1RHJB

Crystal structure of the complex of caspase-3 with a pryazinone inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
91
structure length
91
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Caspase-3
total genus 16
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rhjB00
3P45B 2DKOB 3QNWB 3R7SB 2XZTB 2XYHB 1BMQB 2QLFB 2H4YB 3R6LB 3NS7B 1F9EB 2C1EB 1RHRB 3EDRB 2XYPB 1RHQB 3R7BB 2QL9B 1RHJB 1QDUB 2H51B 2C2OB 1RWXB 4DCJB 1RWMB 2C2ZB 1SC1B 3P4UB 3GJSB 2HBZB 3KJNB 5IC4B 2FQQB 2QL5B 3R7NB 1I3OB 1GFWB 2QLJB 3R5JB 3KJQB 4ZVSB 2CNKB 2HBRB 2H4WB 3GJQB 2CNNB 2H54B 2P2CB 4ZVRB 4JB8B 2C2KB 3IBFB 1I51B 2CJYB 2H5JB 1IBCB 4ZVTB 1RWWB 2C2MB 2QL7B 1QTNB 3SIPB 1RHMB 3GJRB 2H48B 2QLBB 1RWOB 2Y0BB 1PYOB 2XYGB 3R6GB 4ZVOB 2CJXB 2Y1LB 3D6HB 1RHKB 2H5IB 2CNOB 2HBQB 3EDQB 3IBCB 2CDRB 1RWKB 4ZVQB 5K20B 1RWVB 3RJMB 2CNLB 1RWNB 4ZVPB 2XZDB 1RE1B 1SC3B 4ZVUB 4DCPB 3D6MB 1ICEB 5IC6B 1RWPB 4LSZB 1PAUB 1RHUB 1NMEB 3GJTB 2HBYB 4DCOB 3D6FB 3KJFB 2H65B 1SC4B
chains in the Genus database with same CATH superfamily
3KDNA 1DTTA 1TK0A 4WE1A 2D7SA 4GMKA 2KM8C 3K5LA 2AEJA 3KLIA 3H5YA 4C8OA 4PQUA 1GEHA 5JUMA 2IMWP 1X5SA 3EGVA 4AD6A 3GR1A 5EX0A 3QWUA 1D0EA 4DV0J 3FKBA 2B5JA 2GHPA 5KOWA 1RHRB 3EDRB 2QRRA 2EPIA 4RO0A 3PKYA 5HMXA 4IRDA 4YMEA 1N5SA 3QJLA 1P9YA 2VV5A 5A2QU 2M9KA 2ZBQA 2AX1A 2ASLA 2LXFA 3AOAA 2XBPA 3MMAA 2DRBA 2MHNA 1C2PA 4X65F 3OTCA 1WHXA 4WFZA 2PD1A 4CO4A 4AQYF 1JXVA 1WC3A 2NXJA 2XMUA 2Z58B 3KMSA 3CIZA 2BACA 4JI0F 3VCDA 2GV1A 4FP9A 3QT7A 2YY3A 3KK1B 3M8SA 2DNOA 2ZH5A 5DDRC 4H54A 1U0SA 1XR7A 2CQ4A 2PO4A 5HROB 4X64F 1VHFA 2C3PA 2WVCA 4ZIVA 1S49A 3LQVA 3MR5A 2HRTA 2QLJB 4CO0A 2QFJA 4QWDA 4OFZA 2DJWA 2J9CA 3GV5B 1AUDA 3CCSS 4DV7F 1PYTA 2DNYA 1HLWA 1RAAB 1RZMA 2CZ4A 4LMZA 8RUCA 4JI1J 3FFIB 3KDOA 5IWAJ 1SI9A 3RAQA 3JSRA 4I0WA 2C2KB 4I67A 1Q86T 4OLOA 1ZA1B 3VAMA 2VD3A 4DR3J 3IS9B 5IT9Y 3AH6A 4MFBB 4CLLA 4CIOA 2DEJA 2MZRA 2QT7A 3KUHA 4ZVTB 1N36F 4U9RA 2B8PA 4EZ6A 1FRIA 2C2MB 1F5BA 3A8KA 4ED4A 4FYYB 4QU7A 2WBMA 1QAYA 3R3TA 5L1JA 1CULB 1YX2A 3ICLA 4XAKA 1FTRA 1WDTA 2XSJB 1T94A 3Q8UA 2DCLA 3I82A 5E3QA 4O3QA 1N52B 5T41A 2HMIA 1TL1A 1TMMA 4WYLA 2CQHA 1WSRA 2RB7A 5E3CA 3ZZTA 2ZJRQ 3SFUA 3W3SA 3MM5A 2IYIA 4L3NA 3OSNA 2CJKA 3IR7B 4O3OA 2M7SA 2LEBA 4B9SA 1URNA 2B8QA 4B3TF 4TU7A 4ZLJA 2LQBA 2MEWA 3RB3A 2VDHA 1RT1A 4Y28C 3T5KA 4DPXA 4NEYA 4WP9A 1ZPVA 3O3LA 2BXJA 4FF1A 3CCQS 3GU0A 4TY9A 2ZHAA 2IM0A 3CJ8A 2XLKA 4JI8J 2MZ1A 2PIIA 2XQCA 2R7SA 3RZAA 3G6VA 5T14A 3JAMY 3JSYA 5GAEU 2D3UA 3C14A 3MM7A 1OYDA 4DV6J 2OHDA 4I69A 5H9EJ 1S0OA 5D4PA 1NK0A 4JI6J 3BH7B 3HP6A 4UOHA 4XIUA 4RNOA 3POTA 4JI1F 1PBUA 4F4YA 5KFCA 3VZHA 2B9WA 3FCHA 4UW2A 2GX8A 4LF6F 2Y1RI 2FVQA 1REGX 1C4AA 2AJ4A 2RRBA 3OXGA 3W5XA 4DF4A 1R8AA 2FUG9 4MK9A 3Q8PB 1SKRA 3BSAA 4ZN3A 4IFVA 3VVTA 2V8GA 4IFVB 4CLUA 2RQKA 1TV6B 2H5EA 2K8GA 3CCMS 2KL8A 3IGVA 1NMEB 5E3AA 4U7UK 1NJXA 2JLGA 1YDLA 4OHVA 2MY7A 4X4RA 2HG4A 4UZBA 4KTQA 3DC2A 2IMOA 3LP1B 1HBUB 4NRTA 4Y65A 2K7KA 1BE4A 2KG1A 2AD9A 1HI0P 3T5HA 4YQWA 3BO3A 4GC7A 1K8AT 3QJJA 1NNDA 4L75A 2RQ4A 2LXUA 3DFEA 5H9FK 4OX7A 3AXKA 1KTQA 3ZO7A 3UCGA 1X9WA 2H4YB 1T03A 3C2PA 3NS7B 1GMWA 3W61A 1RXOB 5D78A 5ETPA 2GO8A 4N56A 2W7PA 4MYTA 1X4CA 1AXQA 5E3PA 4KB7A 2IHR1 2BR0A 2HFOA 2IJRA 5HP1A 3TARA 1AZSA 3KJVB 1B0VA 1Y11A 4OJGA 3VQTA 4ECTA 4DCJB 1WEXA 3KK3B 5DG7A 1GTHA 5HAOA 5ETSA 4IG0B 4EGLA 2HIYA 3T1HJ 4PABA 4OLPA 3UD3P 2HNZA 4IG3A 4IOCQ 1MWQA 2YH0A 4MJKA 4QIGA 1H7XA 5IZHA 3K17A 2MPUA 1JKHB 1IR2A 1WD6A 1S5ZA 3E01B 2FQQB 2GJFA 4FNIA 4YEAA 3PR4A 3RAXA 3R27A 1EAYC 1RT6B 2K3IA 3GB0A 2FGCA 3M7VA 3K8VA 2CNKB 2KVQE 4M5HA 3LP2B 4R8UA 2OLWA 5KFMA 2W2QP 2H4WB 2BMBA 4C3MA 3MZIA 1VOMA 2VH7A 5FDLB 2IM2A 2Z2YB 4JB8B 4OI3A 1NKCA 4URGA 1FJCA 4LBIA 4RW8B 2EFVA 6AT1B 2W2PP 4B3OB 2CIMA 3OFEA 2I38A 3TRGA 2QA4S 4GKJJ 3TZWA 4DMZA 4M1KA 2M70A 4RW9B 1FWPA 3I0RB 4HTIA 2IM3A 3KHGA 2RSQA 5C24A 3FZ2A 3TO8A 2R2UA 3CO0P 5CD4A 1HW9A 2D3ZA 3ZTPA 2VPXB 3BH6B 3GCWP 4OJ3A 4ZVOB 3TZYA 1ZAVA 2X51A 3BGUA 3L4BC 2DR9A 2VDIA 3LW5C 5B0FA 5JXSA 4Q8EA 4J9KA 4JI3F 2ZE2B 1Y5IB 1FDNA 4CM0A 2PMWA 2ROEA 3AXMA 3ENWA 4LRAA 4AYBD 3TZZA 2D9OA 1QE1A 3DHWC 1RBLA 3FEZA 1AYEA 3AQOA 1YTYA 3J7A1 2E5LJ 1WF0A 3OL6A 3W65A 4J9MA 5KFFA 2G4BA 4M94A 1X9MA 3H8YA 3H5UA 4NXMJ 2LVWA 3RUBL 4X4TA 2ZH4A 4YY3J 1YITS 3RBZA 3W7BA 4WFYA 4J37A 1RT3B 2PEHA 1LKZA 1Y3KA 3I4PA 1ZZFA 3MD1A 2PN6A 4F4ZA 2VA2A 4OMFG 4RW8A 2LU1A 2X7IA 3W8PA 4AQYJ 2NQPA 2N7YA 3DDNA 4NX9A 2HQDA 2YKNB 4RUAA 1RGVA 4P7TA 2HNZB 3UQSA 4DSEA 4OJ1A 4WFNQ 3CC2S 2XG8A 3PO4A 3HSDA 3BF4A 3BSOA 3BPSP 4Q2LA 2Q6BA 3THTA 3V6HA 3T9ZA 5K14B 1NK6A 1SKUB 1LWFA 4NZ7A 5GAGU 3FMBA 1SJQA 4QR1A 4YHHJ 1T9TA 2MKYA 2XTJP 4ED0A 2XMJA 4EO8A 3PX0A 3AAWB 4U96A 5DJBA 1WJ9A 2R3VA 1T05A 3S7RA 1ZM3A 2HAIA 2V5HG 3WIVA 2HZVA 1PYOB 2DNPA 2OMLA 5KG3A 3W66A 2YQ1A 4UUXA 5KFIA 3QGPA 3OR2B 3R5GA 1VQ4S 4A8FA 8AT1B 1SKWA 1IKWA 4QR0A 2NYHA 3S6EA 1D8YA 3PCOB 3IWXA 5KFOA 1BMQB 1FA0A 2OPSA 2DPIA 4FF2A 4UOCA 1PC5A 2CPXA 1IBMJ 3NWGA 4NLDA 3BQ0A 3CWJA 2B5JB 1KHVA 4LF9J 4IUFA 2YWGA 4G1IA 2BANB 2ASYA 4OHWA 5C25A 5CXTA 3CDBA 4OI2A 2AP6A 1RT4A 1TKTA 3QIDA 3V6DB 1FJGJ 5F9LA 1R7IA 1NH7A 4FKXA 4MH8A 4NXMF 4MMOA 1YQHA 2AEFA 4E2FB 4CH7A 1TKXA 2AKWB 4ZS6A 3UDVA 3K5OA 1FNOA 5KFZA 1V3SA 1WEZA 4Z7YA 2N3OA 1FKPB 2R7OA 3M6VA 4QQBA 2Z2ZA 2LCWA 2DXEA 4OX6A 1RU1A 1OPZA 1VS3A 3HHLA 3IMQJ 3OL8A 2IVFB 1FJ7A 5KG5A 4DI6A 4ZP8A 4BWMA 3LP0A 1N33J 1EJ7L 4ICLA 4Q45A 3JQMA 3RRHA 3R7NB 4NLUA 3KKFA 3KJQB 2L9DA 4Y2KA 3EICA 4QWAA 2XY7A 1LW2B 3I55S 5LMNJ 3PACA 3LP2A 2YNFA 4USHA 2GA7A 1TVRB 1HNZJ 1S1WA 1NHVA 4X4QA 5AXNA 1RT3A 3SV4A 2HLTA 3NMRA 3MEDA 1I51B 1WELA 1YGYA 1RAHB 2WW8A 3OVSA 4K2XA 1B70B 4MKAA 4JV5J 4M5GA 1JLCB 3FBEA 4O44A 4FYDA 3DLEA 2FVPA 1LFPA 2HHXA 4P2MA 2VC1A 3B6BA 5KG4A 5D4LA 2G0JA 2VQEJ 3SIPB 4BC9A 3MAQA 2JEIA 2HHVA 2A18A 2ACMA 4IDKA 2GIFA 4ZVHA 2NPFA 1X4DA 4ZMMA 2Y0BB 5KFEA 4ZJLA 3TW0A 1BWVA 1DLOB 3R6GB 4F25A 5HLFB 3RR8A 4QZVB 5DLGA 1RAEB 2JNJA 5DDPC 4DFMA 1ZA2B 1NHKL 2VPZB 1JJ2R 2AF6A 2A3JA 2ZEJA 5HMYA 7FD1A 4DJBA 2XLJA 3DRSA 2OH2A 1RHKB 1YRTA 3BBCA 5GAEI 3AFGA 4HI1A 1UJ6A 1T9WA 4C8ZA 4WIQA 4C2MA 1RISA 3QIPA 1HNWJ 2ZBCA 3A3PB 3W2WB 2XS2A 1LWEB 5HQLA 4MYUA 4WKRA 2C3YA 4EWTA 3J7AN 1RT7A 1RWKB 2WB4A 2XHWA 2P9EA 2W2MP 2YNFB 3BR9A 3MMCB 5DETA 3JQKA 2NUHA 1LFWA 2VBYA 3LPYA 4WBFA 2RDIA 5EGYA 1WSVA 1N8RT 3O8WA 2ZKUA 3L09A 3QJPA 4JI2F 3GV7B 1XC9A 1N56A 1MU2A 3VAFA 5JJBA 1RTZA 1MWYA 4HI2A 3DOMB 1T9VA 3ET6B 5IOLA 4A48A 5IT0A 3VV2B 1CJVB 1VI7A 2JH3A 2RS8A 3DLGA 1CJUA 2D69A 2JRSA 1TL4A 1DHMA 2L3MA 3AA8A 3ENVA 3FC9A 3M1VA 3NG8A 4OZ5A 3GIIA 3TAPA 1X4HA 1XK8A 5A0YA 3SV3A 4JV5F 2QG9B 1Q79A 3MM6A 3NAIA 1PBAA 1GMUA 2XWYA 3GYNA 1L5UA 1P6TA 2B0GA 2DGWA 3D9BA 3KLFB 1X4BA 5IV4A 2ZH7A 1FRXA 2CKWA 4LVOP 1NZ8A 1YG0A 1W25A 4MIAA 3T1AA 3VTIA 3W9HA 4FVMA 4ERDA 5D6GA 3EZUA 1MN7A 4ED5A 2R8HA 2PFFB 2DR6A 2MMYA 1HPZB 2XO7A 2KDOA 3NCQA 1Y4ZB 2DNMA 1SUQB 4WP3A 2EFOA 5AE3A 4TQSA 5A6PA 5HQ8A 5B7WA 1M0SA 5CYQB 2VQFF 3DRRA 2DO0A 4DPWA 3KOAA 2OPRA 3R7SB 3BQ1A 3H5SA 1F5AA 1FO1A 2MTLA 3MPWA 4DZDA 3C15B 4IKAA 5EN1A 4ZVFA 2QLFB 1C0UB 5AJ3F 3M8YA 1BQNA 2MQLA 3HFKA 1T03B 2C1EB 3D1QA 5KT2A 2GQ2A 1TFWA 4DR6F 3GLJA 2HQCA 3M2VB 4K4XA 3AY0A 1H2UX 2W24A 1BGXT 3MF5A 5B08A 1J27A 1HNVA 1Y3JA 2LQ8A 2V68A 1FRJA 2WHOA 2DNQA 1S1TB 4ZIWA 4ZPAA 2C2OB 1QVGR 3M30B 3D7SB 4RJVA 1CC8A 4R0JA 1N6QA 5K8MA 3KWMA 4M5LA 9RUBA 1NKBA 1R0CB 2V2KA 5L1LA 1VYAA 5J2NA 3NNHA 1S0NA 2CQ3A 2F4VJ 3UFCX 4Q2MA 1P8GA 1S1VB 4J91A 3B8HA 4TVAB 4ZVEA 2UP1A 1ZTTA 4U67Q 4K4UA 3FBCA 4OI1A 3WDOA 3D3BJ 5L38A 4E98A 3FSIA 5HROA 2HGLA 4CDIA 5LM7E 5D0RA 4PG8A 2OP5A 1REVB 1KR4A 5IQQA 1REVA 2X1GA 3MHYA 1N88A 4EMDA 2KXNB 1A9NB 1LW2A 1U1KA 1LK5A 4KHPF 1WOPA 2VOPA 5MAOA 4AL5A 1ZAXA 4Y34A 4M8LA 2ZZMA 2VFVA 4PXCA 1VFJA 2AGOA 4LF4F 4KGKA 4H4KC 3QO9B 3F0NA 2RMLA 3SMZA 2WVEA 4YY3F 3VALA 3DOKA 3NS5A 1RK8A 5KTQA 4OI6A 2QO3A 3QSIA 5L1IA 3MI7X 4ZK7M 1F1BB 2HK2A 4CH1A 2YNGA 5FJ4A 4Y0FA 2HHTA 1NJYA 3HVTA 1YRXA 1RCXB 3IA0A 2V69A 3PM9A 4ID5A 4P75A 3ZZRA 5A8WB 3IWNC 2B9YA 4LRCA 2R8JA 4IDKB 3CT9A 3GR0A 2DNHA 4USIA 4X66J 4M5DB 3CE8A 4DFPA 2VG6B 2YVSA 3DDKA 5BR8J 1Q8BA 1IKXB 4ELUA 2Y3YA 1M5SA 1KDNA 1JLEA 1NSAA 1V9OA 4ZJOA 3L3CA 4UQTA 3MM5B 3NCPA 1OQ3A 3VGUA 1O0PA 1SL2A 5HANA 1EQMA 1IQTA 2DNLA 1FWLA 2VFRA 2CYYA 2ZD1A 3MPUB 3QGGA 4DQQA 4BDPA 3TJ9A 5EHHA 1NHUA 3OR2A 1XNRF 3CMQA 2C22A 2WVBA 3HXMA 2ZOFA 4QIVA 3BGFA 3NEKA 5KFXA 3AT1B 2BKNA 4A8WA 2W4PA 1VBZA 2Z8QA 4F0KA 5B0BA 2V94A 4PUOA 1APSA 2E5GA 4WFAQ 2AJ0A 4P10A 4Q8FA 2KH9A 1K1QA 3CDWA 1XMOF 3HM9A 3I87A 4DS4A 2OEMA 1H3DA 4Q7AA 3TEGA 3V5RA 1JLFB 4CLWA 1NK4A 3GSDA 3P96A 2EK1A 2CPYA 3ZTRA 2EG1A 4JOUA 2QE5A 1HQEB 3DOMA 2ZC3A 3ET6A 4ZPBA 3CC7S 1KLMA 3POTB 2RF2A 1UA0A 2PI4A 2XB2D 2BRLA 1G7CB 3HKZD 1Q8KA 3FSXA 1HD0A 3UWTA 4N7TA 4W4MA 4CI0B 4U7CA 1C0TB 4I68A 3VAGA 2CUYA 3D1OA 4F26A 3GPAA 2DD8S 2Z4PA 2CPZA 2UVVA 3Q8VA 5H9FJ 2XS5A 2B9EA 2FHKA 3I0SB 5ETTA 1TL3A 2GQCA 3LGNA 4DV5J 1L3VA 4DPUA 2HHWA 4TY8B 5C2GA 1QVFR 5DQIA 2CG4A 2E5IA 2IDEA 3AD7C 2M0GB 2OFHX 5G0RB 3UR3C 4TNOA 1QSLA 3FEXB 3N9UC 1HYSA 4WE1B 1VQ7S 3TEHB 1UFWA 3PV8A 2ZKTA 4DSFA 2UVWA 1QD1A 1DAXA 1TAQA 3CW2C 3NNAA 1UVNA 1UWAA 1GT8A 2YKQA 1T0TV 3M2RA 1FE4A 4AUKA 3LWMA 3SYZA 1XMOJ 1KD1T 2ZOGA 4KO0B 5KFTA 1YZ6A 3CMES 2HFNA 4NLRA 2D3OR 2WAQD 2VG5A 1HWLA 3BZQA 6FDRA 2IRYA 2BQUA 3DYAA 1DBDA 1RHJB 2A10A 3DM2A 3M8ZA 2VQEF 3V6JA 3AJDA 5F8MA 1VBYA 1CBKA 2XY5A 4ZHRB 2OI2A 4F0HA 3OL9A 3A4TA 3QSYB 1JLGB 3MR7A 4DR2F 2UXCF 3AB2B 3FNNA 1RTIB 2OEKA 3PR5B 3PYEA 3BB5A 3DLGB 4OI0A 1KQSR 4I6YA 2YPZA 3GJSB 2OTLS 1SKSA 2ZH8A 2Z57B 1RKIA 3VWSA 2UUWA 4F04B 3H7HB 1YJVA 1R8HA 1UMJA 3D5MA 3NGUA 4OYAA 1D9DA 2BDPA 3HVAA 5LXRA 2I8EA 2E1AA 2MSTA 3NXZA 2KYXA 2MKSA 2HWHA 4DFJA 1IWGA 4P6QA 3SQOP 4Q0BA 1B4SA 3FCWA 1ZAWA 4DHVA 4DV1J 1S97A 1HNXF 4ZP7A 2B4PA 3ZTSA 3GG1A 1PKUA 2CPJA 5M2UA 1FHTA 3T41A 2M5YA 3QZ7A 1GX6A 1V6HA 4P73A 4RU9A 4WK1A 2P9CA 3B78A 3D6TB 3GFYA 4PAAA 4RUCA 3EVWA 1RACB 2MQ8A 2OPSB 3FZBA 1U2CA 2UU9J 1C0UA 2CG8A 2AU0A 4QJVA 5J2PA 4LF7J 3QPIA 1NO8A 2W8LA 4MIWA 5B0GA 2F40A 2J6SA 2J7WA 4USVA 1QTMA 2X1BA 1MNEA 2RDJA 1JXEA 3I0SA 3M9NB 3V2UC 3JTOA 2H3EB 4ZJQA 1GXLA 4WZMA 1X5OA 2AEMA 2NYIA 5E33A 3K5MA 1LV5A 2LA4A 2BJ7A 5DQHA 4ECQA 1K73T 1BC6A 2OD6A 4DEZA 5HVGA 3CJTA 5LJ5Y 5GMKa 4RWXA 4FXWA 1GTEA 1SQGA 3GQCA 2MJUA 5IT4A 3Q83A 4FDFA 2R7WA 1FKOB 1HBNA 3NL0A 3MR3A 3KLVA 2W9BA 3LA0A 4YP3A 3MPVA 5I42B 2V50A 2W9CA 1ULRA 4O4GB 1DURA 1Q5VA 1U7LA 2ZWOA 3CJ5A 3R5AA 2CDRB 2DHSA 1J5OA 2MGZA 4URQU 1NDCA 4D3GA 1SL1A 4M63A 1UVIA 2LECA 3IRXB 4ELTA 3IWLA 3MOZA 2CNLB 4RBUA 4BBYA 1F2HA 3C14B 3MM7B 1ZM4A 4FN5A 4RPFA 4ZHRA 7AT1B 5DDOC 3KLEB 3MUVP 2QA4G 3EVMA 2UVRA 4B3RF 2VFSA 2VKRA 1C1CB 3DOLA 1Y00A 3CCRS 4CO1A 1SIZA 4ECVA 3K7RA 3QRRA 2IYGA 1WC5A 4OX9F 3TUZC 1BXNA 3AD9C 3HI9A 4UOGA 1HWJA 1GNKA 1X4FA 3OXFA 4WJBA 1QAXA 1SPBP 3CIMA 2A0FB 2LQJA 4ID5B 1R6VA 1UJ5A 2YNIB 4HHHA 5IC6B 3LTOA 5EWGA 4GKJF 2GIQA 3D4JA 3P3DA 3ZZZA 4B3MF 3T3FA 3L7OA 3CJSA 4NLQA 3KNGA 2GC8A 3QFWA 3ZTQA 2Y1IA 3JB9k 2NSBA 3HF5A 1SJFA 3K0JA 4CYUA 4X64J 2VB6A 1DTQA 2E7VA 3O2IA 5E3RA 1CJTA 4OYWA 4QWCA 2P6TA 2VG7B 5HBMB 1KONA 5SUHA 1F60B 3CMAS 1J5EF 4FS1A 1TP7A 1SUQA 3P45B 4ER8A 3VQSA 4RNMA 2DRAA 4LF2A 1TUGB 4PYAA 3GCXP 4AXJA 1ZM9A 1UTAA 2OMOA 1OJ4A 5KT3A 2L9NA 4WPAA 3MM8B 1F9EB 5DDQC 5F0WA 5J1NA 1VQMS 2K1RB 1Q53A 1L3KA 1RAGB 4EK2A 4DQPA 2DH9A 4I2PA 4LUBA 1HHQA 3MMJA 3X3UA 4ES2A 2YKAA 5LJ3Y 4ATNA 2OIHA 4OZ2A 2GVZB 4ED1A 1B64A 3UDLA 3PW5A 2DGQA 2HFVA 3ETOA 3WC0A 4N5SA 1Z4UA 2XM3A 1U1MA 2E44A 4KYZA 3ITHA 1A0OB 1TKZB 3UDCA 3JYTB 5E5NA 2LFVA 2GMLA 2V63A 4WTYA 4WP8A 3THVA 2EG2A 2YXLA 3BO4A 4HT5A 1C1BB 4OHYA 1UPMB 2J8AA 2IRXA 5HO4A 4DV2F 4DLGA 4NLGA 3C6UB 3RGIA 4V19X 4K4WA 1S77D 4N76A 4CWBA 2F9JA 2Z56B 4A8QA 3M9MB 1LOUA 3SEOA 3GJQB 4N47A 4MK8A 2HVHA 2G2ZA 3PXGa 4NYZA 3O44A 4Y2CA 1KVKA 3HMJG 2HGMA 3AA9A 4CM2A 4DBQA 1VQLS 3NGTA 3TUJC 2XMVA 2KJWA 3VAIA 4ID8A 2NCKL 1CSJA 1U1QA 2J0XA 2MY8A 3JTPA 5ETQA 3GILA 1U1NA 4NWBA 1PCAA 2GGPA 2JFDA 1I6JA 2E7WA 3MOJB 2F9DA 3M2VA 4P7VA 2AYGA 1S7IA 4ZCKA 1T7PA 5BYRA 2G13A 2ZJQQ 1X9SA 2VG6A 2KFYA 1IVZA 4M5DA 1H2VZ 3KXDA 4YDXA 4LSNB 3ZXWA 5IFMA 2NZ4A 3DMJA 1DLOA 2V4RA 4ECUA 4JI4F 4KGMA 5CA5A 2V67A 4NASA 4KV8B 1S6OA 4PXEA 1W2IA 2YTCA 3FVYA 1RA6A 3M6WA 1HPZA 3ZNUA 4XPCA 2ZH3A 5KFLA 2EEYA 3LP1A 2J0SD 1U49A 4NXNJ 4RW4B 2R9LA 1NZAA 1RTJB 2YQ3A 1XERA 1ZBTA 3W62A 2QA1A 4DOZA 2ADCA 2V2QA 3W2WA 3G4SS 2A1BA 4MKYA 1WHVA 1WF1A 1PSDA 3WZ0A 5C7PA 2P5VA 3CJ2A 4XDCA 2MGZB 3KK2B 1JX4A 1J5OB 3NOCA 5F3ZA 4EI2A 4USMA 3FCVA 4F2RA 2MHEA 4EBDA 3MEKA 4U7UD 1Q1KA 3PO5A 2O66A 4DN0A 3RTVA 3FBFA 1SH3A 4LRFA 5G4DA 4DX8H 5DQGA 2BE9B 1H38A 4DPYA 5KFHA 2M3DA 2HZCA 3CEDA 2OSRA 3MEEB 4MIBA 2XC9A 1RT2B 2RVJA 2WSCC 1CS4B 3D6MB 4KBIA 4NA2A 3C6TA 2FJEB 4LF1A 5J1EB 2AGQA 5EWFA 1T9YA 2CPIA 1YIJS 3PFOA 1S6PB 2YKPA 3GIKA 1Q5YA 2HZAA 3I9V9 2Q79A 4CRJA 3UCZP 3GFXA 2UXDJ 3MPYA 2XGQA 2OSQA 3PRDA 5HSPA 3UN3A 1TKDA 3HJVA 3KG4A 2LQ9A 3OFHA 4C11A 1UAWA 5HBMA 4GVBB 1CJTB 1KP6A 4DCOB 4TKTA 2Q66A 1E6VA 2ALYB 2FHJD 3H98A 4P72A 1WOOA 4OI4A 2X1AA 4C9DA 2XZWA 4JI4J 1SC4B 3Q8QB 1NLKL 1Y5LB 3R5BA 3QLHB 2DH8A 3FQKA 4RR5A 4TYBA 4AFFA 2FJAB 1MMLA 3DRRB 3L7PA 2W9AA 1EP4B 1FK9B 3CJ4A 2CWKA 2XYHB 3TI0A 4F3OA 1IKYB 3M8QB 5T7LA 5F8JA 1N34F 1TL5A 1G2EA 4NEZA 3HJFA 2ZH6A 5DS7A 2BE2A 1ZM2A 2U2FA 3LAMA 1U24A 4EFAC 2O01C 4NLOA 1UWBA 3NGSA 3R7BB 2QL9B 2IPOB 2DIUA 1HMVA 2RHSB 1TL7B 1XEZA 2GIRA 2RNEA 5A8KA 2YQ0A 1HWIA 3CNQP 1RI7A 2F8HA 1PGZA 4I2QA 1TKXB 3EE3A 4ZP9A 2VJVA 4LFBJ 2OPQA 2DGVA 2RQMA 1RT5B 1VCTA 3R97A 3JYTA 2BRKA 4NLXA 4DQSA 1TK5A 2HIQA 1UFKA 2NXEA 3HHLB 3PZPA 1C1BA 2IDLA 2XI2A 2HS3A 3OQ2A 2EVZA 1VC5A 3CD6S 3C19A 1A6LA 5I3UB 2R7VA 2YWWA 2CXEA 3SCKE 5I4MA 2G0CA 3M32A 2BOPA 2LU2A 2XI3A 4D3HA 1EX8A 4LIRA 1TELA 1WORA 4NMXA 5K9FA 1CJKB 2ZDOA 3QWPA 3S01A 2XCAA 3ILIA 4JI7J 4X4NA 4DQIA 1AROP 2DO4A 3OTOF 2LXIA 3CCZA 3DI6B 1VLOA 4M5NA 3VAHA 2BJDA 3EJMA 4N8OA 2DRDA 2J6UA 4FVCA 3BO2A 5LT5A 3OSPA 1N34J 2PMHA 2OGUA 1I94J 3WC2A 5ETRA 1U6ZA 5B0AA 1SXLA 4J9PA 5FLXY 1YI2S 2VONA 3HDSA 1AW0A 4J5OA 1FXRA 2YNHB 1BQNB 5F3TA 4KC5A 4WYWA 1IUJA 4KO0A 2N3LA 3CD5A 1G4CA 4QYZJ 1VISA 3PW0A 2QLBB 2AV5A 4RZRA 3HCXA 2RHQB 3EVOA 3RB0A 3TP2A 3TWZA 4PXBA 2JFKA 4DR1J 4C0OC 2HMIB 3C66A 5KFSA 3FEYB 2OTJS 3P5BP 4TLQA 2CQ2A 2FVRA 2RJZA 3I6PA 4QYRA 2FJWA 2CJXB 2HVEA 1WG4A 2OPPA 4IYQA 4ZPDA 4H4MB 3KUGA 2LMIA 1SB6A 1DY3A 4CO2A 3K8WA 3W63A 1BHNA 1E6YA 3TQEA 3TX0A 1S1VA 1KOHA 4DL0C 3SDEA 5LSOA 5GAHI 2EW9A 3G6ES 2EXUA 1JQGA 1R0BG 2HGNA 4LF9F 4KHPJ 2OAUA 3KHRA 2FY8A 5EDWA 4OYZA 2J9EA 3J81Y 3EX7B 3M6XA 3W9JA 4O4GA 2QSWA 4Q0BB 3KK2A 3UD5A 1IBKJ 4OQJA 2HK3A 1HR0F 2V6AA 3G6YA 1B0TA 2ZUGA 4ZCIA 4HKQA 2FHOB 2HFSA 3N5BA 4OYXA 3QATA 2WOMA 1KOOA 4A8XA 4B02A 1DQAA 2IVMA 3A8EA 3HHLC 4CH0S 1OY8A 2OPQB 1KFSA 1RTIA 1VRQC 2DGOA 3IR5B 5B09A 3IP0A 5H1SV 3EZ5A 1VQ8S 3MR2A 3HVTB 4OX8A 3TA1A 4BC7A 1HIYA 3VZIA 2RKIA 3BBFA 3QRQA 4FXDA 2E66A 1BY9A 5HJXA 2IBOA 1S6PA 1G3OA 2RS2A 4LF8J 2IVYA 3ISND 1X31C 4PEOA 4ZPWR 5DO2A 4BCAA 4DPTA 1R0AA 1UZHA 4L74A 1Q81T 4F3QA 4LF5F 1ZS6A 2NUUG 4I1TA 1JLAA 4CLYA 2XULA 1KQKA 3PW4A 5L1KA 3QRPA 4C11B 4A8KA 1J2VA 3FK4A 4S0MA 3RBDA 4OYIA 1Q78A 4PXDA 1XIQA 5KFJA 3KTQA 1HD1A 4V19J 3BM7A 4MAKA 4DR3F 3DI6A 1HBUA 4KH0B 3RW6A 3H90A 5CYMA 3MTJA 4Y2AA 1N5TA 3JAMU 1IKWB 5H9EK 1HYSB 1JK9B 4PQUB 4PWDA 3KLIB 4WWSA 2FY1A 1VQYA 5J2QA 2O1PA 3ENQA 4B3TJ 4I6AA 2MZQA 1N0UA 5CYJA 4ZP6A 4C48A 5D4OA 4QYZK 4KFBA 3CD7A 2XYPB 1VLYA 5HVHA 4HYKA 3AQPA 1DARA 1MW7A 4ZKAA 3LWLA 1WTBA 1VIXA 3LF0A 1HI8A 4WXWA 4LT6A 4LVNP 4Q44A 1FDAA 4UOFA 1AZSB 2V4QA 3HVRA 1OYEA 1T11A 4Z7CA 4O4RA 1EIYB 2FDNA 1VK3A 2KRRA 3AB4B 3C8YA 3E8OA 2NSCA 3NBPA 3N0VA 4UZCA 4RWWA 1SC1B 2FJDB 1TR0A 1S1UB 4AT1B 3FQLA 3M8RA 3KK1A 1H0HB 5DZ7A 1TU0B 4ZN1A 5A2QY 4OV1A 1OPIA 4DDFA 1NPRA 1RT6A 2CRLA 2MSSA 3HD2A 3I9ZA 4Z37A 1YJRA 3BEGB 1YJUA 4X4SA 3K5PA 4IO1A 4K4YA 3P6YC 2DCUB 2BUNA 5D4NA 2HBRB 1S57A 4DX7A 2AX0A 2VG7A 3OFGA 5F41A 3WX8A 2J8SA 2FLLA 2APOA 4E8UA 3ZZPA 2X1FA 3PIOQ 2HQGA 4ECSA 1RUSA 2J0WA 2H9ZA 3CDAA 4IQXA 1PC4A 4DXLA 2MQOA 2OPRB 1WKJA 3PFEA 3WIUA 2BM1A 3NGKA 4NI2B 3G6XA 3RW7A 4NI2A 1JNRB 1S7HA 3M2RB 4OZJA 4K50A 4QWEA 1F5CA 5AE1A 4KJIA 2EKNA 3MURP 1M5HA 4DG1A 2YX7A 4DV4F 2E1RA 1CULA 2FC8A 1D9FA 2VC0A 3CXCR 2J5AA 5KFVA 4ZLPA 1HKAA 4JI5J 1WACA 1MLAA 2PC6A 3LH2S 3LPEA 4W92B 1ZOTA 4WIIA 2EBEA 5RUBA 1N4LA 3THPA 4B3SF 2DBBA 2FJVA 2EWHA 3CCJS 1R8CA 3DRPA 5BJRA 4A8SA 2R8KA 3MFHA 2GAGC 3N6LA 5CD4H 2ZZTA 4IOBA 3WBZA 2H5IB 2EFNA 4L3KA 3TOQA 3R9LA 1HBNB 5KFDA 1V3RA 4IQMA 1KBRA 2G1HA 2Z30B 3QIPB 3TZXA 4X62J 5HI7A 3A3OB 4CT9A 4NLPA 3HSJA 5J1PA 2YH1A 1R31A 2DT9A 1RB0A 4PUOB 2HWIA 2M4MA 2DY1A 4BHQA 3K2YA 2W9BB 2VPYB 3UPFA 3HX9A 4G3IA 3C16A 3A13A 3X1LB 1S1TA 2PE8A 1BQXA 2EBGA 3HHLD 4IRKA 1SC6A 2ZNZA 3TUIC 4G1QB 1FEEA 1U2RA 3MMAB 1SH0A 3MM9B 5JMNA 2C2DA 1U8SA 3TA2A 3K59A 2YNHA 4IG0A 4OYPA 1YJWS 2VBXA 4FNHA 3KLHA 3MPDA 1H2TZ 3ISNC 1FRHA 5IV3A 4B3SJ 2EFGA 4PG7A 1TFYA 4CLSA 3EUNA 3AD8C 1TL1B 1ROFA 2KI2A 2JZ5A 3BKFA 3DLJA 4K5SA 4UF4A 4NLWA 2ZH2A 1NDKA 3HFZB 1XR5A 3N01A 3D6FB 2UUCF 3HO1A 2HW3A 4DU8A 5DM7Q 3G87A 2ROPA 3MDFA 3H4BA 1T05B 1MMNA 3QO9A 1H72C 2KHCA 3NWRA 5CYQA 3GTYX 1FEHA 4DX5A 1FXDA 1X7VA 4U8YA 1OIAA 2JX2A 2GHWA 3T1YJ 2HURA 2VUGA 5HL7Q 1UVKA 3DXBA 5GMEA 3VVUA 2KVIA 3AOBA 3MGJA 1YHQS 4LR7A 2FJXA 4I64A 1FVSA 1N48A 3VGTA 2FLPA 3ENAA 4I2PB 3IRXA 4ZCMA 3UVJB 2JJ4D 2WSFC 1VHIA 4ECYA 4K4TA 4JV1A 2V0NA 3P49B 2J9DA 5CZXA 4EBCA 4OV6A 2M2BA 4ZVGA 4OL8A 3EPGA 1NPKA 2C2ZB 2ZD1B 3H20A 4C8KA 1Z2LA 2J7UA 2W7OA 4RX6A 3RG6A 3F73A 1R27B 1KRPA 2MLYA 5EUHA 4MK7A 1NSPA 2IJFA 1RU2A 3CDUA 4ICLB 1FTCA 4O3SA 5KFYA 3HZGA 1RCOB 2RUGA 4NRUA 5CQGA 2AWZA 4KY3A 1DJ0A 4PKDB 4CYUB 1RT7B 3H42A 1HNIB 1H73A 2KKHA 1TTHB 1VR6A 4OZLA 2CNNB 4XK8C 5D8HB 1Q7LB 1NH8A 3D28A 4FYVB 3WHIA 4LBPA 1GQEA 4RL1A 4PR6A 1S9GA 2M8DB 4GO7X 1FX4A 1ZZNA 3G82A 4M5IA 4OHXA 4NLSA 4QOTA 5C2CA 4LFCJ 1ACMB 1OMSA 2F65A 1UCNA 2DR8A 1R3NA 1X5PA 2I5JB 3NGRA 2JEFA 1IBCB 2VFUA 4ELVA 1RT2A 4EZ9A 4IH6A 1CQMA 2RD5C 3QGIA 3RB6A 5C24B 3GYXB 2LEPA 1XJWB 3HSZA 3OJUA 4J9RA 3US5A 1NPPA 4RUHA 2IM1A 1RABB 2ALZA 1NK8A 1Y7PA 1S4FA 1RAJA 1BLUA 1JNZB 2GO9A 3HHEA 5D77A 4MTPA 5GADU 1YJNS 1FERA 2QYGA 4X65J 1U1OA 1UVMA 3LUYA 1ZETA 1SQFA 2N82B 5KG0A 2QV6A 2OD4A 1HA1A 4RKUC 4OZ3A 1JLBB 3NBPB 3L9ZA 1PJ7A 4OYOA 1XNQJ 4LSLB 1UEVA 2R42A 2CQBA 3QZ8A 1N5VA 1D09B 1P1LA 2ZM6J 1FKAF 4WZQA 3LP0B 4PG6A 3SXLA 3HLUA 5KG6A 2JVRA 4HHUA 5L46A 2MB0B 3EDQB 1O6XA 1YK9A 3OVBA 1YBTA 3ULHA 2C28A 4YR2A 1Q16B 4O0IA 1M1HA 2L41A 5LMUJ 3B82A 3MWBA 1XMQJ 1PJ5A 1EB0A 2M8HA 1HMVB 4LIWA 1QAJA 3SSQA 2CJQA 3DM2B 4X2BA 2POKA 3EGZA 3A12A 4C8YA 2V34A 1QM9A 3CGIA 3J81j 1GXTA 2CADA 1S1XA 2XHCA 3BREA 4Q5VA 4NYPA 4HHJA 3UR0A 4DL7A 4DF8A 2G2YA 3MEGB 5ETVA 4I56A 3PRVA 2KTQA 4CNYA 3TANA 1H7WA 1BWEA 4C8MA 1NJIT 3BKUA 5K5MA 1QUVA 4LFBF 4GKKJ 4X66F 1F9HA 4O3NA 3DLLQ 3Q2TC 4DR7F 3RB4A 3BBBA 2FVSA 3KYLA 1MSWD 4RBTA 1K47A 5DM6Q 2YKMB 4EO6A 1SJ1A 2IY5B 1R0AB 3R5CA 1ITPA 4LQ9A 1FXLA 3I56S 2BW7A 3PJWA 5KT5A 3ZZ0A 2AW0A 2PA3A 2WVDA 2AMCB 1N32F 3HULA 2P8IA 2WONB 4PRFA 4P2SA 2R2RA 1PIEA 1M5OC 1Y5NB 1UEUA 2BJ9A 2DNKA 1U0HB 3FRYA 4QPXA 2EC2A 1VQ5S 2IIHA 2C42A 3MUTP 1R6YA 1RBOB 2XZTB 2QN6B 4FPIA 2GHVC 1XNQF 3OPKA 2ZJPQ 2CZ9A 5HJYA 1VRUA 1XR6A 4LREA 3RAMA 2QSFA 3M4XA 2V4JA 1VMBA 2KXFA 4JI5F 2JLEA 4ENOA 3MMCA 2VASA 4C3LA 2DHGA 3IFEA 1IJEB 4UY8T 1RQ0A 1JLFA 1QDUB 1HQ2A 2JLFA 3GYGA 4N77A 4UTGA 5ETMA 3DLHA 3GIRA 1KFDA 2ZVSA 5F8IA 1B3TA 4UY85 2COLA 1QLNA 4J9NA 4DL2A 2RF2B 1FKPA 1RTHA 2HFZA 3DGPA 5A8RA 3PW2A 3MTKA 4QCLA 3VR1A 5J2NB 2ZH9A 2UXBF 1FE0A 2DGUA 1K0TA 2XS7A 2ILZA 3BSCA 4RW4A 5A76A 2YWHA 4FS2A 5KFKA 3PVXA 3PHTA 4YS2A 3H2UB 2CQDA 3CCTA 3NNCA 2KB2A 3EXYA 1GFWB 1I3OB 2IAJA 1EZZB 2BV3A 1TL3B 2CQGA 3EM1A 2CWXA 4RNHA 2XY6A 2I2YA 1D8ZA 4BS2A 4XTTA 2PEBA 1TQLA 5G0RA 1IBKF 1K0VA 2L48A 1RWUA 3G82B 3BSNA 4G1QA 2P6SA 3IAM9 2MXYA 2HQ3A 4ANEA 4TQRA 5AXKA 2W8KA 4YUDA 1MWZA 1RA7A 1U2FA 3HK2A 3IM9A 1Q0NA 3NP5A 4P74A 4G1PA 3KLHB 3R1HA 2R7UA 2ZHBA 3PW7A 5GVQA 1HBOA 5SZTA 3CDEA 3DNCA 3I5AA 2GJ2A 2NS1B 1TV6A 2ZWPA 3CD0A 3HT0A 2YX1A 1Q95G 3IC1A 2XEXA 4LF8F 3MR6A 1D9AA 1QSSA 3ITHB 1YBUA 1T95A 1VK8A 1KVJA 3GFZA 2RQCA 3K58A 1FRMA 2E1PA 3ILLA 2FZGB 4KH1B 4FF4A 3UN2A 4HLBA 1U25A 3U02A 1F9FA 4LFAJ 3CPWR 4HL9A 1EHWA 4X4PA 1RAFB 4KGVB 2NLWA 2R8IA 3HFVA 2I0XA 2HVZA 2ZBRA 3QQCD 2N7CA 4DV1F 1HNXJ 2CJAA 2ILYA 1VRUB 4LRDA 4MT1A 4BWJA 1WC0A 2R7TA 2WRMA 4G65A 1S6UA 4IRCA 1RAOA 5I3PA 2PMZD 1NCLA 1FFWB 5L39A 3ISZA 3MAAA 3OUYB 3OVAA 3K57A 4WF9Q 4N8NA 1S48A 2IJNA 4HACB 5FIIA 5DRKA 4JI7F 3MCNA 3DDIA 2Y0SD 4H4OA 2KM8B 3CC4S 4J9VA 4URSA 3BGLA 3W2VA 3SCIE 3H5XA 3NRBA 1UA1A 4YOEA 1N33F 2DB1A 2DITA 2UV8G 4DL6A 1ICEB 4PYDA 3G8TA 1S1UA 1RTDB 1I5OB 1RAIB 2BE7D 1RWPB 1KQFB 4ECRA 2E7XA 1N36J 4K4ZA 1VC0A 2ZNYA 3MM6B 4H4KA 3TNVA 1NB7A 4IR9A 3HT3A 3MAHA 3GJTB 2JEJA 3UCUP 5CHCB 1SL0A 5D0GA 4KPYA 3O6QA 2ZH1A 4KE5A 4RLEA 5BR8F 2RIJA 4K4VA 3WX4A 2XMKA 2GAHC 1A7GE 3MCOA 4NE9C 4YB6A 3MFIA 1RWNB 3A1YG 3OTEA 4MKBA 1U8WA 2HS4A 3I5BA 3PHEA 1YBAA 3SQGB 2MQPA 1T3OA 3J80U 2QTWA 2HHPA 4KIAA 3QYYA 3FJ2A 2B6AB 2KT3A 1U1RA 1GK8A 3KFWX 4CTAB 3OBIA 4LFAF 2ZM6F 3BKTA 2MLXA 4EEYA 4J7CA 1OSCA 1VRTA 3RRKA 2E9ZA 3CJ0A 1W2BR 4M5JA 2Q3PA 4DG1B 3QAEA 3BDPA 4FBUA 4B9TA 2F7VA 1U1LA 1R8PA 3ELHA 4NCGB 1RSCA 3HHDA 3PTWA 3M8PB 4ILRA 4NCGA 1WC1A 1U02A 3SSRA 3UVJA 1G1XA 4HTJA 4KT0C 1V5IB 1FFGB 3SI8A 2RE1A 4WTOB 3OW2R 3IG1A 3IN5A 2E5HA 1LXNA 1CLFA 2ZBIA 3J7Z5 3KK3A 1FNMA 4KR0B 1GMVA 3LALA 2QIFA 4RW7A 3SBMA 2QX0A 1SH2A 4O0NA 3CJ3A 3DRXA 3O1LA 3OTBA 5KFRA 3J7ZT 4DL4A 3V81A 1JKHA 5ITHA 3KJNB 5E2QA 1OQ6A 2Y1JA 1NJWA 4LF5J 2ZOMA 3G2XA 2HPUA 3HZEA 3N6NA 3PYGA 4RNNA 2YKMA 2F8MA 1T3NA 1AFJA 1H98A 2RRNA 4DR7J 3UD4P 2QLXA 2QEXS 4M5KA 1IJFB 3CB4A 5ETNA 4ZVSB 3KHHA 5JVHQ 1DRZA 2ZZNA 4GVBA 2B43A 3H40A 1LQ9A 1WHYA 4ITSA 1Q82T 3BQ2A 2Z2LA 2J6TA 4JI8F 2EFQA 3UE2A 1CG2A 3KG1A 4DSIA 2WBRA 3OHAA 1N32J 1N5QA 1R43A 2D74B 4DSJA 1VGYA 3UW1A 1R89A 1WC4A 2V8PA 2CJYB 3LGMA 4OYMA 3BGOP 4NPOA 1CJVA 4QPTA 1JLCA 4O44B 1S6QB 2MKCA 3IM8A 2DEIA 4DUZJ 2AJQA 2V4JB 2ACYA 2F63A 2YX4A 3PYDA 5F0UA 5C42B 8ATCB 2I9SA 3TAMB 2R2SA 1Y9OA 3PX6A 1FDDA 1DZ5A 4GKKF 2XSJA 2YBVA 4J9LA 2XYGB 3OL7A 1HARA 5DZ6A 4USKA 1UL3A 1TAUA 4EYIB 1HFEL 1IR1A 2QLWA 4I2QB 4J9QA 3G8QA 1ZTWA 3UO0A 3DGPB 2VQFJ 1O8BA 2WONA 3RBEA 1JLBA 3BYPA 3PYFA 1M5PC 4K0KJ 1E6YB 1IM6A 1WI6A 2XO6A 1Q7YT 1D1UA 1KN6A 2JEGA 1FF2A 2W25A 5IXUA 2JC1A 3FRZA 4N41A 5F8HA 1B7FA 1WC6A 2KG0A 1QY7A 4PWDB 2L9WA 2HWTA 1SQEA 1IWAA 3CVKA 1Q8LA 3PG9A 2QC3A 1LWEA 1QSYA 4ZLNA 2VBWA 3J80Y 2G0IA 1KWMA 3L95X 4KFBB 4CP5A 4ZVQB 3I5CA 4QW9A 5K8NA 1NK7A 3G86A 3C46A 2CZVC 3LOUA 2BA9A 4DR2J 2UXCJ 4FPRA 2B4VA 2GVDB 1PILA 4JBCA 1HBMA 3VAKA 4ES1A 2HNYA 5MLCV 1L3TA 3ILJA 2I6WA 4IFYA 5U47A 4QR2A 2AT1B 5J2MB 4F4XA 2F4VF 3BN7A 2E1MC 2G1DA 3MM9A 4CLKA 5KG2A 3TUPA 3W2VB 4PG5A 1QUPA 1NDPA 2F8EX 1KC8T 1YJ9S 2YNGB 3H4DA 2KT2A 4DCPB 4F4WA 1L3SA 3DLKB 2JSXA 4Y3CA 3C6TB 3DN9A 3OR1B 4OHZA 5J1EA 5GADI 4ECWA 5F8LA 3T1HF 1NJZA 3G96A 3HPOA 4I6WA 4DUZF 3I32A 1OY6A 2AYEA 4K8RA 2JVOA 3M32B 1EETA 4QIEA 2ZC4A 3T5LA 3OTOJ 1AA1B 2R7QA 1JLQA 1Q4RA 2DK2A 2NREA 4JYAF 4F02A 2NXUA 2MQMA 4WCEQ 5D3GA 1Z2ZA 3UDEA 2B51A 2ERRA 2UU9F 1HNWF 3R1LA 2UZAA 1UW4A 4I4BA 4NA3A 3V4IA 2C2NA 2GMJA 4Z2XA 1IKYA 3M8QA 2HQIA 5T7LB 3CCES 1KHWA 4Y2IA 2VICA 4AL7A 4C4WA 4YR0A 2CPHA 1JJ4A 3CF5Q 1I94F 4CT8A 3F56A 1KEKA 4DR1F 1UWBB 2V9KA 1UPPA 3W64A 1UFLA 2W2OP 4JI2J 2GJIA 5ADZA 1XTZA 4IR1A 3DCAA 2ASDA 2FHMA 2GVZA 3VHQA 2KFNA 1O51A 1IKVB 1UW9A 3HHKA 4OX9J 2LYVA 3DU5A 3T5JA 2JOQA 1FT8A 5M2PA 1HNZF 2XNRA 1TUWA 1RWMB 4ZOSA 2CPEA 4WU3A 1KNZA 5KFUA 4PPZA 4A46A 4B3MJ 2FYXA 3A3NB 3U1NA 4K59A 1U6BA 3W8GA 3OR1A 3J81U 1ZH5A 4WFBQ 2AYMA 2LEAA 1WG5A 2MZJA 1KS2A 1U47A 3KLGB 1LXJA 5F8NA 4R5PA 1XNRJ 3VF0B 3AOCA 4ECXA 2VODA 1GAOA 3R5JB 2FZKB 2IAJB 1YRUA 3T6BA 3BN4A 2E5LF 2QMXA 4ZPVR 2WB1D 3D2WA 4W90B 4CLZA 2YKOA 4O3PA 1E6VB 3D0HE 3ZTOA 4RBVA 5GAHU 5HK4A 1QAIA 3PY8A 4DWIA 3HD1A 1NM2A 3ETMA 2PDAA 5CABA 3Q23A 2BKPA 1DTTB 4CLFA 1S9GB 2UUCJ 3D67A 2BJ3A 1D3WA 4DV0F 1BQMA 3OHBA 4C8LA 4TLRA 3IXQA 1RJJA 2BZ2A 4PZVA 4C97A 1VRTB 5B0DA 2ZBPA 1GH8A 2QL7B 2GMHA 1SCJB 4ES3A 3M2UA 4GO5X 3Q8YA 1MMDA 4CQ1A 2VF3A 2WTFA 1KQGB 5FLXU 3LAKA 4HDGA 3V4MA 1B0PA 1SJ4P 2XMAA 3M8PA 1IBMF 2L08A 4HH0A 4J9UE 4CZCA 1M1KT 4NCAA 4FF3A 2F3JA 2FB0A 1EARA 1WUUA 1IBLF 5DGBA 3MECA 4KKOA 2EFPA 4P9SA 4E0DA 2J7KA 1SBRA 2LQ5A 1URRA 2KO1A 2Q1LA 2AZ1A 4HR2A 4A4JA 4H4MA 2F4FA 1L3UA 2E1CA 3D66A 2PA8D 4YHHF 5D3GB 2HHQA 1U0HA 1YSJA 1HHSA 4QWBA 2QA2A 2CNOB 1TMJA 2KN4A 2WW4A 3E01A 4LSLA 4B17A 4B08A 2MYFA 1FKOA 3A8IA 3O5TB 5HMWA 1EP4A 4ECZA 1KVIA 1WEYA 4KHMA 4LQ3A 2FVCA 3NMAA 2LDYA 3JTNA 4I7FA 1UKUA 1FD2A 4UQGA 3IBCB 1FX2A 1HNIA 2BE2B 2XNQA 4NMLA 4IOAQ 3PEHA 5LL6d 2PSZA 2SXLA 5K20B 3LGHA 4FYWB 3TA0A 3WQPA 2HHHJ 1JXLA 3BGRA 3OLAA 3PIPQ 3BGRB 2HHUA 1IR0A 1UETA 3CJKA 4ZVPB 5KFQA 5KAKA 5D15A 1TZ0A 4LF4J 3MEGA 4TN2A 5AE2A 3BJYA 2YWFA 5KFNA 1SC3B 4LRBA 3DLEB 1IQZA 1CS4A 1YZ7A 4XPEA 1G6BA 1Y0HA 2IA6A 2YNIA 2DIVA 1XMBA 3IGNA 1UZDA 2QFIA 1H6KX 3ZZYA 3DKDA 2XLIA 2B7CB 2UVUA 2NXNA 2CVEA 4ILLA 4JP8A 1YWXA 3DU6A 4QIFA 3GG0A 4ZPCA 5M2RA 4BLGA 2VFTA 4ED8A 1EQ0A 3CCUS 4DL5A 1S59A 2D3O1 2VKZG 3TJ8A 1VBXA 1X60A 4U8VA 4F8RA 3GWCA 5KT6A 2HFUA 2K2PA 5CCLA 2H65B 5FDLA 1S9EB 3QNWB 4OJHA 3SQGA 3VAJA 1FD8A 1SJ3P 4PWWA 1F3VA 4B9VA 3HKWA 4F36A 2ABYA 4GRSA 5ETOA 3V4IB 4LF7F 5F8GA 2G9OA 3G71S 3R6LB 4J90A 1HR0J 4M95A 1TUVA 1NSQA 2VA3A 3ONQA 5L8RC 4NLVA 1X4GA 1LWCA 1T02A 2HNDB 2AJ2A 3E51A 5A6WA 3W60A 3UNYA 1RHQB 2FIUA 4B9MA 1WDDA 2K3KA 3LO3A 3MXHP 2FGOA 2H51B 2B3TB 4LSNA 3GV8B 2PT0A 2KRBA 1U1PA 3K5NA 3UNGC 1O5JA 1RWXB 4F4KA 4K2JA 2K06A 3OFFA 6FD1A 2R4FA 3DRPB 4OYBA 5THWA 3Q0AA 2A2CA 1BUXA 1MN9A 4JI6F 5KT4A 4X62F 1CPZA 3HHNB 4DR4J 4FBTA 1XBWA 3DXSX 1U45A 4X4VA 5AXLA 2HBZB 3OD2A 1RTDA 2LDIA 3I96A 4JI3J 1WHWA 1HL6A 4NCBA 4DV5F 4DUYF 2AJFE 2DGSA 4NL5A 1F0XA 1HWUA 4KSEB 2NPIA 5CCMA 3C3LA 1DQ9A 3W5YA 3KHLA 2H1YA 2YPYA 4P52A 3P8BB 4Y2MA 2H54B 2IA0A 2CDQA 2F5GA 2P2CB 3D3CJ 3JXOA 4L73A 4LR9A 1JWWA 3C16B 2UUAJ 2HVIA 4YB7A 4F0MA 2B56A 4JYAJ 4LR8A 3W1YC 3DOKB 4DX6A 1VQNS 4C8NA 4B3OA 4B3RJ 1VQPS 2MDAA 3M05A 5LSLA 2V8HA 3B54A 1LWCB 5FD1A 5AXMA 4A8MP 1NUEA 1JMTA 1HBOB 4IH5A 3Q8RB 1RWOB 4DUTA 2GCFA 1W7WA 2XMTA 4QW8A 1XQIA 2KHDA 3MECB 4KKOB 3DRYA 1F2GA 1JLGA 4B9NA 3BDEA 9ATCB 1FWKA 2CQIA 2HKEA 2Y1LB 3FMWA 4KV8A 3JSBA 3PRBA 1WI8A 2XMWA 3CSKA 4HEA9 4F50A 5IT9U 4IG3B 3BR8A 2MKIA 4YFUA 3F44A 2DH7A 3RYLA 1J5EJ 1RTJA 1QE1B 2C3UA 2GNKA 2HBQB 3EMTA 3FSYA 1UJ4A 2HLUA 2OUGA 3C15A 4DLEA 2IRUA 4I7FB 2X3GA 3GIJA 1C4CA 1VBKA 2BKOA 2R8GA 5CAAA 2HSEB 3KUEA 4CO3A 2IBKA 2C2EA 2N4CA 1HI1A 3CTRA 4Y6IA 1WKKA 2VBZA 1OWXA 2DTJA 2JC0A 1RWVB 1RT4B 1TKTB 3V6DA 1U4BA 2GVDA 5ETKA 2RUSA 5IS2A 2FJBB 2DXFA 2JHEA 1OSDA 3GFHA 2WOMB 3CJKB 2M88A 3ZNJ1 1WTFA 1FJGF 3S1TA 1RE1B 1VQOS 4EUVA 1RTHB 5A8RB 1FVQA 4RUBA 2GGPB 4B9UA 4RW9A 4CO5A 2FC9A 3OLBA 1X0FA 1HHTP 2DNNA 4ZLLA 1VC6A 4PPDA 3ZFVA 3JQJA 4LSZB 4DSLA 2DY9A 3CO9A 3R5DA 2K7JA 3C6UA 3EPIA 5HATA 2GS8A 1LEOA 3GP9A 3CULA 4RW6A 4RW6B 3U1LA 2WSEC 3IAS9 1AB8A 2HBYB 2UUTA 4YN3B 4R8UB 5LOQA 2W2NP 2WCXA 3D0GE 2N4DA 1S1WB 2VPWB 4CNZA 2BEFA 2D41A 7FDRA 1K9MT 3K89A 3CCLS 4O3RA 5HQMA 5GAGI 2B6AA 1FK9A 1P27B 2MQNA 2QMWA 4CCHA 1YVFA 4WXOA 1SV5A 4O23A 3MM8A 3FDSA 3J7YI 2MJNA 2UXBJ 4OZ1A 2VG5B 3TX8A 3PEJA 4UT4A 4F4AA 5C25B 5IQ6A 2J9DE 3E2EA 3FBBA 2FPHX 4F67A 2M52A 3BS9A 2VOOA 1RADB 3OV7A 3GIMA 1JLEB 2HHHF 1VQ6S 4NXNF 2KZMA 3FGVA 1NSKL 1WOSA 3Q8SB 2O3DA 4F3MA 1IBLJ 4QU6A 2CFXA 2IC3B 2QZ8A 3I4HX 4KAIA 2J76E 5B0CA 1NDLA 1M90T 4USTA 1VIOA 2BJ1A 3QMQA 4K0KF 2MZTA 2Z2MA 3B4MA 4ED6A 5I3UA 4R5PB 4RU2A 2HHSA 2QL5B 3Q89A 1LWFB 2DYAA 1AT1B 1DTQB 3JSMB 1CJKA 1CEZA 3BPDA 1TVRA 2W7AA 4USWA 3SSSA 5EX3A 4OZ0A 5DG9A 2DGTA 3U1MA 1CQNA 3F41A 3TVYA 1MROB 3N5FA 1MROA 4KPCA 2VJUA 3IS9A 1VQ9S 2JDJA 1RBAA 1KSPA 2DXDA 2FD2A 4PG4A 2V2VA 3EWGA 1S72S 2AZ3A 2CVIA 1C0TA 2NZCA 1LNQA 2BBEA 1ZPWX 4FKYA 4ED3A 2DNZA 1DFDA 1VQSA 5DLFA 2H48B 3TAMA 3R2CJ 1XWLA 2LA6A 1DQ8A 2R7XA 4A47A 5CZVA 3KMQA 4DV3J 1IN0A 5A8KB 2ADBA 1WF2A 5HN0A 1P9QC 2OJ3A 2RAQA 1Z1ZA 3DMJB 5L9XA 1Q8IA 2RDDA 2FLOA 2E5JA 4FXVA 4GVLA 2DR7A 3I31A 2OPPB 2R7RA 1RLCL 1RT5A 1SVDA 2RH3A 4ANDA 2O5DA 2IC3A 4UUWA 4ETZA 1S0VA 5K8PA 3VGSA 3EXCX 3SDEB 3MCSA 2CPFA 3QBCA 2ATLA 2AQ4A 3KLGA 3NKYA 2V8DA 2KXHA 2CQCA 4KRWA 4USUA 1JJCB 2P9GA 3H2VE 1LW0A 3S8SA 3GE9A 3QFHA 2GZOA 3N28A 5LSRA 1UEKA 1UP1A 2YWKA 3EGNA 3PDNA 4JV2A 2MLZA 1W26A 3T6JA 1F6TA 3GMGA 2OKQA 3RJMB 5JVGQ 4HACA 4P2XA 1X5TA 4X84A 3IR6B 1V5VA 1HQEA 2CPDA 4IFYB 1C1CA 1R8BA 2JWNA 2XZDB 1Y10A 4L6V3 5D0EA 3M9OB 4DV4J 4K5RA 4ZVUB 4ED7A 4TU9A 3OJSA 2AJ1A 4ZDNA 4DV3F 3V81B 1KTVA 2E29A 3EZOA 3T9NA 3G8SA 1NK5A 2RU9A 3DGVA 3SFGA 1S9FA 2EKYA 2GQQA 1NEEA 5D0HA 4DPOA 3MCMA 4JV0A 1XN9A 1HQUA 1GX5A 2HQFA 3BYRA 2HS0A 1RLDA 3H2LA 1K1SA 4P2FA 1RKJA 3TJAA 1JIHA 1X0PA 4DUYJ 1OO0B 2DHAA 2F1FA 3ZZUA 4C0BA 4R0EA 3MUMP 2AIRB 2DISA 3U7JA 5E7OB 2QGFB 3QLHA 4OZNA 4DR5F 1SJRA 5BYQA 4CTAA 2I5JA 2UV8A 1NBEB 3N79A 2FZCB 1PJ6A 5GMDA 3W5ZA 4EU0A 2W9CB 5LMUF 5L9NA 5I42A 4DN9A 1XMQF 3AJ2A 2MKJA 1IM4A 2K1RA 4AL6A 2OO4A 2X3DA 3ADAC 4XDDA 1RYSA 3B4DA 4AXIA 2BM0A 2JL9A 2WZ1A 1FRKA 1TL7A 2VL1A 1B7YB 4FYXB 5E41A 2CA9A 1N5YB 1IXKA 3DYAB 4NLYA 2PGCA 4U6PA 4U95A 1M5VC 3M30A 2XWXA 1N6QB 4JUZA 4WFXA 3IG1B 3UI3A 3KJVA 5AT1B 5HP1B 5HLFA 3G9CA 5IM0A 4LBHA 1CVJA 3KNAA 4DZ6A 3TYTA 1T8EA 3BV8A 4KGZB 4V1Ak 1GXUA 5KG1A 5DG8A 5E0OA 2BJ8A 4Y00A 2D1CA 2UXDF 2DR5A 5IC4B 2KFZA 2A2DA 2KZZA 4C7QA 2Y8YA 3KLFA 1FI4A 2FTRA 5F9NA 3NGDA 2Q43A 4C3KA 2ZUAA 1YKWA 2HEKA 3MAAB 4MKVA 4DFKA 2DNRA 3FFIA 4ZPTR 3GSIA 4ZVRB 3D54A 3DHXA 2V9WA 3NAHA 2VIHA 3IBFB 2B4OA 3JS9A 5KFAA 2BOAA 2BW2A 1BQMB 3L7UA 2H5JB 3MEEA 3N6MA 4MFBA 2BABA 2HYIB 4F2SA 4FZVA 2MZSA 1RWWB 4Q43A 2YKNA 4DR5J 4A8OA 4K4SA 4PWUA 3U27A 5C42A 4IO9Q 4DQRA 4ED2A 4C0HA 2DNGA 3NLCA 3ILOA 2MQQA 2J0QD 2ZHOA 4NOHA 2R2TA 5AJ3J 1HW8A 3ZC4A 3MD3A 2PFDA 2DPJA 4DR6J 1PAEX 2MKHA 3CJQA 1WNEA 4AE5A 3SCLE 3E3XA 3CJRA 4C98A 4YB1P 4ETXA 1TKZA 4L76A 2PI5A 3D6HB 2DHHA 4HH1A 2QJ3A 5K8OA 2QMUB 4KGXB 5CYMB 2XCPA 4DU7A 1NB2A 2BQ3A 4IH7A 3W9IA 3Q22A 1EKRA 1S0MA 2VU5A 1RDRA 3MMBB 3MMBA 4DV7J 5CH7B 2DGXA 2VZ9A 2HNDA 3GZ7A 1LK7A 2QYCA 5IWAF 2V2ZA 3OTDA 4HT7A 4ALZA 2Q6CA 3VGVA 4XO0A 3OUYA 5BYSA 1T9XA 2UUBJ 1HBMB 4DS5A 3KLEA 4KHRA 2KT5A 1RYRA 2LLZA 1KLMB 2WVFA 3NY0A 2BX6A 5IM0B 1JJHA 2HVDA 4JI0J 2YWEA 5DGAA 4A8YA 1RP5A 4RW7B 3TR5A 3I0RA 1CJUB 2GFFA 3M1VB 3M2UB 1VQKS 3OXLA 2HAFA 1I1GA 3AODA 3P5TL 3D0IE 1S10A 2EI5A 4USJC 2U1AA 2OFGX 4DR4F 1WWHA 5LMNF 1PAUB 4DV2J 3M6UA 2ZITA 3AJ1A 1EETB 2W4DA 4YB5A 3SZ2A 1FNXH 3Q86A 2VHGA 3RRGA 2BVZA 3N4WA 2BJEA 3QT8A 2ROGA 4P71A 3TQ1A 1VJQA 4DSKA 3PNIA 3HVWA 5KT7A 4ZA1A 1S76D 3AHPA 2I1RA 3CCWA 2DKOB 1VDHA 2W4CA 2DVIA 2A6OA 1NU4A 1U48A 2FHJA 3LANA 2LKZA 2CQ0A 3QT6A 4F7VA 2O67A 1K44A 3DLBA 1AFIA 1PG5B 1S6QA 1KLNA 1HWKA 5KFPA 3EYZA 3TVZA 1M5KC 2AGPA 5J2PB 1JB0C 3HSGA 3RR7A 1FDBA 2BANA 2BYCA 3PJ9A 4J9SA 1T9UA 2RILA 5A8WA 2MKKA 2ASJA 1S79A 3CCVS 1N5YA 2RRAA 1ZYQA 4EBEA 1HNVB 4TXSA 2EC0A 4CLPA 2KJVA 1NXIA 2EK6A 4H4OB 4YDDB 1NAQA 1IKVA 2AYBA 4HDHA 5J2MA 3QT5A 2ATCB 3NS6A 2UUBF 2HRUA 4QIWD 3IBWA 4R25A 2Y8WA 5BXIA 1YLXA 5HMZA 1U6FA 5KFGA 1UVJA 2C3MA 3P4UB 1M1GA 3NCRA 1WKLA 2RKIB 2HRYA 2XSFA 4WU2A 3A8JA 3QAUA 1GMWD 3TAQA 2GW8A 3H0PA 2E9RX 1FRLA 4NA1A 4WK3A 5K14A 3RU0A 4NZ6A 4ILMA 4L72B 4OIXA 5HVFA 4ZITA 4TU8A 1H74A 2KU7A 2ZVIA 4DV6F 4C6AA 3V6KA 2KYZA 1AUSL 2B4UA 2OEJA 4NLTA 5B0EA 2LP4A 2W01A 2Y9HA 2ZFHA 1S9EA 3M8WA 1MU2B 3UN5A 3MEDB 4LF6J 1FESA 5I3QA 4J9OA 5ETLA 1OS5A 4ZCLA 2IFXA 3H59A 5J2QB 1WG1A 4PQAA 1X4EA 3H25A 2CQPA 1QTNB 1N0VC 1YJ7A 2G2OA 3DLKA 5EWEA 4PCQA 2XGPA 1RHMB 3J7YU 1LWXA 1V3ZA 3GJRB 4WKYA 3Q24A 2OELA 4KQZA 4HVZA 1B99A 5KFWA 1S12A 1F3FA 5KOXA 3PJXA 4RNFA 2RU3A 1IKXA 2XMMA 1JLAB 2A6MA 2NXCA 4CLTA 2E9TA 3EGWB 3PKMA 2FLNA 2CAJA 1NK9A 4TY8A 3CUNA 2RT3A 2ZE2A 3T19A 4GC6A 1CC7A 4W98A 3R8YA 4ANCA 3FUYA 4K7QA 4NYOA 2DHXA 1RT1B 1P1TA 1U09A 1FCAA 1N54B 3D1HA 1QJHA 4LJMA 4NZ0A 3OT9A 4B9LA 1LW0B 2C3OA 2AHOB 3D68A 2NR0A 2CQ1A 1NKEA 3RBXA 1SV5B 1VJWA 2B9XA 3T1YF 2UUAF 1KKHA 1U26A 2W1BA 3IRWP 4EYHB 3SCJE 4X4UA 1PO6A 1OY9A 5LXYA 3Q2SC 2HNYB 1S1XB 1UVLA 1S99A 1BD6A 2BQRA 1EKSA 2B7BB 2WK4A 3DOLB 2CJBA 3PX4A 5KFBA 2CJ9A 4TYAA 1SIWB 3QGHA 5C5JA 4X4OA 3R2DJ 2V8VA 5A0YB 1X8DA 2Z0GA 4QBUA 3JSMA 2ZDPA 1RHUB 1FJEB 4G6VB 1YJTA 1HQUB 3TVKA 1ELOA 4DL3A 4M5MA 1MG7A 1PYSB 5KG7A 1S4EA 1NRKA 3NOGA 1X4AA 3KG0A 1JLQB 1TK8A 3KJFB 2D9PA 4YR3A 4LFCF 3ZZOA 3IO1A 3GONA 2C2RA 3DRSB 1FFSB
chains in the Genus database with same CATH topology
3P45B 2DKOB 3QNWB 3R7SB 2XZTB 2XYHB 1BMQB 2QLFB 2H4YB 3R6LB 3NS7B 1F9EB 2C1EB 1RHRB 3EDRB 2XYPB 1RHQB 3R7BB 2QL9B 1RHJB 1QDUB 2H51B 2C2OB 1RWXB 4DCJB 1RWMB 2C2ZB 1SC1B 3P4UB 3GJSB 2HBZB 3KJNB 5IC4B 2FQQB 2QL5B 3R7NB 1I3OB 1GFWB 2QLJB 3R5JB 3KJQB 4ZVSB 2CNKB 2HBRB 2H4WB 3GJQB 2CNNB 2H54B 2P2CB 4ZVRB 4JB8B 2C2KB 3IBFB 1I51B 2CJYB 2H5JB 1IBCB 4ZVTB 1RWWB 2C2MB 2QL7B 1QTNB 3SIPB 1RHMB 3GJRB 2H48B 2QLBB 1RWOB 2Y0BB 1PYOB 2XYGB 3R6GB 4ZVOB 2CJXB 2Y1LB 3D6HB 1RHKB 2H5IB 2CNOB 2HBQB 3EDQB 3IBCB 2CDRB 1RWKB 4ZVQB 5K20B 1RWVB 3RJMB 2CNLB 1RWNB 4ZVPB 2XZDB 1RE1B 1SC3B 4ZVUB 4DCPB 3D6MB 1ICEB 5IC6B 1RWPB 4LSZB 1PAUB 1RHUB 1NMEB 3GJTB 2HBYB 4DCOB 3D6FB 3KJFB 2H65B 1SC4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P45 B;  2DKO B;  3QNW B;  3R7S B;  2XZT B;  2XYH B;  1BMQ B;  2QLF B;  2H4Y B;  3R6L B;  3NS7 B;  1F9E B;  2C1E B;  1RHR B;  3EDR B;  2XYP B;  1RHQ B;  3R7B B;  2QL9 B;  1RHJ B;  1QDU B;  2H51 B;  2C2O B;  1RWX B;  4DCJ B;  1RWM B;  2C2Z B;  1SC1 B;  3P4U B;  3GJS B;  2HBZ B;  3KJN B;  5IC4 B;  2FQQ B;  2QL5 B;  3R7N B;  1I3O B;  1GFW B;  2QLJ B;  3R5J B;  3KJQ B;  4ZVS B;  2CNK B;  2HBR B;  2H4W B;  3GJQ B;  2CNN B;  2H54 B;  2P2C B;  4ZVR B;  4JB8 B;  2C2K B;  3IBF B;  1I51 B;  2CJY B;  2H5J B;  1IBC B;  4ZVT B;  1RWW B;  2C2M B;  2QL7 B;  1QTN B;  3SIP B;  1RHM B;  3GJR B;  2H48 B;  2QLB B;  1RWO B;  2Y0B B;  1PYO B;  2XYG B;  3R6G B;  4ZVO B;  2CJX B;  2Y1L B;  3D6H B;  1RHK B;  2H5I B;  2CNO B;  2HBQ B;  3EDQ B;  3IBC B;  2CDR B;  1RWK B;  4ZVQ B;  5K20 B;  1RWV B;  3RJM B;  2CNL B;  1RWN B;  4ZVP B;  2XZD B;  1RE1 B;  1SC3 B;  4ZVU B;  4DCP B;  3D6M B;  1ICE B;  5IC6 B;  1RWP B;  4LSZ B;  1PAU B;  1RHU B;  1NME B;  3GJT B;  2HBY B;  4DCO B;  3D6F B;  3KJF B;  2H65 B;  1SC4 B; 
#chains in the Genus database with same CATH topology
 3KDN A;  1DTT A;  1TK0 A;  4WE1 A;  2D7S A;  4GMK A;  2KM8 C;  3K5L A;  2AEJ A;  3KLI A;  3H5Y A;  4C8O A;  4PQU A;  1GEH A;  5JUM A;  2IMW P;  1X5S A;  3EGV A;  4AD6 A;  3GR1 A;  5EX0 A;  3QWU A;  1D0E A;  4DV0 J;  3FKB A;  2B5J A;  2GHP A;  5KOW A;  1RHR B;  3EDR B;  2QRR A;  2EPI A;  4RO0 A;  3PKY A;  5HMX A;  4IRD A;  4YME A;  1N5S A;  3QJL A;  1P9Y A;  2VV5 A;  5A2Q U;  2M9K A;  2ZBQ A;  2AX1 A;  2ASL A;  2LXF A;  3AOA A;  2XBP A;  3MMA A;  2DRB A;  2MHN A;  1C2P A;  4X65 F;  3OTC A;  1WHX A;  4WFZ A;  2PD1 A;  4CO4 A;  4AQY F;  1JXV A;  1WC3 A;  2NXJ A;  2XMU A;  2Z58 B;  3KMS A;  3CIZ A;  2BAC A;  4JI0 F;  3VCD A;  2GV1 A;  4FP9 A;  3QT7 A;  2YY3 A;  3KK1 B;  3M8S A;  2DNO A;  2ZH5 A;  5DDR C;  4H54 A;  1U0S A;  1XR7 A;  2CQ4 A;  2PO4 A;  5HRO B;  4X64 F;  1VHF A;  2C3P A;  2WVC A;  4ZIV A;  1S49 A;  3LQV A;  3MR5 A;  2HRT A;  2QLJ B;  4CO0 A;  2QFJ A;  4QWD A;  4OFZ A;  2DJW A;  2J9C A;  3GV5 B;  1AUD A;  3CCS S;  4DV7 F;  1PYT A;  2DNY A;  1HLW A;  1RAA B;  1RZM A;  2CZ4 A;  4LMZ A;  8RUC A;  4JI1 J;  3FFI B;  3KDO A;  5IWA J;  1SI9 A;  3RAQ A;  3JSR A;  4I0W A;  2C2K B;  4I67 A;  1Q86 T;  4OLO A;  1ZA1 B;  3VAM A;  2VD3 A;  4DR3 J;  3IS9 B;  5IT9 Y;  3AH6 A;  4MFB B;  4CLL A;  4CIO A;  2DEJ A;  2MZR A;  2QT7 A;  3KUH A;  4ZVT B;  1N36 F;  4U9R A;  2B8P A;  4EZ6 A;  1FRI A;  2C2M B;  1F5B A;  3A8K A;  4ED4 A;  4FYY B;  4QU7 A;  2WBM A;  1QAY A;  3R3T A;  5L1J A;  1CUL B;  1YX2 A;  3ICL A;  4XAK A;  1FTR A;  1WDT A;  2XSJ B;  1T94 A;  3Q8U A;  2DCL A;  3I82 A;  5E3Q A;  4O3Q A;  1N52 B;  5T41 A;  2HMI A;  1TL1 A;  1TMM A;  4WYL A;  2CQH A;  1WSR A;  2RB7 A;  5E3C A;  3ZZT A;  2ZJR Q;  3SFU A;  3W3S A;  3MM5 A;  2IYI A;  4L3N A;  3OSN A;  2CJK A;  3IR7 B;  4O3O A;  2M7S A;  2LEB A;  4B9S A;  1URN A;  2B8Q A;  4B3T F;  4TU7 A;  4ZLJ A;  2LQB A;  2MEW A;  3RB3 A;  2VDH A;  1RT1 A;  4Y28 C;  3T5K A;  4DPX A;  4NEY A;  4WP9 A;  1ZPV A;  3O3L A;  2BXJ A;  4FF1 A;  3CCQ S;  3GU0 A;  4TY9 A;  2ZHA A;  2IM0 A;  3CJ8 A;  2XLK A;  4JI8 J;  2MZ1 A;  2PII A;  2XQC A;  2R7S A;  3RZA A;  3G6V A;  5T14 A;  3JAM Y;  3JSY A;  5GAE U;  2D3U A;  3C14 A;  3MM7 A;  1OYD A;  4DV6 J;  2OHD A;  4I69 A;  5H9E J;  1S0O A;  5D4P A;  1NK0 A;  4JI6 J;  3BH7 B;  3HP6 A;  4UOH A;  4XIU A;  4RNO A;  3POT A;  4JI1 F;  1PBU A;  4F4Y A;  5KFC A;  3VZH A;  2B9W A;  3FCH A;  4UW2 A;  2GX8 A;  4LF6 F;  2Y1R I;  2FVQ A;  1REG X;  1C4A A;  2AJ4 A;  2RRB A;  3OXG A;  3W5X A;  4DF4 A;  1R8A A;  2FUG 9;  4MK9 A;  3Q8P B;  1SKR A;  3BSA A;  4ZN3 A;  4IFV A;  3VVT A;  2V8G A;  4IFV B;  4CLU A;  2RQK A;  1TV6 B;  2H5E A;  2K8G A;  3CCM S;  2KL8 A;  3IGV A;  1NME B;  5E3A A;  4U7U K;  1NJX A;  2JLG A;  1YDL A;  4OHV A;  2MY7 A;  4X4R A;  2HG4 A;  4UZB A;  4KTQ A;  3DC2 A;  2IMO A;  3LP1 B;  1HBU B;  4NRT A;  4Y65 A;  2K7K A;  1BE4 A;  2KG1 A;  2AD9 A;  1HI0 P;  3T5H A;  4YQW A;  3BO3 A;  4GC7 A;  1K8A T;  3QJJ A;  1NND A;  4L75 A;  2RQ4 A;  2LXU A;  3DFE A;  5H9F K;  4OX7 A;  3AXK A;  1KTQ A;  3ZO7 A;  3UCG A;  1X9W A;  2H4Y B;  1T03 A;  3C2P A;  3NS7 B;  1GMW A;  3W61 A;  1RXO B;  5D78 A;  5ETP A;  2GO8 A;  4N56 A;  2W7P A;  4MYT A;  1X4C A;  1AXQ A;  5E3P A;  4KB7 A;  2IHR 1;  2BR0 A;  2HFO A;  2IJR A;  5HP1 A;  3TAR A;  1AZS A;  3KJV B;  1B0V A;  1Y11 A;  4OJG A;  3VQT A;  4ECT A;  4DCJ B;  1WEX A;  3KK3 B;  5DG7 A;  1GTH A;  5HAO A;  5ETS A;  4IG0 B;  4EGL A;  2HIY A;  3T1H J;  4PAB A;  4OLP A;  3UD3 P;  2HNZ A;  4IG3 A;  4IOC Q;  1MWQ A;  2YH0 A;  4MJK A;  4QIG A;  1H7X A;  5IZH A;  3K17 A;  2MPU A;  1JKH B;  1IR2 A;  1WD6 A;  1S5Z A;  3E01 B;  2FQQ B;  2GJF A;  4FNI A;  4YEA A;  3PR4 A;  3RAX A;  3R27 A;  1EAY C;  1RT6 B;  2K3I A;  3GB0 A;  2FGC A;  3M7V A;  3K8V A;  2CNK B;  2KVQ E;  4M5H A;  3LP2 B;  4R8U A;  2OLW A;  5KFM A;  2W2Q P;  2H4W B;  2BMB A;  4C3M A;  3MZI A;  1VOM A;  2VH7 A;  5FDL B;  2IM2 A;  2Z2Y B;  4JB8 B;  4OI3 A;  1NKC A;  4URG A;  1FJC A;  4LBI A;  4RW8 B;  2EFV A;  6AT1 B;  2W2P P;  4B3O B;  2CIM A;  3OFE A;  2I38 A;  3TRG A;  2QA4 S;  4GKJ J;  3TZW A;  4DMZ A;  4M1K A;  2M70 A;  4RW9 B;  1FWP A;  3I0R B;  4HTI A;  2IM3 A;  3KHG A;  2RSQ A;  5C24 A;  3FZ2 A;  3TO8 A;  2R2U A;  3CO0 P;  5CD4 A;  1HW9 A;  2D3Z A;  3ZTP A;  2VPX B;  3BH6 B;  3GCW P;  4OJ3 A;  4ZVO B;  3TZY A;  1ZAV A;  2X51 A;  3BGU A;  3L4B C;  2DR9 A;  2VDI A;  3LW5 C;  5B0F A;  5JXS A;  4Q8E A;  4J9K A;  4JI3 F;  2ZE2 B;  1Y5I B;  1FDN A;  4CM0 A;  2PMW A;  2ROE A;  3AXM A;  3ENW A;  4LRA A;  4AYB D;  3TZZ A;  2D9O A;  1QE1 A;  3DHW C;  1RBL A;  3FEZ A;  1AYE A;  3AQO A;  1YTY A;  3J7A 1;  2E5L J;  1WF0 A;  3OL6 A;  3W65 A;  4J9M A;  5KFF A;  2G4B A;  4M94 A;  1X9M A;  3H8Y A;  3H5U A;  4NXM J;  2LVW A;  3RUB L;  4X4T A;  2ZH4 A;  4YY3 J;  1YIT S;  3RBZ A;  3W7B A;  4WFY A;  4J37 A;  1RT3 B;  2PEH A;  1LKZ A;  1Y3K A;  3I4P A;  1ZZF A;  3MD1 A;  2PN6 A;  4F4Z A;  2VA2 A;  4OMF G;  4RW8 A;  2LU1 A;  2X7I A;  3W8P A;  4AQY J;  2NQP A;  2N7Y A;  3DDN A;  4NX9 A;  2HQD A;  2YKN B;  4RUA A;  1RGV A;  4P7T A;  2HNZ B;  3UQS A;  4DSE A;  4OJ1 A;  4WFN Q;  3CC2 S;  2XG8 A;  3PO4 A;  3HSD A;  3BF4 A;  3BSO A;  3BPS P;  4Q2L A;  2Q6B A;  3THT A;  3V6H A;  3T9Z A;  5K14 B;  1NK6 A;  1SKU B;  1LWF A;  4NZ7 A;  5GAG U;  3FMB A;  1SJQ A;  4QR1 A;  4YHH J;  1T9T A;  2MKY A;  2XTJ P;  4ED0 A;  2XMJ A;  4EO8 A;  3PX0 A;  3AAW B;  4U96 A;  5DJB A;  1WJ9 A;  2R3V A;  1T05 A;  3S7R A;  1ZM3 A;  2HAI A;  2V5H G;  3WIV A;  2HZV A;  1PYO B;  2DNP A;  2OML A;  5KG3 A;  3W66 A;  2YQ1 A;  4UUX A;  5KFI A;  3QGP A;  3OR2 B;  3R5G A;  1VQ4 S;  4A8F A;  8AT1 B;  1SKW A;  1IKW A;  4QR0 A;  2NYH A;  3S6E A;  1D8Y A;  3PCO B;  3IWX A;  5KFO A;  1BMQ B;  1FA0 A;  2OPS A;  2DPI A;  4FF2 A;  4UOC A;  1PC5 A;  2CPX A;  1IBM J;  3NWG A;  4NLD A;  3BQ0 A;  3CWJ A;  2B5J B;  1KHV A;  4LF9 J;  4IUF A;  2YWG A;  4G1I A;  2BAN B;  2ASY A;  4OHW A;  5C25 A;  5CXT A;  3CDB A;  4OI2 A;  2AP6 A;  1RT4 A;  1TKT A;  3QID A;  3V6D B;  1FJG J;  5F9L A;  1R7I A;  1NH7 A;  4FKX A;  4MH8 A;  4NXM F;  4MMO A;  1YQH A;  2AEF A;  4E2F B;  4CH7 A;  1TKX A;  2AKW B;  4ZS6 A;  3UDV A;  3K5O A;  1FNO A;  5KFZ A;  1V3S A;  1WEZ A;  4Z7Y A;  2N3O A;  1FKP B;  2R7O A;  3M6V A;  4QQB A;  2Z2Z A;  2LCW A;  2DXE A;  4OX6 A;  1RU1 A;  1OPZ A;  1VS3 A;  3HHL A;  3IMQ J;  3OL8 A;  2IVF B;  1FJ7 A;  5KG5 A;  4DI6 A;  4ZP8 A;  4BWM A;  3LP0 A;  1N33 J;  1EJ7 L;  4ICL A;  4Q45 A;  3JQM A;  3RRH A;  3R7N B;  4NLU A;  3KKF A;  3KJQ B;  2L9D A;  4Y2K A;  3EIC A;  4QWA A;  2XY7 A;  1LW2 B;  3I55 S;  5LMN J;  3PAC A;  3LP2 A;  2YNF A;  4USH A;  2GA7 A;  1TVR B;  1HNZ J;  1S1W A;  1NHV A;  4X4Q A;  5AXN A;  1RT3 A;  3SV4 A;  2HLT A;  3NMR A;  3MED A;  1I51 B;  1WEL A;  1YGY A;  1RAH B;  2WW8 A;  3OVS A;  4K2X A;  1B70 B;  4MKA A;  4JV5 J;  4M5G A;  1JLC B;  3FBE A;  4O44 A;  4FYD A;  3DLE A;  2FVP A;  1LFP A;  2HHX A;  4P2M A;  2VC1 A;  3B6B A;  5KG4 A;  5D4L A;  2G0J A;  2VQE J;  3SIP B;  4BC9 A;  3MAQ A;  2JEI A;  2HHV A;  2A18 A;  2ACM A;  4IDK A;  2GIF A;  4ZVH A;  2NPF A;  1X4D A;  4ZMM A;  2Y0B B;  5KFE A;  4ZJL A;  3TW0 A;  1BWV A;  1DLO B;  3R6G B;  4F25 A;  5HLF B;  3RR8 A;  4QZV B;  5DLG A;  1RAE B;  2JNJ A;  5DDP C;  4DFM A;  1ZA2 B;  1NHK L;  2VPZ B;  1JJ2 R;  2AF6 A;  2A3J A;  2ZEJ A;  5HMY A;  7FD1 A;  4DJB A;  2XLJ A;  3DRS A;  2OH2 A;  1RHK B;  1YRT A;  3BBC A;  5GAE I;  3AFG A;  4HI1 A;  1UJ6 A;  1T9W A;  4C8Z A;  4WIQ A;  4C2M A;  1RIS A;  3QIP A;  1HNW J;  2ZBC A;  3A3P B;  3W2W B;  2XS2 A;  1LWE B;  5HQL A;  4MYU A;  4WKR A;  2C3Y A;  4EWT A;  3J7A N;  1RT7 A;  1RWK B;  2WB4 A;  2XHW A;  2P9E A;  2W2M P;  2YNF B;  3BR9 A;  3MMC B;  5DET A;  3JQK A;  2NUH A;  1LFW A;  2VBY A;  3LPY A;  4WBF A;  2RDI A;  5EGY A;  1WSV A;  1N8R T;  3O8W A;  2ZKU A;  3L09 A;  3QJP A;  4JI2 F;  3GV7 B;  1XC9 A;  1N56 A;  1MU2 A;  3VAF A;  5JJB A;  1RTZ A;  1MWY A;  4HI2 A;  3DOM B;  1T9V A;  3ET6 B;  5IOL A;  4A48 A;  5IT0 A;  3VV2 B;  1CJV B;  1VI7 A;  2JH3 A;  2RS8 A;  3DLG A;  1CJU A;  2D69 A;  2JRS A;  1TL4 A;  1DHM A;  2L3M A;  3AA8 A;  3ENV A;  3FC9 A;  3M1V A;  3NG8 A;  4OZ5 A;  3GII A;  3TAP A;  1X4H A;  1XK8 A;  5A0Y A;  3SV3 A;  4JV5 F;  2QG9 B;  1Q79 A;  3MM6 A;  3NAI A;  1PBA A;  1GMU A;  2XWY A;  3GYN A;  1L5U A;  1P6T A;  2B0G A;  2DGW A;  3D9B A;  3KLF B;  1X4B A;  5IV4 A;  2ZH7 A;  1FRX A;  2CKW A;  4LVO P;  1NZ8 A;  1YG0 A;  1W25 A;  4MIA A;  3T1A A;  3VTI A;  3W9H A;  4FVM A;  4ERD A;  5D6G A;  3EZU A;  1MN7 A;  4ED5 A;  2R8H A;  2PFF B;  2DR6 A;  2MMY A;  1HPZ B;  2XO7 A;  2KDO A;  3NCQ A;  1Y4Z B;  2DNM A;  1SUQ B;  4WP3 A;  2EFO A;  5AE3 A;  4TQS A;  5A6P A;  5HQ8 A;  5B7W A;  1M0S A;  5CYQ B;  2VQF F;  3DRR A;  2DO0 A;  4DPW A;  3KOA A;  2OPR A;  3R7S B;  3BQ1 A;  3H5S A;  1F5A A;  1FO1 A;  2MTL A;  3MPW A;  4DZD A;  3C15 B;  4IKA A;  5EN1 A;  4ZVF A;  2QLF B;  1C0U B;  5AJ3 F;  3M8Y A;  1BQN A;  2MQL A;  3HFK A;  1T03 B;  2C1E B;  3D1Q A;  5KT2 A;  2GQ2 A;  1TFW A;  4DR6 F;  3GLJ A;  2HQC A;  3M2V B;  4K4X A;  3AY0 A;  1H2U X;  2W24 A;  1BGX T;  3MF5 A;  5B08 A;  1J27 A;  1HNV A;  1Y3J A;  2LQ8 A;  2V68 A;  1FRJ A;  2WHO A;  2DNQ A;  1S1T B;  4ZIW A;  4ZPA A;  2C2O B;  1QVG R;  3M30 B;  3D7S B;  4RJV A;  1CC8 A;  4R0J A;  1N6Q A;  5K8M A;  3KWM A;  4M5L A;  9RUB A;  1NKB A;  1R0C B;  2V2K A;  5L1L A;  1VYA A;  5J2N A;  3NNH A;  1S0N A;  2CQ3 A;  2F4V J;  3UFC X;  4Q2M A;  1P8G A;  1S1V B;  4J91 A;  3B8H A;  4TVA B;  4ZVE A;  2UP1 A;  1ZTT A;  4U67 Q;  4K4U A;  3FBC A;  4OI1 A;  3WDO A;  3D3B J;  5L38 A;  4E98 A;  3FSI A;  5HRO A;  2HGL A;  4CDI A;  5LM7 E;  5D0R A;  4PG8 A;  2OP5 A;  1REV B;  1KR4 A;  5IQQ A;  1REV A;  2X1G A;  3MHY A;  1N88 A;  4EMD A;  2KXN B;  1A9N B;  1LW2 A;  1U1K A;  1LK5 A;  4KHP F;  1WOP A;  2VOP A;  5MAO A;  4AL5 A;  1ZAX A;  4Y34 A;  4M8L A;  2ZZM A;  2VFV A;  4PXC A;  1VFJ A;  2AGO A;  4LF4 F;  4KGK A;  4H4K C;  3QO9 B;  3F0N A;  2RML A;  3SMZ A;  2WVE A;  4YY3 F;  3VAL A;  3DOK A;  3NS5 A;  1RK8 A;  5KTQ A;  4OI6 A;  2QO3 A;  3QSI A;  5L1I A;  3MI7 X;  4ZK7 M;  1F1B B;  2HK2 A;  4CH1 A;  2YNG A;  5FJ4 A;  4Y0F A;  2HHT A;  1NJY A;  3HVT A;  1YRX A;  1RCX B;  3IA0 A;  2V69 A;  3PM9 A;  4ID5 A;  4P75 A;  3ZZR A;  5A8W B;  3IWN C;  2B9Y A;  4LRC A;  2R8J A;  4IDK B;  3CT9 A;  3GR0 A;  2DNH A;  4USI A;  4X66 J;  4M5D B;  3CE8 A;  4DFP A;  2VG6 B;  2YVS A;  3DDK A;  5BR8 J;  1Q8B A;  1IKX B;  4ELU A;  2Y3Y A;  1M5S A;  1KDN A;  1JLE A;  1NSA A;  1V9O A;  4ZJO A;  3L3C A;  4UQT A;  3MM5 B;  3NCP A;  1OQ3 A;  3VGU A;  1O0P A;  1SL2 A;  5HAN A;  1EQM A;  1IQT A;  2DNL A;  1FWL A;  2VFR A;  2CYY A;  2ZD1 A;  3MPU B;  3QGG A;  4DQQ A;  4BDP A;  3TJ9 A;  5EHH A;  1NHU A;  3OR2 A;  1XNR F;  3CMQ A;  2C22 A;  2WVB A;  3HXM A;  2ZOF A;  4QIV A;  3BGF A;  3NEK A;  5KFX A;  3AT1 B;  2BKN A;  4A8W A;  2W4P A;  1VBZ A;  2Z8Q A;  4F0K A;  5B0B A;  2V94 A;  4PUO A;  1APS A;  2E5G A;  4WFA Q;  2AJ0 A;  4P10 A;  4Q8F A;  2KH9 A;  1K1Q A;  3CDW A;  1XMO F;  3HM9 A;  3I87 A;  4DS4 A;  2OEM A;  1H3D A;  4Q7A A;  3TEG A;  3V5R A;  1JLF B;  4CLW A;  1NK4 A;  3GSD A;  3P96 A;  2EK1 A;  2CPY A;  3ZTR A;  2EG1 A;  4JOU A;  2QE5 A;  1HQE B;  3DOM A;  2ZC3 A;  3ET6 A;  4ZPB A;  3CC7 S;  1KLM A;  3POT B;  2RF2 A;  1UA0 A;  2PI4 A;  2XB2 D;  2BRL A;  1G7C B;  3HKZ D;  1Q8K A;  3FSX A;  1HD0 A;  3UWT A;  4N7T A;  4W4M A;  4CI0 B;  4U7C A;  1C0T B;  4I68 A;  3VAG A;  2CUY A;  3D1O A;  4F26 A;  3GPA A;  2DD8 S;  2Z4P A;  2CPZ A;  2UVV A;  3Q8V A;  5H9F J;  2XS5 A;  2B9E A;  2FHK A;  3I0S B;  5ETT A;  1TL3 A;  2GQC A;  3LGN A;  4DV5 J;  1L3V A;  4DPU A;  2HHW A;  4TY8 B;  5C2G A;  1QVF R;  5DQI A;  2CG4 A;  2E5I A;  2IDE A;  3AD7 C;  2M0G B;  2OFH X;  5G0R B;  3UR3 C;  4TNO A;  1QSL A;  3FEX B;  3N9U C;  1HYS A;  4WE1 B;  1VQ7 S;  3TEH B;  1UFW A;  3PV8 A;  2ZKT A;  4DSF A;  2UVW A;  1QD1 A;  1DAX A;  1TAQ A;  3CW2 C;  3NNA A;  1UVN A;  1UWA A;  1GT8 A;  2YKQ A;  1T0T V;  3M2R A;  1FE4 A;  4AUK A;  3LWM A;  3SYZ A;  1XMO J;  1KD1 T;  2ZOG A;  4KO0 B;  5KFT A;  1YZ6 A;  3CME S;  2HFN A;  4NLR A;  2D3O R;  2WAQ D;  2VG5 A;  1HWL A;  3BZQ A;  6FDR A;  2IRY A;  2BQU A;  3DYA A;  1DBD A;  1RHJ B;  2A10 A;  3DM2 A;  3M8Z A;  2VQE F;  3V6J A;  3AJD A;  5F8M A;  1VBY A;  1CBK A;  2XY5 A;  4ZHR B;  2OI2 A;  4F0H A;  3OL9 A;  3A4T A;  3QSY B;  1JLG B;  3MR7 A;  4DR2 F;  2UXC F;  3AB2 B;  3FNN A;  1RTI B;  2OEK A;  3PR5 B;  3PYE A;  3BB5 A;  3DLG B;  4OI0 A;  1KQS R;  4I6Y A;  2YPZ A;  3GJS B;  2OTL S;  1SKS A;  2ZH8 A;  2Z57 B;  1RKI A;  3VWS A;  2UUW A;  4F04 B;  3H7H B;  1YJV A;  1R8H A;  1UMJ A;  3D5M A;  3NGU A;  4OYA A;  1D9D A;  2BDP A;  3HVA A;  5LXR A;  2I8E A;  2E1A A;  2MST A;  3NXZ A;  2KYX A;  2MKS A;  2HWH A;  4DFJ A;  1IWG A;  4P6Q A;  3SQO P;  4Q0B A;  1B4S A;  3FCW A;  1ZAW A;  4DHV A;  4DV1 J;  1S97 A;  1HNX F;  4ZP7 A;  2B4P A;  3ZTS A;  3GG1 A;  1PKU A;  2CPJ A;  5M2U A;  1FHT A;  3T41 A;  2M5Y A;  3QZ7 A;  1GX6 A;  1V6H A;  4P73 A;  4RU9 A;  4WK1 A;  2P9C A;  3B78 A;  3D6T B;  3GFY A;  4PAA A;  4RUC A;  3EVW A;  1RAC B;  2MQ8 A;  2OPS B;  3FZB A;  1U2C A;  2UU9 J;  1C0U A;  2CG8 A;  2AU0 A;  4QJV A;  5J2P A;  4LF7 J;  3QPI A;  1NO8 A;  2W8L A;  4MIW A;  5B0G A;  2F40 A;  2J6S A;  2J7W A;  4USV A;  1QTM A;  2X1B A;  1MNE A;  2RDJ A;  1JXE A;  3I0S A;  3M9N B;  3V2U C;  3JTO A;  2H3E B;  4ZJQ A;  1GXL A;  4WZM A;  1X5O A;  2AEM A;  2NYI A;  5E33 A;  3K5M A;  1LV5 A;  2LA4 A;  2BJ7 A;  5DQH A;  4ECQ A;  1K73 T;  1BC6 A;  2OD6 A;  4DEZ A;  5HVG A;  3CJT A;  5LJ5 Y;  5GMK a;  4RWX A;  4FXW A;  1GTE A;  1SQG A;  3GQC A;  2MJU A;  5IT4 A;  3Q83 A;  4FDF A;  2R7W A;  1FKO B;  1HBN A;  3NL0 A;  3MR3 A;  3KLV A;  2W9B A;  3LA0 A;  4YP3 A;  3MPV A;  5I42 B;  2V50 A;  2W9C A;  1ULR A;  4O4G B;  1DUR A;  1Q5V A;  1U7L A;  2ZWO A;  3CJ5 A;  3R5A A;  2CDR B;  2DHS A;  1J5O A;  2MGZ A;  4URQ U;  1NDC A;  4D3G A;  1SL1 A;  4M63 A;  1UVI A;  2LEC A;  3IRX B;  4ELT A;  3IWL A;  3MOZ A;  2CNL B;  4RBU A;  4BBY A;  1F2H A;  3C14 B;  3MM7 B;  1ZM4 A;  4FN5 A;  4RPF A;  4ZHR A;  7AT1 B;  5DDO C;  3KLE B;  3MUV P;  2QA4 G;  3EVM A;  2UVR A;  4B3R F;  2VFS A;  2VKR A;  1C1C B;  3DOL A;  1Y00 A;  3CCR S;  4CO1 A;  1SIZ A;  4ECV A;  3K7R A;  3QRR A;  2IYG A;  1WC5 A;  4OX9 F;  3TUZ C;  1BXN A;  3AD9 C;  3HI9 A;  4UOG A;  1HWJ A;  1GNK A;  1X4F A;  3OXF A;  4WJB A;  1QAX A;  1SPB P;  3CIM A;  2A0F B;  2LQJ A;  4ID5 B;  1R6V A;  1UJ5 A;  2YNI B;  4HHH A;  5IC6 B;  3LTO A;  5EWG A;  4GKJ F;  2GIQ A;  3D4J A;  3P3D A;  3ZZZ A;  4B3M F;  3T3F A;  3L7O A;  3CJS A;  4NLQ A;  3KNG A;  2GC8 A;  3QFW A;  3ZTQ A;  2Y1I A;  3JB9 k;  2NSB A;  3HF5 A;  1SJF A;  3K0J A;  4CYU A;  4X64 J;  2VB6 A;  1DTQ A;  2E7V A;  3O2I A;  5E3R A;  1CJT A;  4OYW A;  4QWC A;  2P6T A;  2VG7 B;  5HBM B;  1KON A;  5SUH A;  1F60 B;  3CMA S;  1J5E F;  4FS1 A;  1TP7 A;  1SUQ A;  3P45 B;  4ER8 A;  3VQS A;  4RNM A;  2DRA A;  4LF2 A;  1TUG B;  4PYA A;  3GCX P;  4AXJ A;  1ZM9 A;  1UTA A;  2OMO A;  1OJ4 A;  5KT3 A;  2L9N A;  4WPA A;  3MM8 B;  1F9E B;  5DDQ C;  5F0W A;  5J1N A;  1VQM S;  2K1R B;  1Q53 A;  1L3K A;  1RAG B;  4EK2 A;  4DQP A;  2DH9 A;  4I2P A;  4LUB A;  1HHQ A;  3MMJ A;  3X3U A;  4ES2 A;  2YKA A;  5LJ3 Y;  4ATN A;  2OIH A;  4OZ2 A;  2GVZ B;  4ED1 A;  1B64 A;  3UDL A;  3PW5 A;  2DGQ A;  2HFV A;  3ETO A;  3WC0 A;  4N5S A;  1Z4U A;  2XM3 A;  1U1M A;  2E44 A;  4KYZ A;  3ITH A;  1A0O B;  1TKZ B;  3UDC A;  3JYT B;  5E5N A;  2LFV A;  2GML A;  2V63 A;  4WTY A;  4WP8 A;  3THV A;  2EG2 A;  2YXL A;  3BO4 A;  4HT5 A;  1C1B B;  4OHY A;  1UPM B;  2J8A A;  2IRX A;  5HO4 A;  4DV2 F;  4DLG A;  4NLG A;  3C6U B;  3RGI A;  4V19 X;  4K4W A;  1S77 D;  4N76 A;  4CWB A;  2F9J A;  2Z56 B;  4A8Q A;  3M9M B;  1LOU A;  3SEO A;  3GJQ B;  4N47 A;  4MK8 A;  2HVH A;  2G2Z A;  3PXG a;  4NYZ A;  3O44 A;  4Y2C A;  1KVK A;  3HMJ G;  2HGM A;  3AA9 A;  4CM2 A;  4DBQ A;  1VQL S;  3NGT A;  3TUJ C;  2XMV A;  2KJW A;  3VAI A;  4ID8 A;  2NCK L;  1CSJ A;  1U1Q A;  2J0X A;  2MY8 A;  3JTP A;  5ETQ A;  3GIL A;  1U1N A;  4NWB A;  1PCA A;  2GGP A;  2JFD A;  1I6J A;  2E7W A;  3MOJ B;  2F9D A;  3M2V A;  4P7V A;  2AYG A;  1S7I A;  4ZCK A;  1T7P A;  5BYR A;  2G13 A;  2ZJQ Q;  1X9S A;  2VG6 A;  2KFY A;  1IVZ A;  4M5D A;  1H2V Z;  3KXD A;  4YDX A;  4LSN B;  3ZXW A;  5IFM A;  2NZ4 A;  3DMJ A;  1DLO A;  2V4R A;  4ECU A;  4JI4 F;  4KGM A;  5CA5 A;  2V67 A;  4NAS A;  4KV8 B;  1S6O A;  4PXE A;  1W2I A;  2YTC A;  3FVY A;  1RA6 A;  3M6W A;  1HPZ A;  3ZNU A;  4XPC A;  2ZH3 A;  5KFL A;  2EEY A;  3LP1 A;  2J0S D;  1U49 A;  4NXN J;  4RW4 B;  2R9L A;  1NZA A;  1RTJ B;  2YQ3 A;  1XER A;  1ZBT A;  3W62 A;  2QA1 A;  4DOZ A;  2ADC A;  2V2Q A;  3W2W A;  3G4S S;  2A1B A;  4MKY A;  1WHV A;  1WF1 A;  1PSD A;  3WZ0 A;  5C7P A;  2P5V A;  3CJ2 A;  4XDC A;  2MGZ B;  3KK2 B;  1JX4 A;  1J5O B;  3NOC A;  5F3Z A;  4EI2 A;  4USM A;  3FCV A;  4F2R A;  2MHE A;  4EBD A;  3MEK A;  4U7U D;  1Q1K A;  3PO5 A;  2O66 A;  4DN0 A;  3RTV A;  3FBF A;  1SH3 A;  4LRF A;  5G4D A;  4DX8 H;  5DQG A;  2BE9 B;  1H38 A;  4DPY A;  5KFH A;  2M3D A;  2HZC A;  3CED A;  2OSR A;  3MEE B;  4MIB A;  2XC9 A;  1RT2 B;  2RVJ A;  2WSC C;  1CS4 B;  3D6M B;  4KBI A;  4NA2 A;  3C6T A;  2FJE B;  4LF1 A;  5J1E B;  2AGQ A;  5EWF A;  1T9Y A;  2CPI A;  1YIJ S;  3PFO A;  1S6P B;  2YKP A;  3GIK A;  1Q5Y A;  2HZA A;  3I9V 9;  2Q79 A;  4CRJ A;  3UCZ P;  3GFX A;  2UXD J;  3MPY A;  2XGQ A;  2OSQ A;  3PRD A;  5HSP A;  3UN3 A;  1TKD A;  3HJV A;  3KG4 A;  2LQ9 A;  3OFH A;  4C11 A;  1UAW A;  5HBM A;  4GVB B;  1CJT B;  1KP6 A;  4DCO B;  4TKT A;  2Q66 A;  1E6V A;  2ALY B;  2FHJ D;  3H98 A;  4P72 A;  1WOO A;  4OI4 A;  2X1A A;  4C9D A;  2XZW A;  4JI4 J;  1SC4 B;  3Q8Q B;  1NLK L;  1Y5L B;  3R5B A;  3QLH B;  2DH8 A;  3FQK A;  4RR5 A;  4TYB A;  4AFF A;  2FJA B;  1MML A;  3DRR B;  3L7P A;  2W9A A;  1EP4 B;  1FK9 B;  3CJ4 A;  2CWK A;  2XYH B;  3TI0 A;  4F3O A;  1IKY B;  3M8Q B;  5T7L A;  5F8J A;  1N34 F;  1TL5 A;  1G2E A;  4NEZ A;  3HJF A;  2ZH6 A;  5DS7 A;  2BE2 A;  1ZM2 A;  2U2F A;  3LAM A;  1U24 A;  4EFA C;  2O01 C;  4NLO A;  1UWB A;  3NGS A;  3R7B B;  2QL9 B;  2IPO B;  2DIU A;  1HMV A;  2RHS B;  1TL7 B;  1XEZ A;  2GIR A;  2RNE A;  5A8K A;  2YQ0 A;  1HWI A;  3CNQ P;  1RI7 A;  2F8H A;  1PGZ A;  4I2Q A;  1TKX B;  3EE3 A;  4ZP9 A;  2VJV A;  4LFB J;  2OPQ A;  2DGV A;  2RQM A;  1RT5 B;  1VCT A;  3R97 A;  3JYT A;  2BRK A;  4NLX A;  4DQS A;  1TK5 A;  2HIQ A;  1UFK A;  2NXE A;  3HHL B;  3PZP A;  1C1B A;  2IDL A;  2XI2 A;  2HS3 A;  3OQ2 A;  2EVZ A;  1VC5 A;  3CD6 S;  3C19 A;  1A6L A;  5I3U B;  2R7V A;  2YWW A;  2CXE A;  3SCK E;  5I4M A;  2G0C A;  3M32 A;  2BOP A;  2LU2 A;  2XI3 A;  4D3H A;  1EX8 A;  4LIR A;  1TEL A;  1WOR A;  4NMX A;  5K9F A;  1CJK B;  2ZDO A;  3QWP A;  3S01 A;  2XCA A;  3ILI A;  4JI7 J;  4X4N A;  4DQI A;  1ARO P;  2DO4 A;  3OTO F;  2LXI A;  3CCZ A;  3DI6 B;  1VLO A;  4M5N A;  3VAH A;  2BJD A;  3EJM A;  4N8O A;  2DRD A;  2J6U A;  4FVC A;  3BO2 A;  5LT5 A;  3OSP A;  1N34 J;  2PMH A;  2OGU A;  1I94 J;  3WC2 A;  5ETR A;  1U6Z A;  5B0A A;  1SXL A;  4J9P A;  5FLX Y;  1YI2 S;  2VON A;  3HDS A;  1AW0 A;  4J5O A;  1FXR A;  2YNH B;  1BQN B;  5F3T A;  4KC5 A;  4WYW A;  1IUJ A;  4KO0 A;  2N3L A;  3CD5 A;  1G4C A;  4QYZ J;  1VIS A;  3PW0 A;  2QLB B;  2AV5 A;  4RZR A;  3HCX A;  2RHQ B;  3EVO A;  3RB0 A;  3TP2 A;  3TWZ A;  4PXB A;  2JFK A;  4DR1 J;  4C0O C;  2HMI B;  3C66 A;  5KFS A;  3FEY B;  2OTJ S;  3P5B P;  4TLQ A;  2CQ2 A;  2FVR A;  2RJZ A;  3I6P A;  4QYR A;  2FJW A;  2CJX B;  2HVE A;  1WG4 A;  2OPP A;  4IYQ A;  4ZPD A;  4H4M B;  3KUG A;  2LMI A;  1SB6 A;  1DY3 A;  4CO2 A;  3K8W A;  3W63 A;  1BHN A;  1E6Y A;  3TQE A;  3TX0 A;  1S1V A;  1KOH A;  4DL0 C;  3SDE A;  5LSO A;  5GAH I;  2EW9 A;  3G6E S;  2EXU A;  1JQG A;  1R0B G;  2HGN A;  4LF9 F;  4KHP J;  2OAU A;  3KHR A;  2FY8 A;  5EDW A;  4OYZ A;  2J9E A;  3J81 Y;  3EX7 B;  3M6X A;  3W9J A;  4O4G A;  2QSW A;  4Q0B B;  3KK2 A;  3UD5 A;  1IBK J;  4OQJ A;  2HK3 A;  1HR0 F;  2V6A A;  3G6Y A;  1B0T A;  2ZUG A;  4ZCI A;  4HKQ A;  2FHO B;  2HFS A;  3N5B A;  4OYX A;  3QAT A;  2WOM A;  1KOO A;  4A8X A;  4B02 A;  1DQA A;  2IVM A;  3A8E A;  3HHL C;  4CH0 S;  1OY8 A;  2OPQ B;  1KFS A;  1RTI A;  1VRQ C;  2DGO A;  3IR5 B;  5B09 A;  3IP0 A;  5H1S V;  3EZ5 A;  1VQ8 S;  3MR2 A;  3HVT B;  4OX8 A;  3TA1 A;  4BC7 A;  1HIY A;  3VZI A;  2RKI A;  3BBF A;  3QRQ A;  4FXD A;  2E66 A;  1BY9 A;  5HJX A;  2IBO A;  1S6P A;  1G3O A;  2RS2 A;  4LF8 J;  2IVY A;  3ISN D;  1X31 C;  4PEO A;  4ZPW R;  5DO2 A;  4BCA A;  4DPT A;  1R0A A;  1UZH A;  4L74 A;  1Q81 T;  4F3Q A;  4LF5 F;  1ZS6 A;  2NUU G;  4I1T A;  1JLA A;  4CLY A;  2XUL A;  1KQK A;  3PW4 A;  5L1K A;  3QRP A;  4C11 B;  4A8K A;  1J2V A;  3FK4 A;  4S0M A;  3RBD A;  4OYI A;  1Q78 A;  4PXD A;  1XIQ A;  5KFJ A;  3KTQ A;  1HD1 A;  4V19 J;  3BM7 A;  4MAK A;  4DR3 F;  3DI6 A;  1HBU A;  4KH0 B;  3RW6 A;  3H90 A;  5CYM A;  3MTJ A;  4Y2A A;  1N5T A;  3JAM U;  1IKW B;  5H9E K;  1HYS B;  1JK9 B;  4PQU B;  4PWD A;  3KLI B;  4WWS A;  2FY1 A;  1VQY A;  5J2Q A;  2O1P A;  3ENQ A;  4B3T J;  4I6A A;  2MZQ A;  1N0U A;  5CYJ A;  4ZP6 A;  4C48 A;  5D4O A;  4QYZ K;  4KFB A;  3CD7 A;  2XYP B;  1VLY A;  5HVH A;  4HYK A;  3AQP A;  1DAR A;  1MW7 A;  4ZKA A;  3LWL A;  1WTB A;  1VIX A;  3LF0 A;  1HI8 A;  4WXW A;  4LT6 A;  4LVN P;  4Q44 A;  1FDA A;  4UOF A;  1AZS B;  2V4Q A;  3HVR A;  1OYE A;  1T11 A;  4Z7C A;  4O4R A;  1EIY B;  2FDN A;  1VK3 A;  2KRR A;  3AB4 B;  3C8Y A;  3E8O A;  2NSC A;  3NBP A;  3N0V A;  4UZC A;  4RWW A;  1SC1 B;  2FJD B;  1TR0 A;  1S1U B;  4AT1 B;  3FQL A;  3M8R A;  3KK1 A;  1H0H B;  5DZ7 A;  1TU0 B;  4ZN1 A;  5A2Q Y;  4OV1 A;  1OPI A;  4DDF A;  1NPR A;  1RT6 A;  2CRL A;  2MSS A;  3HD2 A;  3I9Z A;  4Z37 A;  1YJR A;  3BEG B;  1YJU A;  4X4S A;  3K5P A;  4IO1 A;  4K4Y A;  3P6Y C;  2DCU B;  2BUN A;  5D4N A;  2HBR B;  1S57 A;  4DX7 A;  2AX0 A;  2VG7 A;  3OFG A;  5F41 A;  3WX8 A;  2J8S A;  2FLL A;  2APO A;  4E8U A;  3ZZP A;  2X1F A;  3PIO Q;  2HQG A;  4ECS A;  1RUS A;  2J0W A;  2H9Z A;  3CDA A;  4IQX A;  1PC4 A;  4DXL A;  2MQO A;  2OPR B;  1WKJ A;  3PFE A;  3WIU A;  2BM1 A;  3NGK A;  4NI2 B;  3G6X A;  3RW7 A;  4NI2 A;  1JNR B;  1S7H A;  3M2R B;  4OZJ A;  4K50 A;  4QWE A;  1F5C A;  5AE1 A;  4KJI A;  2EKN A;  3MUR P;  1M5H A;  4DG1 A;  2YX7 A;  4DV4 F;  2E1R A;  1CUL A;  2FC8 A;  1D9F A;  2VC0 A;  3CXC R;  2J5A A;  5KFV A;  4ZLP A;  1HKA A;  4JI5 J;  1WAC A;  1MLA A;  2PC6 A;  3LH2 S;  3LPE A;  4W92 B;  1ZOT A;  4WII A;  2EBE A;  5RUB A;  1N4L A;  3THP A;  4B3S F;  2DBB A;  2FJV A;  2EWH A;  3CCJ S;  1R8C A;  3DRP A;  5BJR A;  4A8S A;  2R8K A;  3MFH A;  2GAG C;  3N6L A;  5CD4 H;  2ZZT A;  4IOB A;  3WBZ A;  2H5I B;  2EFN A;  4L3K A;  3TOQ A;  3R9L A;  1HBN B;  5KFD A;  1V3R A;  4IQM A;  1KBR A;  2G1H A;  2Z30 B;  3QIP B;  3TZX A;  4X62 J;  5HI7 A;  3A3O B;  4CT9 A;  4NLP A;  3HSJ A;  5J1P A;  2YH1 A;  1R31 A;  2DT9 A;  1RB0 A;  4PUO B;  2HWI A;  2M4M A;  2DY1 A;  4BHQ A;  3K2Y A;  2W9B B;  2VPY B;  3UPF A;  3HX9 A;  4G3I A;  3C16 A;  3A13 A;  3X1L B;  1S1T A;  2PE8 A;  1BQX A;  2EBG A;  3HHL D;  4IRK A;  1SC6 A;  2ZNZ A;  3TUI C;  4G1Q B;  1FEE A;  1U2R A;  3MMA B;  1SH0 A;  3MM9 B;  5JMN A;  2C2D A;  1U8S A;  3TA2 A;  3K59 A;  2YNH A;  4IG0 A;  4OYP A;  1YJW S;  2VBX A;  4FNH A;  3KLH A;  3MPD A;  1H2T Z;  3ISN C;  1FRH A;  5IV3 A;  4B3S J;  2EFG A;  4PG7 A;  1TFY A;  4CLS A;  3EUN A;  3AD8 C;  1TL1 B;  1ROF A;  2KI2 A;  2JZ5 A;  3BKF A;  3DLJ A;  4K5S A;  4UF4 A;  4NLW A;  2ZH2 A;  1NDK A;  3HFZ B;  1XR5 A;  3N01 A;  3D6F B;  2UUC F;  3HO1 A;  2HW3 A;  4DU8 A;  5DM7 Q;  3G87 A;  2ROP A;  3MDF A;  3H4B A;  1T05 B;  1MMN A;  3QO9 A;  1H72 C;  2KHC A;  3NWR A;  5CYQ A;  3GTY X;  1FEH A;  4DX5 A;  1FXD A;  1X7V A;  4U8Y A;  1OIA A;  2JX2 A;  2GHW A;  3T1Y J;  2HUR A;  2VUG A;  5HL7 Q;  1UVK A;  3DXB A;  5GME A;  3VVU A;  2KVI A;  3AOB A;  3MGJ A;  1YHQ S;  4LR7 A;  2FJX A;  4I64 A;  1FVS A;  1N48 A;  3VGT A;  2FLP A;  3ENA A;  4I2P B;  3IRX A;  4ZCM A;  3UVJ B;  2JJ4 D;  2WSF C;  1VHI A;  4ECY A;  4K4T A;  4JV1 A;  2V0N A;  3P49 B;  2J9D A;  5CZX A;  4EBC A;  4OV6 A;  2M2B A;  4ZVG A;  4OL8 A;  3EPG A;  1NPK A;  2C2Z B;  2ZD1 B;  3H20 A;  4C8K A;  1Z2L A;  2J7U A;  2W7O A;  4RX6 A;  3RG6 A;  3F73 A;  1R27 B;  1KRP A;  2MLY A;  5EUH A;  4MK7 A;  1NSP A;  2IJF A;  1RU2 A;  3CDU A;  4ICL B;  1FTC A;  4O3S A;  5KFY A;  3HZG A;  1RCO B;  2RUG A;  4NRU A;  5CQG A;  2AWZ A;  4KY3 A;  1DJ0 A;  4PKD B;  4CYU B;  1RT7 B;  3H42 A;  1HNI B;  1H73 A;  2KKH A;  1TTH B;  1VR6 A;  4OZL A;  2CNN B;  4XK8 C;  5D8H B;  1Q7L B;  1NH8 A;  3D28 A;  4FYV B;  3WHI A;  4LBP A;  1GQE A;  4RL1 A;  4PR6 A;  1S9G A;  2M8D B;  4GO7 X;  1FX4 A;  1ZZN A;  3G82 A;  4M5I A;  4OHX A;  4NLS A;  4QOT A;  5C2C A;  4LFC J;  1ACM B;  1OMS A;  2F65 A;  1UCN A;  2DR8 A;  1R3N A;  1X5P A;  2I5J B;  3NGR A;  2JEF A;  1IBC B;  2VFU A;  4ELV A;  1RT2 A;  4EZ9 A;  4IH6 A;  1CQM A;  2RD5 C;  3QGI A;  3RB6 A;  5C24 B;  3GYX B;  2LEP A;  1XJW B;  3HSZ A;  3OJU A;  4J9R A;  3US5 A;  1NPP A;  4RUH A;  2IM1 A;  1RAB B;  2ALZ A;  1NK8 A;  1Y7P A;  1S4F A;  1RAJ A;  1BLU A;  1JNZ B;  2GO9 A;  3HHE A;  5D77 A;  4MTP A;  5GAD U;  1YJN S;  1FER A;  2QYG A;  4X65 J;  1U1O A;  1UVM A;  3LUY A;  1ZET A;  1SQF A;  2N82 B;  5KG0 A;  2QV6 A;  2OD4 A;  1HA1 A;  4RKU C;  4OZ3 A;  1JLB B;  3NBP B;  3L9Z A;  1PJ7 A;  4OYO A;  1XNQ J;  4LSL B;  1UEV A;  2R42 A;  2CQB A;  3QZ8 A;  1N5V A;  1D09 B;  1P1L A;  2ZM6 J;  1FKA F;  4WZQ A;  3LP0 B;  4PG6 A;  3SXL A;  3HLU A;  5KG6 A;  2JVR A;  4HHU A;  5L46 A;  2MB0 B;  3EDQ B;  1O6X A;  1YK9 A;  3OVB A;  1YBT A;  3ULH A;  2C28 A;  4YR2 A;  1Q16 B;  4O0I A;  1M1H A;  2L41 A;  5LMU J;  3B82 A;  3MWB A;  1XMQ J;  1PJ5 A;  1EB0 A;  2M8H A;  1HMV B;  4LIW A;  1QAJ A;  3SSQ A;  2CJQ A;  3DM2 B;  4X2B A;  2POK A;  3EGZ A;  3A12 A;  4C8Y A;  2V34 A;  1QM9 A;  3CGI A;  3J81 j;  1GXT A;  2CAD A;  1S1X A;  2XHC A;  3BRE A;  4Q5V A;  4NYP A;  4HHJ A;  3UR0 A;  4DL7 A;  4DF8 A;  2G2Y A;  3MEG B;  5ETV A;  4I56 A;  3PRV A;  2KTQ A;  4CNY A;  3TAN A;  1H7W A;  1BWE A;  4C8M A;  1NJI T;  3BKU A;  5K5M A;  1QUV A;  4LFB F;  4GKK J;  4X66 F;  1F9H A;  4O3N A;  3DLL Q;  3Q2T C;  4DR7 F;  3RB4 A;  3BBB A;  2FVS A;  3KYL A;  1MSW D;  4RBT A;  1K47 A;  5DM6 Q;  2YKM B;  4EO6 A;  1SJ1 A;  2IY5 B;  1R0A B;  3R5C A;  1ITP A;  4LQ9 A;  1FXL A;  3I56 S;  2BW7 A;  3PJW A;  5KT5 A;  3ZZ0 A;  2AW0 A;  2PA3 A;  2WVD A;  2AMC B;  1N32 F;  3HUL A;  2P8I A;  2WON B;  4PRF A;  4P2S A;  2R2R A;  1PIE A;  1M5O C;  1Y5N B;  1UEU A;  2BJ9 A;  2DNK A;  1U0H B;  3FRY A;  4QPX A;  2EC2 A;  1VQ5 S;  2IIH A;  2C42 A;  3MUT P;  1R6Y A;  1RBO B;  2XZT B;  2QN6 B;  4FPI A;  2GHV C;  1XNQ F;  3OPK A;  2ZJP Q;  2CZ9 A;  5HJY A;  1VRU A;  1XR6 A;  4LRE A;  3RAM A;  2QSF A;  3M4X A;  2V4J A;  1VMB A;  2KXF A;  4JI5 F;  2JLE A;  4ENO A;  3MMC A;  2VAS A;  4C3L A;  2DHG A;  3IFE A;  1IJE B;  4UY8 T;  1RQ0 A;  1JLF A;  1QDU B;  1HQ2 A;  2JLF A;  3GYG A;  4N77 A;  4UTG A;  5ETM A;  3DLH A;  3GIR A;  1KFD A;  2ZVS A;  5F8I A;  1B3T A;  4UY8 5;  2COL A;  1QLN A;  4J9N A;  4DL2 A;  2RF2 B;  1FKP A;  1RTH A;  2HFZ A;  3DGP A;  5A8R A;  3PW2 A;  3MTK A;  4QCL A;  3VR1 A;  5J2N B;  2ZH9 A;  2UXB F;  1FE0 A;  2DGU A;  1K0T A;  2XS7 A;  2ILZ A;  3BSC A;  4RW4 A;  5A76 A;  2YWH A;  4FS2 A;  5KFK A;  3PVX A;  3PHT A;  4YS2 A;  3H2U B;  2CQD A;  3CCT A;  3NNC A;  2KB2 A;  3EXY A;  1GFW B;  1I3O B;  2IAJ A;  1EZZ B;  2BV3 A;  1TL3 B;  2CQG A;  3EM1 A;  2CWX A;  4RNH A;  2XY6 A;  2I2Y A;  1D8Z A;  4BS2 A;  4XTT A;  2PEB A;  1TQL A;  5G0R A;  1IBK F;  1K0V A;  2L48 A;  1RWU A;  3G82 B;  3BSN A;  4G1Q A;  2P6S A;  3IAM 9;  2MXY A;  2HQ3 A;  4ANE A;  4TQR A;  5AXK A;  2W8K A;  4YUD A;  1MWZ A;  1RA7 A;  1U2F A;  3HK2 A;  3IM9 A;  1Q0N A;  3NP5 A;  4P74 A;  4G1P A;  3KLH B;  3R1H A;  2R7U A;  2ZHB A;  3PW7 A;  5GVQ A;  1HBO A;  5SZT A;  3CDE A;  3DNC A;  3I5A A;  2GJ2 A;  2NS1 B;  1TV6 A;  2ZWP A;  3CD0 A;  3HT0 A;  2YX1 A;  1Q95 G;  3IC1 A;  2XEX A;  4LF8 F;  3MR6 A;  1D9A A;  1QSS A;  3ITH B;  1YBU A;  1T95 A;  1VK8 A;  1KVJ A;  3GFZ A;  2RQC A;  3K58 A;  1FRM A;  2E1P A;  3ILL A;  2FZG B;  4KH1 B;  4FF4 A;  3UN2 A;  4HLB A;  1U25 A;  3U02 A;  1F9F A;  4LFA J;  3CPW R;  4HL9 A;  1EHW A;  4X4P A;  1RAF B;  4KGV B;  2NLW A;  2R8I A;  3HFV A;  2I0X A;  2HVZ A;  2ZBR A;  3QQC D;  2N7C A;  4DV1 F;  1HNX J;  2CJA A;  2ILY A;  1VRU B;  4LRD A;  4MT1 A;  4BWJ A;  1WC0 A;  2R7T A;  2WRM A;  4G65 A;  1S6U A;  4IRC A;  1RAO A;  5I3P A;  2PMZ D;  1NCL A;  1FFW B;  5L39 A;  3ISZ A;  3MAA A;  3OUY B;  3OVA A;  3K57 A;  4WF9 Q;  4N8N A;  1S48 A;  2IJN A;  4HAC B;  5FII A;  5DRK A;  4JI7 F;  3MCN A;  3DDI A;  2Y0S D;  4H4O A;  2KM8 B;  3CC4 S;  4J9V A;  4URS A;  3BGL A;  3W2V A;  3SCI E;  3H5X A;  3NRB A;  1UA1 A;  4YOE A;  1N33 F;  2DB1 A;  2DIT A;  2UV8 G;  4DL6 A;  1ICE B;  4PYD A;  3G8T A;  1S1U A;  1RTD B;  1I5O B;  1RAI B;  2BE7 D;  1RWP B;  1KQF B;  4ECR A;  2E7X A;  1N36 J;  4K4Z A;  1VC0 A;  2ZNY A;  3MM6 B;  4H4K A;  3TNV A;  1NB7 A;  4IR9 A;  3HT3 A;  3MAH A;  3GJT B;  2JEJ A;  3UCU P;  5CHC B;  1SL0 A;  5D0G A;  4KPY A;  3O6Q A;  2ZH1 A;  4KE5 A;  4RLE A;  5BR8 F;  2RIJ A;  4K4V A;  3WX4 A;  2XMK A;  2GAH C;  1A7G E;  3MCO A;  4NE9 C;  4YB6 A;  3MFI A;  1RWN B;  3A1Y G;  3OTE A;  4MKB A;  1U8W A;  2HS4 A;  3I5B A;  3PHE A;  1YBA A;  3SQG B;  2MQP A;  1T3O A;  3J80 U;  2QTW A;  2HHP A;  4KIA A;  3QYY A;  3FJ2 A;  2B6A B;  2KT3 A;  1U1R A;  1GK8 A;  3KFW X;  4CTA B;  3OBI A;  4LFA F;  2ZM6 F;  3BKT A;  2MLX A;  4EEY A;  4J7C A;  1OSC A;  1VRT A;  3RRK A;  2E9Z A;  3CJ0 A;  1W2B R;  4M5J A;  2Q3P A;  4DG1 B;  3QAE A;  3BDP A;  4FBU A;  4B9T A;  2F7V A;  1U1L A;  1R8P A;  3ELH A;  4NCG B;  1RSC A;  3HHD A;  3PTW A;  3M8P B;  4ILR A;  4NCG A;  1WC1 A;  1U02 A;  3SSR A;  3UVJ A;  1G1X A;  4HTJ A;  4KT0 C;  1V5I B;  1FFG B;  3SI8 A;  2RE1 A;  4WTO B;  3OW2 R;  3IG1 A;  3IN5 A;  2E5H A;  1LXN A;  1CLF A;  2ZBI A;  3J7Z 5;  3KK3 A;  1FNM A;  4KR0 B;  1GMV A;  3LAL A;  2QIF A;  4RW7 A;  3SBM A;  2QX0 A;  1SH2 A;  4O0N A;  3CJ3 A;  3DRX A;  3O1L A;  3OTB A;  5KFR A;  3J7Z T;  4DL4 A;  3V81 A;  1JKH A;  5ITH A;  3KJN B;  5E2Q A;  1OQ6 A;  2Y1J A;  1NJW A;  4LF5 J;  2ZOM A;  3G2X A;  2HPU A;  3HZE A;  3N6N A;  3PYG A;  4RNN A;  2YKM A;  2F8M A;  1T3N A;  1AFJ A;  1H98 A;  2RRN A;  4DR7 J;  3UD4 P;  2QLX A;  2QEX S;  4M5K A;  1IJF B;  3CB4 A;  5ETN A;  4ZVS B;  3KHH A;  5JVH Q;  1DRZ A;  2ZZN A;  4GVB A;  2B43 A;  3H40 A;  1LQ9 A;  1WHY A;  4ITS A;  1Q82 T;  3BQ2 A;  2Z2L A;  2J6T A;  4JI8 F;  2EFQ A;  3UE2 A;  1CG2 A;  3KG1 A;  4DSI A;  2WBR A;  3OHA A;  1N32 J;  1N5Q A;  1R43 A;  2D74 B;  4DSJ A;  1VGY A;  3UW1 A;  1R89 A;  1WC4 A;  2V8P A;  2CJY B;  3LGM A;  4OYM A;  3BGO P;  4NPO A;  1CJV A;  4QPT A;  1JLC A;  4O44 B;  1S6Q B;  2MKC A;  3IM8 A;  2DEI A;  4DUZ J;  2AJQ A;  2V4J B;  2ACY A;  2F63 A;  2YX4 A;  3PYD A;  5F0U A;  5C42 B;  8ATC B;  2I9S A;  3TAM B;  2R2S A;  1Y9O A;  3PX6 A;  1FDD A;  1DZ5 A;  4GKK F;  2XSJ A;  2YBV A;  4J9L A;  2XYG B;  3OL7 A;  1HAR A;  5DZ6 A;  4USK A;  1UL3 A;  1TAU A;  4EYI B;  1HFE L;  1IR1 A;  2QLW A;  4I2Q B;  4J9Q A;  3G8Q A;  1ZTW A;  3UO0 A;  3DGP B;  2VQF J;  1O8B A;  2WON A;  3RBE A;  1JLB A;  3BYP A;  3PYF A;  1M5P C;  4K0K J;  1E6Y B;  1IM6 A;  1WI6 A;  2XO6 A;  1Q7Y T;  1D1U A;  1KN6 A;  2JEG A;  1FF2 A;  2W25 A;  5IXU A;  2JC1 A;  3FRZ A;  4N41 A;  5F8H A;  1B7F A;  1WC6 A;  2KG0 A;  1QY7 A;  4PWD B;  2L9W A;  2HWT A;  1SQE A;  1IWA A;  3CVK A;  1Q8L A;  3PG9 A;  2QC3 A;  1LWE A;  1QSY A;  4ZLN A;  2VBW A;  3J80 Y;  2G0I A;  1KWM A;  3L95 X;  4KFB B;  4CP5 A;  4ZVQ B;  3I5C A;  4QW9 A;  5K8N A;  1NK7 A;  3G86 A;  3C46 A;  2CZV C;  3LOU A;  2BA9 A;  4DR2 J;  2UXC J;  4FPR A;  2B4V A;  2GVD B;  1PIL A;  4JBC A;  1HBM A;  3VAK A;  4ES1 A;  2HNY A;  5MLC V;  1L3T A;  3ILJ A;  2I6W A;  4IFY A;  5U47 A;  4QR2 A;  2AT1 B;  5J2M B;  4F4X A;  2F4V F;  3BN7 A;  2E1M C;  2G1D A;  3MM9 A;  4CLK A;  5KG2 A;  3TUP A;  3W2V B;  4PG5 A;  1QUP A;  1NDP A;  2F8E X;  1KC8 T;  1YJ9 S;  2YNG B;  3H4D A;  2KT2 A;  4DCP B;  4F4W A;  1L3S A;  3DLK B;  2JSX A;  4Y3C A;  3C6T B;  3DN9 A;  3OR1 B;  4OHZ A;  5J1E A;  5GAD I;  4ECW A;  5F8L A;  3T1H F;  1NJZ A;  3G96 A;  3HPO A;  4I6W A;  4DUZ F;  3I32 A;  1OY6 A;  2AYE A;  4K8R A;  2JVO A;  3M32 B;  1EET A;  4QIE A;  2ZC4 A;  3T5L A;  3OTO J;  1AA1 B;  2R7Q A;  1JLQ A;  1Q4R A;  2DK2 A;  2NRE A;  4JYA F;  4F02 A;  2NXU A;  2MQM A;  4WCE Q;  5D3G A;  1Z2Z A;  3UDE A;  2B51 A;  2ERR A;  2UU9 F;  1HNW F;  3R1L A;  2UZA A;  1UW4 A;  4I4B A;  4NA3 A;  3V4I A;  2C2N A;  2GMJ A;  4Z2X A;  1IKY A;  3M8Q A;  2HQI A;  5T7L B;  3CCE S;  1KHW A;  4Y2I A;  2VIC A;  4AL7 A;  4C4W A;  4YR0 A;  2CPH A;  1JJ4 A;  3CF5 Q;  1I94 F;  4CT8 A;  3F56 A;  1KEK A;  4DR1 F;  1UWB B;  2V9K A;  1UPP A;  3W64 A;  1UFL A;  2W2O P;  4JI2 J;  2GJI A;  5ADZ A;  1XTZ A;  4IR1 A;  3DCA A;  2ASD A;  2FHM A;  2GVZ A;  3VHQ A;  2KFN A;  1O51 A;  1IKV B;  1UW9 A;  3HHK A;  4OX9 J;  2LYV A;  3DU5 A;  3T5J A;  2JOQ A;  1FT8 A;  5M2P A;  1HNZ F;  2XNR A;  1TUW A;  1RWM B;  4ZOS A;  2CPE A;  4WU3 A;  1KNZ A;  5KFU A;  4PPZ A;  4A46 A;  4B3M J;  2FYX A;  3A3N B;  3U1N A;  4K59 A;  1U6B A;  3W8G A;  3OR1 A;  3J81 U;  1ZH5 A;  4WFB Q;  2AYM A;  2LEA A;  1WG5 A;  2MZJ A;  1KS2 A;  1U47 A;  3KLG B;  1LXJ A;  5F8N A;  4R5P A;  1XNR J;  3VF0 B;  3AOC A;  4ECX A;  2VOD A;  1GAO A;  3R5J B;  2FZK B;  2IAJ B;  1YRU A;  3T6B A;  3BN4 A;  2E5L F;  2QMX A;  4ZPV R;  2WB1 D;  3D2W A;  4W90 B;  4CLZ A;  2YKO A;  4O3P A;  1E6V B;  3D0H E;  3ZTO A;  4RBV A;  5GAH U;  5HK4 A;  1QAI A;  3PY8 A;  4DWI A;  3HD1 A;  1NM2 A;  3ETM A;  2PDA A;  5CAB A;  3Q23 A;  2BKP A;  1DTT B;  4CLF A;  1S9G B;  2UUC J;  3D67 A;  2BJ3 A;  1D3W A;  4DV0 F;  1BQM A;  3OHB A;  4C8L A;  4TLR A;  3IXQ A;  1RJJ A;  2BZ2 A;  4PZV A;  4C97 A;  1VRT B;  5B0D A;  2ZBP A;  1GH8 A;  2QL7 B;  2GMH A;  1SCJ B;  4ES3 A;  3M2U A;  4GO5 X;  3Q8Y A;  1MMD A;  4CQ1 A;  2VF3 A;  2WTF A;  1KQG B;  5FLX U;  3LAK A;  4HDG A;  3V4M A;  1B0P A;  1SJ4 P;  2XMA A;  3M8P A;  1IBM F;  2L08 A;  4HH0 A;  4J9U E;  4CZC A;  1M1K T;  4NCA A;  4FF3 A;  2F3J A;  2FB0 A;  1EAR A;  1WUU A;  1IBL F;  5DGB A;  3MEC A;  4KKO A;  2EFP A;  4P9S A;  4E0D A;  2J7K A;  1SBR A;  2LQ5 A;  1URR A;  2KO1 A;  2Q1L A;  2AZ1 A;  4HR2 A;  4A4J A;  4H4M A;  2F4F A;  1L3U A;  2E1C A;  3D66 A;  2PA8 D;  4YHH F;  5D3G B;  2HHQ A;  1U0H A;  1YSJ A;  1HHS A;  4QWB A;  2QA2 A;  2CNO B;  1TMJ A;  2KN4 A;  2WW4 A;  3E01 A;  4LSL A;  4B17 A;  4B08 A;  2MYF A;  1FKO A;  3A8I A;  3O5T B;  5HMW A;  1EP4 A;  4ECZ A;  1KVI A;  1WEY A;  4KHM A;  4LQ3 A;  2FVC A;  3NMA A;  2LDY A;  3JTN A;  4I7F A;  1UKU A;  1FD2 A;  4UQG A;  3IBC B;  1FX2 A;  1HNI A;  2BE2 B;  2XNQ A;  4NML A;  4IOA Q;  3PEH A;  5LL6 d;  2PSZ A;  2SXL A;  5K20 B;  3LGH A;  4FYW B;  3TA0 A;  3WQP A;  2HHH J;  1JXL A;  3BGR A;  3OLA A;  3PIP Q;  3BGR B;  2HHU A;  1IR0 A;  1UET A;  3CJK A;  4ZVP B;  5KFQ A;  5KAK A;  5D15 A;  1TZ0 A;  4LF4 J;  3MEG A;  4TN2 A;  5AE2 A;  3BJY A;  2YWF A;  5KFN A;  1SC3 B;  4LRB A;  3DLE B;  1IQZ A;  1CS4 A;  1YZ7 A;  4XPE A;  1G6B A;  1Y0H A;  2IA6 A;  2YNI A;  2DIV A;  1XMB A;  3IGN A;  1UZD A;  2QFI A;  1H6K X;  3ZZY A;  3DKD A;  2XLI A;  2B7C B;  2UVU A;  2NXN A;  2CVE A;  4ILL A;  4JP8 A;  1YWX A;  3DU6 A;  4QIF A;  3GG0 A;  4ZPC A;  5M2R A;  4BLG A;  2VFT A;  4ED8 A;  1EQ0 A;  3CCU S;  4DL5 A;  1S59 A;  2D3O 1;  2VKZ G;  3TJ8 A;  1VBX A;  1X60 A;  4U8V A;  4F8R A;  3GWC A;  5KT6 A;  2HFU A;  2K2P A;  5CCL A;  2H65 B;  5FDL A;  1S9E B;  3QNW B;  4OJH A;  3SQG A;  3VAJ A;  1FD8 A;  1SJ3 P;  4PWW A;  1F3V A;  4B9V A;  3HKW A;  4F36 A;  2ABY A;  4GRS A;  5ETO A;  3V4I B;  4LF7 F;  5F8G A;  2G9O A;  3G71 S;  3R6L B;  4J90 A;  1HR0 J;  4M95 A;  1TUV A;  1NSQ A;  2VA3 A;  3ONQ A;  5L8R C;  4NLV A;  1X4G A;  1LWC A;  1T02 A;  2HND B;  2AJ2 A;  3E51 A;  5A6W A;  3W60 A;  3UNY A;  1RHQ B;  2FIU A;  4B9M A;  1WDD A;  2K3K A;  3LO3 A;  3MXH P;  2FGO A;  2H51 B;  2B3T B;  4LSN A;  3GV8 B;  2PT0 A;  2KRB A;  1U1P A;  3K5N A;  3UNG C;  1O5J A;  1RWX B;  4F4K A;  4K2J A;  2K06 A;  3OFF A;  6FD1 A;  2R4F A;  3DRP B;  4OYB A;  5THW A;  3Q0A A;  2A2C A;  1BUX A;  1MN9 A;  4JI6 F;  5KT4 A;  4X62 F;  1CPZ A;  3HHN B;  4DR4 J;  4FBT A;  1XBW A;  3DXS X;  1U45 A;  4X4V A;  5AXL A;  2HBZ B;  3OD2 A;  1RTD A;  2LDI A;  3I96 A;  4JI3 J;  1WHW A;  1HL6 A;  4NCB A;  4DV5 F;  4DUY F;  2AJF E;  2DGS A;  4NL5 A;  1F0X A;  1HWU A;  4KSE B;  2NPI A;  5CCM A;  3C3L A;  1DQ9 A;  3W5Y A;  3KHL A;  2H1Y A;  2YPY A;  4P52 A;  3P8B B;  4Y2M A;  2H54 B;  2IA0 A;  2CDQ A;  2F5G A;  2P2C B;  3D3C J;  3JXO A;  4L73 A;  4LR9 A;  1JWW A;  3C16 B;  2UUA J;  2HVI A;  4YB7 A;  4F0M A;  2B56 A;  4JYA J;  4LR8 A;  3W1Y C;  3DOK B;  4DX6 A;  1VQN S;  4C8N A;  4B3O A;  4B3R J;  1VQP S;  2MDA A;  3M05 A;  5LSL A;  2V8H A;  3B54 A;  1LWC B;  5FD1 A;  5AXM A;  4A8M P;  1NUE A;  1JMT A;  1HBO B;  4IH5 A;  3Q8R B;  1RWO B;  4DUT A;  2GCF A;  1W7W A;  2XMT A;  4QW8 A;  1XQI A;  2KHD A;  3MEC B;  4KKO B;  3DRY A;  1F2G A;  1JLG A;  4B9N A;  3BDE A;  9ATC B;  1FWK A;  2CQI A;  2HKE A;  2Y1L B;  3FMW A;  4KV8 A;  3JSB A;  3PRB A;  1WI8 A;  2XMW A;  3CSK A;  4HEA 9;  4F50 A;  5IT9 U;  4IG3 B;  3BR8 A;  2MKI A;  4YFU A;  3F44 A;  2DH7 A;  3RYL A;  1J5E J;  1RTJ A;  1QE1 B;  2C3U A;  2GNK A;  2HBQ B;  3EMT A;  3FSY A;  1UJ4 A;  2HLU A;  2OUG A;  3C15 A;  4DLE A;  2IRU A;  4I7F B;  2X3G A;  3GIJ A;  1C4C A;  1VBK A;  2BKO A;  2R8G A;  5CAA A;  2HSE B;  3KUE A;  4CO3 A;  2IBK A;  2C2E A;  2N4C A;  1HI1 A;  3CTR A;  4Y6I A;  1WKK A;  2VBZ A;  1OWX A;  2DTJ A;  2JC0 A;  1RWV B;  1RT4 B;  1TKT B;  3V6D A;  1U4B A;  2GVD A;  5ETK A;  2RUS A;  5IS2 A;  2FJB B;  2DXF A;  2JHE A;  1OSD A;  3GFH A;  2WOM B;  3CJK B;  2M88 A;  3ZNJ 1;  1WTF A;  1FJG F;  3S1T A;  1RE1 B;  1VQO S;  4EUV A;  1RTH B;  5A8R B;  1FVQ A;  4RUB A;  2GGP B;  4B9U A;  4RW9 A;  4CO5 A;  2FC9 A;  3OLB A;  1X0F A;  1HHT P;  2DNN A;  4ZLL A;  1VC6 A;  4PPD A;  3ZFV A;  3JQJ A;  4LSZ B;  4DSL A;  2DY9 A;  3CO9 A;  3R5D A;  2K7J A;  3C6U A;  3EPI A;  5HAT A;  2GS8 A;  1LEO A;  3GP9 A;  3CUL A;  4RW6 A;  4RW6 B;  3U1L A;  2WSE C;  3IAS 9;  1AB8 A;  2HBY B;  2UUT A;  4YN3 B;  4R8U B;  5LOQ A;  2W2N P;  2WCX A;  3D0G E;  2N4D A;  1S1W B;  2VPW B;  4CNZ A;  2BEF A;  2D41 A;  7FDR A;  1K9M T;  3K89 A;  3CCL S;  4O3R A;  5HQM A;  5GAG I;  2B6A A;  1FK9 A;  1P27 B;  2MQN A;  2QMW A;  4CCH A;  1YVF A;  4WXO A;  1SV5 A;  4O23 A;  3MM8 A;  3FDS A;  3J7Y I;  2MJN A;  2UXB J;  4OZ1 A;  2VG5 B;  3TX8 A;  3PEJ A;  4UT4 A;  4F4A A;  5C25 B;  5IQ6 A;  2J9D E;  3E2E A;  3FBB A;  2FPH X;  4F67 A;  2M52 A;  3BS9 A;  2VOO A;  1RAD B;  3OV7 A;  3GIM A;  1JLE B;  2HHH F;  1VQ6 S;  4NXN F;  2KZM A;  3FGV A;  1NSK L;  1WOS A;  3Q8S B;  2O3D A;  4F3M A;  1IBL J;  4QU6 A;  2CFX A;  2IC3 B;  2QZ8 A;  3I4H X;  4KAI A;  2J76 E;  5B0C A;  1NDL A;  1M90 T;  4UST A;  1VIO A;  2BJ1 A;  3QMQ A;  4K0K F;  2MZT A;  2Z2M A;  3B4M A;  4ED6 A;  5I3U A;  4R5P B;  4RU2 A;  2HHS A;  2QL5 B;  3Q89 A;  1LWF B;  2DYA A;  1AT1 B;  1DTQ B;  3JSM B;  1CJK A;  1CEZ A;  3BPD A;  1TVR A;  2W7A A;  4USW A;  3SSS A;  5EX3 A;  4OZ0 A;  5DG9 A;  2DGT A;  3U1M A;  1CQN A;  3F41 A;  3TVY A;  1MRO B;  3N5F A;  1MRO A;  4KPC A;  2VJU A;  3IS9 A;  1VQ9 S;  2JDJ A;  1RBA A;  1KSP A;  2DXD A;  2FD2 A;  4PG4 A;  2V2V A;  3EWG A;  1S72 S;  2AZ3 A;  2CVI A;  1C0T A;  2NZC A;  1LNQ A;  2BBE A;  1ZPW X;  4FKY A;  4ED3 A;  2DNZ A;  1DFD A;  1VQS A;  5DLF A;  2H48 B;  3TAM A;  3R2C J;  1XWL A;  2LA6 A;  1DQ8 A;  2R7X A;  4A47 A;  5CZV A;  3KMQ A;  4DV3 J;  1IN0 A;  5A8K B;  2ADB A;  1WF2 A;  5HN0 A;  1P9Q C;  2OJ3 A;  2RAQ A;  1Z1Z A;  3DMJ B;  5L9X A;  1Q8I A;  2RDD A;  2FLO A;  2E5J A;  4FXV A;  4GVL A;  2DR7 A;  3I31 A;  2OPP B;  2R7R A;  1RLC L;  1RT5 A;  1SVD A;  2RH3 A;  4AND A;  2O5D A;  2IC3 A;  4UUW A;  4ETZ A;  1S0V A;  5K8P A;  3VGS A;  3EXC X;  3SDE B;  3MCS A;  2CPF A;  3QBC A;  2ATL A;  2AQ4 A;  3KLG A;  3NKY A;  2V8D A;  2KXH A;  2CQC A;  4KRW A;  4USU A;  1JJC B;  2P9G A;  3H2V E;  1LW0 A;  3S8S A;  3GE9 A;  3QFH A;  2GZO A;  3N28 A;  5LSR A;  1UEK A;  1UP1 A;  2YWK A;  3EGN A;  3PDN A;  4JV2 A;  2MLZ A;  1W26 A;  3T6J A;  1F6T A;  3GMG A;  2OKQ A;  3RJM B;  5JVG Q;  4HAC A;  4P2X A;  1X5T A;  4X84 A;  3IR6 B;  1V5V A;  1HQE A;  2CPD A;  4IFY B;  1C1C A;  1R8B A;  2JWN A;  2XZD B;  1Y10 A;  4L6V 3;  5D0E A;  3M9O B;  4DV4 J;  4K5R A;  4ZVU B;  4ED7 A;  4TU9 A;  3OJS A;  2AJ1 A;  4ZDN A;  4DV3 F;  3V81 B;  1KTV A;  2E29 A;  3EZO A;  3T9N A;  3G8S A;  1NK5 A;  2RU9 A;  3DGV A;  3SFG A;  1S9F A;  2EKY A;  2GQQ A;  1NEE A;  5D0H A;  4DPO A;  3MCM A;  4JV0 A;  1XN9 A;  1HQU A;  1GX5 A;  2HQF A;  3BYR A;  2HS0 A;  1RLD A;  3H2L A;  1K1S A;  4P2F A;  1RKJ A;  3TJA A;  1JIH A;  1X0P A;  4DUY J;  1OO0 B;  2DHA A;  2F1F A;  3ZZU A;  4C0B A;  4R0E A;  3MUM P;  2AIR B;  2DIS A;  3U7J A;  5E7O B;  2QGF B;  3QLH A;  4OZN A;  4DR5 F;  1SJR A;  5BYQ A;  4CTA A;  2I5J A;  2UV8 A;  1NBE B;  3N79 A;  2FZC B;  1PJ6 A;  5GMD A;  3W5Z A;  4EU0 A;  2W9C B;  5LMU F;  5L9N A;  5I42 A;  4DN9 A;  1XMQ F;  3AJ2 A;  2MKJ A;  1IM4 A;  2K1R A;  4AL6 A;  2OO4 A;  2X3D A;  3ADA C;  4XDD A;  1RYS A;  3B4D A;  4AXI A;  2BM0 A;  2JL9 A;  2WZ1 A;  1FRK A;  1TL7 A;  2VL1 A;  1B7Y B;  4FYX B;  5E41 A;  2CA9 A;  1N5Y B;  1IXK A;  3DYA B;  4NLY A;  2PGC A;  4U6P A;  4U95 A;  1M5V C;  3M30 A;  2XWX A;  1N6Q B;  4JUZ A;  4WFX A;  3IG1 B;  3UI3 A;  3KJV A;  5AT1 B;  5HP1 B;  5HLF A;  3G9C A;  5IM0 A;  4LBH A;  1CVJ A;  3KNA A;  4DZ6 A;  3TYT A;  1T8E A;  3BV8 A;  4KGZ B;  4V1A k;  1GXU A;  5KG1 A;  5DG8 A;  5E0O A;  2BJ8 A;  4Y00 A;  2D1C A;  2UXD F;  2DR5 A;  5IC4 B;  2KFZ A;  2A2D A;  2KZZ A;  4C7Q A;  2Y8Y A;  3KLF A;  1FI4 A;  2FTR A;  5F9N A;  3NGD A;  2Q43 A;  4C3K A;  2ZUA A;  1YKW A;  2HEK A;  3MAA B;  4MKV A;  4DFK A;  2DNR A;  3FFI A;  4ZPT R;  3GSI A;  4ZVR B;  3D54 A;  3DHX A;  2V9W A;  3NAH A;  2VIH A;  3IBF B;  2B4O A;  3JS9 A;  5KFA A;  2BOA A;  2BW2 A;  1BQM B;  3L7U A;  2H5J B;  3MEE A;  3N6M A;  4MFB A;  2BAB A;  2HYI B;  4F2S A;  4FZV A;  2MZS A;  1RWW B;  4Q43 A;  2YKN A;  4DR5 J;  4A8O A;  4K4S A;  4PWU A;  3U27 A;  5C42 A;  4IO9 Q;  4DQR A;  4ED2 A;  4C0H A;  2DNG A;  3NLC A;  3ILO A;  2MQQ A;  2J0Q D;  2ZHO A;  4NOH A;  2R2T A;  5AJ3 J;  1HW8 A;  3ZC4 A;  3MD3 A;  2PFD A;  2DPJ A;  4DR6 J;  1PAE X;  2MKH A;  3CJQ A;  1WNE A;  4AE5 A;  3SCL E;  3E3X A;  3CJR A;  4C98 A;  4YB1 P;  4ETX A;  1TKZ A;  4L76 A;  2PI5 A;  3D6H B;  2DHH A;  4HH1 A;  2QJ3 A;  5K8O A;  2QMU B;  4KGX B;  5CYM B;  2XCP A;  4DU7 A;  1NB2 A;  2BQ3 A;  4IH7 A;  3W9I A;  3Q22 A;  1EKR A;  1S0M A;  2VU5 A;  1RDR A;  3MMB B;  3MMB A;  4DV7 J;  5CH7 B;  2DGX A;  2VZ9 A;  2HND A;  3GZ7 A;  1LK7 A;  2QYC A;  5IWA F;  2V2Z A;  3OTD A;  4HT7 A;  4ALZ A;  2Q6C A;  3VGV A;  4XO0 A;  3OUY A;  5BYS A;  1T9X A;  2UUB J;  1HBM B;  4DS5 A;  3KLE A;  4KHR A;  2KT5 A;  1RYR A;  2LLZ A;  1KLM B;  2WVF A;  3NY0 A;  2BX6 A;  5IM0 B;  1JJH A;  2HVD A;  4JI0 J;  2YWE A;  5DGA A;  4A8Y A;  1RP5 A;  4RW7 B;  3TR5 A;  3I0R A;  1CJU B;  2GFF A;  3M1V B;  3M2U B;  1VQK S;  3OXL A;  2HAF A;  1I1G A;  3AOD A;  3P5T L;  3D0I E;  1S10 A;  2EI5 A;  4USJ C;  2U1A A;  2OFG X;  4DR4 F;  1WWH A;  5LMN F;  1PAU B;  4DV2 J;  3M6U A;  2ZIT A;  3AJ1 A;  1EET B;  2W4D A;  4YB5 A;  3SZ2 A;  1FNX H;  3Q86 A;  2VHG A;  3RRG A;  2BVZ A;  3N4W A;  2BJE A;  3QT8 A;  2ROG A;  4P71 A;  3TQ1 A;  1VJQ A;  4DSK A;  3PNI A;  3HVW A;  5KT7 A;  4ZA1 A;  1S76 D;  3AHP A;  2I1R A;  3CCW A;  2DKO B;  1VDH A;  2W4C A;  2DVI A;  2A6O A;  1NU4 A;  1U48 A;  2FHJ A;  3LAN A;  2LKZ A;  2CQ0 A;  3QT6 A;  4F7V A;  2O67 A;  1K44 A;  3DLB A;  1AFI A;  1PG5 B;  1S6Q A;  1KLN A;  1HWK A;  5KFP A;  3EYZ A;  3TVZ A;  1M5K C;  2AGP A;  5J2P B;  1JB0 C;  3HSG A;  3RR7 A;  1FDB A;  2BAN A;  2BYC A;  3PJ9 A;  4J9S A;  1T9U A;  2RIL A;  5A8W A;  2MKK A;  2ASJ A;  1S79 A;  3CCV S;  1N5Y A;  2RRA A;  1ZYQ A;  4EBE A;  1HNV B;  4TXS A;  2EC0 A;  4CLP A;  2KJV A;  1NXI A;  2EK6 A;  4H4O B;  4YDD B;  1NAQ A;  1IKV A;  2AYB A;  4HDH A;  5J2M A;  3QT5 A;  2ATC B;  3NS6 A;  2UUB F;  2HRU A;  4QIW D;  3IBW A;  4R25 A;  2Y8W A;  5BXI A;  1YLX A;  5HMZ A;  1U6F A;  5KFG A;  1UVJ A;  2C3M A;  3P4U B;  1M1G A;  3NCR A;  1WKL A;  2RKI B;  2HRY A;  2XSF A;  4WU2 A;  3A8J A;  3QAU A;  1GMW D;  3TAQ A;  2GW8 A;  3H0P A;  2E9R X;  1FRL A;  4NA1 A;  4WK3 A;  5K14 A;  3RU0 A;  4NZ6 A;  4ILM A;  4L72 B;  4OIX A;  5HVF A;  4ZIT A;  4TU8 A;  1H74 A;  2KU7 A;  2ZVI A;  4DV6 F;  4C6A A;  3V6K A;  2KYZ A;  1AUS L;  2B4U A;  2OEJ A;  4NLT A;  5B0E A;  2LP4 A;  2W01 A;  2Y9H A;  2ZFH A;  1S9E A;  3M8W A;  1MU2 B;  3UN5 A;  3MED B;  4LF6 J;  1FES A;  5I3Q A;  4J9O A;  5ETL A;  1OS5 A;  4ZCL A;  2IFX A;  3H59 A;  5J2Q B;  1WG1 A;  4PQA A;  1X4E A;  3H25 A;  2CQP A;  1QTN B;  1N0V C;  1YJ7 A;  2G2O A;  3DLK A;  5EWE A;  4PCQ A;  2XGP A;  1RHM B;  3J7Y U;  1LWX A;  1V3Z A;  3GJR B;  4WKY A;  3Q24 A;  2OEL A;  4KQZ A;  4HVZ A;  1B99 A;  5KFW A;  1S12 A;  1F3F A;  5KOX A;  3PJX A;  4RNF A;  2RU3 A;  1IKX A;  2XMM A;  1JLA B;  2A6M A;  2NXC A;  4CLT A;  2E9T A;  3EGW B;  3PKM A;  2FLN A;  2CAJ A;  1NK9 A;  4TY8 A;  3CUN A;  2RT3 A;  2ZE2 A;  3T19 A;  4GC6 A;  1CC7 A;  4W98 A;  3R8Y A;  4ANC A;  3FUY A;  4K7Q A;  4NYO A;  2DHX A;  1RT1 B;  1P1T A;  1U09 A;  1FCA A;  1N54 B;  3D1H A;  1QJH A;  4LJM A;  4NZ0 A;  3OT9 A;  4B9L A;  1LW0 B;  2C3O A;  2AHO B;  3D68 A;  2NR0 A;  2CQ1 A;  1NKE A;  3RBX A;  1SV5 B;  1VJW A;  2B9X A;  3T1Y F;  2UUA F;  1KKH A;  1U26 A;  2W1B A;  3IRW P;  4EYH B;  3SCJ E;  4X4U A;  1PO6 A;  1OY9 A;  5LXY A;  3Q2S C;  2HNY B;  1S1X B;  1UVL A;  1S99 A;  1BD6 A;  2BQR A;  1EKS A;  2B7B B;  2WK4 A;  3DOL B;  2CJB A;  3PX4 A;  5KFB A;  2CJ9 A;  4TYA A;  1SIW B;  3QGH A;  5C5J A;  4X4O A;  3R2D J;  2V8V A;  5A0Y B;  1X8D A;  2Z0G A;  4QBU A;  3JSM A;  2ZDP A;  1RHU B;  1FJE B;  4G6V B;  1YJT A;  1HQU B;  3TVK A;  1ELO A;  4DL3 A;  4M5M A;  1MG7 A;  1PYS B;  5KG7 A;  1S4E A;  1NRK A;  3NOG A;  1X4A A;  3KG0 A;  1JLQ B;  1TK8 A;  3KJF B;  2D9P A;  4YR3 A;  4LFC F;  3ZZO A;  3IO1 A;  3GON A;  2C2R A;  3DRS B;  1FFS B; 
#chains in the Genus database with same CATH homology
 3P45 B;  2DKO B;  3QNW B;  3R7S B;  2XZT B;  2XYH B;  1BMQ B;  2QLF B;  2H4Y B;  3R6L B;  3NS7 B;  1F9E B;  2C1E B;  1RHR B;  3EDR B;  2XYP B;  1RHQ B;  3R7B B;  2QL9 B;  1RHJ B;  1QDU B;  2H51 B;  2C2O B;  1RWX B;  4DCJ B;  1RWM B;  2C2Z B;  1SC1 B;  3P4U B;  3GJS B;  2HBZ B;  3KJN B;  5IC4 B;  2FQQ B;  2QL5 B;  3R7N B;  1I3O B;  1GFW B;  2QLJ B;  3R5J B;  3KJQ B;  4ZVS B;  2CNK B;  2HBR B;  2H4W B;  3GJQ B;  2CNN B;  2H54 B;  2P2C B;  4ZVR B;  4JB8 B;  2C2K B;  3IBF B;  1I51 B;  2CJY B;  2H5J B;  1IBC B;  4ZVT B;  1RWW B;  2C2M B;  2QL7 B;  1QTN B;  3SIP B;  1RHM B;  3GJR B;  2H48 B;  2QLB B;  1RWO B;  2Y0B B;  1PYO B;  2XYG B;  3R6G B;  4ZVO B;  2CJX B;  2Y1L B;  3D6H B;  1RHK B;  2H5I B;  2CNO B;  2HBQ B;  3EDQ B;  3IBC B;  2CDR B;  1RWK B;  4ZVQ B;  5K20 B;  1RWV B;  3RJM B;  2CNL B;  1RWN B;  4ZVP B;  2XZD B;  1RE1 B;  1SC3 B;  4ZVU B;  4DCP B;  3D6M B;  1ICE B;  5IC6 B;  1RWP B;  4LSZ B;  1PAU B;  1RHU B;  1NME B;  3GJT B;  2HBY B;  4DCO B;  3D6F B;  3KJF B;  2H65 B;  1SC4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...