1RHJB

Crystal structure of the complex of caspase-3 with a pryazinone inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
91
structure length
91
Chain Sequence
b'KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 16
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rhjB00
2HBQB 1RHRB 2H48B 2CNLB 3D6MB 1RWNB 4ZVRB 1RWOB 3D6HB 3R7BB 2CJXB 3KJQB 1SC1B 1RHKB 1QTNB 3IBCB 2CNOB 3EDRB 4DCPB 2H5IB 2C2MB 1NMEB 2QLFB 2QLJB 2H4WB 1RWKB 2FQQB 3GJQB 1RHJB 1BMQB 2DKOB 2XYGB 5IC6B 4ZVSB 2XZDB 2H54B 3NS7B 3SIPB 1F9EB 2Y0BB 1QDUB 4ZVUB 1SC4B 2H5JB 3R7SB 3R7NB 2H65B 3KJNB 1RWMB 4ZVOB 3EDQB 2C2KB 5IC4B 3GJTB 3QNWB 3KJFB 3R5JB 2C2ZB 1RWWB 1ICEB 4ZVTB 2HBZB 1I51B 2Y1LB 3P4UB 5K20B 2QLBB 2C2OB 2HBYB 4DCJB 1RHQB 2H4YB 2XYPB 1RHUB 1IBCB 2XZTB 2H51B 2CJYB 1PAUB 2CDRB 2CNKB 3R6GB 1RWVB 4ZVQB 3RJMB 2XYHB 1SC3B 1RE1B 3P45B 4JB8B 2QL9B 1GFWB 2CNNB 2P2CB 1I3OB 3GJSB 1PYOB 2QL5B 1RWXB 3R6LB 1RHMB 4LSZB 2QL7B 3GJRB 3D6FB 4DCOB 4ZVPB 1RWPB 2HBRB 3IBFB 2C1EB
chains in the Genus database with same CATH superfamily
3MUVP 4Z37A 4K5SA 2C3YA 3CC2S 4ETXA 1XR7A 4X66J 1X5PA 3NKYA 1RDRA 3MAHA 2QN6B 5K8MA 4JYAJ 2QLJB 1Z1ZA 1C1CA 2FDNA 1WG1A 1FRLA 2HMIB 1N52B 1KQFB 2GS8A 4DLEA 3MAAB 2VICA 2NXCA 3G86A 4OIXA 3ILJA 2RNEA 2L9WA 3VQSA 2HHSA 2K7KA 2GGPB 2MQ8A 4R5PB 1H6KX 4ED3A 1Y5IB 4LVNP 4JI4F 5D78A 4NLXA 4P73A 1WHXA 3PX4A 4DX7A 1S1XA 1XMOJ 5B08A 3PFOA 3VGUA 2MY8A 4M5LA 2UUAF 3Q22A 3IS9B 1JNRB 2UVVA 1OWXA 4P71A 3ITHA 4DR1J 3CJQA 1T3NA 4USVA 5D6GA 4RKUC 4RW4A 3RBEA 3ELHA 1KTQA 2OEKA 1RWNB 1XC9A 5J1NA 3M8WA 1IBKF 4ZP7A 2DGUA 3WBZA 1TVRB 2YH0A 2IDLA 2M0GB 3OUYA 3UCGA 3VZHA 2B51A 3IRWP 3UN3A 2J8AA 2I38A 1CSJA 4RW7B 4F4ZA 3JTPA 1U1QA 2ZJPQ 3Q8QB 1MMNA 1U1PA 4O3QA 3EPIA 3TUZC 4JI0F 1NJYA 5GVQA 3OFHA 1YJNS 5KG4A 2HHXA 3G6XA 4NLQA 1Q8BA 1RHQB 4OJGA 2KHDA 1URRA 1H3DA 4FYWB 2V2KA 4FKXA 1LXJA 3V6JA 3K5OA 3PRBA 1K0TA 3DLLQ 2WOMB 3VAIA 5KFYA 3CDBA 3HZGA 1XIQA 1NK8A 3GE9A 2R8KA 3GYNA 3G8QA 1RU1A 1EIYB 3VAHA 3VQTA 1S1TB 1FVSA 1MG7A 2HRUA 4UOFA 1Y5LB 4ZMMA 2VFRA 3J81j 1PYTA 5J1EB 2DGXA 4O4GA 5ETTA 2FZCB 2IAJA 3SIPB 1HWIA 3TANA 1O0PA 3MM8B 1YJUA 2CWXA 1U6ZA 3EUNA 3DN9A 3DOKB 3NEKA 5D0EA 1RWUA 1QSSA 1R8CA 3RR8A 4DV2F 4O3NA 4KPYA 1PGZA 4LBIA 2C2OB 1S76D 4Q0BA 1BY9A 1F0XA 2F1FA 4RBVA 4ED6A 2AJ2A 2XHWA 4DZ6A 5A8KB 3CJRA 4CLTA 4YHHF 1RE1B 2PT0A 1A9NB 5DG7A 4Q2LA 1TMMA 3O44A 2DNKA 1VQ5S 3HD2A 3IGVA 2UXDF 3MM6B 3H42A 2A6MA 1RHMB 5GAEI 1WF1A 4DN9A 2P9CA 3GYXB 4LFBJ 5IS2A 3PR5B 1I1GA 4O0IA 5I3QA 2N7YA 1N56A 2MQQA 2BV3A 2CNLB 4ZVRB 1M0SA 2HQFA 2H9ZA 4P9SA 2F8EX 3EM1A 3IGNA 2G0JA 3LWMA 1EQMA 5LM7E 4JV5J 4CLYA 2EWHA 1W2BR 1RHJB 2G9OA 4DR4F 3LP0A 1PJ7A 4UF4A 3LP2B 1M5OC 3RU0A 2VDHA 4C7QA 1OQ3A 5CZVA 3NMAA 1X9SA 1NZ8A 3A3NB 4GC6A 2EFPA 2YTCA 1ICEB 3VHQA 4OZLA 2CYYA 2GAHC 1T3OA 4P72A 5DGBA 2GJIA 5J2QB 3I5BA 3UN5A 4GKKJ 3C14B 5D0RA 1FD2A 2AGQA 5JVHQ 1LKZA 1ELOA 3K57A 5D4PA 3M6WA 4X4OA 5EWGA 4WIQA 2BBEA 1KP6A 1S0MA 4CO2A 1VGYA 4ZJQA 2DNNA 3LGNA 4NRTA 4YY3F 2C2EA 3PO5A 1WEYA 2E66A 1KVKA 5L39A 2HHHJ 2IMWP 2CJXB 2VJVA 1N5YB 1HI0P 4BC9A 2E1PA 1WG5A 3SQGB 4FF2A 2JVOA 1VQ4S 1GH8A 1C1BA 2DD8S 2R9LA 5IV4A 4MTPA 5B0FA 3DOLA 1M5VC 4ZK7M 4CLPA 1U48A 2Z57B 3IWLA 3QBCA 2MQNA 1CJVA 3DDIA 1Q79A 4WJBA 3ISZA 1YJWS 4IOAQ 1KOOA 4C8NA 1L3SA 1GMVA 5DDOC 2GCFA 4ATNA 5C42B 4ZVQB 1WC3A 1SVDA 3BYPA 2VFUA 3KJVB 3PY8A 2LA6A 4EO8A 4DQPA 1VQNS 1F3VA 1WOSA 3MMAA 1LWFB 1JLQB 1RP5A 1SC6A 5CYQA 1KTVA 1T05B 1B7FA 2D3UA 1HL6A 5CH7B 3EPGA 3D0GE 4C8OA 5ETVA 1U1LA 1SBRA 1Z2ZA 1RTZA 2DNMA 2Z30B 1NO8A 4USKA 2BMBA 3IC1A 1FDBA 1DBDA 1EZZB 4OHZA 5C5JA 2BRLA 2ZEJA 3B78A 2NUHA 4PG8A 4OV1A 4CH7A 3GONA 2BDPA 4GKJJ 4CQ1A 3MEGA 2YXLA 4R0EA 3ADAC 2MKKA 3J81Y 1APSA 1R0CB 3UW1A 1M1GA 2SXLA 4PYDA 4K4XA 1VQYA 1IBLF 3UN2A 2AJ1A 2RDIA 5B0CA 1F9FA 1SH0A 4NYOA 3DMJB 4PWUA 2DR5A 2QT7A 1CEZA 4OYOA 2LXIA 5DQGA 1J5OB 2F4FA 5E2QA 2UVRA 1ZAXA 2YNGB 4Y2IA 3M8PA 1XTZA 2NXJA 1HBNA 1EETB 4C3MA 1CJUA 2KI2A 3EZUA 2V5HG 4M5DA 3MURP 1S6QB 3PM9A 2XGPA 3D9BA 4JI6F 1FFGB 2A3JA 3M2VA 2XLIA 4OFZA 4Q43A 4FYYB 4DL3A 1VQLS 1T95A 3QT8A 3N6MA 2FGOA 2D69A 3QO9A 3KLHA 2DJWA 3KXDA 2YWFA 1BQNB 2G2OA 4MH8A 2VPZB 1MMDA 3I4HX 4C3LA 2GHVC 1AA1B 2CJQA 3F44A 3DLGA 1NM2A 2CZ4A 2FJXA 1ITPA 3RB6A 3ZXWA 3EVMA 2ATLA 5D0GA 4ETZA 2IM2A 2MQPA 4JUZA 1VRTA 3LP1A 1RB0A 2DR8A 1E6YB 4PG5A 1RWVB 1S1WB 2F9DA 3IAM9 3GFYA 4OZ1A 3LUYA 2ZZMA 3KUGA 1RWXB 3MM5A 2DR6A 3EMTA 3GLJA 2QFJA 4EWTA 2XLKA 3OD2A 3OL6A 1LXNA 3AJ1A 4CH1A 3RAQA 5KG1A 4F4XA 2OMLA 3QRRA 2V69A 1AUSL 1IWAA 4EYIB 1XNQJ 5A2QY 2CJAA 5DO2A 2DGVA 1FEHA 1RTHB 2ROPA 3Q8VA 4U95A 1JLFA 5HL7Q 1NKCA 4X64F 3OHAA 3NAHA 4L3KA 3R5GA 2K1RA 4K50A 1NXIA 5A76A 3ZFVA 5L46A 3AAWB 1WOPA 2YNFA 4ECTA 2L9NA 1HW8A 2Y9HA 4M5KA 2YKMA 1FNMA 3P6YC 2VA2A 2HGMA 2DGQA 3JAMY 1ZTTA 3ZTSA 1Y7PA 2YVSA 4RW9A 1MU2B 4XIUA 4MK8A 5I3UB 1KVJA 3DDNA 2JEIA 2VPWB 2XY7A 1NPKA 1S6UA 1CJTB 4J9UE 1Q8KA 2JLFA 2O67A 4EGLA 3NCPA 2K8GA 4L74A 1HNIB 2RJZA 4JI4J 2CQGA 2RF2B 4OYBA 2QC3A 3SEOA 4KJIA 1UPMB 2DKOB 2XZDB 3KYLA 4BCAA 2E1MC 4DR2F 2WVEA 4NCGA 4OX7A 4QWBA 2R7UA 2UUAJ 1HHTP 4WFZA 3G82A 2KKHA 2FLLA 1UKUA 5BYQA 2W2NP 2J76E 3LF0A 2K3KA 4KGZB 1GNKA 1FESA 5KG0A 2VJUA 2MZTA 2J7KA 3J7Z5 2HS0A 2ZBIA 4ECWA 3X3UA 1TL7B 4OI2A 1IBKJ 3LQVA 3D0HE 2CG4A 4P2MA 1YGYA 3LTOA 1RADB 3L09A 4WU2A 4RWWA 1JLEB 3HJVA 4NLWA 2XS5A 1EHWA 4M5GA 1C2PA 4AYBD 3DLHA 1S9GA 1KOHA 1KN6A 5HVFA 3M8YA 2JDJA 2HZVA 2XO6A 2WCXA 1BQMA 1CBKA 1U1KA 4JI0J 4DV3F 1K47A 3DU6A 2AX0A 1D8YA 2ATCB 3UFCX 1M90T 1DAXA 4ZVSB 2J9DE 1KKHA 1PC5A 2VASA 4PWDB 2WSEC 3DI6A 2IC3B 2VOOA 4NZ6A 3HF5A 2HK2A 1KBRA 1HNZF 3GV7B 3OXGA 1K9MT 2ZD1A 4DG1B 2E7XA 1RZMA 3ZTOA 1SKRA 3KLVA 2PA8D 3RAMA 3P4UB 2QSWA 3PEHA 1FKOA 2DNHA 3CJ8A 4A8QA 4ZPCA 4OJ1A 1MW7A 5AE1A 1DQAA 4X4QA 4OI1A 3MOJB 3CIMA 3MM7B 2IM0A 3B82A 4J9VA 1GAOA 1LW2B 2KFNA 2LQ5A 4CNZA 4DJBA 1DZ5A 1S99A 1VJQA 4WFYA 5K9FA 1LEOA 1U1OA 4KE5A 1WG4A 2EW9A 2W4DA 2GVDA 3OXFA 2HNYB 4A46A 3ENQA 3ZZOA 5KFJA 2HMIA 3M7VA 3RRGA 5EN1A 3C8YA 3MCNA 4WE1B 4DV2J 2WB4A 3QFHA 5D8HB 4TNOA 1WC5A 1UCNA 2CADA 2ZC3A 1FHTA 3D66A 3TI0A 4NI2B 2DGSA 4RNNA 5HAOA 4HYKA 1TV6B 1DQ8A 4R5PA 5IM0A 4QWCA 4YHHJ 1S9EB 2WONB 2AEMA 4LFCF 1AZSA 2CVEA 1JB0C 2XLJA 3R9LA 3GIMA 1TR0A 2X1GA 5B0EA 2VQEF 4JI3J 1ZM4A 5BJRA 2ZH3A 1YZ6A 3CTRA 2MZQA 4FBUA 3GIIA 1J5EJ 1X4GA 3HDSA 3HCXA 4LMZA 4DR4J 4WP9A 4JI8F 3MEDB 2VBYA 4OZNA 1TVRA 2VBZA 1H7XA 2DNYA 2NYIA 3SDEB 1T9YA 1EP4B 2V34A 3GSIA 8ATCB 2N4CA 2F7VA 2IRYA 2PEHA 2W7PA 1X31C 2R7RA 1IJFB 1LWEB 1RAJA 6FD1A 5GAHI 4PRFA 3PTWA 2EBGA 2HHPA 4UOGA 1S4EA 2GC8A 3H8YA 2WW8A 5HMYA 4OZJA 3N9UC 2LYVA 4MFBB 2B9EA 2UXCF 2P8IA 2XMWA 4JOUA 3LGMA 1YJRA 4WFAQ 5H9EK 2C3PA 3MMCB 3SSRA 1VISA 2QX0A 3MWBA 1S59A 2IFXA 4YY3J 1TKDA 1ZZFA 2WOMA 3P96A 1QE1B 2JX2A 3HP6A 1HI8A 1BC6A 3R6GB 1ZBTA 4TQRA 5HVGA 3UR0A 2ALYB 4ZITA 1Q95G 3FEXB 4QZVB 2CQPA 3LWLA 1BQXA 2IRUA 4QWAA 3GR1A 3GSDA 2V63A 4LF7J 2C2NA 3GB0A 2IDEA 5IT9U 1JKHB 3FSIA 1U6BA 3HKZD 1HNXF 1O51A 3OL7A 4XTTA 3DM2B 3WC0A 3HT0A 2ZH8A 1OS5A 1FCAA 2ASDA 1D3WA 3I9ZA 2E29A 3W61A 4ZVGA 1ZPVA 3T1HF 2AF6A 3AQOA 3DOKA 4ZPBA 3TWZA 3CPWR 2AX1A 1IWGA 2ZJQQ 2HGNA 2A2DA 4KGVB 2ZUAA 4XPCA 4UUXA 2C2KB 4DU7A 2JWNA 2RQKA 4DHVA 1XR6A 2R7WA 5AXMA 1RQ0A 2WK4A 2VIHA 4QIGA 5IQQA 1N5QA 3QQCD 3BKTA 5BXIA 4MIWA 2OPRB 2FHKA 2VC1A 3I0RB 3IR5B 4CO5A 4FP9A 2P5VA 4IKAA 3MM6A 1K8AT 5H9FK 2NCKL 2XYHB 3QSIA 1WHVA 2KT5A 3E01B 4I2QB 4QWEA 3MR3A 3ET6A 4ZCKA 1UAWA 3PCOB 3BR9A 1NB7A 4LRCA 4OL8A 2U1AA 2CRLA 1UPPA 3K8VA 3CWJA 3LP2A 5H1SV 2Y1IA 2QLXA 1W2IA 3RZAA 1WC1A 2V8PA 5I3PA 4U7CA 2W4PA 1SPBP 1ZM9A 1JLBB 2W8LA 1V5IB 2J0XA 1YKWA 2IA0A 4DR6F 2LXUA 3TUPA 2C3UA 3BO3A 2HWIA 2I9SA 4HDHA 1SQGA 4F02A 1GX5A 3ZZUA 1WWHA 5DZ7A 5DG8A 3GFHA 1S57A 2ZDPA 1SJ3P 1IKVB 4F3OA 2C2ZB 2HRTA 3O1LA 3OTEA 1NKBA 4NA1A 2A10A 3AOBA 5J2QA 5C24B 3K89A 4WK3A 1OMSA 3KOAA 3G6VA 3DOMB 3C14A 2JFKA 2BW7A 4NEZA 2WAQD 1MLAA 3OSNA 2E5HA 2W7AA 3VAGA 2VG6A 4M5MA 3NY0A 2OTJS 2D74B 3GJSB 3CD6S 2DO4A 1S5ZA 1CULB 2C28A 2BJ9A 3CW2C 4OYXA 2IIHA 3CCES 1N5YA 2FYXA 3BR8A 1L3VA 4J9OA 4A8FA 1RT3B 4OQJA 1DRZA 4RUCA 2CJ9A 2DNGA 3KLFB 1S10A 4J91A 4OLOA 2KN4A 4TLQA 2EKYA 2FVRA 1JXLA 1REVB 2GVZB 2FJWA 1R6VA 2PMHA 4ZS6A 5EHHA 4LF4F 1U4BA 1UJ5A 2J9CA 4ZKAA 2NZCA 3OTDA 4IRDA 4B9LA 3TA0A 3LOUA 1FFWB 3WDOA 4ECUA 3KJVA 2W9CB 2D1CA 2B43A 1VQPS 4ZHRB 1LWFA 1JLQA 1N33F 2IHR1 4H4KC 2RE1A 5LMUF 4QWDA 1T05A 2FVSA 2KXHA 5HQMA 1S0VA 4DLGA 4HI1A 2YX1A 5H9FJ 3NBPB 2UXBF 4X64J 1Q1KA 2C22A 3ZTQA 5JMNA 1OY8A 1FRHA 3TR5A 2HNZB 3W63A 2QV6A 4YB5A 3HSJA 1VIXA 3MDFA 1JWWA 1T94A 1KSPA 4GO5X 1AROP 4CO0A 1N5SA 3GJQB 3M4XA 5IT0A 2BOPA 3MR6A 1B4SA 1K1QA 4G6VB 3DGPB 3QT5A 3TYTA 2DHAA 3KJNB 3KUEA 2M9KA 3I96A 2V0NA 2FY8A 2I1RA 1NJIT 1KLNA 3DMJA 2PMZD 3D1OA 3WX4A 4U7UK 4GVLA 1HFEL 3HHNB 1J5OA 3QLHB 4OYAA 1S1UB 3CCQS 2EFQA 2OJ3A 2YNGA 3BGRB 4RUHA 1EETA 3TRGA 1S6QA 3EGNA 3HD1A 5LSLA 3W5ZA 1DY3A 5K14B 3CD0A 5K8PA 4R25A 4DOZA 1R8BA 1SKWA 2ADCA 1NDKA 3BDEA 1BQNA 1IR1A 1HIYA 1FNOA 4N56A 3GFZA 2HFNA 2EFNA 3EWGA 2VL1A 3DLBA 4OYZA 4J9SA 2D3ZA 2HLUA 2E5GA 2R8GA 1JX4A 4OHVA 3M2UB 3J7YI 1JIHA 2GNKA 3HHLD 1FDDA 3M8ZA 5AE3A 4ZVFA 4Q7AA 5E41A 2LA4A 4OI4A 4CCHA 1S1WA 1X5OA 1T7PA 1UVJA 1IVZA 2DRAA 2EXUA 2OFGX 3BPDA 3SCJE 3OR2A 3K58A 2W4CA 3LALA 4DV3J 2YNHB 2YWGA 1WDTA 1UVKA 2MPUA 4BWJA 1T02A 5G0RB 1RU2A 4JI5F 4P2FA 1WSVA 1SL2A 2I8EA 4UTGA 3M32B 4TN2A 1SL0A 3CCZA 1KWMA 2C3OA 4IG3B 3ZZPA 4LRFA 1VK3A 3OVAA 1XBWA 3H25A 4FKYA 1HNZJ 3KHHA 1TL1B 2HFSA 2AGPA 1YIJS 2M2BA 5LJ5Y 1RTHA 3FEZA 3UDLA 2LQBA 2IYGA 3RW6A 1NHVA 4A8YA 1R31A 4R8UB 4QIEA 2L9DA 1RTIB 1QAJA 2GIRA 2KYZA 3MUTP 1D1UA 1RWMB 2RRAA 2DB1A 2Q3PA 2UP1A 3OHBA 3CCMS 3SBMA 2HQCA 4YEAA 4DQRA 3PW4A 4ZOSA 4NEYA 2FLPA 4WFBQ 1S77D 3T1AA 1GX6A 3K17A 1RYSA 3UNGC 2CDRB 2LQJA 5DM7Q 2VA3A 3RJMB 5KG5A 4DL0C 3KMSA 3U02A 2OSRA 1N88A 7FDRA 1CJTA 2B9WA 2UUWA 1JLAB 1R0AB 2L48A 3WHIA 5T7LB 4O3SA 3MUMP 1HNIA 2B6AB 2RF2A 1E6VB 3BKUA 2DPJA 4ZN3A 4P7VA 3DRYA 1XMBA 2VG5B 4NLOA 4DUZF 4J7CA 2QIFA 4CLFA 2VQEJ 4WPAA 1SJ4P 5HBMA 4OZ5A 3V6DB 2BABA 1H73A 2GO8A 2GA7A 1SC4B 2WTFA 4ILMA 3RUBL 2JL9A 1HARA 2XMMA 4JI8J 2W7OA 3AOCA 3R27A 1V9OA 4HTJA 4DPTA 4GMKA 4DL7A 1JNZB 2H51B 4DWIA 1P1LA 2XMKA 2RUGA 1CC7A 5ETMA 1CQNA 3JYTA 4KHPF 4B9NA 2CZVC 4C9DA 1FRJA 4HI2A 3M8SA 1M5SA 4ZLLA 1R89A 2XMTA 2G4BA 2XMAA 2W24A 2MTLA 3AD9C 3IAS9 3CDUA 3BN4A 3OR1B 4NYZA 4Q8EA 3TUIC 1VFJA 4P7TA 4DV6F 1TK0A 3F41A 2QYGA 3NS6A 2CQ1A 2UXCJ 3BV8A 1WACA 5F8JA 4LQ3A 3LH2S 2IC3A 1N0UA 3BQ0A 4YFUA 1N4LA 4KH0B 3BDPA 2E1CA 4KC5A 2CWKA 3PHTA 3KG1A 4DG1A 3HFZB 1JJ2R 3N4WA 3HT3A 2XZWA 1DTTB 3CJKB 1UEKA 4I6AA 2BUNA 1T9TA 5HK4A 2HLTA 2LU2A 4KFBB 3MM7A 1JLGB 3C66A 2QLBB 2B7CB 4ED5A 1HNXJ 1U1MA 3VTIA 4X65F 4CP5A 4FYVB 4W4MA 2OEJA 1VDHA 5J2MB 2XO7A 4L76A 5LMNF 4OV6A 1RA6A 2E9TA 2HNYA 3T1HJ 2CPDA 4YR2A 1FERA 5IOLA 3G4SS 2BW2A 2LEAA 2P9EA 2W01A 4WE1A 3C15B 2AYMA 4C11A 2IMOA 2Y3YA 2YX4A 2W2OP 4QU7A 4NI2A 2VHGA 4CZCA 1EQ0A 4DCPB 1YJTA 4JBCA 3FFIB 1KVIA 3HHKA 1U45A 1S9EA 2BXJA 1N48A 2XMUA 3W2WB 1B3TA 4Q8FA 5KFBA 4DPOA 2PE8A 2Y1RI 2WBMA 5BR8F 4WXOA 4PG6A 3THVA 1S6OA 3RB4A 4WFNQ 2RKIA 2B9YA 1G7CB 4E2FB 2YWKA 4MYTA 1DTQB 4LR8A 1I51B 1CVJA 1N32F 2CQ2A 1RT2B 3DC2A 1TKTA 2RMLA 4X2BA 2JOQA 4HACA 2QRRA 1REGX 2VBXA 2DISA 4YOEA 1GMWD 3AXMA 3MEDA 4WP8A 2KO1A 3FK4A 2AZ3A 3MM9B 2AJFE 1PG5B 4DS4A 2I5JA 3T9ZA 2AYEA 2VZ9A 4OJ3A 1F3FA 1KFSA 4DF4A 3I82A 4J9PA 3WQPA 2R7VA 1JXVA 4WFXA 3FCWA 2O5DA 3R7BB 2UVWA 4ED0A 2YKPA 4DR5F 5DDQC 3NXZA 2L3MA 3HVAA 4RJVA 1U2CA 3C46A 2QE5A 2HIYA 3UDVA 3M9MB 5BYSA 3MMJA 1U2RA 2PC6A 3CDEA 5ETSA 2XG8A 1IM6A 4MFBA 3W3SA 4WKYA 2MZ1A 4F8RA 2X1FA 4FXDA 5DQHA 5KFOA 4D3GA 2LKZA 2ZHOA 1Y10A 1QE1A 4X84A 4NASA 1EARA 1VCTA 2BR0A 1YBAA 2VUGA 1TK5A 1NKEA 2WBRA 3CCWA 3Q8YA 5ETQA 1NK7A 1I6JA 2N3LA 2ZZNA 2DH8A 2ZDOA 1JKHA 3ZNUA 2YKOA 4DU8A 3BBCA 4LF4J 3DM2A 3L9ZA 1ZPWX 4AQYF 3HHLC 3HI9A 2XS2A 2PDAA 2VFTA 3M1VB 5E3CA 4F0KA 2UV8A 3IXQA 3SMZA 4JI2F 5A8WB 3HK2A 5KFTA 1VQOS 1FA0A 4LQ9A 3W60A 4OYMA 2UUBJ 3PO4A 2KXFA 3CC7S 5KFCA 1HYSB 1QUVA 5F0UA 3N5FA 4RWXA 4J9MA 4C8YA 2IJNA 2M7SA 2WVCA 4I1TA 5LMUJ 1Y3KA 2OPRA 3I0RA 4F4WA 5HP1B 4ELVA 3TZWA 4J9KA 4Q45A 1IBMJ 2UXBJ 2P6TA 4LF9F 3IG1B 4I2QA 4P52A 2E1AA 2FLNA 3K0JA 1SB6A 2BQ3A 1B64A 4ZVEA 7AT1B 2VV5A 2LVWA 3QIPA 2HHUA 1KQSR 2V2QA 3DXBA 2VG7B 1JLBA 1NDPA 1OY6A 2JEJA 3D6HB 2X1AA 4FPRA 1RKJA 4C8MA 3RYLA 1DARA 3TAPA 3MEEA 1T9VA 2ZE2B 2R2TA 1IKVA 3PEJA 2RVJA 4RUAA 1TUGB 3A13A 4LF5F 2BANB 5C24A 1OSCA 4KKOB 2DHSA 2R8IA 4ZPTR 1ZETA 2LDIA 4ZJOA 1NSPA 3IBWA 2AIRB 3OTOF 4QYZJ 4NOHA 4ZLNA 2CFXA 3L95X 1HKAA 4J9LA 4PG4A 1P9QC 2KH9A 1CULA 5IXUA 3ETMA 4OJHA 4IQMA 3AA8A 3RB3A 2ZH2A 5KFEA 4NXNF 3VWSA 4RU9A 2F40A 1TAUA 2MLZA 1RT3A 2BOAA 1NK9A 5HSPA 3KLFA 3ENAA 4XK8C 1FK9B 4O3PA 2XC9A 3HXMA 1CG2A 3MMBB 4DFPA 1REVA 2QZ8A 1M5PC 3JXOA 3EYZA 4A8SA 3IWNC 2PI4A 3LGHA 3IBCB 4N47A 2CQ0A 3LA0A 2C2MB 3TZZA 3X1LB 5IC6B 3TNVA 5HN0A 2F3JA 4B3OA 1GT8A 1BLUA 3HKWA 4ZVUB 3ZTRA 2ZNZA 2GQCA 2XB2D 4ITSA 2ZFHA 4ZVOB 1HNWF 5A0YA 3FDSA 2KZMA 2W9CA 4YR3A 4Y2KA 3TEGA 2QJ3A 2YKQA 2KB2A 3ILOA 4ZVTB 3G96A 3SSSA 3PACA 3G71S 3K7RA 2OD6A 4A48A 3JSRA 3AHPA 3PZPA 1JK9B 4ZCMA 1RKIA 1N34F 4RNOA 1C4AA 5FD1A 3PKMA 1MROB 4B3TF 1I3OB 4NL5A 2EPIA 4TXSA 3JSMB 2HNZA 3OPKA 2Y8YA 2VPXB 2DHHA 3V81B 2W9AA 2UUCF 3CCJS 4B3MF 2A18A 2BA9A 4Y65A 3H5YA 4DV4F 3BS9A 4KGMA 1XWLA 3PX0A 3DGPA 4FYXB 2CQHA 2NPIA 1UZDA 4N41A 4KPCA 1IKYB 2OUGA 2WVDA 3FVYA 1Y4ZB 3M6XA 5KOXA 2RSQA 3SXLA 1B0PA 5L1JA 3MFHA 1FI4A 4OI3A 2ZOGA 4GVBB 4TVAB 2J5AA 3EDQB 3D2WA 3MPVA 3E3XA 1H0HB 2O3DA 3J7ZT 1VBYA 3G8TA 9ATCB 3BGRA 4F4YA 1GTHA 3UD5A 2ZOMA 2XZTB 1NRKA 1KRPA 3R1HA 4DR3F 4DUZJ 1FFSB 2HPUA 3IMQJ 3P45B 1NJZA 4TY8A 4LIRA 4ED2A 1JLCB 2J6SA 1VYAA 2LFVA 4DCOB 3Q0AA 4A47A 1NZAA 3D1HA 2UUTA 4W98A 4EBEA 1OY9A 4F4KA 1I94J 4IDKB 3GU0A 2MGZB 3QGGA 5AJ3J 3QZ7A 3C19A 3PFEA 4C6AA 1ZA2B 2AYGA 4BWMA 2BKPA 2OO4A 5BYRA 2DBBA 2B8PA 3DRSB 2GIFA 2I2YA 4KHPJ 4IOBA 5D4OA 4NLGA 2M8HA 3CO0P 4ALZA 1R3NA 4OMFG 2HBZB 3E51A 3BBFA 4QQBA 1VC5A 2HK3A 4DQIA 5AXLA 4WYLA 1YWXA 5G0RA 4ES2A 5LT5A 2QG9B 3JTNA 3BO4A 4OYPA 4RUBA 1UW9A 5KT2A 3M32A 1KD1T 4HL9A 4IR9A 2AW0A 2WVBA 4IG3A 1R43A 4DEZA 3TZYA 3EXYA 2PEBA 4LRDA 4OZ2A 1TL1A 2MLXA 1RT4B 2KM8C 4ZCLA 3CC4S 2BJDA 4PG7A 4LIWA 2HZAA 2POKA 4R8UA 3NNAA 2MY7A 1GXLA 3CSKA 3B4DA 4H4MB 2DGOA 1RABB 1X4BA 4LUBA 1FF2A 4QPXA 2VFSA 3HZEA 3GIRA 3Q86A 4WU3A 1UFKA 3CCRS 2BJ3A 3C6TA 2HFZA 3US5A 3EGZA 1NJWA 3NG8A 4X65J 3HULA 4J5OA 5KFPA 4ICLB 3UNYA 3Q83A 2A6OA 2YWHA 2QSFA 2Q6CA 1TKXB 3R7SB 1RAFB 5IV3A 1GEHA 2Q43A 4JI1F 2R7SA 3B4MA 2R7TA 4Q44A 2ZWPA 2C42A 4ERDA 4XDCA 1C1CB 3EX7B 1R0AA 3N5BA 5CYMB 1YRXA 2FTRA 1HWUA 2B6AA 3NGSA 3DCAA 4DX5A 2OD4A 2R8JA 2ACMA 3FCVA 3OFGA 4QCLA 5LSRA 2VG5A 4NZ7A 2FD2A 5JJBA 4ZVPB 2ZH6A 3KLGB 1PO6A 2O1PA 2F4VJ 2D3OR 5BR8J 4LBPA 5HO4A 1RSCA 3EICA 5HMXA 5LL6d 2JVRA 1NCLA 2KT3A 4X62F 2DNZA 3GYGA 1FO1A 4HR2A 1TTHB 4KB7A 1N32J 3NGKA 3IFEA 3DLKB 4QYRA 1SH2A 3TAQA 1QY7A 1S7IA 3CULA 5DZ6A 1ZYQA 1NSAA 2BJ7A 4A4JA 4ED1A 2CUYA 4EBCA 5EGYA 3CJ0A 3RBXA 2CJBA 1QTMA 3OUYB 4CWBA 2FY1A 3U1NA 3VAJA 1AFJA 3H7HB 2VBWA 3OR1A 4DR5J 2CPJA 4O0NA 2ZUGA 2ZVIA 2DH7A 3NCQA 2GZOA 1GFWB 4N8NA 1SQFA 2CPFA 1PYOB 3OLAA 1T9UA 4EI2A 1PC4A 4OLPA 5AXKA 3R5BA 2OI2A 3KK2B 2CQBA 3O5TB 1QLNA 5GMEA 2KRRA 4Z7YA 3NAIA 3PYFA 1UP1A 1U26A 2G2YA 4LF6F 3BSCA 4LREA 2VONA 3OTCA 5KFAA 2OLWA 1XMQF 1DTTA 2CA9A 3MECA 4CO4A 4YR0A 1HW9A 4ZA1A 2Y0SD 3FBCA 4KFBA 3PYGA 4FXWA 1S1VB 1JLGA 3HSZA 4AUKA 2R8HA 2RH3A 4IFYB 4J9RA 2MYFA 2ZVSA 3BH7B 5LXRA 4DN0A 1B99A 3G87A 3BZQA 2KDOA 2Z2YB 4USJC 3QIDA 4DFMA 5FDLB 2YQ3A 1NB2A 4C4WA 2FHJD 1O8BA 3AY0A 1GXTA 5ETKA 3SCKE 2VH7A 4JI2J 1VQSA 4JYAF 3D28A 4U6PA 1G2EA 4EK2A 2XULA 2G0IA 1VI7A 3BEGB 1FRIA 4DFKA 4CLZA 1T0TV 4K8RA 1FWPA 1G4CA 1W7WA 2HBQB 3PW5A 3AD7C 1FT8A 3FFIA 5GMKa 4B17A 2ZKUA 3W2WA 4KSEB 4IR1A 1RAOA 3FNNA 1SXLA 1GMWA 4V19J 3KUHA 7FD1A 3ZTPA 1C0UB 1NHKL 3OFFA 3D67A 2F9JA 3GFXA 2QMWA 5ETPA 4FPIA 1DTQA 3L7PA 3BGUA 3C6UB 4EMDA 3KLEB 1RT2A 5IC4B 1NU4A 3HSDA 2V4JA 3KMQA 3R5JB 3PYEA 3K5NA 3PW0A 2FJVA 1P1TA 1Y3JA 1JQGA 3A12A 1FDNA 3P5TL 1RTJB 2BYCA 3POTB 4K4WA 1WTFA 4MKYA 4ES1A 2IJFA 3D1QA 4CM0A 2OGUA 5HJYA 4M63A 3M2RA 4PEOA 1RT5A 4ZPWR 1LK7A 4FS2A 1WF0A 1AB8A 3PRVA 4LF8F 1Y0HA 2XWXA 1U6FA 5D4LA 3FBEA 1FJCA 2J0QD 4LF5J 2PD1A 3UO0A 3OBIA 2NS1B 2HZCA 1WTBA 3OTOJ 2LEBA 1BMQB 1FRKA 2JSXA 1RUSA 1VBZA 4DI6A 1YRTA 4NXNJ 2COLA 3G9CA 1TL3B 2DY1A 1FKPB 2H65B 4G1QA 4WZMA 1QVFR 5AE2A 3NP5A 2Z4PA 1B0TA 2DO0A 4N76A 1D0EA 1OYEA 2BRKA 2ASYA 1T11A 2MZSA 4HHJA 1PJ5A 4TU9A 1C1BB 2MJNA 3KK3B 2V50A 4EYHB 2KT2A 4RX6A 4DV5J 3ZZ0A 2LP4A 1PBUA 4BDPA 1SI9A 1KDNA 2CNNB 2P2CB 5LXYA 2QL5B 2DY9A 2ZKTA 2RS8A 4F2RA 2JEGA 2L41A 1AFIA 2PFFB 4ELUA 3G6YA 1YG0A 2HQDA 1KFDA 3M1VA 2B3TB 1F5AA 4H4OB 1RHRB 1FVQA 5A8WA 2I6WA 2ZBQA 3EZ5A 4IO1A 1PILA 8AT1B 1TUVA 1NK5A 2ZWOA 2MSSA 3W8GA 1PJ6A 2AT1B 5ETLA 2MZJA 2ZOFA 4QPTA 4DR7J 3M9OB 2F63A 4NLSA 1MMLA 1S79A 3MMAB 1N34J 5HP1A 2KYXA 5IFMA 4ECYA 4JI7F 2B4VA 3IG1A 3CCSS 5CYQB 4B3TJ 2R7XA 1FX2A 3BPSP 5D77A 5B0GA 3GJTB 1F5CA 2RRBA 5DQIA 4ECVA 3I32A 3QPIA 4DV4J 4X4SA 2HQIA 1X4EA 1U0HB 3T3FA 2AEFA 4NMLA 3Q24A 4UUWA 3NNHA 2VPYB 1U7LA 4ES3A 2B7BB 2VG7A 2W2MP 4DSFA 4CI0B 3UE2A 4ECQA 1Q81T 4Y2AA 1HBOB 4WXWA 5CA5A 3BH6B 4IG0B 5KG3A 4I6YA 2CIMA 2D9PA 2HS3A 2QMUB 2RQ4A 2VKRA 2FHMA 3J80U 1YBUA 1T8EA 5I42B 4FNIA 3PJWA 1H7WA 2P9GA 5HLFB 5C7PA 1RTDB 4B9VA 3BGLA 4V19X 2RD5C 2FC8A 5DETA 2DPIA 3S01A 3SZ2A 3TZXA 4DR3J 4ECZA 3T5KA 4TQSA 1VQ6S 1B0VA 3M8PB 4M5JA 2ZH7A 4GKKF 4RR5A 4NX9A 3GIKA 4K4ZA 5JUMA 5E3RA 4Y00A 2BACA 3CF5Q 5B7WA 1N36J 1VQMS 5F8HA 1FJ7A 4C0OC 5ETNA 4DV7F 3DRXA 2FUG9 4I7FB 1FEEA 3D7SB 1SL1A 4ZPAA 3MMBA 4PXCA 4DPWA 4RPFA 1S97A 1YQHA 1RWPB 1HWLA 5KFXA 1WKJA 2XMJA 4GO7X 2VQFF 1VRTB 4IRKA 3ETOA 1PCAA 3CUNA 3I6PA 4DBQA 2AWZA 3SQOP 1Q0NA 1I5OB 2PFDA 2H4WB 1A7GE 1OO0B 4HHHA 3MFIA 3DRPA 5HMZA 3NS7B 4X4UA 4I4BA 2EC0A 3EVOA 3MR7A 3MD1A 3TUJC 5E7OB 5KFDA 3G8SA 3LAKA 3FMBA 4KHMA 3I87A 2Z8QA 3RBDA 3BQ2A 1MROA 5L9NA 2HVDA 1GMUA 4WP3A 2Z56B 3W9IA 3JSMA 4CTAB 1Y9OA 1ZAWA 3D54A 3V81A 4DL4A 3TJAA 3LANA 1RT6B 4X4VA 4N77A 3M30B 1X0FA 2AJ0A 1NLKL 4NCAA 3FGVA 4ZP6A 4KO0B 2NPFA 3CGIA 1RT1B 2MMYA 4JI1J 2GMJA 5FJ4A 2YKMB 3GG1A 5KOWA 1Q8LA 1XNRF 5CABA 1LNQA 3OVBA 2ZBRA 2MQOA 5DLFA 3H5UA 3H40A 4GVBA 2GW8A 1CS4B 1D09B 2E5JA 4C98A 2DITA 1QAYA 2IVMA 3BQ1A 3RW7A 3MGJA 5AT1B 3FQKA 3AH6A 4NYPA 4JV1A 1F60B 1HD1A 1NPRA 4RBUA 1IJEB 4JV2A 3QATA 3SCLE 1D9FA 3KTQA 2CZ9A 2PIIA 4CH0S 1JLCA 3W8PA 3HMJG 2X3DA 2J8SA 2B0GA 3ILIA 3PG9A 4X62J 1DLOB 5M2PA 2KZZA 4YB6A 2DGWA 2QL9B 5KFUA 2BKOA 4K7QA 3VGVA 3G82B 2YQ0A 4MJKA 4IRCA 3HHEA 4HVZA 4IDKA 1HBUB 2CQIA 2MGZA 4O44B 3FRYA 4DV1F 3TW0A 5KFWA 5F9NA 2ZH9A 2RQCA 2IPOB 1PSDA 2HHQA 1TUWA 3Q8RB 3DRSA 1TQLA 1SH3A 5GAGU 1JJCB 4FN5A 2OSQA 1F5BA 1Y11A 1VQ7S 3ENWA 2HQ3A 1NK4A 5ETOA 5T14A 3R7NB 1LWCB 4YN3B 5EWFA 2HAIA 2D9OA 2E5LF 1Q4RA 4ANEA 5IWAF 2BX6A 2Y1LB 5E33A 3A4TA 3UPFA 2OTLS 3CDAA 4MKBA 1UVNA 2LMIA 4IH7A 5MAOA 2IA6A 2AQ4A 1NNDA 1RT4A 1X8DA 4LF6J 1M5HA 4FF3A 3RRKA 2HEKA 2MKHA 3GMGA 5FLXU 1LQ9A 4Y34A 2IYIA 1WUUA 3MAAA 1XMQJ 2VDIA 2MSTA 2ZD1B 3BBBA 1F6TA 4ED7A 2XCPA 1YHQS 3Q2TC 1S12A 5IQ6A 2GGPA 3L7UA 2GQ2A 1FKOB 3IWXA 3F73A 2ZM6F 1QAXA 5EWEA 4DQQA 2HHWA 2MLYA 1S0NA 4PQAA 2CNOB 4UT4A 2N7CA 3DLJA 1X7VA 4ICLA 4IFVB 2UXDJ 1Q7LB 1EKRA 1BD6A 2H54B 1HBMB 3DYAB 1D9DA 2AU0A 3IS9A 2G13A 3PRDA 5DJBA 4HT5A 2GVDB 2DYAA 4K4VA 3AJDA 3MPWA 4CLLA 4F3QA 1X4FA 2RS2A 2EVZA 2QEXS 2UVUA 4MKVA 2HQGA 2B4UA 5CYMA 2WW4A 3GG0A 4M5HA 2NXNA 4ZP9A 3U1LA 5K8NA 3CJ3A 1UA1A 1RYRA 1WNEA 3TP2A 1OIAA 2BKNA 1RAAB 2PGCA 4C8LA 4HT7A 4RNHA 5IM0B 2ZNYA 3KLGA 3TO8A 1AZSB 1QVGR 1HQUB 2DRDA 2WZ1A 3Q89A 2ABYA 4RW7A 2JJ4D 2EG1A 4G3IA 3R2DJ 1DFDA 2FJEB 2DNQA 2BE2B 3VGTA 4OYWA 2MHNA 2PO4A 3DLKA 1SJQA 2GO9A 2PSZA 4J9QA 3KLIB 5KT3A 3M6UA 2U2FA 3DHWC 3A8IA 1UA0A 5DLGA 2MZRA 1WDDA 2EKNA 2YQ1A 3T6BA 5IZHA 1M1KT 3GV8B 5CCMA 1AUDA 4O3OA 5KFHA 4KYZA 2H5JB 2F5GA 3KWMA 3CO9A 2ZITA 1ZZNA 3WX8A 4I2PB 1R8AA 3QWUA 4CRJA 1KC8T 4LF8J 2M4MA 3MXHP 2RIJA 3ZC4A 5K20B 3RRHA 1VJWA 3HPOA 3FZ2A 3PW7A 1FD8A 1S1TA 4B08A 3GPAA 2DNOA 3CCTA 3B6BA 2W2QP 1YTYA 4CT8A 5J1EA 1WSRA 5J2PB 3KK2A 3R97A 5FIIA 1YZ7A 1WI8A 1T03B 1KQGB 3KKFA 3MM8A 1NBEB 2DK2A 3Q8SB 2F8HA 3MTJA 2NLWA 2KG0A 4NLUA 2J7UA 4ZCIA 3NWRA 2H5IB 4WCEQ 3OV7A 2FHJA 1S1VA 5HMWA 1VQ9S 1FXDA 4DL6A 5A8KA 1ZA1B 4I69A 4IFYA 2M5YA 5KAKA 1XN9A 2F8MA 3AODA 1Q86T 3DDKA 1XR5A 1V3ZA 1U8SA 3FCHA 2Z58B 3NGUA 5FDLA 2FVCA 2HW3A 4ZPVR 4YDXA 3V6HA 3RBZA 2OP5A 3MZIA 1LFWA 4O23A 2HVEA 4PABA 4B9TA 4ILRA 4DDFA 4U67Q 5KFKA 2CJYB 2R3VA 1RCXB 2XNQA 4RO0A 3ISND 2XGQA 3MEKA 2G0CA 3MPDA 1EKSA 1UVIA 2HS4A 1IBLJ 2CKWA 4PAAA 4XAKA 2HFUA 2EC2A 4FZVA 3N01A 2KJWA 2Q66A 1H74A 4JI7J 4KV8B 2KFZA 4NMXA 2LQ8A 1F1BB 4B3RF 1C0UA 5KG2A 2D41A 2EK1A 1TKZB 5B09A 3DKDA 3TVZA 4CLWA 4DFJA 3TEHB 2FQQB 3C6UA 4JI3F 1KHWA 3KLEA 1IM4A 4O4RA 3ET6B 3K2YA 1HQEB 2XSFA 4E0DA 2OHDA 2HNDB 1ZAVA 1J5EF 1WELA 1FRXA 3P3DA 3NMRA 5H9EJ 1RTJA 4JI6J 3QMQA 2EBEA 3POTA 3HVRA 5HQ8A 4OX8A 2W2PP 5HQLA 3C2PA 2XCAA 2VODA 2MQMA 4AXJA 1V3SA 2EK6A 2RB7A 4C3KA 4PPDA 1BWVA 2DH9A 3SQGA 2V8GA 3W2VB 3R5CA 3NGDA 5F8LA 1MNEA 2QFIA 3HX9A 4PWWA 2J0WA 4PCQA 3NLCA 3KG0A 1X5SA 3C3LA 3KDOA 2QGFB 4NZ0A 5GADU 2XM3A 5D3GB 1M5KC 4DL5A 4G65A 2BVZA 4DV0F 2AV5A 3QJJA 3SYZA 2DCLA 2VG6B 1TL3A 1MN9A 1FKPA 4Q5VA 4A8KA 1PBAA 5C42A 4A8WA 4KGKA 4DV7J 1H2UX 1X4HA 3BREA 4GRSA 2KJVA 2NSCA 4DSLA 4UOCA 3JQMA 2Q1LA 1JMTA 2DVIA 1DURA 3TX0A 4K4SA 5CD4H 4L75A 3KK3A 1X4DA 3KK1B 2C2RA 5HI7A 3BJYA 1WC6A 2Z2ZA 5KT4A 3BGFA 2OH2A 4LF7F 2VQFJ 3UD3P 4JP8A 3G6ES 3UVJB 3QRPA 8RUCA 3T1YF 3FJ2A 4W90B 4H4OA 2DXEA 1AW0A 5EX0A 1SV5B 1N5TA 4DPUA 2HBRB 1IKXB 1U2FA 3D3BJ 2ACYA 4KR0B 2LDYA 4DSKA 3A3OB 4QW9A 2ZH4A 3EDRB 5F41A 2MDAA 1HPZB 4G1IA 3O3LA 4USIA 3UDEA 5I4MA 1MWQA 2QA2A 2R2SA 1DJ0A 9RUBA 4RZRA 1Q82T 3G2XA 4YMEA 2IY5B 1U0HA 4HH1A 1UWBB 3ZNJ1 2RHQB 4PYAA 2K2PA 4TYAA 2GQQA 3MCSA 2B5JB 3CB4A 4TLRA 1UTAA 1NH7A 4DR2J 5DDPC 3HFKA 2JLEA 1RBOB 4TY9A 2ZJRQ 2JFDA 1HBOA 1NDCA 1XNRJ 5KFQA 3AXKA 4IG0A 3AQPA 2FVPA 2RT3A 4M1KA 3TQEA 2V8HA 1Q78A 3QJPA 4B9MA 1S6PB 2X51A 3D6TB 1NPPA 1HA1A 5KFVA 5I42A 4USUA 4USTA 2IRXA 2HG4A 5HLFA 1RTDA 3MAQA 1GK8A 3ICLA 2A2CA 3R8YA 1FTRA 2Y8WA 3LO3A 4Q2MA 1ZOTA 1RAHB 1SQEA 3QSYB 1NUEA 3R5DA 2CG8A 5ITHA 1WC0A 3ZZTA 5L1IA 3E2EA 4PUOB 1E6YA 2ASJA 5CYJA 2YX7A 4Y2MA 5C25B 1UVLA 1VIOA 4I68A 3JTOA 1ULRA 2V9KA 3CEDA 4DX6A 2CJKA 2B4OA 4IQXA 2DGTA 1R27B 2A1BA 4RL1A 1ZTWA 1VHFA 4MAKA 4OYIA 3DU5A 4DV1J 1D9AA 5B0BA 2X3GA 1QM9A 2VU5A 3H2LA 4I7FA 1U47A 3A8JA 4ZIVA 2DT9A 1FE0A 3FBFA 2GMLA 1JJ4A 3H59A 4F50A 4EZ9A 4QIWD 4KBIA 4JB8B 5EDWA 3T5HA 3HVTB 1PIEA 3HM9A 1LOUA 4KH1B 4MIAA 3FSYA 3PVXA 1IQZA 2KFYA 4URSA 3W5YA 2AZ1A 3OVSA 3LAMA 2YPZA 5ETRA 4N7TA 5LSOA 2IVFB 2E5LJ 3S1TA 1UFWA 3OR2B 2MKSA 5IWAJ 5F3ZA 2LECA 4F4AA 1SUQB 4K2JA 4LF1A 1LV5A 4IYQA 1N6QB 2VB6A 2N3OA 1ROFA 4GC7A 1YVFA 3A3PB 2DIVA 1FX4A 1MU2A 5I3UA 4KT0C 4NA2A 3HO1A 6AT1B 2MB0B 1PYSB 4CTAA 5DRKA 1WKKA 3QYYA 2BEFA 3HJFA 2HBYB 2FPHX 3ZZYA 2KHCA 2HHVA 2M3DA 1TFWA 3K5PA 1O6XA 3H98A 2ZM6J 4RNFA 1RT6A 4LFCJ 2QA4G 2WSCC 1RAIB 4K2XA 3M30A 3T5LA 4ZVHA 1GXUA 3VVTA 1HMVB 4KO0A 2RU3A 1LW0B 3D6FB 1RT1A 3R1LA 2NXUA 2Z2LA 3IM9A 5J2NB 3AOAA 2QA4S 4LR9A 4EUVA 3TVKA 3BN7A 4QOTA 5U47A 1CS4A 4K0KF 1UMJA 1VS3A 5DM6Q 2ROEA 2A0FB 2AP6A 1TL7A 2HURA 3N6NA 4M5NA 4ID8A 3ISNC 1MWYA 1NSKL 3DLEB 1Q5VA 1O5JA 3D3CJ 2J9DA 1JLEA 4ED8A 1RJJA 5L38A 5KFGA 3AA9A 1Z2LA 3H0PA 2HFVA 2XWYA 1DLOA 2Z2MA 3KFWX 1CC8A 1VRUB 2M8DB 4IH6A 4QR2A 2HVHA 3SV3A 5HBMB 1NEEA 2MEWA 1X9WA 1A0OB 3R5AA 3PW2A 1HBUA 1FDAA 1SC3B 3VAMA 5GAEU 3DRRB 3NRBA 4O44A 4RW8B 2G1DA 4EEYA 2D7SA 4X4TA 3MPYA 2B56A 1FE4A 4PWDA 3S8SA 2UU9F 1QUPA 2YBVA 5C2GA 2XSJB 3B54A 3IBFB 5L1KA 1AT1B 1CJKB 3H2UB 2NYHA 2NXEA 4Z7CA 3BSAA 2CPIA 4LFAF 4E8UA 1X5TA 2RAQA 4A8MP 4UQTA 1CQMA 3JYTB 1BHNA 2MKJA 1U25A 1SCJB 1LWCA 4UZCA 3H4DA 3UQSA 1FRMA 1LW2A 3ONQA 3MD3A 4ECXA 3V4MA 3F56A 1UJ6A 3UCZP 4RNMA 4DUTA 2LQ9A 1S7HA 3N6LA 2X7IA 1HQ2A 2J6UA 2J7WA 1HHSA 5K5MA 3KHLA 2X1BA 2WSFC 2YPYA 1NAQA 5A8RB 1S0OA 1U09A 1WC4A 4D3HA 2KL8A 1VC6A 3VVUA 3GR0A 1TV6A 3CJTA 4LSNB 3RTVA 2H5EA 2QL7B 3VZIA 4KGXB 2ERRA 4B3SF 2LEPA 2WONA 2R2UA 1RXOB 1UFLA 1C4CA 3IO1A 4IFVA 1YSJA 3C16B 3TA2A 1HBMA 3DYAA 4P2SA 3GP9A 4XPEA 3S6EA 3A1YG 1WORA 2XYGB 1VBXA 5L1LA 4HHUA 1CPZA 4X4PA 3OW2R 3MCOA 1WJ9A 3W9HA 3H2VE 1VLYA 4MMOA 4C11B 5MLCV 3KJFB 4EO6A 3WIUA 1W25A 3JB9k 3IN5A 5M2UA 3J81U 2M52A 4LSLB 1EB0A 1FKAF 1QSYA 3MTKA 4DR6J 3SFGA 2OELA 3SDEA 1EP4A 2K06A 3AFGA 2BE9B 2M70A 1L3UA 3EE3A 4MT1A 4B3RJ 1OYDA 3K5MA 1HQUA 2DHXA 1U49A 1LWEA 5CCLA 2R2RA 1RBLA 1YBTA 4BHQA 1T9XA 2VKZG 2FJAB 2BE2A 4Y3CA 2IBKA 2RKIB 4N5SA 3TJ9A 4ECSA 2ZBPA 3PJ9A 5HROB 3TX8A 2H3EB 3KLIA 4OX9F 2W1BA 2GJ2A 1BE4A 1TMJA 4NLRA 3D6MB 1TKTB 2ZC4A 1KR4A 4HACB 3MMCA 4A8XA 1PKUA 4W92B 1NSQA 3W65A 4PR6A 2I5JB 4MYUA 2Q79A 2G2ZA 2OPSB 1WOOA 2WB1D 1QAIA 4I2PA 4M94A 1XJWB 4LR7A 1LFPA 1RA7A 4QR1A 2V4QA 2MJUA 1VMBA 3TAMB 4NLPA 2DR7A 2HFOA 4HDGA 4CYUB 5J1PA 1TL5A 3F0NA 3OLBA 5J2PA 1UEUA 4WK1A 2CNKB 4F25A 1T03A 2WVFA 1YX2A 3CCLS 4DV0J 2JZ5A 1JJHA 3FEYB 4F26A 1IKWB 3M9NB 4L72B 3BSOA 4HTIA 1RBAA 3FSXA 4P2XA 4UW2A 3T19A 1N33J 2XY5A 4U8VA 2GHPA 3UWTA 2OKQA 2K3IA 2XS7A 3LPEA 2QMXA 2BQUA 3PR4A 1RWKB 1P27B 1HR0F 1WF2A 2IVYA 2W25A 5A2QU 4DS5A 3VV2B 4FDFA 3T1YJ 3E01A 2RUSA 3SFUA 4F3MA 2K7JA 4NXMF 1KQKA 3A8KA 1LK5A 4LBHA 1N8RT 3O8WA 2MQLA 3L7OA 4DL2A 1K73T 1X4AA 2GIQA 2DXFA 4L3NA 4FVCA 3UI3A 4AL6A 4YQWA 1VLOA 4KIAA 1FJGF 3T6JA 3MPUB 4F36A 1K0VA 2YKNB 1U24A 4ZDNA 4FVMA 1Q53A 1HD0A 3W66A 4KV8A 2UV8G 1HHQA 5CQGA 3JAMU 3RGIA 2JHEA 4RW6B 1TKZA 1V3RA 3PNIA 2RRNA 1N0VC 2PA3A 2OPQB 4NRUA 1RWOB 5LOQA 3QT7A 1YDLA 1HQEA 4WIIA 2HNDA 3D5MA 4P6QA 1OPIA 3DOMA 5KT5A 2CPHA 4MIBA 2V9WA 4HH0A 3RG6A 5F8MA 3OJUA 1R6YA 1UL3A 3FRZA 4DX8H 4ID5B 3JSBA 2UZAA 3QIPB 3R2CJ 5CAAA 2HAFA 1KNZA 4URGA 4Y2CA 3CD5A 4A8OA 2R7OA 4PQUB 4EFAC 4F0MA 2YY3A 3W1YC 2L08A 4E98A 1VC0A 3HHDA 1YJVA 2HWTA 5KFSA 3DHXA 3CNQP 1Q7YT 5E3QA 2XYPB 3W2VA 2V2ZA 4FS1A 3VALA 3R3TA 3H5SA 3CT9A 4Y0FA 3MEEB 5IT4A 3I5AA 2CPEA 2GVZA 2IM3A 2QTWA 1C0TB 4DF8A 3W62A 4Z2XA 1SJRA 3VCDA 1VHIA 5F8NA 2CPZA 1W26A 5D3GA 2QA1A 1X4CA 4J90A 4K4TA 1PAEX 1P8GA 2H48B 1S4FA 2MXYA 2DEJA 1EJ7L 2GAGC 3BM7A 2BM0A 1VBKA 2ZZTA 2MKIA 1SC1B 1BUXA 1U1RA 2V4RA 4JI5J 1RT7B 4BS2A 3TVYA 2H1YA 1TELA 3Q23A 3HFVA 4WWSA 3NNCA 4K5RA 4ZHRA 1VOMA 1QJHA 3GV5B 3O2IA 2BE7D 3KK1A 3D4JA 4DUYF 3NBPA 2XNRA 4UZBA 3PKYA 3FC9A 3UVJA 2EFGA 1HNVB 1UWAA 4U7UD 4WZQA 4X4NA 3GIJA 2EEYA 5GMDA 3UR3C 2JLGA 1NJXA 2D3O1 1SV5A 2DRBA 4B3OB 4AT1B 1OPZA 1IKXA 5CD4A 4OZ3A 2DNLA 5A0YB 3GILA 4C8KA 2CQ4A 2E9ZA 1BXNA 5KG6A 4OHYA 1NHUA 2UUBF 2CVIA 1VR6A 1HPZA 2FVQA 2J9EA 2KTQA 4DZDA 4URQU 1L3TA 3JSYA 2EFVA 3A8EA 3VAKA 4I56A 2OPPB 3DFEA 4BBYA 4CT9A 2XHCA 4YP3A 1IBMF 4UY8T 1S72S 1KLMB 3P49B 3QLHA 2FIUA 5DGAA 4AL5A 5K8OA 1S1UA 4RU2A 2Y0BB 3SSQA 2Z0GA 1UWBA 2HHTA 2B5JA 4M8LA 2KRBA 2EFOA 1U8WA 3NWGA 4OZ0A 1ZM3A 2DTJA 2BJ8A 1UETA 5K14A 3IRXB 1G6BA 3HLUA 3QGPA 3I4PA 4NLDA 2V2VA 1S6PA 5D15A 2ZHAA 4K0KJ 3Q8PB 2ROGA 3RB0A 3IR6B 2NZ4A 3CVKA 1S49A 4BLGA 5KT7A 4XDDA 4WBFA 5E3AA 1SKSA 2HYIB 2GV1A 3UCUP 3M2UA 3I0SB 4ZIWA 2C1EB 4NLYA 2NQPA 3MOZA 2DIUA 1X0PA 4FNHA 5HANA 2YWEA 3J7AN 5A6PA 1N5VA 4I0WA 4PUOA 5CXTA 1OSDA 1IR0A 5C25A 3VGSA 2OAUA 2CQCA 4TY8B 2DNPA 2HGLA 2XBPA 4DV6J 2YNIB 2CXEA 5F3TA 2YNHA 2W9BB 1QDUB 2APOA 1RAGB 1MSWD 4KHRA 4C0HA 1T9WA 2IBOA 2C2DA 3HHLB 5L8RC 1V5VA 2KVQE 1J2VA 5KFMA 1R8HA 2UU9J 2ILZA 4CLKA 1R0BG 1UJ4A 3ULHA 3D68A 4OI0A 4FBTA 2H4YB 1ZH5A 3FBBA 4LFAJ 4LT6A 1YITS 3HVTA 4F0HA 2QO3A 4F04B 2N82B 3NCRA 4ED4A 4PXBA 3W64A 1HWKA 3QFWA 3U1MA 1RTIA 4FF1A 2V8VA 5EX3A 2XMVA 4ELTA 3M8QB 1RACB 1UEVA 2RU9A 4CDIA 4F67A 1SUQA 5G4DA 3K59A 4K4YA 1KEKA 1TAQA 5CHCB 1F9HA 5LMNJ 3V4IB 1TFYA 1N6QA 1WKLA 5GAHU 1VQKS 4YS2A 3QWPA 3RAXA 3EVWA 3BKFA 1X60A 3H5XA 4IUFA 3KNGA 3MI7X 4TU8A 1R8PA 1Q5YA 3U7JA 1JLAA 1HWJA 5T7LA 5THWA 4B3SJ 3CXCR 3T41A 3UDCA 4C8ZA 2BM1A 1E6VA 4NLTA 3KHRA 5DG9A 2V67A 4CNYA 3AD8C 3C6TB 1HMVA 2JC1A 4IH5A 3ZO7A 1LW0A 2AEJA 4TKTA 5B0DA 5AXNA 1S1XB 2V6AA 3V6DA 3CCUS 4M95A 5J2NA 1WEZA 4UQGA 3GJRB 3QAEA 2FGCA 3TOQA 3H20A 3U27A 3J80Y 4WTYA 1GTEA 4J37A 2HWHA 4YUDA 3ITHB 4X4RA 1ACMB 5E3PA 3I55S 3THPA 2E9RX 5SZTA 1VQ8S 1RHKB 1YJ9S 2JNJA 1DHMA 4RW4B 4LRBA 3DLEA 1RAEB 1RLCL 2NSBA 4ECRA 3OXLA 1RLDA 1H98A 4K4UA 2GJFA 1G1XA 2RDJA 2AHOB 1H2TZ 1VRUA 2J6TA 4KY3A 2EI5A 4QIFA 2B9XA 4I6WA 1WHWA 3HSGA 3M8RA 3H90A 3NOGA 3DRRA 4OX9J 3OTBA 4RW8A 1RHUB 2J0SD 1HI1A 2IM1A 1K44A 1I94F 2E5IA 3NOCA 4CO1A 1SKUB 2XSJA 1QD1A 4DQSA 5AJ3F 1FXRA 1CJKA 3PIOQ 1NDLA 4NE9C 1B70B 1SJFA 1IQTA 1FNXH 3W9JA 2BJ1A 2R7QA 5F9LA 4H4KA 1FWLA 1OJ4A 3Q8UA 4DXLA 3CJKA 4C97A 3T9NA 2LLZA 2LXFA 2FZKB 3QZ8A 3OT9A 4B9UA 3QAUA 2WHOA 2NR0A 2R4FA 2OMOA 1CLFA 2HRYA 5HATA 4AQYJ 5J2MA 3OSPA 3BO2A 1IN0A 4NA3A 4O4GB 4FXVA 3GQCA 1OQ6A 2IAJB 3P5BP 1U1NA 4X66F 3C15A 5KFFA 4EBDA 5A8RA 2RHSB 4DSJA 4USMA 1IBCB 1TL4A 3OL9A 1PAUB 4LSNA 2GFFA 3MECB 4K59A 3CJ2A 3V6KA 2KU7A 2AD9A 4Q0BB 2DR9A 3OQ2A 1HR0J 4AFFA 3FMWA 1XK8A 4YB7A 2XI2A 1RCOB 3ILLA 3L4BC 4LF9J 1D8ZA 3C16A 2ZHBA 3T5JA 1TU0B 3CJ4A 4NLVA 5KFZA 3NGTA 4NXMJ 4B9SA 1URNA 3P8BB 2V8DA 2VD3A 3PIPQ 1RK8A 3GZ7A 1XMOF 2EG2A 1U02A 3GCXP 4P74A 2AGOA 2ZH5A 1IXKA 2GHWA 5A6WA 1FJGJ 4DR1F 4P75A 1FXLA 1ZS6A 5GAGI 3GCWP 3CDWA 4OI6A 1FWKA 3EJMA 3MM9A 4RBTA 3IA0A 3JS9A 4LSLA 1H38A 2MKYA 3LP0B 4RLEA 3FUYA 4P10A 2E1RA 2NREA 5KFLA 3NGRA 2YKAA 2XI3A 2JH3A 3DGVA 1FJEB 3WZ0A 5CZXA 1EAYC 2F4VF 3FKBA 4L6V3 2IJRA 3JQJA 3ZZRA 2ZBCA 4HLBA 3NL0A 4F7VA 1MN7A 3PHEA 5DDRC 4YDDB 3OJSA 4YB1P 5HROA 4OHWA 2FB0A 5HVHA 5EUHA 3BGOP 3E8OA 4NPOA 2V4JB 4EU0A 2KVIA 4JV0A 1WD6A 3MR5A 4TYBA 3UD4P 3CMES 1TK8A 3EZOA 3FZBA 4ZP8A 3SI8A 3EGWB 1X9MA 4V1Ak 4ZPDA 3L3CA 2OPSA 4ER8A 2FJDB 1QTNB 3DXSX 2CQDA 3M2RB 1RT5B 1Z4UA 3SCIE 3QT6A 3TAMA 2DHGA 3EGVA 1F9EB 2VFVA 2KXNB 4CYUA 2KM8B 2JRSA 2BZ2A 1NH8A 3IM8A 4L73A 3PV8A 4ANCA 2AKWB 3DOLB 2YH1A 2Q6BA 4Y6IA 3ZZZA 5ADZA 5L9XA 1CJVB 2AJQA 4LF2A 2VC0A 4PXDA 4QJVA 2N4DA 2FC9A 4QYZK 5KG7A 3VAFA 3AB4B 4DPXA 4AXIA 1V6HA 5FLXY 4QR0A 1HNWJ 1IKWA 3VF0B 4DMZA 4BC7A 3H4BA 4G1QB 4LSZB 2XY6A 1KS2A 1HYSA 2DCUB 2PN6A 2KG1A 1YI2S 4U8YA 2E7VA 1J27A 3LW5C 2GMHA 5B0AA 2DNRA 3PYDA 2BJEA 4DUYJ 3WIVA 2CAJA 3KJQB 5KFNA 4ZJLA 4ZLPA 2W8KA 1UW4A 2WRMA 3BF4A 3CCVS 1Y00A 4AE5A 3J7YU 4LFBF 2UUCJ 4DSEA 4MK7A 1WHYA 2HIQA 4B3MJ 3Q2SC 5F8GA 1ZM2A 3CIZA 4HEA9 3N28A 1DQ9A 2FJBB 1F2GA 2V94A 5SUHA 2AJ4A 1RISA 1NK6A 4PPZA 1RWWB 1JXEA 4JV5F 1AXQA 2YKNA 3MEGB 3LPYA 3KG4A 1LWXA 1IR2A 2OEMA 5JXSA 4KAIA 4U9RA 5D0HA 4RW6A 1VK8A 4FF4A 1SJ1A 2ZE2A 6FDRA 2OPQA 2OIHA 5KFIA 3AJ2A 2AYBA 2RDDA 2BANA 4ILLA 3CJ5A 3QGHA 5KT6A 4UOHA 3PXGa 4KKOA 2R42A 4OX6A 1BGXT 4I64A 3OFEA 1HBNB 4WKRA 1EX8A 4ID5A 3TJ8A 2Y1JA 1NMEB 3W7BA 1KONA 5F8IA 1CJUB 1QSLA 4M5DB 3V5RA 1HLWA 4PQUA 4QU6A 2B8QA 3M2VB 4MK9A 3KNAA 5E5NA 2CPXA 2V68A 2F65A 4ZLJA 4OHXA 2ADBA 4WTOB 1UVMA 2PMWA 3DNCA 3QO9B 4Y28C 3KLHB 2HHHF 3N79A 1FK9A 3B8HA 2JEFA 4M5IA 5KTQA 4G1PA 3I5CA 3RR7A 4PXEA 4DCJB 2CPYA 1C0TA 3DLGB 4NWBA 5IT9Y 2DEIA 2LU1A 3SV4A 3W5XA 3IR7B 4IO9Q 4FYDA 2I0XA 3LP1B 2MHEA 4WYWA 5F0WA 2VOPA 1M1HA 3CJSA 2BQRA 3V2UC 4CLSA 1RT7A 2P6SA 4CO3A 3MM5B 2ASLA 3I56S 2OFHX 5E0OA 4C48A 3CMQA 1WI6A 2HSEB 5D4NA 4I67A 4WF9Q 3HVWA 3M6VA 3CMAS 2G1HA 1GQEA 2QYCA 1S9FA 4USWA 5M2RA 1NK0A 2RQMA 4CLUA 3MR2A 1WEXA 4U96A 2FZGB 4C2MA 4DV5F 3MCMA 2CQ3A 1Y5NB 3MF5A 1HNVA 2XEXA 5C2CA 4QW8A 4HKQA 4PKDB 2O66A 1XQIA 4H54A 1MWZA 2ZH1A 1JLFB 1R7IA 2HVZA 2C3MA 4ENOA 1Q8IA 2K1RB 4ZN1A 1A6LA 3GTYX 4DPYA 3DRPB 3THTA 2HKEA 2B4PA 4IOCQ 2GX8A 2YNFB 2RILA 1L3KA 3IP0A 4C0BA 1Q16B 1S48A 4GKJF 1IKYA 2LCWA 4DR7F 2CDQA 4O3RA 1P9YA 1F2HA 4KRWA 3O6QA 1B7YB 3ENVA 2OPPA 3MHYA 4UY85 1XEZA 2E7WA 1KLMA 1RI7A 4RW9B 2YWWA 4KQZA 4N8OA 3OL8A 2O01C 3PX6A 2E44A 3EXCX 2ILYA 3WC2A 1VRQC 5GADI 4TU7A 2QLFB 5DS7A 3M05A 5HJXA 4MKAA 3J7A1 2DXDA 4CIOA 3BB5A 2ALZA 3TARA 4USHA 4ANDA 3NS5A 3IRXA 4PZVA 4QBUA 4NCGB 3FQLA 3QJLA 4LRAA 3TQ1A 1AYEA 1FTCA 3I9V9 2FLOA 1U0SA 3PJXA 2AMCB 1YK9A 4KTQA 1SIWB 1UZHA 2XTJP 3I0SA 3CE8A 2XQCA 1BWEA 4EZ6A 4CM2A 1L5UA 3R6LB 2JC0A 2MKCA 3N0VA 3TA1A 1RGVA 3KDNA 4DSIA 3K8WA 3CD7A 5T41A 1YLXA 4AD6A 2QLWA 2NUUG 1TP7A 2VF3A 4AL7A 2YNIA 3AB2B 1S9GB 2W9BA 2HVIA 1YRUA 4S0MA 1TZ0A 3D0IE 1XERA 1H2VZ 1BQMB 3HHLA 4LJMA 1G3OA 4XO0A 1N36F 1K1SA 4NCBA 4B02A 1N54B 3KHGA 4QIVA 3QNWB 1YJ7A 5JVGQ 3DI6B 3K5LA 2PI5A 4LVOP 1XNQF 4J9NA 2M88A 3BSNA 4R0JA 3GWCA 3I31A 4H4MA 3BYRA 3PDNA 5KFRA 1IUJA 2FHOB 3S7RA 4F2SA 1SIZA 3QGIA 3JQKA 3VR1A 3M8QA 1P6TA 5RUBA 3AT1B 1KHVA 1H72C 3QRQA 5LJ3Y 3V4IA 1TKXA
chains in the Genus database with same CATH topology
2HBQB 1RHRB 2H48B 2CNLB 3D6MB 1RWNB 4ZVRB 1RWOB 3D6HB 3R7BB 2CJXB 3KJQB 1SC1B 1RHKB 1QTNB 3IBCB 2CNOB 3EDRB 4DCPB 2H5IB 2C2MB 1NMEB 2QLFB 2QLJB 2H4WB 1RWKB 2FQQB 3GJQB 1RHJB 1BMQB 2DKOB 2XYGB 5IC6B 4ZVSB 2XZDB 2H54B 3NS7B 3SIPB 1F9EB 2Y0BB 1QDUB 4ZVUB 1SC4B 2H5JB 3R7SB 3R7NB 2H65B 3KJNB 1RWMB 4ZVOB 3EDQB 2C2KB 5IC4B 3GJTB 3QNWB 3KJFB 3R5JB 2C2ZB 1RWWB 1ICEB 4ZVTB 2HBZB 1I51B 2Y1LB 3P4UB 5K20B 2QLBB 2C2OB 2HBYB 4DCJB 1RHQB 2H4YB 2XYPB 1RHUB 1IBCB 2XZTB 2H51B 2CJYB 1PAUB 2CDRB 2CNKB 3R6GB 1RWVB 4ZVQB 3RJMB 2XYHB 1SC3B 1RE1B 3P45B 4JB8B 2QL9B 1GFWB 2CNNB 2P2CB 1I3OB 3GJSB 1PYOB 2QL5B 1RWXB 3R6LB 1RHMB 4LSZB 2QL7B 3GJRB 3D6FB 4DCOB 4ZVPB 1RWPB 2HBRB 3IBFB 2C1EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBQ B;  1RHR B;  2H48 B;  2CNL B;  3D6M B;  1RWN B;  4ZVR B;  1RWO B;  3D6H B;  3R7B B;  2CJX B;  3KJQ B;  1SC1 B;  1RHK B;  1QTN B;  3IBC B;  2CNO B;  3EDR B;  4DCP B;  2H5I B;  2C2M B;  1NME B;  2QLF B;  2QLJ B;  2H4W B;  1RWK B;  2FQQ B;  3GJQ B;  1RHJ B;  1BMQ B;  2DKO B;  2XYG B;  5IC6 B;  4ZVS B;  2XZD B;  2H54 B;  3NS7 B;  3SIP B;  1F9E B;  2Y0B B;  1QDU B;  4ZVU B;  1SC4 B;  2H5J B;  3R7S B;  3R7N B;  2H65 B;  3KJN B;  1RWM B;  4ZVO B;  3EDQ B;  2C2K B;  5IC4 B;  3GJT B;  3QNW B;  3KJF B;  3R5J B;  2C2Z B;  1RWW B;  1ICE B;  4ZVT B;  2HBZ B;  1I51 B;  2Y1L B;  3P4U B;  5K20 B;  2QLB B;  2C2O B;  2HBY B;  4DCJ B;  1RHQ B;  2H4Y B;  2XYP B;  1RHU B;  1IBC B;  2XZT B;  2H51 B;  2CJY B;  1PAU B;  2CDR B;  2CNK B;  3R6G B;  1RWV B;  4ZVQ B;  3RJM B;  2XYH B;  1SC3 B;  1RE1 B;  3P45 B;  4JB8 B;  2QL9 B;  1GFW B;  2CNN B;  2P2C B;  1I3O B;  3GJS B;  1PYO B;  2QL5 B;  1RWX B;  3R6L B;  1RHM B;  4LSZ B;  2QL7 B;  3GJR B;  3D6F B;  4DCO B;  4ZVP B;  1RWP B;  2HBR B;  3IBF B;  2C1E B; 
#chains in the Genus database with same CATH topology
 3MUV P;  4Z37 A;  4K5S A;  2C3Y A;  3CC2 S;  4ETX A;  1XR7 A;  4X66 J;  1X5P A;  3NKY A;  1RDR A;  3MAH A;  2QN6 B;  5K8M A;  4JYA J;  2QLJ B;  1Z1Z A;  1C1C A;  2FDN A;  1WG1 A;  1FRL A;  2HMI B;  1N52 B;  1KQF B;  2GS8 A;  4DLE A;  3MAA B;  2VIC A;  2NXC A;  3G86 A;  4OIX A;  3ILJ A;  2RNE A;  2L9W A;  3VQS A;  2HHS A;  2K7K A;  2GGP B;  2MQ8 A;  4R5P B;  1H6K X;  4ED3 A;  1Y5I B;  4LVN P;  4JI4 F;  5D78 A;  4NLX A;  4P73 A;  1WHX A;  3PX4 A;  4DX7 A;  1S1X A;  1XMO J;  5B08 A;  3PFO A;  3VGU A;  2MY8 A;  4M5L A;  2UUA F;  3Q22 A;  3IS9 B;  1JNR B;  2UVV A;  1OWX A;  4P71 A;  3ITH A;  4DR1 J;  3CJQ A;  1T3N A;  4USV A;  5D6G A;  4RKU C;  4RW4 A;  3RBE A;  3ELH A;  1KTQ A;  2OEK A;  1RWN B;  1XC9 A;  5J1N A;  3M8W A;  1IBK F;  4ZP7 A;  2DGU A;  3WBZ A;  1TVR B;  2YH0 A;  2IDL A;  2M0G B;  3OUY A;  3UCG A;  3VZH A;  2B51 A;  3IRW P;  3UN3 A;  2J8A A;  2I38 A;  1CSJ A;  4RW7 B;  4F4Z A;  3JTP A;  1U1Q A;  2ZJP Q;  3Q8Q B;  1MMN A;  1U1P A;  4O3Q A;  3EPI A;  3TUZ C;  4JI0 F;  1NJY A;  5GVQ A;  3OFH A;  1YJN S;  5KG4 A;  2HHX A;  3G6X A;  4NLQ A;  1Q8B A;  1RHQ B;  4OJG A;  2KHD A;  1URR A;  1H3D A;  4FYW B;  2V2K A;  4FKX A;  1LXJ A;  3V6J A;  3K5O A;  3PRB A;  1K0T A;  3DLL Q;  2WOM B;  3VAI A;  5KFY A;  3CDB A;  3HZG A;  1XIQ A;  1NK8 A;  3GE9 A;  2R8K A;  3GYN A;  3G8Q A;  1RU1 A;  1EIY B;  3VAH A;  3VQT A;  1S1T B;  1FVS A;  1MG7 A;  2HRU A;  4UOF A;  1Y5L B;  4ZMM A;  2VFR A;  3J81 j;  1PYT A;  5J1E B;  2DGX A;  4O4G A;  5ETT A;  2FZC B;  2IAJ A;  3SIP B;  1HWI A;  3TAN A;  1O0P A;  3MM8 B;  1YJU A;  2CWX A;  1U6Z A;  3EUN A;  3DN9 A;  3DOK B;  3NEK A;  5D0E A;  1RWU A;  1QSS A;  1R8C A;  3RR8 A;  4DV2 F;  4O3N A;  4KPY A;  1PGZ A;  4LBI A;  2C2O B;  1S76 D;  4Q0B A;  1BY9 A;  1F0X A;  2F1F A;  4RBV A;  4ED6 A;  2AJ2 A;  2XHW A;  4DZ6 A;  5A8K B;  3CJR A;  4CLT A;  4YHH F;  1RE1 B;  2PT0 A;  1A9N B;  5DG7 A;  4Q2L A;  1TMM A;  3O44 A;  2DNK A;  1VQ5 S;  3HD2 A;  3IGV A;  2UXD F;  3MM6 B;  3H42 A;  2A6M A;  1RHM B;  5GAE I;  1WF1 A;  4DN9 A;  2P9C A;  3GYX B;  4LFB J;  5IS2 A;  3PR5 B;  1I1G A;  4O0I A;  5I3Q A;  2N7Y A;  1N56 A;  2MQQ A;  2BV3 A;  2CNL B;  4ZVR B;  1M0S A;  2HQF A;  2H9Z A;  4P9S A;  2F8E X;  3EM1 A;  3IGN A;  2G0J A;  3LWM A;  1EQM A;  5LM7 E;  4JV5 J;  4CLY A;  2EWH A;  1W2B R;  1RHJ B;  2G9O A;  4DR4 F;  3LP0 A;  1PJ7 A;  4UF4 A;  3LP2 B;  1M5O C;  3RU0 A;  2VDH A;  4C7Q A;  1OQ3 A;  5CZV A;  3NMA A;  1X9S A;  1NZ8 A;  3A3N B;  4GC6 A;  2EFP A;  2YTC A;  1ICE B;  3VHQ A;  4OZL A;  2CYY A;  2GAH C;  1T3O A;  4P72 A;  5DGB A;  2GJI A;  5J2Q B;  3I5B A;  3UN5 A;  4GKK J;  3C14 B;  5D0R A;  1FD2 A;  2AGQ A;  5JVH Q;  1LKZ A;  1ELO A;  3K57 A;  5D4P A;  3M6W A;  4X4O A;  5EWG A;  4WIQ A;  2BBE A;  1KP6 A;  1S0M A;  4CO2 A;  1VGY A;  4ZJQ A;  2DNN A;  3LGN A;  4NRT A;  4YY3 F;  2C2E A;  3PO5 A;  1WEY A;  2E66 A;  1KVK A;  5L39 A;  2HHH J;  2IMW P;  2CJX B;  2VJV A;  1N5Y B;  1HI0 P;  4BC9 A;  2E1P A;  1WG5 A;  3SQG B;  4FF2 A;  2JVO A;  1VQ4 S;  1GH8 A;  1C1B A;  2DD8 S;  2R9L A;  5IV4 A;  4MTP A;  5B0F A;  3DOL A;  1M5V C;  4ZK7 M;  4CLP A;  1U48 A;  2Z57 B;  3IWL A;  3QBC A;  2MQN A;  1CJV A;  3DDI A;  1Q79 A;  4WJB A;  3ISZ A;  1YJW S;  4IOA Q;  1KOO A;  4C8N A;  1L3S A;  1GMV A;  5DDO C;  2GCF A;  4ATN A;  5C42 B;  4ZVQ B;  1WC3 A;  1SVD A;  3BYP A;  2VFU A;  3KJV B;  3PY8 A;  2LA6 A;  4EO8 A;  4DQP A;  1VQN S;  1F3V A;  1WOS A;  3MMA A;  1LWF B;  1JLQ B;  1RP5 A;  1SC6 A;  5CYQ A;  1KTV A;  1T05 B;  1B7F A;  2D3U A;  1HL6 A;  5CH7 B;  3EPG A;  3D0G E;  4C8O A;  5ETV A;  1U1L A;  1SBR A;  1Z2Z A;  1RTZ A;  2DNM A;  2Z30 B;  1NO8 A;  4USK A;  2BMB A;  3IC1 A;  1FDB A;  1DBD A;  1EZZ B;  4OHZ A;  5C5J A;  2BRL A;  2ZEJ A;  3B78 A;  2NUH A;  4PG8 A;  4OV1 A;  4CH7 A;  3GON A;  2BDP A;  4GKJ J;  4CQ1 A;  3MEG A;  2YXL A;  4R0E A;  3ADA C;  2MKK A;  3J81 Y;  1APS A;  1R0C B;  3UW1 A;  1M1G A;  2SXL A;  4PYD A;  4K4X A;  1VQY A;  1IBL F;  3UN2 A;  2AJ1 A;  2RDI A;  5B0C A;  1F9F A;  1SH0 A;  4NYO A;  3DMJ B;  4PWU A;  2DR5 A;  2QT7 A;  1CEZ A;  4OYO A;  2LXI A;  5DQG A;  1J5O B;  2F4F A;  5E2Q A;  2UVR A;  1ZAX A;  2YNG B;  4Y2I A;  3M8P A;  1XTZ A;  2NXJ A;  1HBN A;  1EET B;  4C3M A;  1CJU A;  2KI2 A;  3EZU A;  2V5H G;  4M5D A;  3MUR P;  1S6Q B;  3PM9 A;  2XGP A;  3D9B A;  4JI6 F;  1FFG B;  2A3J A;  3M2V A;  2XLI A;  4OFZ A;  4Q43 A;  4FYY B;  4DL3 A;  1VQL S;  1T95 A;  3QT8 A;  3N6M A;  2FGO A;  2D69 A;  3QO9 A;  3KLH A;  2DJW A;  3KXD A;  2YWF A;  1BQN B;  2G2O A;  4MH8 A;  2VPZ B;  1MMD A;  3I4H X;  4C3L A;  2GHV C;  1AA1 B;  2CJQ A;  3F44 A;  3DLG A;  1NM2 A;  2CZ4 A;  2FJX A;  1ITP A;  3RB6 A;  3ZXW A;  3EVM A;  2ATL A;  5D0G A;  4ETZ A;  2IM2 A;  2MQP A;  4JUZ A;  1VRT A;  3LP1 A;  1RB0 A;  2DR8 A;  1E6Y B;  4PG5 A;  1RWV B;  1S1W B;  2F9D A;  3IAM 9;  3GFY A;  4OZ1 A;  3LUY A;  2ZZM A;  3KUG A;  1RWX B;  3MM5 A;  2DR6 A;  3EMT A;  3GLJ A;  2QFJ A;  4EWT A;  2XLK A;  3OD2 A;  3OL6 A;  1LXN A;  3AJ1 A;  4CH1 A;  3RAQ A;  5KG1 A;  4F4X A;  2OML A;  3QRR A;  2V69 A;  1AUS L;  1IWA A;  4EYI B;  1XNQ J;  5A2Q Y;  2CJA A;  5DO2 A;  2DGV A;  1FEH A;  1RTH B;  2ROP A;  3Q8V A;  4U95 A;  1JLF A;  5HL7 Q;  1NKC A;  4X64 F;  3OHA A;  3NAH A;  4L3K A;  3R5G A;  2K1R A;  4K50 A;  1NXI A;  5A76 A;  3ZFV A;  5L46 A;  3AAW B;  1WOP A;  2YNF A;  4ECT A;  2L9N A;  1HW8 A;  2Y9H A;  4M5K A;  2YKM A;  1FNM A;  3P6Y C;  2VA2 A;  2HGM A;  2DGQ A;  3JAM Y;  1ZTT A;  3ZTS A;  1Y7P A;  2YVS A;  4RW9 A;  1MU2 B;  4XIU A;  4MK8 A;  5I3U B;  1KVJ A;  3DDN A;  2JEI A;  2VPW B;  2XY7 A;  1NPK A;  1S6U A;  1CJT B;  4J9U E;  1Q8K A;  2JLF A;  2O67 A;  4EGL A;  3NCP A;  2K8G A;  4L74 A;  1HNI B;  2RJZ A;  4JI4 J;  2CQG A;  2RF2 B;  4OYB A;  2QC3 A;  3SEO A;  4KJI A;  1UPM B;  2DKO B;  2XZD B;  3KYL A;  4BCA A;  2E1M C;  4DR2 F;  2WVE A;  4NCG A;  4OX7 A;  4QWB A;  2R7U A;  2UUA J;  1HHT P;  4WFZ A;  3G82 A;  2KKH A;  2FLL A;  1UKU A;  5BYQ A;  2W2N P;  2J76 E;  3LF0 A;  2K3K A;  4KGZ B;  1GNK A;  1FES A;  5KG0 A;  2VJU A;  2MZT A;  2J7K A;  3J7Z 5;  2HS0 A;  2ZBI A;  4ECW A;  3X3U A;  1TL7 B;  4OI2 A;  1IBK J;  3LQV A;  3D0H E;  2CG4 A;  4P2M A;  1YGY A;  3LTO A;  1RAD B;  3L09 A;  4WU2 A;  4RWW A;  1JLE B;  3HJV A;  4NLW A;  2XS5 A;  1EHW A;  4M5G A;  1C2P A;  4AYB D;  3DLH A;  1S9G A;  1KOH A;  1KN6 A;  5HVF A;  3M8Y A;  2JDJ A;  2HZV A;  2XO6 A;  2WCX A;  1BQM A;  1CBK A;  1U1K A;  4JI0 J;  4DV3 F;  1K47 A;  3DU6 A;  2AX0 A;  1D8Y A;  2ATC B;  3UFC X;  1M90 T;  1DAX A;  4ZVS B;  2J9D E;  1KKH A;  1PC5 A;  2VAS A;  4PWD B;  2WSE C;  3DI6 A;  2IC3 B;  2VOO A;  4NZ6 A;  3HF5 A;  2HK2 A;  1KBR A;  1HNZ F;  3GV7 B;  3OXG A;  1K9M T;  2ZD1 A;  4DG1 B;  2E7X A;  1RZM A;  3ZTO A;  1SKR A;  3KLV A;  2PA8 D;  3RAM A;  3P4U B;  2QSW A;  3PEH A;  1FKO A;  2DNH A;  3CJ8 A;  4A8Q A;  4ZPC A;  4OJ1 A;  1MW7 A;  5AE1 A;  1DQA A;  4X4Q A;  4OI1 A;  3MOJ B;  3CIM A;  3MM7 B;  2IM0 A;  3B82 A;  4J9V A;  1GAO A;  1LW2 B;  2KFN A;  2LQ5 A;  4CNZ A;  4DJB A;  1DZ5 A;  1S99 A;  1VJQ A;  4WFY A;  5K9F A;  1LEO A;  1U1O A;  4KE5 A;  1WG4 A;  2EW9 A;  2W4D A;  2GVD A;  3OXF A;  2HNY B;  4A46 A;  3ENQ A;  3ZZO A;  5KFJ A;  2HMI A;  3M7V A;  3RRG A;  5EN1 A;  3C8Y A;  3MCN A;  4WE1 B;  4DV2 J;  2WB4 A;  3QFH A;  5D8H B;  4TNO A;  1WC5 A;  1UCN A;  2CAD A;  2ZC3 A;  1FHT A;  3D66 A;  3TI0 A;  4NI2 B;  2DGS A;  4RNN A;  5HAO A;  4HYK A;  1TV6 B;  1DQ8 A;  4R5P A;  5IM0 A;  4QWC A;  4YHH J;  1S9E B;  2WON B;  2AEM A;  4LFC F;  1AZS A;  2CVE A;  1JB0 C;  2XLJ A;  3R9L A;  3GIM A;  1TR0 A;  2X1G A;  5B0E A;  2VQE F;  4JI3 J;  1ZM4 A;  5BJR A;  2ZH3 A;  1YZ6 A;  3CTR A;  2MZQ A;  4FBU A;  3GII A;  1J5E J;  1X4G A;  3HDS A;  3HCX A;  4LMZ A;  4DR4 J;  4WP9 A;  4JI8 F;  3MED B;  2VBY A;  4OZN A;  1TVR A;  2VBZ A;  1H7X A;  2DNY A;  2NYI A;  3SDE B;  1T9Y A;  1EP4 B;  2V34 A;  3GSI A;  8ATC B;  2N4C A;  2F7V A;  2IRY A;  2PEH A;  2W7P A;  1X31 C;  2R7R A;  1IJF B;  1LWE B;  1RAJ A;  6FD1 A;  5GAH I;  4PRF A;  3PTW A;  2EBG A;  2HHP A;  4UOG A;  1S4E A;  2GC8 A;  3H8Y A;  2WW8 A;  5HMY A;  4OZJ A;  3N9U C;  2LYV A;  4MFB B;  2B9E A;  2UXC F;  2P8I A;  2XMW A;  4JOU A;  3LGM A;  1YJR A;  4WFA Q;  5H9E K;  2C3P A;  3MMC B;  3SSR A;  1VIS A;  2QX0 A;  3MWB A;  1S59 A;  2IFX A;  4YY3 J;  1TKD A;  1ZZF A;  2WOM A;  3P96 A;  1QE1 B;  2JX2 A;  3HP6 A;  1HI8 A;  1BC6 A;  3R6G B;  1ZBT A;  4TQR A;  5HVG A;  3UR0 A;  2ALY B;  4ZIT A;  1Q95 G;  3FEX B;  4QZV B;  2CQP A;  3LWL A;  1BQX A;  2IRU A;  4QWA A;  3GR1 A;  3GSD A;  2V63 A;  4LF7 J;  2C2N A;  3GB0 A;  2IDE A;  5IT9 U;  1JKH B;  3FSI A;  1U6B A;  3HKZ D;  1HNX F;  1O51 A;  3OL7 A;  4XTT A;  3DM2 B;  3WC0 A;  3HT0 A;  2ZH8 A;  1OS5 A;  1FCA A;  2ASD A;  1D3W A;  3I9Z A;  2E29 A;  3W61 A;  4ZVG A;  1ZPV A;  3T1H F;  2AF6 A;  3AQO A;  3DOK A;  4ZPB A;  3TWZ A;  3CPW R;  2AX1 A;  1IWG A;  2ZJQ Q;  2HGN A;  2A2D A;  4KGV B;  2ZUA A;  4XPC A;  4UUX A;  2C2K B;  4DU7 A;  2JWN A;  2RQK A;  4DHV A;  1XR6 A;  2R7W A;  5AXM A;  1RQ0 A;  2WK4 A;  2VIH A;  4QIG A;  5IQQ A;  1N5Q A;  3QQC D;  3BKT A;  5BXI A;  4MIW A;  2OPR B;  2FHK A;  2VC1 A;  3I0R B;  3IR5 B;  4CO5 A;  4FP9 A;  2P5V A;  4IKA A;  3MM6 A;  1K8A T;  5H9F K;  2NCK L;  2XYH B;  3QSI A;  1WHV A;  2KT5 A;  3E01 B;  4I2Q B;  4QWE A;  3MR3 A;  3ET6 A;  4ZCK A;  1UAW A;  3PCO B;  3BR9 A;  1NB7 A;  4LRC A;  4OL8 A;  2U1A A;  2CRL A;  1UPP A;  3K8V A;  3CWJ A;  3LP2 A;  5H1S V;  2Y1I A;  2QLX A;  1W2I A;  3RZA A;  1WC1 A;  2V8P A;  5I3P A;  4U7C A;  2W4P A;  1SPB P;  1ZM9 A;  1JLB B;  2W8L A;  1V5I B;  2J0X A;  1YKW A;  2IA0 A;  4DR6 F;  2LXU A;  3TUP A;  2C3U A;  3BO3 A;  2HWI A;  2I9S A;  4HDH A;  1SQG A;  4F02 A;  1GX5 A;  3ZZU A;  1WWH A;  5DZ7 A;  5DG8 A;  3GFH A;  1S57 A;  2ZDP A;  1SJ3 P;  1IKV B;  4F3O A;  2C2Z B;  2HRT A;  3O1L A;  3OTE A;  1NKB A;  4NA1 A;  2A10 A;  3AOB A;  5J2Q A;  5C24 B;  3K89 A;  4WK3 A;  1OMS A;  3KOA A;  3G6V A;  3DOM B;  3C14 A;  2JFK A;  2BW7 A;  4NEZ A;  2WAQ D;  1MLA A;  3OSN A;  2E5H A;  2W7A A;  3VAG A;  2VG6 A;  4M5M A;  3NY0 A;  2OTJ S;  2D74 B;  3GJS B;  3CD6 S;  2DO4 A;  1S5Z A;  1CUL B;  2C28 A;  2BJ9 A;  3CW2 C;  4OYX A;  2IIH A;  3CCE S;  1N5Y A;  2FYX A;  3BR8 A;  1L3V A;  4J9O A;  4A8F A;  1RT3 B;  4OQJ A;  1DRZ A;  4RUC A;  2CJ9 A;  2DNG A;  3KLF B;  1S10 A;  4J91 A;  4OLO A;  2KN4 A;  4TLQ A;  2EKY A;  2FVR A;  1JXL A;  1REV B;  2GVZ B;  2FJW A;  1R6V A;  2PMH A;  4ZS6 A;  5EHH A;  4LF4 F;  1U4B A;  1UJ5 A;  2J9C A;  4ZKA A;  2NZC A;  3OTD A;  4IRD A;  4B9L A;  3TA0 A;  3LOU A;  1FFW B;  3WDO A;  4ECU A;  3KJV A;  2W9C B;  2D1C A;  2B43 A;  1VQP S;  4ZHR B;  1LWF A;  1JLQ A;  1N33 F;  2IHR 1;  4H4K C;  2RE1 A;  5LMU F;  4QWD A;  1T05 A;  2FVS A;  2KXH A;  5HQM A;  1S0V A;  4DLG A;  4HI1 A;  2YX1 A;  5H9F J;  3NBP B;  2UXB F;  4X64 J;  1Q1K A;  2C22 A;  3ZTQ A;  5JMN A;  1OY8 A;  1FRH A;  3TR5 A;  2HNZ B;  3W63 A;  2QV6 A;  4YB5 A;  3HSJ A;  1VIX A;  3MDF A;  1JWW A;  1T94 A;  1KSP A;  4GO5 X;  1ARO P;  4CO0 A;  1N5S A;  3GJQ B;  3M4X A;  5IT0 A;  2BOP A;  3MR6 A;  1B4S A;  1K1Q A;  4G6V B;  3DGP B;  3QT5 A;  3TYT A;  2DHA A;  3KJN B;  3KUE A;  2M9K A;  3I96 A;  2V0N A;  2FY8 A;  2I1R A;  1NJI T;  1KLN A;  3DMJ A;  2PMZ D;  3D1O A;  3WX4 A;  4U7U K;  4GVL A;  1HFE L;  3HHN B;  1J5O A;  3QLH B;  4OYA A;  1S1U B;  3CCQ S;  2EFQ A;  2OJ3 A;  2YNG A;  3BGR B;  4RUH A;  1EET A;  3TRG A;  1S6Q A;  3EGN A;  3HD1 A;  5LSL A;  3W5Z A;  1DY3 A;  5K14 B;  3CD0 A;  5K8P A;  4R25 A;  4DOZ A;  1R8B A;  1SKW A;  2ADC A;  1NDK A;  3BDE A;  1BQN A;  1IR1 A;  1HIY A;  1FNO A;  4N56 A;  3GFZ A;  2HFN A;  2EFN A;  3EWG A;  2VL1 A;  3DLB A;  4OYZ A;  4J9S A;  2D3Z A;  2HLU A;  2E5G A;  2R8G A;  1JX4 A;  4OHV A;  3M2U B;  3J7Y I;  1JIH A;  2GNK A;  3HHL D;  1FDD A;  3M8Z A;  5AE3 A;  4ZVF A;  4Q7A A;  5E41 A;  2LA4 A;  4OI4 A;  4CCH A;  1S1W A;  1X5O A;  1T7P A;  1UVJ A;  1IVZ A;  2DRA A;  2EXU A;  2OFG X;  3BPD A;  3SCJ E;  3OR2 A;  3K58 A;  2W4C A;  3LAL A;  4DV3 J;  2YNH B;  2YWG A;  1WDT A;  1UVK A;  2MPU A;  4BWJ A;  1T02 A;  5G0R B;  1RU2 A;  4JI5 F;  4P2F A;  1WSV A;  1SL2 A;  2I8E A;  4UTG A;  3M32 B;  4TN2 A;  1SL0 A;  3CCZ A;  1KWM A;  2C3O A;  4IG3 B;  3ZZP A;  4LRF A;  1VK3 A;  3OVA A;  1XBW A;  3H25 A;  4FKY A;  1HNZ J;  3KHH A;  1TL1 B;  2HFS A;  2AGP A;  1YIJ S;  2M2B A;  5LJ5 Y;  1RTH A;  3FEZ A;  3UDL A;  2LQB A;  2IYG A;  3RW6 A;  1NHV A;  4A8Y A;  1R31 A;  4R8U B;  4QIE A;  2L9D A;  1RTI B;  1QAJ A;  2GIR A;  2KYZ A;  3MUT P;  1D1U A;  1RWM B;  2RRA A;  2DB1 A;  2Q3P A;  2UP1 A;  3OHB A;  3CCM S;  3SBM A;  2HQC A;  4YEA A;  4DQR A;  3PW4 A;  4ZOS A;  4NEY A;  2FLP A;  4WFB Q;  1S77 D;  3T1A A;  1GX6 A;  3K17 A;  1RYS A;  3UNG C;  2CDR B;  2LQJ A;  5DM7 Q;  2VA3 A;  3RJM B;  5KG5 A;  4DL0 C;  3KMS A;  3U02 A;  2OSR A;  1N88 A;  7FDR A;  1CJT A;  2B9W A;  2UUW A;  1JLA B;  1R0A B;  2L48 A;  3WHI A;  5T7L B;  4O3S A;  3MUM P;  1HNI A;  2B6A B;  2RF2 A;  1E6V B;  3BKU A;  2DPJ A;  4ZN3 A;  4P7V A;  3DRY A;  1XMB A;  2VG5 B;  4NLO A;  4DUZ F;  4J7C A;  2QIF A;  4CLF A;  2VQE J;  4WPA A;  1SJ4 P;  5HBM A;  4OZ5 A;  3V6D B;  2BAB A;  1H73 A;  2GO8 A;  2GA7 A;  1SC4 B;  2WTF A;  4ILM A;  3RUB L;  2JL9 A;  1HAR A;  2XMM A;  4JI8 J;  2W7O A;  3AOC A;  3R27 A;  1V9O A;  4HTJ A;  4DPT A;  4GMK A;  4DL7 A;  1JNZ B;  2H51 B;  4DWI A;  1P1L A;  2XMK A;  2RUG A;  1CC7 A;  5ETM A;  1CQN A;  3JYT A;  4KHP F;  4B9N A;  2CZV C;  4C9D A;  1FRJ A;  4HI2 A;  3M8S A;  1M5S A;  4ZLL A;  1R89 A;  2XMT A;  2G4B A;  2XMA A;  2W24 A;  2MTL A;  3AD9 C;  3IAS 9;  3CDU A;  3BN4 A;  3OR1 B;  4NYZ A;  4Q8E A;  3TUI C;  1VFJ A;  4P7T A;  4DV6 F;  1TK0 A;  3F41 A;  2QYG A;  3NS6 A;  2CQ1 A;  2UXC J;  3BV8 A;  1WAC A;  5F8J A;  4LQ3 A;  3LH2 S;  2IC3 A;  1N0U A;  3BQ0 A;  4YFU A;  1N4L A;  4KH0 B;  3BDP A;  2E1C A;  4KC5 A;  2CWK A;  3PHT A;  3KG1 A;  4DG1 A;  3HFZ B;  1JJ2 R;  3N4W A;  3HT3 A;  2XZW A;  1DTT B;  3CJK B;  1UEK A;  4I6A A;  2BUN A;  1T9T A;  5HK4 A;  2HLT A;  2LU2 A;  4KFB B;  3MM7 A;  1JLG B;  3C66 A;  2QLB B;  2B7C B;  4ED5 A;  1HNX J;  1U1M A;  3VTI A;  4X65 F;  4CP5 A;  4FYV B;  4W4M A;  2OEJ A;  1VDH A;  5J2M B;  2XO7 A;  4L76 A;  5LMN F;  4OV6 A;  1RA6 A;  2E9T A;  2HNY A;  3T1H J;  2CPD A;  4YR2 A;  1FER A;  5IOL A;  3G4S S;  2BW2 A;  2LEA A;  2P9E A;  2W01 A;  4WE1 A;  3C15 B;  2AYM A;  4C11 A;  2IMO A;  2Y3Y A;  2YX4 A;  2W2O P;  4QU7 A;  4NI2 A;  2VHG A;  4CZC A;  1EQ0 A;  4DCP B;  1YJT A;  4JBC A;  3FFI B;  1KVI A;  3HHK A;  1U45 A;  1S9E A;  2BXJ A;  1N48 A;  2XMU A;  3W2W B;  1B3T A;  4Q8F A;  5KFB A;  4DPO A;  2PE8 A;  2Y1R I;  2WBM A;  5BR8 F;  4WXO A;  4PG6 A;  3THV A;  1S6O A;  3RB4 A;  4WFN Q;  2RKI A;  2B9Y A;  1G7C B;  4E2F B;  2YWK A;  4MYT A;  1DTQ B;  4LR8 A;  1I51 B;  1CVJ A;  1N32 F;  2CQ2 A;  1RT2 B;  3DC2 A;  1TKT A;  2RML A;  4X2B A;  2JOQ A;  4HAC A;  2QRR A;  1REG X;  2VBX A;  2DIS A;  4YOE A;  1GMW D;  3AXM A;  3MED A;  4WP8 A;  2KO1 A;  3FK4 A;  2AZ3 A;  3MM9 B;  2AJF E;  1PG5 B;  4DS4 A;  2I5J A;  3T9Z A;  2AYE A;  2VZ9 A;  4OJ3 A;  1F3F A;  1KFS A;  4DF4 A;  3I82 A;  4J9P A;  3WQP A;  2R7V A;  1JXV A;  4WFX A;  3FCW A;  2O5D A;  3R7B B;  2UVW A;  4ED0 A;  2YKP A;  4DR5 F;  5DDQ C;  3NXZ A;  2L3M A;  3HVA A;  4RJV A;  1U2C A;  3C46 A;  2QE5 A;  2HIY A;  3UDV A;  3M9M B;  5BYS A;  3MMJ A;  1U2R A;  2PC6 A;  3CDE A;  5ETS A;  2XG8 A;  1IM6 A;  4MFB A;  3W3S A;  4WKY A;  2MZ1 A;  4F8R A;  2X1F A;  4FXD A;  5DQH A;  5KFO A;  4D3G A;  2LKZ A;  2ZHO A;  1Y10 A;  1QE1 A;  4X84 A;  4NAS A;  1EAR A;  1VCT A;  2BR0 A;  1YBA A;  2VUG A;  1TK5 A;  1NKE A;  2WBR A;  3CCW A;  3Q8Y A;  5ETQ A;  1NK7 A;  1I6J A;  2N3L A;  2ZZN A;  2DH8 A;  2ZDO A;  1JKH A;  3ZNU A;  2YKO A;  4DU8 A;  3BBC A;  4LF4 J;  3DM2 A;  3L9Z A;  1ZPW X;  4AQY F;  3HHL C;  3HI9 A;  2XS2 A;  2PDA A;  2VFT A;  3M1V B;  5E3C A;  4F0K A;  2UV8 A;  3IXQ A;  3SMZ A;  4JI2 F;  5A8W B;  3HK2 A;  5KFT A;  1VQO S;  1FA0 A;  4LQ9 A;  3W60 A;  4OYM A;  2UUB J;  3PO4 A;  2KXF A;  3CC7 S;  5KFC A;  1HYS B;  1QUV A;  5F0U A;  3N5F A;  4RWX A;  4J9M A;  4C8Y A;  2IJN A;  2M7S A;  2WVC A;  4I1T A;  5LMU J;  1Y3K A;  2OPR A;  3I0R A;  4F4W A;  5HP1 B;  4ELV A;  3TZW A;  4J9K A;  4Q45 A;  1IBM J;  2UXB J;  2P6T A;  4LF9 F;  3IG1 B;  4I2Q A;  4P52 A;  2E1A A;  2FLN A;  3K0J A;  1SB6 A;  2BQ3 A;  1B64 A;  4ZVE A;  7AT1 B;  2VV5 A;  2LVW A;  3QIP A;  2HHU A;  1KQS R;  2V2Q A;  3DXB A;  2VG7 B;  1JLB A;  1NDP A;  1OY6 A;  2JEJ A;  3D6H B;  2X1A A;  4FPR A;  1RKJ A;  4C8M A;  3RYL A;  1DAR A;  3TAP A;  3MEE A;  1T9V A;  2ZE2 B;  2R2T A;  1IKV A;  3PEJ A;  2RVJ A;  4RUA A;  1TUG B;  3A13 A;  4LF5 F;  2BAN B;  5C24 A;  1OSC A;  4KKO B;  2DHS A;  2R8I A;  4ZPT R;  1ZET A;  2LDI A;  4ZJO A;  1NSP A;  3IBW A;  2AIR B;  3OTO F;  4QYZ J;  4NOH A;  4ZLN A;  2CFX A;  3L95 X;  1HKA A;  4J9L A;  4PG4 A;  1P9Q C;  2KH9 A;  1CUL A;  5IXU A;  3ETM A;  4OJH A;  4IQM A;  3AA8 A;  3RB3 A;  2ZH2 A;  5KFE A;  4NXN F;  3VWS A;  4RU9 A;  2F40 A;  1TAU A;  2MLZ A;  1RT3 A;  2BOA A;  1NK9 A;  5HSP A;  3KLF A;  3ENA A;  4XK8 C;  1FK9 B;  4O3P A;  2XC9 A;  3HXM A;  1CG2 A;  3MMB B;  4DFP A;  1REV A;  2QZ8 A;  1M5P C;  3JXO A;  3EYZ A;  4A8S A;  3IWN C;  2PI4 A;  3LGH A;  3IBC B;  4N47 A;  2CQ0 A;  3LA0 A;  2C2M B;  3TZZ A;  3X1L B;  5IC6 B;  3TNV A;  5HN0 A;  2F3J A;  4B3O A;  1GT8 A;  1BLU A;  3HKW A;  4ZVU B;  3ZTR A;  2ZNZ A;  2GQC A;  2XB2 D;  4ITS A;  2ZFH A;  4ZVO B;  1HNW F;  5A0Y A;  3FDS A;  2KZM A;  2W9C A;  4YR3 A;  4Y2K A;  3TEG A;  2QJ3 A;  2YKQ A;  2KB2 A;  3ILO A;  4ZVT B;  3G96 A;  3SSS A;  3PAC A;  3G71 S;  3K7R A;  2OD6 A;  4A48 A;  3JSR A;  3AHP A;  3PZP A;  1JK9 B;  4ZCM A;  1RKI A;  1N34 F;  4RNO A;  1C4A A;  5FD1 A;  3PKM A;  1MRO B;  4B3T F;  1I3O B;  4NL5 A;  2EPI A;  4TXS A;  3JSM B;  2HNZ A;  3OPK A;  2Y8Y A;  2VPX B;  2DHH A;  3V81 B;  2W9A A;  2UUC F;  3CCJ S;  4B3M F;  2A18 A;  2BA9 A;  4Y65 A;  3H5Y A;  4DV4 F;  3BS9 A;  4KGM A;  1XWL A;  3PX0 A;  3DGP A;  4FYX B;  2CQH A;  2NPI A;  1UZD A;  4N41 A;  4KPC A;  1IKY B;  2OUG A;  2WVD A;  3FVY A;  1Y4Z B;  3M6X A;  5KOX A;  2RSQ A;  3SXL A;  1B0P A;  5L1J A;  3MFH A;  1FI4 A;  4OI3 A;  2ZOG A;  4GVB B;  4TVA B;  2J5A A;  3EDQ B;  3D2W A;  3MPV A;  3E3X A;  1H0H B;  2O3D A;  3J7Z T;  1VBY A;  3G8T A;  9ATC B;  3BGR A;  4F4Y A;  1GTH A;  3UD5 A;  2ZOM A;  2XZT B;  1NRK A;  1KRP A;  3R1H A;  4DR3 F;  4DUZ J;  1FFS B;  2HPU A;  3IMQ J;  3P45 B;  1NJZ A;  4TY8 A;  4LIR A;  4ED2 A;  1JLC B;  2J6S A;  1VYA A;  2LFV A;  4DCO B;  3Q0A A;  4A47 A;  1NZA A;  3D1H A;  2UUT A;  4W98 A;  4EBE A;  1OY9 A;  4F4K A;  1I94 J;  4IDK B;  3GU0 A;  2MGZ B;  3QGG A;  5AJ3 J;  3QZ7 A;  3C19 A;  3PFE A;  4C6A A;  1ZA2 B;  2AYG A;  4BWM A;  2BKP A;  2OO4 A;  5BYR A;  2DBB A;  2B8P A;  3DRS B;  2GIF A;  2I2Y A;  4KHP J;  4IOB A;  5D4O A;  4NLG A;  2M8H A;  3CO0 P;  4ALZ A;  1R3N A;  4OMF G;  2HBZ B;  3E51 A;  3BBF A;  4QQB A;  1VC5 A;  2HK3 A;  4DQI A;  5AXL A;  4WYL A;  1YWX A;  5G0R A;  4ES2 A;  5LT5 A;  2QG9 B;  3JTN A;  3BO4 A;  4OYP A;  4RUB A;  1UW9 A;  5KT2 A;  3M32 A;  1KD1 T;  4HL9 A;  4IR9 A;  2AW0 A;  2WVB A;  4IG3 A;  1R43 A;  4DEZ A;  3TZY A;  3EXY A;  2PEB A;  4LRD A;  4OZ2 A;  1TL1 A;  2MLX A;  1RT4 B;  2KM8 C;  4ZCL A;  3CC4 S;  2BJD A;  4PG7 A;  4LIW A;  2HZA A;  2POK A;  4R8U A;  3NNA A;  2MY7 A;  1GXL A;  3CSK A;  3B4D A;  4H4M B;  2DGO A;  1RAB B;  1X4B A;  4LUB A;  1FF2 A;  4QPX A;  2VFS A;  3HZE A;  3GIR A;  3Q86 A;  4WU3 A;  1UFK A;  3CCR S;  2BJ3 A;  3C6T A;  2HFZ A;  3US5 A;  3EGZ A;  1NJW A;  3NG8 A;  4X65 J;  3HUL A;  4J5O A;  5KFP A;  4ICL B;  3UNY A;  3Q83 A;  2A6O A;  2YWH A;  2QSF A;  2Q6C A;  1TKX B;  3R7S B;  1RAF B;  5IV3 A;  1GEH A;  2Q43 A;  4JI1 F;  2R7S A;  3B4M A;  2R7T A;  4Q44 A;  2ZWP A;  2C42 A;  4ERD A;  4XDC A;  1C1C B;  3EX7 B;  1R0A A;  3N5B A;  5CYM B;  1YRX A;  2FTR A;  1HWU A;  2B6A A;  3NGS A;  3DCA A;  4DX5 A;  2OD4 A;  2R8J A;  2ACM A;  3FCV A;  3OFG A;  4QCL A;  5LSR A;  2VG5 A;  4NZ7 A;  2FD2 A;  5JJB A;  4ZVP B;  2ZH6 A;  3KLG B;  1PO6 A;  2O1P A;  2F4V J;  2D3O R;  5BR8 J;  4LBP A;  5HO4 A;  1RSC A;  3EIC A;  5HMX A;  5LL6 d;  2JVR A;  1NCL A;  2KT3 A;  4X62 F;  2DNZ A;  3GYG A;  1FO1 A;  4HR2 A;  1TTH B;  4KB7 A;  1N32 J;  3NGK A;  3IFE A;  3DLK B;  4QYR A;  1SH2 A;  3TAQ A;  1QY7 A;  1S7I A;  3CUL A;  5DZ6 A;  1ZYQ A;  1NSA A;  2BJ7 A;  4A4J A;  4ED1 A;  2CUY A;  4EBC A;  5EGY A;  3CJ0 A;  3RBX A;  2CJB A;  1QTM A;  3OUY B;  4CWB A;  2FY1 A;  3U1N A;  3VAJ A;  1AFJ A;  3H7H B;  2VBW A;  3OR1 A;  4DR5 J;  2CPJ A;  4O0N A;  2ZUG A;  2ZVI A;  2DH7 A;  3NCQ A;  2GZO A;  1GFW B;  4N8N A;  1SQF A;  2CPF A;  1PYO B;  3OLA A;  1T9U A;  4EI2 A;  1PC4 A;  4OLP A;  5AXK A;  3R5B A;  2OI2 A;  3KK2 B;  2CQB A;  3O5T B;  1QLN A;  5GME A;  2KRR A;  4Z7Y A;  3NAI A;  3PYF A;  1UP1 A;  1U26 A;  2G2Y A;  4LF6 F;  3BSC A;  4LRE A;  2VON A;  3OTC A;  5KFA A;  2OLW A;  1XMQ F;  1DTT A;  2CA9 A;  3MEC A;  4CO4 A;  4YR0 A;  1HW9 A;  4ZA1 A;  2Y0S D;  3FBC A;  4KFB A;  3PYG A;  4FXW A;  1S1V B;  1JLG A;  3HSZ A;  4AUK A;  2R8H A;  2RH3 A;  4IFY B;  4J9R A;  2MYF A;  2ZVS A;  3BH7 B;  5LXR A;  4DN0 A;  1B99 A;  3G87 A;  3BZQ A;  2KDO A;  2Z2Y B;  4USJ C;  3QID A;  4DFM A;  5FDL B;  2YQ3 A;  1NB2 A;  4C4W A;  2FHJ D;  1O8B A;  3AY0 A;  1GXT A;  5ETK A;  3SCK E;  2VH7 A;  4JI2 J;  1VQS A;  4JYA F;  3D28 A;  4U6P A;  1G2E A;  4EK2 A;  2XUL A;  2G0I A;  1VI7 A;  3BEG B;  1FRI A;  4DFK A;  4CLZ A;  1T0T V;  4K8R A;  1FWP A;  1G4C A;  1W7W A;  2HBQ B;  3PW5 A;  3AD7 C;  1FT8 A;  3FFI A;  5GMK a;  4B17 A;  2ZKU A;  3W2W A;  4KSE B;  4IR1 A;  1RAO A;  3FNN A;  1SXL A;  1GMW A;  4V19 J;  3KUH A;  7FD1 A;  3ZTP A;  1C0U B;  1NHK L;  3OFF A;  3D67 A;  2F9J A;  3GFX A;  2QMW A;  5ETP A;  4FPI A;  1DTQ A;  3L7P A;  3BGU A;  3C6U B;  4EMD A;  3KLE B;  1RT2 A;  5IC4 B;  1NU4 A;  3HSD A;  2V4J A;  3KMQ A;  3R5J B;  3PYE A;  3K5N A;  3PW0 A;  2FJV A;  1P1T A;  1Y3J A;  1JQG A;  3A12 A;  1FDN A;  3P5T L;  1RTJ B;  2BYC A;  3POT B;  4K4W A;  1WTF A;  4MKY A;  4ES1 A;  2IJF A;  3D1Q A;  4CM0 A;  2OGU A;  5HJY A;  4M63 A;  3M2R A;  4PEO A;  1RT5 A;  4ZPW R;  1LK7 A;  4FS2 A;  1WF0 A;  1AB8 A;  3PRV A;  4LF8 F;  1Y0H A;  2XWX A;  1U6F A;  5D4L A;  3FBE A;  1FJC A;  2J0Q D;  4LF5 J;  2PD1 A;  3UO0 A;  3OBI A;  2NS1 B;  2HZC A;  1WTB A;  3OTO J;  2LEB A;  1BMQ B;  1FRK A;  2JSX A;  1RUS A;  1VBZ A;  4DI6 A;  1YRT A;  4NXN J;  2COL A;  3G9C A;  1TL3 B;  2DY1 A;  1FKP B;  2H65 B;  4G1Q A;  4WZM A;  1QVF R;  5AE2 A;  3NP5 A;  2Z4P A;  1B0T A;  2DO0 A;  4N76 A;  1D0E A;  1OYE A;  2BRK A;  2ASY A;  1T11 A;  2MZS A;  4HHJ A;  1PJ5 A;  4TU9 A;  1C1B B;  2MJN A;  3KK3 B;  2V50 A;  4EYH B;  2KT2 A;  4RX6 A;  4DV5 J;  3ZZ0 A;  2LP4 A;  1PBU A;  4BDP A;  1SI9 A;  1KDN A;  2CNN B;  2P2C B;  5LXY A;  2QL5 B;  2DY9 A;  2ZKT A;  2RS8 A;  4F2R A;  2JEG A;  2L41 A;  1AFI A;  2PFF B;  4ELU A;  3G6Y A;  1YG0 A;  2HQD A;  1KFD A;  3M1V A;  2B3T B;  1F5A A;  4H4O B;  1RHR B;  1FVQ A;  5A8W A;  2I6W A;  2ZBQ A;  3EZ5 A;  4IO1 A;  1PIL A;  8AT1 B;  1TUV A;  1NK5 A;  2ZWO A;  2MSS A;  3W8G A;  1PJ6 A;  2AT1 B;  5ETL A;  2MZJ A;  2ZOF A;  4QPT A;  4DR7 J;  3M9O B;  2F63 A;  4NLS A;  1MML A;  1S79 A;  3MMA B;  1N34 J;  5HP1 A;  2KYX A;  5IFM A;  4ECY A;  4JI7 F;  2B4V A;  3IG1 A;  3CCS S;  5CYQ B;  4B3T J;  2R7X A;  1FX2 A;  3BPS P;  5D77 A;  5B0G A;  3GJT B;  1F5C A;  2RRB A;  5DQI A;  4ECV A;  3I32 A;  3QPI A;  4DV4 J;  4X4S A;  2HQI A;  1X4E A;  1U0H B;  3T3F A;  2AEF A;  4NML A;  3Q24 A;  4UUW A;  3NNH A;  2VPY B;  1U7L A;  4ES3 A;  2B7B B;  2VG7 A;  2W2M P;  4DSF A;  4CI0 B;  3UE2 A;  4ECQ A;  1Q81 T;  4Y2A A;  1HBO B;  4WXW A;  5CA5 A;  3BH6 B;  4IG0 B;  5KG3 A;  4I6Y A;  2CIM A;  2D9P A;  2HS3 A;  2QMU B;  2RQ4 A;  2VKR A;  2FHM A;  3J80 U;  1YBU A;  1T8E A;  5I42 B;  4FNI A;  3PJW A;  1H7W A;  2P9G A;  5HLF B;  5C7P A;  1RTD B;  4B9V A;  3BGL A;  4V19 X;  2RD5 C;  2FC8 A;  5DET A;  2DPI A;  3S01 A;  3SZ2 A;  3TZX A;  4DR3 J;  4ECZ A;  3T5K A;  4TQS A;  1VQ6 S;  1B0V A;  3M8P B;  4M5J A;  2ZH7 A;  4GKK F;  4RR5 A;  4NX9 A;  3GIK A;  4K4Z A;  5JUM A;  5E3R A;  4Y00 A;  2BAC A;  3CF5 Q;  5B7W A;  1N36 J;  1VQM S;  5F8H A;  1FJ7 A;  4C0O C;  5ETN A;  4DV7 F;  3DRX A;  2FUG 9;  4I7F B;  1FEE A;  3D7S B;  1SL1 A;  4ZPA A;  3MMB A;  4PXC A;  4DPW A;  4RPF A;  1S97 A;  1YQH A;  1RWP B;  1HWL A;  5KFX A;  1WKJ A;  2XMJ A;  4GO7 X;  2VQF F;  1VRT B;  4IRK A;  3ETO A;  1PCA A;  3CUN A;  3I6P A;  4DBQ A;  2AWZ A;  3SQO P;  1Q0N A;  1I5O B;  2PFD A;  2H4W B;  1A7G E;  1OO0 B;  4HHH A;  3MFI A;  3DRP A;  5HMZ A;  3NS7 B;  4X4U A;  4I4B A;  2EC0 A;  3EVO A;  3MR7 A;  3MD1 A;  3TUJ C;  5E7O B;  5KFD A;  3G8S A;  3LAK A;  3FMB A;  4KHM A;  3I87 A;  2Z8Q A;  3RBD A;  3BQ2 A;  1MRO A;  5L9N A;  2HVD A;  1GMU A;  4WP3 A;  2Z56 B;  3W9I A;  3JSM A;  4CTA B;  1Y9O A;  1ZAW A;  3D54 A;  3V81 A;  4DL4 A;  3TJA A;  3LAN A;  1RT6 B;  4X4V A;  4N77 A;  3M30 B;  1X0F A;  2AJ0 A;  1NLK L;  4NCA A;  3FGV A;  4ZP6 A;  4KO0 B;  2NPF A;  3CGI A;  1RT1 B;  2MMY A;  4JI1 J;  2GMJ A;  5FJ4 A;  2YKM B;  3GG1 A;  5KOW A;  1Q8L A;  1XNR F;  5CAB A;  1LNQ A;  3OVB A;  2ZBR A;  2MQO A;  5DLF A;  3H5U A;  3H40 A;  4GVB A;  2GW8 A;  1CS4 B;  1D09 B;  2E5J A;  4C98 A;  2DIT A;  1QAY A;  2IVM A;  3BQ1 A;  3RW7 A;  3MGJ A;  5AT1 B;  3FQK A;  3AH6 A;  4NYP A;  4JV1 A;  1F60 B;  1HD1 A;  1NPR A;  4RBU A;  1IJE B;  4JV2 A;  3QAT A;  3SCL E;  1D9F A;  3KTQ A;  2CZ9 A;  2PII A;  4CH0 S;  1JLC A;  3W8P A;  3HMJ G;  2X3D A;  2J8S A;  2B0G A;  3ILI A;  3PG9 A;  4X62 J;  1DLO B;  5M2P A;  2KZZ A;  4YB6 A;  2DGW A;  2QL9 B;  5KFU A;  2BKO A;  4K7Q A;  3VGV A;  3G82 B;  2YQ0 A;  4MJK A;  4IRC A;  3HHE A;  4HVZ A;  4IDK A;  1HBU B;  2CQI A;  2MGZ A;  4O44 B;  3FRY A;  4DV1 F;  3TW0 A;  5KFW A;  5F9N A;  2ZH9 A;  2RQC A;  2IPO B;  1PSD A;  2HHQ A;  1TUW A;  3Q8R B;  3DRS A;  1TQL A;  1SH3 A;  5GAG U;  1JJC B;  4FN5 A;  2OSQ A;  1F5B A;  1Y11 A;  1VQ7 S;  3ENW A;  2HQ3 A;  1NK4 A;  5ETO A;  5T14 A;  3R7N B;  1LWC B;  4YN3 B;  5EWF A;  2HAI A;  2D9O A;  2E5L F;  1Q4R A;  4ANE A;  5IWA F;  2BX6 A;  2Y1L B;  5E33 A;  3A4T A;  3UPF A;  2OTL S;  3CDA A;  4MKB A;  1UVN A;  2LMI A;  4IH7 A;  5MAO A;  2IA6 A;  2AQ4 A;  1NND A;  1RT4 A;  1X8D A;  4LF6 J;  1M5H A;  4FF3 A;  3RRK A;  2HEK A;  2MKH A;  3GMG A;  5FLX U;  1LQ9 A;  4Y34 A;  2IYI A;  1WUU A;  3MAA A;  1XMQ J;  2VDI A;  2MST A;  2ZD1 B;  3BBB A;  1F6T A;  4ED7 A;  2XCP A;  1YHQ S;  3Q2T C;  1S12 A;  5IQ6 A;  2GGP A;  3L7U A;  2GQ2 A;  1FKO B;  3IWX A;  3F73 A;  2ZM6 F;  1QAX A;  5EWE A;  4DQQ A;  2HHW A;  2MLY A;  1S0N A;  4PQA A;  2CNO B;  4UT4 A;  2N7C A;  3DLJ A;  1X7V A;  4ICL A;  4IFV B;  2UXD J;  1Q7L B;  1EKR A;  1BD6 A;  2H54 B;  1HBM B;  3DYA B;  1D9D A;  2AU0 A;  3IS9 A;  2G13 A;  3PRD A;  5DJB A;  4HT5 A;  2GVD B;  2DYA A;  4K4V A;  3AJD A;  3MPW A;  4CLL A;  4F3Q A;  1X4F A;  2RS2 A;  2EVZ A;  2QEX S;  2UVU A;  4MKV A;  2HQG A;  2B4U A;  5CYM A;  2WW4 A;  3GG0 A;  4M5H A;  2NXN A;  4ZP9 A;  3U1L A;  5K8N A;  3CJ3 A;  1UA1 A;  1RYR A;  1WNE A;  3TP2 A;  1OIA A;  2BKN A;  1RAA B;  2PGC A;  4C8L A;  4HT7 A;  4RNH A;  5IM0 B;  2ZNY A;  3KLG A;  3TO8 A;  1AZS B;  1QVG R;  1HQU B;  2DRD A;  2WZ1 A;  3Q89 A;  2ABY A;  4RW7 A;  2JJ4 D;  2EG1 A;  4G3I A;  3R2D J;  1DFD A;  2FJE B;  2DNQ A;  2BE2 B;  3VGT A;  4OYW A;  2MHN A;  2PO4 A;  3DLK A;  1SJQ A;  2GO9 A;  2PSZ A;  4J9Q A;  3KLI B;  5KT3 A;  3M6U A;  2U2F A;  3DHW C;  3A8I A;  1UA0 A;  5DLG A;  2MZR A;  1WDD A;  2EKN A;  2YQ1 A;  3T6B A;  5IZH A;  1M1K T;  3GV8 B;  5CCM A;  1AUD A;  4O3O A;  5KFH A;  4KYZ A;  2H5J B;  2F5G A;  3KWM A;  3CO9 A;  2ZIT A;  1ZZN A;  3WX8 A;  4I2P B;  1R8A A;  3QWU A;  4CRJ A;  1KC8 T;  4LF8 J;  2M4M A;  3MXH P;  2RIJ A;  3ZC4 A;  5K20 B;  3RRH A;  1VJW A;  3HPO A;  3FZ2 A;  3PW7 A;  1FD8 A;  1S1T A;  4B08 A;  3GPA A;  2DNO A;  3CCT A;  3B6B A;  2W2Q P;  1YTY A;  4CT8 A;  5J1E A;  1WSR A;  5J2P B;  3KK2 A;  3R97 A;  5FII A;  1YZ7 A;  1WI8 A;  1T03 B;  1KQG B;  3KKF A;  3MM8 A;  1NBE B;  2DK2 A;  3Q8S B;  2F8H A;  3MTJ A;  2NLW A;  2KG0 A;  4NLU A;  2J7U A;  4ZCI A;  3NWR A;  2H5I B;  4WCE Q;  3OV7 A;  2FHJ A;  1S1V A;  5HMW A;  1VQ9 S;  1FXD A;  4DL6 A;  5A8K A;  1ZA1 B;  4I69 A;  4IFY A;  2M5Y A;  5KAK A;  1XN9 A;  2F8M A;  3AOD A;  1Q86 T;  3DDK A;  1XR5 A;  1V3Z A;  1U8S A;  3FCH A;  2Z58 B;  3NGU A;  5FDL A;  2FVC A;  2HW3 A;  4ZPV R;  4YDX A;  3V6H A;  3RBZ A;  2OP5 A;  3MZI A;  1LFW A;  4O23 A;  2HVE A;  4PAB A;  4B9T A;  4ILR A;  4DDF A;  4U67 Q;  5KFK A;  2CJY B;  2R3V A;  1RCX B;  2XNQ A;  4RO0 A;  3ISN D;  2XGQ A;  3MEK A;  2G0C A;  3MPD A;  1EKS A;  1UVI A;  2HS4 A;  1IBL J;  2CKW A;  4PAA A;  4XAK A;  2HFU A;  2EC2 A;  4FZV A;  3N01 A;  2KJW A;  2Q66 A;  1H74 A;  4JI7 J;  4KV8 B;  2KFZ A;  4NMX A;  2LQ8 A;  1F1B B;  4B3R F;  1C0U A;  5KG2 A;  2D41 A;  2EK1 A;  1TKZ B;  5B09 A;  3DKD A;  3TVZ A;  4CLW A;  4DFJ A;  3TEH B;  2FQQ B;  3C6U A;  4JI3 F;  1KHW A;  3KLE A;  1IM4 A;  4O4R A;  3ET6 B;  3K2Y A;  1HQE B;  2XSF A;  4E0D A;  2OHD A;  2HND B;  1ZAV A;  1J5E F;  1WEL A;  1FRX A;  3P3D A;  3NMR A;  5H9E J;  1RTJ A;  4JI6 J;  3QMQ A;  2EBE A;  3POT A;  3HVR A;  5HQ8 A;  4OX8 A;  2W2P P;  5HQL A;  3C2P A;  2XCA A;  2VOD A;  2MQM A;  4AXJ A;  1V3S A;  2EK6 A;  2RB7 A;  4C3K A;  4PPD A;  1BWV A;  2DH9 A;  3SQG A;  2V8G A;  3W2V B;  3R5C A;  3NGD A;  5F8L A;  1MNE A;  2QFI A;  3HX9 A;  4PWW A;  2J0W A;  4PCQ A;  3NLC A;  3KG0 A;  1X5S A;  3C3L A;  3KDO A;  2QGF B;  4NZ0 A;  5GAD U;  2XM3 A;  5D3G B;  1M5K C;  4DL5 A;  4G65 A;  2BVZ A;  4DV0 F;  2AV5 A;  3QJJ A;  3SYZ A;  2DCL A;  2VG6 B;  1TL3 A;  1MN9 A;  1FKP A;  4Q5V A;  4A8K A;  1PBA A;  5C42 A;  4A8W A;  4KGK A;  4DV7 J;  1H2U X;  1X4H A;  3BRE A;  4GRS A;  2KJV A;  2NSC A;  4DSL A;  4UOC A;  3JQM A;  2Q1L A;  1JMT A;  2DVI A;  1DUR A;  3TX0 A;  4K4S A;  5CD4 H;  4L75 A;  3KK3 A;  1X4D A;  3KK1 B;  2C2R A;  5HI7 A;  3BJY A;  1WC6 A;  2Z2Z A;  5KT4 A;  3BGF A;  2OH2 A;  4LF7 F;  2VQF J;  3UD3 P;  4JP8 A;  3G6E S;  3UVJ B;  3QRP A;  8RUC A;  3T1Y F;  3FJ2 A;  4W90 B;  4H4O A;  2DXE A;  1AW0 A;  5EX0 A;  1SV5 B;  1N5T A;  4DPU A;  2HBR B;  1IKX B;  1U2F A;  3D3B J;  2ACY A;  4KR0 B;  2LDY A;  4DSK A;  3A3O B;  4QW9 A;  2ZH4 A;  3EDR B;  5F41 A;  2MDA A;  1HPZ B;  4G1I A;  3O3L A;  4USI A;  3UDE A;  5I4M A;  1MWQ A;  2QA2 A;  2R2S A;  1DJ0 A;  9RUB A;  4RZR A;  1Q82 T;  3G2X A;  4YME A;  2IY5 B;  1U0H A;  4HH1 A;  1UWB B;  3ZNJ 1;  2RHQ B;  4PYA A;  2K2P A;  4TYA A;  2GQQ A;  3MCS A;  2B5J B;  3CB4 A;  4TLR A;  1UTA A;  1NH7 A;  4DR2 J;  5DDP C;  3HFK A;  2JLE A;  1RBO B;  4TY9 A;  2ZJR Q;  2JFD A;  1HBO A;  1NDC A;  1XNR J;  5KFQ A;  3AXK A;  4IG0 A;  3AQP A;  2FVP A;  2RT3 A;  4M1K A;  3TQE A;  2V8H A;  1Q78 A;  3QJP A;  4B9M A;  1S6P B;  2X51 A;  3D6T B;  1NPP A;  1HA1 A;  5KFV A;  5I42 A;  4USU A;  4UST A;  2IRX A;  2HG4 A;  5HLF A;  1RTD A;  3MAQ A;  1GK8 A;  3ICL A;  2A2C A;  3R8Y A;  1FTR A;  2Y8W A;  3LO3 A;  4Q2M A;  1ZOT A;  1RAH B;  1SQE A;  3QSY B;  1NUE A;  3R5D A;  2CG8 A;  5ITH A;  1WC0 A;  3ZZT A;  5L1I A;  3E2E A;  4PUO B;  1E6Y A;  2ASJ A;  5CYJ A;  2YX7 A;  4Y2M A;  5C25 B;  1UVL A;  1VIO A;  4I68 A;  3JTO A;  1ULR A;  2V9K A;  3CED A;  4DX6 A;  2CJK A;  2B4O A;  4IQX A;  2DGT A;  1R27 B;  2A1B A;  4RL1 A;  1ZTW A;  1VHF A;  4MAK A;  4OYI A;  3DU5 A;  4DV1 J;  1D9A A;  5B0B A;  2X3G A;  1QM9 A;  2VU5 A;  3H2L A;  4I7F A;  1U47 A;  3A8J A;  4ZIV A;  2DT9 A;  1FE0 A;  3FBF A;  2GML A;  1JJ4 A;  3H59 A;  4F50 A;  4EZ9 A;  4QIW D;  4KBI A;  4JB8 B;  5EDW A;  3T5H A;  3HVT B;  1PIE A;  3HM9 A;  1LOU A;  4KH1 B;  4MIA A;  3FSY A;  3PVX A;  1IQZ A;  2KFY A;  4URS A;  3W5Y A;  2AZ1 A;  3OVS A;  3LAM A;  2YPZ A;  5ETR A;  4N7T A;  5LSO A;  2IVF B;  2E5L J;  3S1T A;  1UFW A;  3OR2 B;  2MKS A;  5IWA J;  5F3Z A;  2LEC A;  4F4A A;  1SUQ B;  4K2J A;  4LF1 A;  1LV5 A;  4IYQ A;  1N6Q B;  2VB6 A;  2N3O A;  1ROF A;  4GC7 A;  1YVF A;  3A3P B;  2DIV A;  1FX4 A;  1MU2 A;  5I3U A;  4KT0 C;  4NA2 A;  3HO1 A;  6AT1 B;  2MB0 B;  1PYS B;  4CTA A;  5DRK A;  1WKK A;  3QYY A;  2BEF A;  3HJF A;  2HBY B;  2FPH X;  3ZZY A;  2KHC A;  2HHV A;  2M3D A;  1TFW A;  3K5P A;  1O6X A;  3H98 A;  2ZM6 J;  4RNF A;  1RT6 A;  4LFC J;  2QA4 G;  2WSC C;  1RAI B;  4K2X A;  3M30 A;  3T5L A;  4ZVH A;  1GXU A;  3VVT A;  1HMV B;  4KO0 A;  2RU3 A;  1LW0 B;  3D6F B;  1RT1 A;  3R1L A;  2NXU A;  2Z2L A;  3IM9 A;  5J2N B;  3AOA A;  2QA4 S;  4LR9 A;  4EUV A;  3TVK A;  3BN7 A;  4QOT A;  5U47 A;  1CS4 A;  4K0K F;  1UMJ A;  1VS3 A;  5DM6 Q;  2ROE A;  2A0F B;  2AP6 A;  1TL7 A;  2HUR A;  3N6N A;  4M5N A;  4ID8 A;  3ISN C;  1MWY A;  1NSK L;  3DLE B;  1Q5V A;  1O5J A;  3D3C J;  2J9D A;  1JLE A;  4ED8 A;  1RJJ A;  5L38 A;  5KFG A;  3AA9 A;  1Z2L A;  3H0P A;  2HFV A;  2XWY A;  1DLO A;  2Z2M A;  3KFW X;  1CC8 A;  1VRU B;  2M8D B;  4IH6 A;  4QR2 A;  2HVH A;  3SV3 A;  5HBM B;  1NEE A;  2MEW A;  1X9W A;  1A0O B;  3R5A A;  3PW2 A;  1HBU A;  1FDA A;  1SC3 B;  3VAM A;  5GAE U;  3DRR B;  3NRB A;  4O44 A;  4RW8 B;  2G1D A;  4EEY A;  2D7S A;  4X4T A;  3MPY A;  2B56 A;  1FE4 A;  4PWD A;  3S8S A;  2UU9 F;  1QUP A;  2YBV A;  5C2G A;  2XSJ B;  3B54 A;  3IBF B;  5L1K A;  1AT1 B;  1CJK B;  3H2U B;  2NYH A;  2NXE A;  4Z7C A;  3BSA A;  2CPI A;  4LFA F;  4E8U A;  1X5T A;  2RAQ A;  4A8M P;  4UQT A;  1CQM A;  3JYT B;  1BHN A;  2MKJ A;  1U25 A;  1SCJ B;  1LWC A;  4UZC A;  3H4D A;  3UQS A;  1FRM A;  1LW2 A;  3ONQ A;  3MD3 A;  4ECX A;  3V4M A;  3F56 A;  1UJ6 A;  3UCZ P;  4RNM A;  4DUT A;  2LQ9 A;  1S7H A;  3N6L A;  2X7I A;  1HQ2 A;  2J6U A;  2J7W A;  1HHS A;  5K5M A;  3KHL A;  2X1B A;  2WSF C;  2YPY A;  1NAQ A;  5A8R B;  1S0O A;  1U09 A;  1WC4 A;  4D3H A;  2KL8 A;  1VC6 A;  3VVU A;  3GR0 A;  1TV6 A;  3CJT A;  4LSN B;  3RTV A;  2H5E A;  2QL7 B;  3VZI A;  4KGX B;  2ERR A;  4B3S F;  2LEP A;  2WON A;  2R2U A;  1RXO B;  1UFL A;  1C4C A;  3IO1 A;  4IFV A;  1YSJ A;  3C16 B;  3TA2 A;  1HBM A;  3DYA A;  4P2S A;  3GP9 A;  4XPE A;  3S6E A;  3A1Y G;  1WOR A;  2XYG B;  1VBX A;  5L1L A;  4HHU A;  1CPZ A;  4X4P A;  3OW2 R;  3MCO A;  1WJ9 A;  3W9H A;  3H2V E;  1VLY A;  4MMO A;  4C11 B;  5MLC V;  3KJF B;  4EO6 A;  3WIU A;  1W25 A;  3JB9 k;  3IN5 A;  5M2U A;  3J81 U;  2M52 A;  4LSL B;  1EB0 A;  1FKA F;  1QSY A;  3MTK A;  4DR6 J;  3SFG A;  2OEL A;  3SDE A;  1EP4 A;  2K06 A;  3AFG A;  2BE9 B;  2M70 A;  1L3U A;  3EE3 A;  4MT1 A;  4B3R J;  1OYD A;  3K5M A;  1HQU A;  2DHX A;  1U49 A;  1LWE A;  5CCL A;  2R2R A;  1RBL A;  1YBT A;  4BHQ A;  1T9X A;  2VKZ G;  2FJA B;  2BE2 A;  4Y3C A;  2IBK A;  2RKI B;  4N5S A;  3TJ9 A;  4ECS A;  2ZBP A;  3PJ9 A;  5HRO B;  3TX8 A;  2H3E B;  3KLI A;  4OX9 F;  2W1B A;  2GJ2 A;  1BE4 A;  1TMJ A;  4NLR A;  3D6M B;  1TKT B;  2ZC4 A;  1KR4 A;  4HAC B;  3MMC A;  4A8X A;  1PKU A;  4W92 B;  1NSQ A;  3W65 A;  4PR6 A;  2I5J B;  4MYU A;  2Q79 A;  2G2Z A;  2OPS B;  1WOO A;  2WB1 D;  1QAI A;  4I2P A;  4M94 A;  1XJW B;  4LR7 A;  1LFP A;  1RA7 A;  4QR1 A;  2V4Q A;  2MJU A;  1VMB A;  3TAM B;  4NLP A;  2DR7 A;  2HFO A;  4HDG A;  4CYU B;  5J1P A;  1TL5 A;  3F0N A;  3OLB A;  5J2P A;  1UEU A;  4WK1 A;  2CNK B;  4F25 A;  1T03 A;  2WVF A;  1YX2 A;  3CCL S;  4DV0 J;  2JZ5 A;  1JJH A;  3FEY B;  4F26 A;  1IKW B;  3M9N B;  4L72 B;  3BSO A;  4HTI A;  1RBA A;  3FSX A;  4P2X A;  4UW2 A;  3T19 A;  1N33 J;  2XY5 A;  4U8V A;  2GHP A;  3UWT A;  2OKQ A;  2K3I A;  2XS7 A;  3LPE A;  2QMX A;  2BQU A;  3PR4 A;  1RWK B;  1P27 B;  1HR0 F;  1WF2 A;  2IVY A;  2W25 A;  5A2Q U;  4DS5 A;  3VV2 B;  4FDF A;  3T1Y J;  3E01 A;  2RUS A;  3SFU A;  4F3M A;  2K7J A;  4NXM F;  1KQK A;  3A8K A;  1LK5 A;  4LBH A;  1N8R T;  3O8W A;  2MQL A;  3L7O A;  4DL2 A;  1K73 T;  1X4A A;  2GIQ A;  2DXF A;  4L3N A;  4FVC A;  3UI3 A;  4AL6 A;  4YQW A;  1VLO A;  4KIA A;  1FJG F;  3T6J A;  3MPU B;  4F36 A;  1K0V A;  2YKN B;  1U24 A;  4ZDN A;  4FVM A;  1Q53 A;  1HD0 A;  3W66 A;  4KV8 A;  2UV8 G;  1HHQ A;  5CQG A;  3JAM U;  3RGI A;  2JHE A;  4RW6 B;  1TKZ A;  1V3R A;  3PNI A;  2RRN A;  1N0V C;  2PA3 A;  2OPQ B;  4NRU A;  1RWO B;  5LOQ A;  3QT7 A;  1YDL A;  1HQE A;  4WII A;  2HND A;  3D5M A;  4P6Q A;  1OPI A;  3DOM A;  5KT5 A;  2CPH A;  4MIB A;  2V9W A;  4HH0 A;  3RG6 A;  5F8M A;  3OJU A;  1R6Y A;  1UL3 A;  3FRZ A;  4DX8 H;  4ID5 B;  3JSB A;  2UZA A;  3QIP B;  3R2C J;  5CAA A;  2HAF A;  1KNZ A;  4URG A;  4Y2C A;  3CD5 A;  4A8O A;  2R7O A;  4PQU B;  4EFA C;  4F0M A;  2YY3 A;  3W1Y C;  2L08 A;  4E98 A;  1VC0 A;  3HHD A;  1YJV A;  2HWT A;  5KFS A;  3DHX A;  3CNQ P;  1Q7Y T;  5E3Q A;  2XYP B;  3W2V A;  2V2Z A;  4FS1 A;  3VAL A;  3R3T A;  3H5S A;  3CT9 A;  4Y0F A;  3MEE B;  5IT4 A;  3I5A A;  2CPE A;  2GVZ A;  2IM3 A;  2QTW A;  1C0T B;  4DF8 A;  3W62 A;  4Z2X A;  1SJR A;  3VCD A;  1VHI A;  5F8N A;  2CPZ A;  1W26 A;  5D3G A;  2QA1 A;  1X4C A;  4J90 A;  4K4T A;  1PAE X;  1P8G A;  2H48 B;  1S4F A;  2MXY A;  2DEJ A;  1EJ7 L;  2GAG C;  3BM7 A;  2BM0 A;  1VBK A;  2ZZT A;  2MKI A;  1SC1 B;  1BUX A;  1U1R A;  2V4R A;  4JI5 J;  1RT7 B;  4BS2 A;  3TVY A;  2H1Y A;  1TEL A;  3Q23 A;  3HFV A;  4WWS A;  3NNC A;  4K5R A;  4ZHR A;  1VOM A;  1QJH A;  3GV5 B;  3O2I A;  2BE7 D;  3KK1 A;  3D4J A;  4DUY F;  3NBP A;  2XNR A;  4UZB A;  3PKY A;  3FC9 A;  3UVJ A;  2EFG A;  1HNV B;  1UWA A;  4U7U D;  4WZQ A;  4X4N A;  3GIJ A;  2EEY A;  5GMD A;  3UR3 C;  2JLG A;  1NJX A;  2D3O 1;  1SV5 A;  2DRB A;  4B3O B;  4AT1 B;  1OPZ A;  1IKX A;  5CD4 A;  4OZ3 A;  2DNL A;  5A0Y B;  3GIL A;  4C8K A;  2CQ4 A;  2E9Z A;  1BXN A;  5KG6 A;  4OHY A;  1NHU A;  2UUB F;  2CVI A;  1VR6 A;  1HPZ A;  2FVQ A;  2J9E A;  2KTQ A;  4DZD A;  4URQ U;  1L3T A;  3JSY A;  2EFV A;  3A8E A;  3VAK A;  4I56 A;  2OPP B;  3DFE A;  4BBY A;  4CT9 A;  2XHC A;  4YP3 A;  1IBM F;  4UY8 T;  1S72 S;  1KLM B;  3P49 B;  3QLH A;  2FIU A;  5DGA A;  4AL5 A;  5K8O A;  1S1U A;  4RU2 A;  2Y0B B;  3SSQ A;  2Z0G A;  1UWB A;  2HHT A;  2B5J A;  4M8L A;  2KRB A;  2EFO A;  1U8W A;  3NWG A;  4OZ0 A;  1ZM3 A;  2DTJ A;  2BJ8 A;  1UET A;  5K14 A;  3IRX B;  1G6B A;  3HLU A;  3QGP A;  3I4P A;  4NLD A;  2V2V A;  1S6P A;  5D15 A;  2ZHA A;  4K0K J;  3Q8P B;  2ROG A;  3RB0 A;  3IR6 B;  2NZ4 A;  3CVK A;  1S49 A;  4BLG A;  5KT7 A;  4XDD A;  4WBF A;  5E3A A;  1SKS A;  2HYI B;  2GV1 A;  3UCU P;  3M2U A;  3I0S B;  4ZIW A;  2C1E B;  4NLY A;  2NQP A;  3MOZ A;  2DIU A;  1X0P A;  4FNH A;  5HAN A;  2YWE A;  3J7A N;  5A6P A;  1N5V A;  4I0W A;  4PUO A;  5CXT A;  1OSD A;  1IR0 A;  5C25 A;  3VGS A;  2OAU A;  2CQC A;  4TY8 B;  2DNP A;  2HGL A;  2XBP A;  4DV6 J;  2YNI B;  2CXE A;  5F3T A;  2YNH A;  2W9B B;  1QDU B;  2APO A;  1RAG B;  1MSW D;  4KHR A;  4C0H A;  1T9W A;  2IBO A;  2C2D A;  3HHL B;  5L8R C;  1V5V A;  2KVQ E;  1J2V A;  5KFM A;  1R8H A;  2UU9 J;  2ILZ A;  4CLK A;  1R0B G;  1UJ4 A;  3ULH A;  3D68 A;  4OI0 A;  4FBT A;  2H4Y B;  1ZH5 A;  3FBB A;  4LFA J;  4LT6 A;  1YIT S;  3HVT A;  4F0H A;  2QO3 A;  4F04 B;  2N82 B;  3NCR A;  4ED4 A;  4PXB A;  3W64 A;  1HWK A;  3QFW A;  3U1M A;  1RTI A;  4FF1 A;  2V8V A;  5EX3 A;  2XMV A;  4ELT A;  3M8Q B;  1RAC B;  1UEV A;  2RU9 A;  4CDI A;  4F67 A;  1SUQ A;  5G4D A;  3K59 A;  4K4Y A;  1KEK A;  1TAQ A;  5CHC B;  1F9H A;  5LMN J;  3V4I B;  1TFY A;  1N6Q A;  1WKL A;  5GAH U;  1VQK S;  4YS2 A;  3QWP A;  3RAX A;  3EVW A;  3BKF A;  1X60 A;  3H5X A;  4IUF A;  3KNG A;  3MI7 X;  4TU8 A;  1R8P A;  1Q5Y A;  3U7J A;  1JLA A;  1HWJ A;  5T7L A;  5THW A;  4B3S J;  3CXC R;  3T41 A;  3UDC A;  4C8Z A;  2BM1 A;  1E6V A;  4NLT A;  3KHR A;  5DG9 A;  2V67 A;  4CNY A;  3AD8 C;  3C6T B;  1HMV A;  2JC1 A;  4IH5 A;  3ZO7 A;  1LW0 A;  2AEJ A;  4TKT A;  5B0D A;  5AXN A;  1S1X B;  2V6A A;  3V6D A;  3CCU S;  4M95 A;  5J2N A;  1WEZ A;  4UQG A;  3GJR B;  3QAE A;  2FGC A;  3TOQ A;  3H20 A;  3U27 A;  3J80 Y;  4WTY A;  1GTE A;  4J37 A;  2HWH A;  4YUD A;  3ITH B;  4X4R A;  1ACM B;  5E3P A;  3I55 S;  3THP A;  2E9R X;  5SZT A;  1VQ8 S;  1RHK B;  1YJ9 S;  2JNJ A;  1DHM A;  4RW4 B;  4LRB A;  3DLE A;  1RAE B;  1RLC L;  2NSB A;  4ECR A;  3OXL A;  1RLD A;  1H98 A;  4K4U A;  2GJF A;  1G1X A;  2RDJ A;  2AHO B;  1H2T Z;  1VRU A;  2J6T A;  4KY3 A;  2EI5 A;  4QIF A;  2B9X A;  4I6W A;  1WHW A;  3HSG A;  3M8R A;  3H90 A;  3NOG A;  3DRR A;  4OX9 J;  3OTB A;  4RW8 A;  1RHU B;  2J0S D;  1HI1 A;  2IM1 A;  1K44 A;  1I94 F;  2E5I A;  3NOC A;  4CO1 A;  1SKU B;  2XSJ A;  1QD1 A;  4DQS A;  5AJ3 F;  1FXR A;  1CJK A;  3PIO Q;  1NDL A;  4NE9 C;  1B70 B;  1SJF A;  1IQT A;  1FNX H;  3W9J A;  2BJ1 A;  2R7Q A;  5F9L A;  4H4K A;  1FWL A;  1OJ4 A;  3Q8U A;  4DXL A;  3CJK A;  4C97 A;  3T9N A;  2LLZ A;  2LXF A;  2FZK B;  3QZ8 A;  3OT9 A;  4B9U A;  3QAU A;  2WHO A;  2NR0 A;  2R4F A;  2OMO A;  1CLF A;  2HRY A;  5HAT A;  4AQY J;  5J2M A;  3OSP A;  3BO2 A;  1IN0 A;  4NA3 A;  4O4G B;  4FXV A;  3GQC A;  1OQ6 A;  2IAJ B;  3P5B P;  1U1N A;  4X66 F;  3C15 A;  5KFF A;  4EBD A;  5A8R A;  2RHS B;  4DSJ A;  4USM A;  1IBC B;  1TL4 A;  3OL9 A;  1PAU B;  4LSN A;  2GFF A;  3MEC B;  4K59 A;  3CJ2 A;  3V6K A;  2KU7 A;  2AD9 A;  4Q0B B;  2DR9 A;  3OQ2 A;  1HR0 J;  4AFF A;  3FMW A;  1XK8 A;  4YB7 A;  2XI2 A;  1RCO B;  3ILL A;  3L4B C;  4LF9 J;  1D8Z A;  3C16 A;  2ZHB A;  3T5J A;  1TU0 B;  3CJ4 A;  4NLV A;  5KFZ A;  3NGT A;  4NXM J;  4B9S A;  1URN A;  3P8B B;  2V8D A;  2VD3 A;  3PIP Q;  1RK8 A;  3GZ7 A;  1XMO F;  2EG2 A;  1U02 A;  3GCX P;  4P74 A;  2AGO A;  2ZH5 A;  1IXK A;  2GHW A;  5A6W A;  1FJG J;  4DR1 F;  4P75 A;  1FXL A;  1ZS6 A;  5GAG I;  3GCW P;  3CDW A;  4OI6 A;  1FWK A;  3EJM A;  3MM9 A;  4RBT A;  3IA0 A;  3JS9 A;  4LSL A;  1H38 A;  2MKY A;  3LP0 B;  4RLE A;  3FUY A;  4P10 A;  2E1R A;  2NRE A;  5KFL A;  3NGR A;  2YKA A;  2XI3 A;  2JH3 A;  3DGV A;  1FJE B;  3WZ0 A;  5CZX A;  1EAY C;  2F4V F;  3FKB A;  4L6V 3;  2IJR A;  3JQJ A;  3ZZR A;  2ZBC A;  4HLB A;  3NL0 A;  4F7V A;  1MN7 A;  3PHE A;  5DDR C;  4YDD B;  3OJS A;  4YB1 P;  5HRO A;  4OHW A;  2FB0 A;  5HVH A;  5EUH A;  3BGO P;  3E8O A;  4NPO A;  2V4J B;  4EU0 A;  2KVI A;  4JV0 A;  1WD6 A;  3MR5 A;  4TYB A;  3UD4 P;  3CME S;  1TK8 A;  3EZO A;  3FZB A;  4ZP8 A;  3SI8 A;  3EGW B;  1X9M A;  4V1A k;  4ZPD A;  3L3C A;  2OPS A;  4ER8 A;  2FJD B;  1QTN B;  3DXS X;  2CQD A;  3M2R B;  1RT5 B;  1Z4U A;  3SCI E;  3QT6 A;  3TAM A;  2DHG A;  3EGV A;  1F9E B;  2VFV A;  2KXN B;  4CYU A;  2KM8 B;  2JRS A;  2BZ2 A;  1NH8 A;  3IM8 A;  4L73 A;  3PV8 A;  4ANC A;  2AKW B;  3DOL B;  2YH1 A;  2Q6B A;  4Y6I A;  3ZZZ A;  5ADZ A;  5L9X A;  1CJV B;  2AJQ A;  4LF2 A;  2VC0 A;  4PXD A;  4QJV A;  2N4D A;  2FC9 A;  4QYZ K;  5KG7 A;  3VAF A;  3AB4 B;  4DPX A;  4AXI A;  1V6H A;  5FLX Y;  4QR0 A;  1HNW J;  1IKW A;  3VF0 B;  4DMZ A;  4BC7 A;  3H4B A;  4G1Q B;  4LSZ B;  2XY6 A;  1KS2 A;  1HYS A;  2DCU B;  2PN6 A;  2KG1 A;  1YI2 S;  4U8Y A;  2E7V A;  1J27 A;  3LW5 C;  2GMH A;  5B0A A;  2DNR A;  3PYD A;  2BJE A;  4DUY J;  3WIV A;  2CAJ A;  3KJQ B;  5KFN A;  4ZJL A;  4ZLP A;  2W8K A;  1UW4 A;  2WRM A;  3BF4 A;  3CCV S;  1Y00 A;  4AE5 A;  3J7Y U;  4LFB F;  2UUC J;  4DSE A;  4MK7 A;  1WHY A;  2HIQ A;  4B3M J;  3Q2S C;  5F8G A;  1ZM2 A;  3CIZ A;  4HEA 9;  3N28 A;  1DQ9 A;  2FJB B;  1F2G A;  2V94 A;  5SUH A;  2AJ4 A;  1RIS A;  1NK6 A;  4PPZ A;  1RWW B;  1JXE A;  4JV5 F;  1AXQ A;  2YKN A;  3MEG B;  3LPY A;  3KG4 A;  1LWX A;  1IR2 A;  2OEM A;  5JXS A;  4KAI A;  4U9R A;  5D0H A;  4RW6 A;  1VK8 A;  4FF4 A;  1SJ1 A;  2ZE2 A;  6FDR A;  2OPQ A;  2OIH A;  5KFI A;  3AJ2 A;  2AYB A;  2RDD A;  2BAN A;  4ILL A;  3CJ5 A;  3QGH A;  5KT6 A;  4UOH A;  3PXG a;  4KKO A;  2R42 A;  4OX6 A;  1BGX T;  4I64 A;  3OFE A;  1HBN B;  4WKR A;  1EX8 A;  4ID5 A;  3TJ8 A;  2Y1J A;  1NME B;  3W7B A;  1KON A;  5F8I A;  1CJU B;  1QSL A;  4M5D B;  3V5R A;  1HLW A;  4PQU A;  4QU6 A;  2B8Q A;  3M2V B;  4MK9 A;  3KNA A;  5E5N A;  2CPX A;  2V68 A;  2F65 A;  4ZLJ A;  4OHX A;  2ADB A;  4WTO B;  1UVM A;  2PMW A;  3DNC A;  3QO9 B;  4Y28 C;  3KLH B;  2HHH F;  3N79 A;  1FK9 A;  3B8H A;  2JEF A;  4M5I A;  5KTQ A;  4G1P A;  3I5C A;  3RR7 A;  4PXE A;  4DCJ B;  2CPY A;  1C0T A;  3DLG B;  4NWB A;  5IT9 Y;  2DEI A;  2LU1 A;  3SV4 A;  3W5X A;  3IR7 B;  4IO9 Q;  4FYD A;  2I0X A;  3LP1 B;  2MHE A;  4WYW A;  5F0W A;  2VOP A;  1M1H A;  3CJS A;  2BQR A;  3V2U C;  4CLS A;  1RT7 A;  2P6S A;  4CO3 A;  3MM5 B;  2ASL A;  3I56 S;  2OFH X;  5E0O A;  4C48 A;  3CMQ A;  1WI6 A;  2HSE B;  5D4N A;  4I67 A;  4WF9 Q;  3HVW A;  3M6V A;  3CMA S;  2G1H A;  1GQE A;  2QYC A;  1S9F A;  4USW A;  5M2R A;  1NK0 A;  2RQM A;  4CLU A;  3MR2 A;  1WEX A;  4U96 A;  2FZG B;  4C2M A;  4DV5 F;  3MCM A;  2CQ3 A;  1Y5N B;  3MF5 A;  1HNV A;  2XEX A;  5C2C A;  4QW8 A;  4HKQ A;  4PKD B;  2O66 A;  1XQI A;  4H54 A;  1MWZ A;  2ZH1 A;  1JLF B;  1R7I A;  2HVZ A;  2C3M A;  4ENO A;  1Q8I A;  2K1R B;  4ZN1 A;  1A6L A;  3GTY X;  4DPY A;  3DRP B;  3THT A;  2HKE A;  2B4P A;  4IOC Q;  2GX8 A;  2YNF B;  2RIL A;  1L3K A;  3IP0 A;  4C0B A;  1Q16 B;  1S48 A;  4GKJ F;  1IKY A;  2LCW A;  4DR7 F;  2CDQ A;  4O3R A;  1P9Y A;  1F2H A;  4KRW A;  3O6Q A;  1B7Y B;  3ENV A;  2OPP A;  3MHY A;  4UY8 5;  1XEZ A;  2E7W A;  1KLM A;  1RI7 A;  4RW9 B;  2YWW A;  4KQZ A;  4N8O A;  3OL8 A;  2O01 C;  3PX6 A;  2E44 A;  3EXC X;  2ILY A;  3WC2 A;  1VRQ C;  5GAD I;  4TU7 A;  2QLF B;  5DS7 A;  3M05 A;  5HJX A;  4MKA A;  3J7A 1;  2DXD A;  4CIO A;  3BB5 A;  2ALZ A;  3TAR A;  4USH A;  4AND A;  3NS5 A;  3IRX A;  4PZV A;  4QBU A;  4NCG B;  3FQL A;  3QJL A;  4LRA A;  3TQ1 A;  1AYE A;  1FTC A;  3I9V 9;  2FLO A;  1U0S A;  3PJX A;  2AMC B;  1YK9 A;  4KTQ A;  1SIW B;  1UZH A;  2XTJ P;  3I0S A;  3CE8 A;  2XQC A;  1BWE A;  4EZ6 A;  4CM2 A;  1L5U A;  3R6L B;  2JC0 A;  2MKC A;  3N0V A;  3TA1 A;  1RGV A;  3KDN A;  4DSI A;  3K8W A;  3CD7 A;  5T41 A;  1YLX A;  4AD6 A;  2QLW A;  2NUU G;  1TP7 A;  2VF3 A;  4AL7 A;  2YNI A;  3AB2 B;  1S9G B;  2W9B A;  2HVI A;  1YRU A;  4S0M A;  1TZ0 A;  3D0I E;  1XER A;  1H2V Z;  1BQM B;  3HHL A;  4LJM A;  1G3O A;  4XO0 A;  1N36 F;  1K1S A;  4NCB A;  4B02 A;  1N54 B;  3KHG A;  4QIV A;  3QNW B;  1YJ7 A;  5JVG Q;  3DI6 B;  3K5L A;  2PI5 A;  4LVO P;  1XNQ F;  4J9N A;  2M88 A;  3BSN A;  4R0J A;  3GWC A;  3I31 A;  4H4M A;  3BYR A;  3PDN A;  5KFR A;  1IUJ A;  2FHO B;  3S7R A;  4F2S A;  1SIZ A;  3QGI A;  3JQK A;  3VR1 A;  3M8Q A;  1P6T A;  5RUB A;  3AT1 B;  1KHV A;  1H72 C;  3QRQ A;  5LJ3 Y;  3V4I A;  1TKX A; 
#chains in the Genus database with same CATH homology
 2HBQ B;  1RHR B;  2H48 B;  2CNL B;  3D6M B;  1RWN B;  4ZVR B;  1RWO B;  3D6H B;  3R7B B;  2CJX B;  3KJQ B;  1SC1 B;  1RHK B;  1QTN B;  3IBC B;  2CNO B;  3EDR B;  4DCP B;  2H5I B;  2C2M B;  1NME B;  2QLF B;  2QLJ B;  2H4W B;  1RWK B;  2FQQ B;  3GJQ B;  1RHJ B;  1BMQ B;  2DKO B;  2XYG B;  5IC6 B;  4ZVS B;  2XZD B;  2H54 B;  3NS7 B;  3SIP B;  1F9E B;  2Y0B B;  1QDU B;  4ZVU B;  1SC4 B;  2H5J B;  3R7S B;  3R7N B;  2H65 B;  3KJN B;  1RWM B;  4ZVO B;  3EDQ B;  2C2K B;  5IC4 B;  3GJT B;  3QNW B;  3KJF B;  3R5J B;  2C2Z B;  1RWW B;  1ICE B;  4ZVT B;  2HBZ B;  1I51 B;  2Y1L B;  3P4U B;  5K20 B;  2QLB B;  2C2O B;  2HBY B;  4DCJ B;  1RHQ B;  2H4Y B;  2XYP B;  1RHU B;  1IBC B;  2XZT B;  2H51 B;  2CJY B;  1PAU B;  2CDR B;  2CNK B;  3R6G B;  1RWV B;  4ZVQ B;  3RJM B;  2XYH B;  1SC3 B;  1RE1 B;  3P45 B;  4JB8 B;  2QL9 B;  1GFW B;  2CNN B;  2P2C B;  1I3O B;  3GJS B;  1PYO B;  2QL5 B;  1RWX B;  3R6L B;  1RHM B;  4LSZ B;  2QL7 B;  3GJR B;  3D6F B;  4DCO B;  4ZVP B;  1RWP B;  2HBR B;  3IBF B;  2C1E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...