3A 3VRLE 2NNXA 3BPLC 2BERA 2NXYD 4HCGA 1C08A 3ABKB 2BSED 1AQDA 5DHMC 3V4UL 1QQDB 5D4JA 5KWYC 1T6BX 3IJ9A 1PLBA 3N1MC 4H5SB 4GBXB 4G9FB 1EFQA 2XZZA 2V17L 2W91A 2EKSA 3GHEL 4BE5A 4PJGF 4Q9RL 3VD3A 1E0OB 4LOFA 4F93B 2J4WL 2IALA 3SYCA 2R29H 4IBWA 5KVGE 3G6AA 2D73A 5E1HB 4GKNB 4DN4H 4C4BA 5AVTB 3LNGA 1AVAA 5JDSA 3NUKA 4Y1AB 2VDMB 4XBEL 1LK3H 2VDQH 3T08A 5ISZB 4ZMXA 1GCYA 4ISVB 1TEYA 1T22A 4JKWA 3QNXB 3TCXA 1UKSA 5TDNB 4B9CA 4E9SA 3KPRD 4QD2E 1IFGA 5KUKA 4FFVC 3DMMC 3T2PA 1KUMA 2JI1A 4A2LA 4MASA 2CMRH 2DB8A 1O9VA 1H9DA 3F7LA 4HK3N 4JFFE 5EIVA 2B7DT 2NY7H 3L3IA 4HIXL 3TO2A 2B1OA 2KZWA 5DQDL 3VW3H 4P3DB 2G4GA 4HMEA 1CDYA 2EDNA 1YEIH 2PLTA 2X4PA 3C60A 5SWSA 1GS6X 3B2VL 1A8ZA 3FB8B 5JQ6H 2I07A 2VC2L 1BZ7B 4AK2A 4LAJH 2CR0A 1ED3B 4LP4A 4ODHH 5HVGB 1S8DA 1WJ3A 2HFFA 1IBGL 1D9KC 3WCYA 1S3KL 2KLRA 2F9BT 5EDXA 4WEMB 5GGUB 2V0AA 3F7KA 4L1BA 3MLTB 3TU6A 3D18B 3UPRA 2PW2A 3M1CA 1QFWH 4HCFA 4EDXB 1XDTT 2WQVA 2XXMB 2WZ6A 1HEZB 4FQXD 3WAJA 4H20H 2C4FU 4ODUA 4WNSA 3B5GA 1GYWA 4X99A 2VLRA 2EVFA 4KPHH 1RJZA 4IRJD 4PY7A 3IJEB 4W6XB 3ZTEA 2GSMB 2LU4A 3W57A 7PAZA 3CVIL 4R7DB 4B9ZA 2GK0B 5B3JF 4H8VA 3TZVC 5GHWL 4LOVA 4N1EA 1BSIA 1MF2L 3NCYS 4ODWB 5D1QD 2IADA 5JOFA 2ITDB 2YEVB 5B3JE 5C97A 1XTMA 4L8SB 4W4OA 4QRBA 1UA3A 4OF7A 1M7DA 3A6CL 1R33A 3GSOB 3M1OA 2HJKB 4WTZA 2B14A 3IEAA 3GB7B 4ONGH 3MLUH 4X4XB 2FSEA 3RVTD 1KYFA 1GJUA 3ABMB 3V8OA 3WXWL 2PXYC 4ZFGL 2FIKA 4OV5A 3CXFA 3MV7B 4G7YH 4JEGB 4PRHD 3INUH 4NQDA 3BAEL 4TQEL 3I3BA 2IH1B 5CUSL 5ADOL 2Y25A 3FCBA 1J8HD 4TUOA 5EF1A 1XGUB 1GA2A 4HC1H 2WTRB 4PJFB 4R5XA 1KTJA 5L4MA 2YC1B 1E2VA 4XI5D 2AFNA 3CFKB 3MA7A 4JY6A 1E30A 4NRZA 2Y72A 1KB5H 4FDWA 3L7FB 1T21B 3HE6B 5FM8A 3SB3A 2VDNH 5HJGA 1QWNA 2R4SL 3RIKA 3ZZQA 3RZCD 3ZO0A 2OCJA 4YJZL 1L9SA 1ZK5A 2WAQA 2Y7QA 4HAGA 2ERJC 3ILEA 2A83B 4DZ8B 3D09A 3P30H 1DLFL 1U9KA 3ARDB 5CXPA 1Z9OA 2ED9A 2CUMA 3WEAA 5C0CA 1AXSB 1V05A 2DLTA 1DDHB 1PD6A 3GGWA 3MLWL 4MCMA 1SRDA 2D9QB 3WGUB 4GUCA 3PWNA 3DJZA 2B5IB 2Z0BA 1WAAF 1OL0A 4R2GC 3GBML 4XP1H 4F9LA 1T3FB 3HR5A 1FYTA 1B4JH 1JPGA 1PG7L 3RDTC 2UZIL 1AD9B 3BN3B 3ZE2E 3NPZB 3MLZH 5DRNB 1QI5A 3NZ8A 3O3DA 5DHVA 2VRKA 2M83A 1NM4A 5IJKA 5D7KD 1IEBB 3ASNB 4AOFA 4FQQB 3IDJA 2GAZB 5FYKD 2ZAHA 1RZ7H 4XMKL 3SDXE 1DVFC 1RJYA 4FERA 4WKZB 1S7XB 2ROXA 5CWSB 5E94B 2X53A 1GGIH 1AHMA 3O4LB 5IZ7A 3D2UD 1MQ8A 4BXSV 3SIKA 1WZKA 3DYMA 4I48B 4XH2A 3UTZA 4I0KA 1Z3GL 1BFVH 3KJ6L 4XT1C 1QSFD 2GTZB 1F4YH 4LSQH 5I6XC 3A4DA 4ZMWA 2W0KA 3BZFA 1BZDA 4WFHE 2EDLA 4L3ED 4M8UA 4IKJA 4ESKA 4XP4L 2VERN 3GMNB 2CDFA 2EDRA 4TQIA 4WHYH 5JORB 3WOVA 3DVNB 2IV8A 4YHOH 5JPNA 5HI4D 5JW5A 4PRIA 3K6SB 3PREA 2EIJB 1GS8A 1CF8L 4PRPD 1S7SA 2J73A 5FO9B 2DQFB 5CLYA 2ZOLA 3ALXA 3CFDA 5FKPA 5F6IB 4LRIA 1MI5B 2X4OA 1N5YH 1EEYA 2O5XL 3TNNA 1S7WB 5DJ0A 1I7TB 3CN1A 3HZMA 3GRBA 4PJ7B 2AMUA 4BHUI 3IFOB 4B0MM 5JO5B 1N6QH 1EHLL 1CJYA 4U05A 3UTOA 4X6BA 4F24A 5TPWL 4BFKA 3FO1A 5DJ8A 2JLPA 2NZIA 3HS9A 4CBZA 4ILDA 4KHXL 2C34A 3M07A 2VDPB 2VW6A 4R4NC 5E2JA 4XNDA 3TFKC 1OTTC 1S9KC 1A66A 1D5XB 4UOJA 3BKJH 1KLFA 1ZMYA 2K4AA 3L9RA 3ZKMD 3F65A 1NLDH 1J5HA 1N2RB 4G3YL 1IQWH 2VQUA 3UAJA 2VM3A 3ESOA 2HTLD 4V2CB 3P0YH 4K5LA 3BKMH 1N64H 1LILA 1FZMA 2AJ3A 3E8UL 4DP1X 1EEUA 3THMH 2J2ZA 4JY5L 1XSKA 3G9VA 1YYML 4WK2B 3VXRE 3S4SB 1JZJA 1A2YA 4LSRL 3Q13A 4BZYA 4UQ3B 3MUHL 4AQOA 5HJDA 5GRUH 3UAJD 4MMYA 4WFEE 4MDRA 4HPOH 1A02N 3WFDH 3FN9A 2WC7A 4Y0GA 1KCLA 3DX6A 1GZPB 4P48A 5TQ0H 5DWUH 2ED8A 1HQ4A 1Q9KA 2VDQB 4ANVA 5F7DB 4PJEB 5EF2A 1CLOL 2CCWA 1NBVL 2K7PA 4KO6A 1AANA 2VISB 5BRPA 5B4MC 3OKYA 4XNXL 1R75A 2H32H 1RULH 1UJ3A 2WV3A 3DRTB 4MJ2A 4OCLC 3U1SH 3UC0L 5KSBB 4KY1L 1I8UA 4WF7A 5JO5A 4M7JL 4P4KD 4W6YB 1QHQA 5BUGA 3T0AA 1SBBA 2UWEB 3PFQA 2OZ4A 4YX2L 2BP0A 2V5MA 4H25B 2XA3A 5FKPB 3R0NA 1YECH 3UBXG 5DZVA 3LZRA 1C1EH 2HKFL 1WFMA 1W15A 1HSAA 1VFAA 4HHAA 1H15A 1YC8A 1WYJA 1RULL 3U1SL 4Y5XB 2FO4A 3EYQC 3L4ZA 5AOIA 4L18A 5A2CA 4OH2A 5KVEH 1E8ZA 4LCUA 2N7AA 3H2PA 3HZYA 2LT9A 3VFNA 3FSZA 3HLAA 3MXWH 2K8MA 1PZ3A 5E51A 3C6LD 4XE0A 4OW6A 3TM6A 4BD4A 2G3ZA 2X05A 3RGVB 2NY1C 1UH3A 2H0FA 4XPBH 2VL5A 3ARGA 2VR7A 4H1LB 2ZXAA 2MCPH 4YC2C 1MXGA 3DC0A 3O4LA 3NJNA 2F8OA 1IU1A 4GIPD 4YDNA 3WHXB 1A3QA 1SVCP 2TSBA 3CHPA 4HXAH 1E6JL 1XIWD 2LFGA 4ADGA 1BLNA 1MW1A 1Y1DA 4OJCA 1BMWA 5BS0D 4UQIM 1NAKH 1FIGL 5K69A 3TS8A 4AIZA 1R5VB 2F74A 1KPUA 3IKCA 4B9PA 4OR1A 5JXAH 4HPYH 3IGFA 1I1FA 2F61A 2FWLB 4UQ3A 4LLVA 1T2QH 2OJZL 4JFFA 5I73B 1AZCA 3TF7C 4C54A 3CDYA 3IRCA 4AQ1C 3L13A 3QNZA 4GLRH 4G43B 4K23L 4GINA 5F6IC 2ODHA 3O2VH 3J27A 3U2SA 3ARYA 2K78A 4NZTL 4OKVA 4IRSB 4R5TA 2ZUUA 5E8OB 2A6IB 4XB3A 3RILA 3QRLA 2X1PA 1K8IB 5DHXB 4WSJA 5E5MA 2YPLE 3NSXA 4G7VH 4GQQA 1BZEA 1WBYB 2KZKA 3QRBA 4XBPA 4ZTPL 5H37H 5IROD 5FYLL 5CZXD 3NP3A 5KANG 4Z3FA 3WEXA 4M6OL 2NR6D 3JWNE 4WWKD 5B38A 4XNYL 2YFOA 2ZWZA 1E4HA 3CFEB 3NCMA 4G6KH 4OT1H 4HUCA 4QRUA 3SN6N 1D6VH 1QR4A 1J8HA 3U2IA 4X6BB 3QJVB 3U7AA 4UOZA 1L3NA 3FTYA 4JNXA 4D3CH 1FHGA 3WJMB 4G42A 3D52A 1ZV5A 3WY4A 2O26U 4DQOH 3IDNA 3W9EB 4LDEB 5GS1A 3A6OA 2XDHA 4QRPD 4FZEH 1TJHH 4N3TA 2YMXL 5EOQL 5C3TA 1ZLWK 4BBWA 4YDLC 5JZ7C 4BKTC 4H2AA 1BFSA 2XY2A 1WFIA 3WTYA 2XWBA 5C08A 1IL1A 3ZY7A 4YH6A 3V4VH 3ZL4L 3I9GL 4MAUH 3D50A 3NBNA 5D4HA 2GJPA 4MJ6A 5CAYB 4Y9FA 1DJZA 4AUYA 4BFBD 5JORA 4ODWA 3ZE0F 3KCWA 4KRPD 1JPEA 1UXSA 5T1LA 5GJSH 3U0PB 2A73B 4R7DA 1RMFL 1L0QA 4A39A 1UD3A 5J7CC 3DXAE 1FNSL 3BUYA 5F7KC 2P5EB 2P49B 1MWAH 5F1SA 2WY3B 4JE0A 5HI4C 3FQ4A 4UTBL 3MJ9L 1FO0H 3J2PA 3NACH 4OD3L 2Q8BH 2IBZY 2ZKWA 3E8UH 4BFEA 1NDGA 2J88H 4QRFA 3NDZE 1SM3H 1PJ9A 4KQ0A 3BRGC 3MODH 3PABA 3WIIL 5AVXB 4F9LC 5D7SL 3SKOA 1ITBB 5TF1H 1BHGA 1W2KT 4NKQB 4Y2DD 1HX0A 2FD6H 5IM7B 1IEBA 1BZ7A 4DN3H 4IW4C 1TMQA 4LCYB 3JTSB 3FCGA 5DRNA 1E9QA 3SCMD 5SWSB 3CSTA 2HN7B 2WQWA 1JPGB 1YPZE 3H55A 5E95B 3RUGB 5GRVL 5KVGL 2MRYA 4ODVH 3RX5A 1AGEB 1NCBL 1KG0B 1UXLA 5I74B 4BSWA 4HW6A 2B1HH 3SE8H 3AC0A 4YUEH 1FP5A 1JI2A 3RIFF 3F7YB 1UD2A 1QBML 3FQUB 4XNAA 3LB6C 3UROR 5IT2L 1MFBL 2P5WB 4K3JH 1FAIL 3ARDA 1VFOA 2NY1B 3KD4A 3W2DH 3GM0A 4AVKA 1EXUA 1ROWA 4AG4H 4ABVA 1GMEA 5ERWA 5KVGH 4YC2B 1EVUA 5DD5H 4GUPB 1R3KA 3BPNC 3WKPA 2P80A 5ISZA 2I85A 4OGXH 3EG9B 2ZWLT 2DKUA 3LH2L 3ROLA 5B1KA 3FU9A 1OGAE 5PCYA 1T7VA 1A7OL 1CUOA 1KIPA 2UYLB 3S8GB 1J05B 1J9TA 3SPHA 2PETA 2AS5M 2IH1A 2VXSH 3BAJA 1JUFB 3IFPB 4N0YL 1W91A 1OAZH 5J5EA 4Z7NE 3VJ6A 4S1DC 3FB6A 5B4MD 4JFHD 3MRGB 3EYQD 1RY7B 4H5SA 3WENA 2OA9A 3MO1B 5F9OH 5ALBL 5CBAA 3FUEA 4NP4L 4BSJA 1RHFA 1QQDA 2NY6D 3IJ8A 2V2WB 4WI0A 1FYHB 5J13B 3A6BH 2P8PA 3R8BB 1A4KB 5F1KC 3GO1H 2W9DH 1FZOA 5IFJA 4A63A 4LASH 2VOTA 4KUZH 5JHLH 3LD8C 3SQOH 5CMAA 3DK0A 1DVYA 3OBAA 3SDYL 2FX7H 2MOGA 2BHYA 1N10A 3IJEA 2KDGA 4XPHL 4PJBF 1TJXA 3UGXA 1TMCB 3ESUF 1BXXA 1I7UB 4WI4A 2R2HA 4X98B 2BOCA 4X9IA 2P5EE 4PJIE 4XCYB 2HKHH 3BIAX 3FZUC 3GI9L 5MEQB 1WIOA 1JF1B 5H94A 2BP8A 5BVJB 1QSED 3TPUB 3JT0A 5TPWH 3WNKA 1DEEB 4JFFD 3OKMA 4N0UE 3TVMB 1LWHA 1S8DB 2HFFB 2ZUSA 5GRJL 4YVNA 5T1MA 5C2UB 1Z9SB 4X0KB 4DEPB 3QZOA 5BO1H 1C9SA 1XCQB 3HPJA 5JIIA 3BKCL 5KOMC 1CS6A 2OSYA 2HKAA 5IQMA 2X4PB 2WLKA 3G5VA 3FHEA 5E1GA 5F7WC 4CBPA 4GAYA 4IKLA 2J56A 4J3VA 5HGGS 1SF5A 4GXUN 2O6FA 2PUQT 5C7ZA 5CS7A 2IPTH 1YNTB 3HZVA 2RFXB 5ALCL 2YUZA 1T1YB 5DMJB 1Q9LB 2XETA 2ARJB 5EN2B 3KW7A 3UEQA 3DV6B 3IDXH 2R2HB 4X98A 5TDNA 2XZCL 2NXZB 1X5XA 4N0UA 4NGHL 5TE4H 3QNXA 5E9DD 4OM1L 2QMKA 1TO4A 5T3ZL 1XF1A 3EIFA 4QRPB 5JDSB 3N9GH 3NABL 4QJ5B 2LTQC 3PE9A 2E86A 2X4RB 3O2DL 2WLIB 4FS0A 4Z95L 3SYAA 2ICEA 4RAHA 5EEVA 4LHUD 3S3PA 4FA8A 5LHDA 1CXIA 1FZOB 1AP2A 1IC4L 4B9YA 4GG8B 2FQFA 4Z78B 3FTWA 4LAQH 4PCTA 1E27A 1N0XH 3BWUC 2ALWA 3H9SD 4HIHB 4LCWD 2X87A 2AJUL 5FLUA 1GYAA 1NWPA 3K72B 3BKML 1NLDL 5CR8A 5KZCD 3NZHL 3AT9A 3NCJL 3VM5A 4BXVA 2YEZA 1PDKA 5GGQH 2PPCA 1FL5A 3QUXD 5FYKU 5ID1A 5KG9A 3LN4B 1ZA3B 1FVCB 1JV2A 3MOQA 1KJMA 5E8NA 3QJUB 4N2GA 2Z4QA 4GEIA 4M8QB 2RTTA 2NZ1A 4OM0H 1N0LB 2A9MH 2JH2A 1RV6X 3OKDB 4ZUSB 4FQXA 4OZFB 4M93C 3PGCB 3C5SB 4PN6A 4XP6H 5LN4A 3ZDYF 4YR6A 3TONA 1BEXA 4KDWA 3WTVA 3EJZD 2GBAA 4NLHA 1G9NH 2N1KA 2JJVA 4FNTA 4IBTA 3E0GA 1PAMA 1RD6A 4M5YH 1BAFH 4KX9A 4DPBX 3D3VB 1I1CA 1L7IH 1T66C 3UTTD 5J11C 4F37F 3LB6D 5DD1L 2GITB 3T0EE 3RGHA 3L3GA 3UP1A 3NK4A 4J1UB 3W11C 5D1XB 2Z64C 4NIYE 2CDEB 3CFJA 4M62L 2HN7A 1FWXA 4LVNB 4WWKC 4ZDHB 2XC8A 4PVLA 4KH9A 1CICB 1QSFA 4X0NA 1HWHB 3G3LA 2XPGB 4I18C 1F8TH 3Q2CA 4A6YB 3ARVA 2NY5H 4U7KA 5ACZA 3SKOB 3D4ZA 1LO2L 4MS8C 2Q10A 4JFSA 1GW6A 1HS6A 2Z7WA 3DX9B 4NUGH 1N19A 3RIAF 2YN3A 3AAZA 3C6LC 3LRSA 2JQAA 5C07B 3RVWC 2G9HB 2Z31D 1OE1A 1F6FB 3C08L 3QIBC 4U3CA 2Q9OA 5F9JA 1RZ8A 4N0CC 4N2KA 1CXKA 2XJLA 3QUXB 1U8CB 3H8NA 2YOAA 3BQUA 1ZT7A 4X5XA 4Z3EA 2NTFB 4L05A 4XX5A 1OKEA 2PXYB 2ZSVA 4XHQA 1EZVX 2O6EA 2FVNA 4L3EE 1I8KB 4XAWL 3NJGA 3FQ2A 1H6UA 3HTLX 2RH0A 4MA8H 1B4JL 5DRXB 2QSQA 3U6RB 5KAQF 1KBGH 3X14A 3MNWB 1XO8A 4ONHB 1ZE3H 1IGML 4MMXB 4PWKA 3RAJL 1FORL 1FIEA 5KYXA 4LB8A 1M7XA 5IVNA 3K74B 1FG2A 1TU2B 4ZS6D 4NKOB 1JFQH 3DIFB 2DJ4A 2X9ZA 1X9LA 3POCA 4PTUB 2C1OB 3NA9H 5F7NC 2P8LA 4IMKA 5GGSA 3GF8A 4DGYL 4EI5D 4S0TD 5I1GL 2IWGA 4K07A 3ZYOA 3BAYA 3BEWB 5E00B 1JCKA 3FUFA 4AQ8A 1FFPB 3M6DA 4LGSB 4N25A 4F2MA 1UENA 5GJTH 4UQ2B 4HIEA 2RQ8A 2BFVL 3LS4H 4M29A 3TJPA 1MSPA 3GKZA 4LPYA 4PEEA 2DIBA 5AW1B 2NTSP 4S1RL 3OKLB 3RX9A 3FN0L 5I8KL 4JE4B 2VQTA 2C1PB 2IDTA 2B4CL 3HN3A 5AFAA 1J8HE 1ZE3C 3G5ZB 5E00A 3WIFB 5E8OA 3P4NB 2EEBA 4LBEB 3ZKSD 1QBAA 5FW7A 4FFTA 3RTQB 4ZXBC 4R26L 1PIFA 2EDOA 1EZVY 2YRZA 4M43L 3MR9B 3SE4C 5ID0B 5K1VA 1U93A 5C0NC 1IKFL 4ES8A 5EBLB 3GLDA 3T1WA 5DRXA 3BX7C 1FH5L 1P84J 1YY8A 2P7TB 5HYJB 1BEYL 3ROOA 2CIKA 4K8RC 3WUZA 1H8LA 3BP7B 4D0BA 3NCJH 4PLKC 4APQC 1NGWB 3AGVA 1KOAA 2Y7NA 3LQZB 3SE6A 1JHLL 5KYWB 4HUXB 5LLIC 3LIZH 5CKGA 3P4MB 4RMUA 5DFVC 2L7UA 3H7LA 4BK8A 1W0WA 3SYQA 2IBGA 2WVTA 4AGLA 3WXVH 2P46B 1DVXA 1P4BL 2AQ3A 3SPVA 5J1SC 2E7HA 2XU9A 1I9EA 3EFOA 4UF7C 2OXGA 2VR4A 5IFAH 1ORQB 4DP6X 5HGAA 1SHXA 3LRHA 1O6SA 3DSNB 1DVQA 3W0WB 4ZOEA 4GXUM 4PJIF 4OLXL 4Q6YA 2C3VB 3LPPA 4LCUB 3STLA 3ZKMC 3TTYA 4DK3A 2F53E 4JKMA 2Y24A 5TH2A 1QSFB 3HPLB 3LH2H 5JIKA 2K1MA 3O8XC 1CFNA 3QCTL 3WNPA 5IHBA 5BXFB 1JN6B 3I02B 3V5HA 1WFOA 3L3GB 3IGKA 2XKSA 4GP4B 2C7UA 2P45B 4M62H 5TFSL 1SEBB 3FUHA 4XAKE 3S7GA 4ZMAT 1YO4A 1NDMB 3ECVA 1KLUB 3WXWH 3ARRA 1KIRA 3SE8L 3OD3A 4AWJC 2R0ZL 2V6HA 4KO9A 1T5XA 1BQSA 3S96A 4BWTA 4K8RD 5C8JB 5KBDA 4X7SH 1NOFA 1GW0A 2WYTA 2Z31B 4TUJA 3F12B 4UM9A 4KQ4H 2W07B 2YSSA 3VRIA 3CXDL 1JPST 1QZ1A 5HVHB 1P5UA 3G6JE 4UT9H 3OKDA 1N0LA 3SY6A 4G5ZL 5I6PA 3GZPA 5GS0C 1OB1A 4U1HA 2CLVB 3CZUB 5LDSA 1LO0L 2MNJB 2DM2A 3V79C 1XSIA 3ECBA 4J39A 3W39B 2XXFA 1CICD 3ZKNC 2DPKA 1QBLH 1B9KA 4XPAL 4CJ1A 5DGQA 3P40A 1KXHA 2BNQB 4Q6IC 3AU0A 4YXKH 4QXUL 1ERNA 5ABAA 4OZGE 5JW4Q 3DO7B 2LU5A 5T1DL 1FZMB 4O4YL 5TK2A 1SXCA 1YHPA 3QQ3B 1UKTA 2ZTBA 1M6UA 3LVEA 2B77A 1W72B 3D25B 5GZNC 4PJFF 3BLPX 3N50A 1I1AC 4OZIE 2D3NA 5DQ9B 5F3BB 3BDBA 2WSDA 1NBYA 1A1MA 1D6EA 3WFHA 2CE6A 4HWZA 1BREA 1XF4B 2HWZL 2VLKA 4IBZA 1SY6H 2XIBA 4YXKL 4FQLL 2AQTA 3BT2L 2A38A 1KPRB 1NMAH 4HS8H 4XC3H 3QK0A 4P5TA 3DJSA 1A6AB 4A67A 3SGDI 5GRZA 3TNNB 2MEJB 3EH2A 4M6NL 2OMTB 1RZGA 2PTVA 4RA0C 5E03A 5FHBL 1X4YA 3T6ZA 2BSTA 1EANA 1E9OB 2K70A 1IJNA 4FP8L 4X8GA 4HFUH 4Y2NA 4FKEA 4XNYH 5FK9A 4YE0A 1OAYH 1D5MB 5DHDA 2VJXA 1Q94A 4CGTA 2D3LA 3FT9A 3L4UA 4HKXB 1MRCL 2VDKH 4YHZL 4QT5B 4PJHE 3S97C 1RUML 3V0VA 4NQXA 3ZE0B 4FP8H 4PRID 3RWDA 4GMTL 3CVBA 3FHAA 3EYVA 1JF1A 2B08A 1NEZA 3K4DA 2PW1B 1IT9L 5DO8A 3ZUCA 2ETWA 4B5EA 1GAFH 1R46A 1JHTB 3O41B 1CYXA 2MPAL 3BDXA 5HDQH 3NFPA 4LKCB 4KOBA 4PUBH 3PL6A 1QFPA 4X4YB 3CSBA 3CGTA 3I6LD 1QEXA 5D7SH 5D7LA 1T89A 5D7HA 2Y9RT 4P23A 5FDYA 5IOPA 2UV3A 4ODSH 1RZJH 2F5AH 1A7QH 2FWUA 1DQDL 3MRFB 1A4KA 3V95A 2OW7A 1QPKA 4CL7A 2HP4A 1JGIA 4X6DF 4I18A 3IFLH 3FQXB 1M2VB 1DBML 1R1CA 3P0YL 2FH6A 4JO3L 4ELMB 4QCIA 5ANMA 2H26B 3I6LE 4JHBA 4FQCL 4L4VD 1HSBA 2ESVE 4PV9A 5KJ7E 2NUPA 3H3KA 3B2UD 4AGPA 2CUHA 4JFEB 1I9JH 1G0DA 1H5BC 3OG6B 4FKHA 5F6HJ 1QASA 3C6LA 4Z7UA 4ZO7A 1J05A 1XCWA 1DQTA 1YEGH 2O5ZH 3NN8B 1QEWA 3G04B 4KKBD 4PJ9C 1JWUB 4BFRA 1Q9OB 5CJXC 4AG4L 2QGCA 3S35H 3C75A 4JRXB 1NGYA 3SCMB 1FRGH 1CXHA 2EJ1A 3H9ZA 3SO3C 4LLDA 3IJYB 1ET5A 1J9CT 3GSNB 1VENA 4I77H 4P57B 4C4KT 1DQJB 2JCWA 3OJVC 5DRZB 2VZOA 3I6GB 1UH4A 4V11A 4BH8A 4DPRA 3GXPA 4YDIL 1RXLA 2R7EB 3N1GC 5I6MA 3U4BL 4WI2A 2AK4E 2EDYA 3KPOB 1DO5A 3U2JA 4JQVA 2ZCLL 3BAXA 4FMKA 1QEWB 3C87A 4WSKA 4XXWA 3DVIA 4ZPTB 4AQAA 1UWYA 4ZFZB 4RISH 5KBLA 5E24E 1T1WA 3FUKA 2QBWA 4F58L 1A6TA 1SVZA 3RWEB 5IM7A 3NA4A 1DANU 1I8IB 5C07E 5ANMB 2QV2A 1NAMA 3GT6A 3VFRA 1W72H 2A6KB 4PY7B 3KDMB 1CI3M 4QWWC 3LVTA 1JRHH 3BWAB 3LHAA 1L5GA 3POHA 5CSBA 1ICTA 2ZP8A 4NO3B 5FHAL 4WFGD 3L3DB 1SHMA 4NFBA 5AW8B 1WHOA 4U0RB 5C07D 3MLTA 4BH7B 2X1XR 4OZFH 3QAQA 5A2KH 3VWJA 4LKCA 4X5RA 3DDFA 4BKSC 4XNUL 5I30H 3FT1A 2ZOUA 3T0EB 3OAZH 5ALBH 1OGSA 4MZIA 4HUWA 2X4QA 4Y4FD 3T1FB 4EZKA 1VKXB 3V52L 5F88A 3TURA 3IGAB 4QHMA 4QRRD 3QUMH 4N0RA 4RAVB 2NY0C 4P3DA 4GNKB 4AJYV 3RWDB 1F2XK 3PQYE 3EO0A 2PTTB 3KPSB 2Q6WB 3V6FA 1QFWI 3CSPA 4QY8A 5FF6B 1N6QL 1EHLH 2ZSWB 1SOKA 2GIXA 1PIGA 5C1MB 4R26H 4IKKA 4JFYA 4ZMQA 3FO0H 5BZZA 5TDOA 5C6WH 1QNZL 1AQMA 3U30B 3BH8B 3MLRL 5DC2A 3K2UH 4X5PA 3HAEG 2E3VA 7FABL 3MC0A 4O00A 5IG7B 3VGFA 4NT6A 2YKKA 4RIRB 2DJSA 3TZVB 2AAAA 2RIKA 1M2OA 5AL0A 4NWUH 1X4XA 4FQJH 1MIMH 3QZMA 4M6OH 2ZG1A 2XJKA 3VMNA 3GPSA 3K81A 4RA3A 4EEEA 3ZZ1A 1GYUA 4Y19E 1CG9A 1HHJB 2V5SA 3FO2B 1HYSC 4WVRA 2JKJA 3LZLA 1EGJA 5HHQB 2I9TA 3QIUA 5EOQH 4R97B 5D9SB 1ZTMA 1A1MB 1D6EB 3TC9A 3M7OA 1NJ9A 4DQOL 5KZCB 3DDGA 3PJSA 1PF3A 3W9DB 2L0DA 4GXFA 1I85C 2QKSA 3CU7A 1G7JA 3F6LA 4HJJL 1TOXA 4JZJC 5C0RH 2EYRB 4P9HC 4U1KA 5F0MB 3EBHA 2YGNA 1OSYA 3GSWB 5IGXH 1FA4A 2AVGA 4LSDA 2ZKHH 3ATAA 1QW8A 3M8OL 1SMAA 1QSVA 4HWBL 4I0PB 3SKNB 3QXTA 3T2NH 5B3NA 4LHUB 1KEMH 4NXKA 4Q8BA 2R83A 1MNNA 4AQEB 4F3FB 4NM8H 1LHZA 1KPVB 1XZ0A 4NUQA 3AW5A 2WJ5A 4OGQC 2XICA 1D2PA 1HILA 5BJTB 2NCEA 4F7KA 1CPUA 5CIPA 1P7QB 1PKQA 2VDPL 4J27A 4Z0XB 1FC2D 1P5UC 1E4XL 4Q6IB 3SO5A 5I1LB 2VLLA 4RZCA 3RGVA 2WXLA 4OGXL 2HG5B 1MCHA 1WWWX 1YMHA 3CFUA 1E43A 4U1LA 2VMEA 4IRSD 4BUGA 3CDZA 3H9SA 4YEEA 3WFZA 4RGNE 1DSFL 4WEUD 5IQ7L 4P04A 1H8SA 3JTTB 4N2AA 5D6DA 2EH7H 1OANA 2FO4B 1J86A 1NCUA 1V7NH 4XMLL 1CD0A 5HI5D 2VXTH 1F00I 3VG9B 1WVZA 3PV6B 5D2LE 5IKCA 2IPUK 4N2LA 2AJYH 4B9KC 4ACTA 2WO4A 2X6MA 4HC1L 4I0PD 3AY2A 4GO9A 3INUL 3V7AG 4BJLA 3BP5B 1AHWA 3FRPB 3TV3L 4M61B 3FTXA 1QRND 3IKKA 1OTTD 4X7TB 5TGBB 4J4PC 2BP5M 1PNDA 2H8PB 1UWXK 3MV8E 1HH9A 4IJ3C 4U33A 1U3ZA 2VDMH 4JCLA 2F7OA 3REWA 4DNLA 4UV4H 3AS3A 3NFSH 1MAML 4P5SA 2KERA 1JPFA 3BKYH 3FMGH 1WT5C 4TUKH 4PCKA 1SYSB 4I5BB 4K7FB 1WP6A 3CIAA 4OBRA 4PY8I 4QOKB 4KKQA 3SPVB 5CBEB 4R4FL 1VGKB 4S1QL 4XAWH 4LLUA 2B0SH 4W9IC 4D9QD 5LNDA 2IQAB 2VW7A 2BSCA 1ZPLA 3DVFA 1JGVH 4IGBD 4HXAL 5MENB 3GXUB 5KYWA 2W0FB 4ZOCA 3JWNG 1CMOA 4BA8A 4H8HA 3MFGB 5J12B 5D72L 3K71B 3BP7A 3DKHA 2QQLH 1I8MB 2ITFA 1ZVSB 1A7RH 1AYRA 4UQEA 2ENJA 3GS4A 4ZTPH 2CCLA 1NBCA 2R9HD 4DOHE 3CQFA 1WLHA 4OUUB 4PU2A 1PLAA 2YZ8A 5EOCH 3MR9A 4KBPA 3ULVC 2COVD 3V9FA 1IVLA 4HISA 1CTOA 4IGBC 3SDCB 2FJGB 4PJDA 1KN4L 1CYGA 5I6KA 3CFBA 4WUUD 2VRQA 4QF1A 3ZDZF 5B21A 1BPVA 1P4LA 4XPHH 5IQLA 4JQVC 3QORC 5IVXA 3DX7A 3GEWB 2XV3A 3I9AA 4XHJD 1HH6B 1BX2A 3KBEA 1MUJB 2DLFH 1ASQA 3PDOB 3O3AB 1KJ3H 1ETJA 5D1QE 1NMBL 3X1NA 1C8QA 1Q0XL 4P3CL 2FJGA 4W6WB 3VXTA 3GJFK 4YHOL 3HRZC 2V8LA 3CFDB 2OFQA 3HG3A 1FDLL 1RHHB 3D85A 4F8LA 1HN1A 3OMNB 4O9HL 1QBBA 3ORJA 4EN3D 1PLGH 2APFA 1X5AA 4MB4A 2C1OA 4OF0A 1CDIA 4MLSA 2AC0A 4YSSA 3B6SB 3CH8A 4CSSA 4QKXB 2CDFB 1KNOA 4R6UA 1I9RL 3X3GL 2XVBA 1BQHB 3D85D 3MROA 3O2DA 2WK2A 4AK1A 4O2FA 4OJDH 3GJEA 1OQOA 4JGUA 3S3BB 1MCRA 2KH2B 3LXUX 4G6FD 3KPNA 3QARA 4TNVK 2VXVL 4FF9A 5EU5B 2N01B 3EO9L 4XBGA 2VDNB 3D2UA 1SJMA 4LLWB 4GG6E 3K91A 5DURD 1C7SA 3CSYB 4IRJB 2WO2B 4NKDA 4G3YH 3T6QC 2YD2A 4ELME 4U1IA 2Q76B 1KXQA 3JT2A 1YMMD 5F9JB 2XG4A 3QB7C 3FH5A 4X7TA 1S7RA 3WY1A 5D5MF 1FNHA 3VXUB 2A0LC 3BP5A 4ZO6A 3VXSA 1U91A 4UT6L 3K1DA 1OK8A 2VLME 1AI1L 3M17B 5ANME 5IQNA 3ZYZA 1ND0A 2WINA 4K7PH 5I8EA 4ZUWB 4YHIB 4RQQB 5EOTB 1MRDH 4A2FA 1JS4A 5HPMA 2AEPL 3FQWB 3HBGA 3Q9PA 4PJGB 2C4FT 2DQGH 3IDIA 1NGXB 3GM8A 3WO3B 3OC8A 5SWZA 1AZZC 3TFKD 4B0MB 2W0PA 2WXRA 4KKRA 4HOWA 5BW7C 4A1RA 4Z7OB 1VIWA 3VXMD 2BNRB 3UZQA 5L7XL 4NUMA 2Y5QA 1X5JA 2ZCZA 3IBOA 1AFVL 5C0AE 3S9DB 1TKWB 4JFXB 3WNNA 5DD5L 3ZSSA 4G80B 3T65B 1P7QA 1PKQB 1U8KB 2LLNA 5C0DB 5HI5C 4YR6B 4MHHG 5HDBE 5KS9A 4G8FB 4OFQA 3SDAD 2OMXA 4NQSA 3TNMA 4G6AD 3VI3A 5C09D 4OZFA 4DTGL 3MRNA 3VGAC 4LEXL 4MJ5B 5LXVA 1XAUA 4WK4B 1JZEA 5F93C 2Z1PA 4B3VA 1KJMB 5E8NB 3NIGF 4FLRA 4DVRH 3BT0A 2EYRA 1MCNA 4TUUA 2KYIA 4HUNB 4MAYD 4EN2A 1U2HA 4OFDA 2D4DA 1CFSB 3O2WL 4ZTOL 1NJ9B 1AD0B 1YEKL 2DRUA 5SX5K 3EYFA 3PGDA 3TBWB 4YAQB 2YUXA 4DGIL 2Y07L 3LKQB 4ABUA