1RHMA

Crystal structure of the complex of caspase-3 with a nicotinic acid aldehyde inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
140
structure length
140
Chain Sequence
b'DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASP-3
molecule tags Hydrolase
source organism Homo sapiens
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
total genus 46
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rhmA00
3SIRA 4N6OA 2XYGA 3S70A 4PS1A 5H0IA 3PD1A 2Y0BA 2AR9A 5IBPA 5JFTA 1PAUA 3H1PA 2NN3C 4JJ7A 4M9RA 3SIPA 4ZVSA 3D6MA 2HBZA 1BMQA 1M72A 3DEJA 5K20A 1F1JA 4NBLA 4NOLA 2FQQA 4PS0A 2H65A 3R7SA 4DCJA 3D6FA 3BIJA 1QDUA 5IAGA 2XZTA 1SC1A 4I1RA 4HVAA 2QL7A 2QLBA 3K7EA 2CJXA 5IAEA 5LU8A 3NKFA 2XYPA 2QLFA 4HQ0A 3PCXA 4ZVOA 4EHNA 2HBQA 4QUDA 1RHUA 3GJQA 3V6MA 3GJSA 4QU8A 2C2MA 4N7MA 5IASA 3V4LA 4DCOA 1NMSA 1I3OA 3RJMA 4N7JA 5LU9A 1NMQA 4IYRA 3E4CA 4AWBA 1RHKA 2CNNA 3KJQA 4FGUA 2DKOA 1K86A 1F9EA 2CNKA 2FP3A 2H4YA 4FEAA 3V3KA 3V4OA 2CNLA 1RE1A 2H51A 5I9BA 4EHFA 3H11A 4EHDA 1RWVA 1NW9B 2HBYA 5IC4A 2J30A 1RHMA 1RWXA 1NMEA 2H4WA 2WDPA 3EDRA 3IBCA 1RWWA 1RWOA 3P45A 3OD5A 4PRZA 3QNWA 5IANA 2C2KA 1JXQA 3P4UA 4QUJA 4QUEA 4NOJA 4I1PA 3H13A 4EHLA 1I4OA 3R6LA 2C2OA 3R7NA 2J33A 1I4EB 3GJTA 1SHLA 1GFWA 2J32A 4JQZA 4QULA 4D3YA 1RWMA 4NBNA 2J31A 4N5DA 1CP3A 2CNOA 4N6NA 1PYOA 2C1EA 3KJFA 4JJ8A 3V55A 4QTYA 4QU9A 2XZDA 2QL5A 3H0EA 2Y1LA 4JR1A 4ZVUA 4ZVTA 5IARA 4NBKA 2XYHA 5IAJA 1SHJA 4JR0A 2P2CA 2QL9A 4ZVPA 4QU5A 1GQFA 2C2ZA 4EHKA 3R6GA 5LUAA 3IBFA 5IBRA 1QTNA 1RHRA 1RWPA 4N6GA 5IABA 1QX3A 4NOKA 2H48A 3ITNA 3DEKA 4QUHA 1CVRA 4DCPA 1SC4A 4EHAA 4ZVQA 1KMCA 3NR2A 1RHJA 2CDRA 5I9TA 3UO8B 1RWNA 4IEFB 3S8EA 2H5JA 4QTXA 5IC6A 3UOAB 3R7BA 4D3XA 4EJFA 4FXOA 2H54A 1I51A 4PRYA 4NOMA 2K7ZA 4D3ZA 2QLJA 4QUGA 4FDLA 4QUIA 3NS7A 1ICEA 1RWKA 3H11B 4JQYA 2CJYA 3DEIA 1RHQA 1K88A 4JB8A 4QUBA 3DEHA 3R5JA 1IBCA 4JR2A 4QUAA 4HQRA 2H5IA 4AW9A 5LUBA 3EDQA 4JJEA 3D6HA 2HBRA 5IBCA 3GJRA 3R5KA 4LSZA 4ZVRA 4EHHA 3KJNA 5IAKA 3V6LA 2FUNB 3PD0A 4QU0A 1SC3A 4AWAA
chains in the Genus database with same CATH superfamily
2Q1XA 1KHHA 1WKCA 3G79A 1K06A 1C14A 1YVUA 2GXSA 1KGDA 2XYRA 1DC3A 3D8NA 3N2YA 1AO3A 2C77A 2FPPA 4OYHA 1JF8A 2PH5A 2W98A 4I4TA 1XA4A 1MNAA 1DG3A 4IS2A 4QJ4A 4AB1A 1H4QA 5IJ9A 2GZHA 3ND6A 2C42A 3OA2A 5K0NA 3WYDA 1VHTA 1W9HA 3HN7A 1U99A 3JQ8B 1ZITA 5CK5A 2F55A 5DLDA 3ER6A 1Y82A 2ZE5A 3WI7A 1Z2DA 1F3OA 3FMPB 4FMPA 4O2BB 1BE1A 1O0CA 2R9VA 5ALPA 2YRFA 2X6TA 2CZGA 2PXXA 3DDWA 1VSVA 1KY4A 3HCCA 3LLVA 4C3ZA 2NNLD 5IZCC 3HNOA 2QF7A 5EQJB 5TMEA 2QG9A 4C07A 2BZSA 2FPMA 4DR1B 5P21A 3R20A 2EFEB 1DRKA 4IKOA 3DE5X 5G02A 1XFAA 5IPFA 3FOCA 4WXRA 3BG5A 1Y3FE 2AHRA 2VTDA 4RIIA 5EG5A 4E5VA 4DSZA 4OLHA 1P2SA 2DUUA 3D1JA 1GRQA 3KQSA 5T4BA 1ZH4A 5MFPA 4BP9A 4X3PA 5MN5A 4NCBA 3FA2A 1EJ0A 3GMSA 3TK1A 4AVYA 2AFHB 2O3QA 2J9FB 4R9VA 5A1TA 3ESCA 3NOQA 2PWAA 1KEVA 2QDKA 4FWBA 5CJ2A 3VYTB 1QB8A 5JBNA 3K6SB 1HNWB 2BGGA 3FPLA 4L28A 1U1CA 3QEKA 2XUJA 1H8EA 2SICE 4XQ0A 2JJ1A 1E7RA 4H15A 5BWMA 1P9OA 2RHJA 3DDHA 4HN4B 2R8ZA 4EL5A 1VSQA 3D6UA 1J97A 3MNFA 2WZCA 1VYTA 5JCJA 1QYIA 3R9KA 1L6IA 4LY9A 4OFXA 5CAEB 2ZZKA 5JANA 2EBUA 1OWOA 5T64A 1QV9A 2GK4A 2IJGX 1YUNA 3LPAA 1TCCA 3U4DA 4BGUA 3CMMA 2P6OA 3IDSA 2VTKA 4OHPA 1GYQA 4B3IA 1YL6A 1GN8A 5KYWB 1U7DA 4U7PB 4DR7B 3NTVA 1TVKB 1P1CA 3DPUA 4H7FA 2DSTA 4KQ1A 1MX1A 2IPLA 2Q3MA 3GNQA 4HBGA 4BEJA 3MUEA 4RGYA 5HVNA 5H9VA 4JUFA 5BMVA 2NU7A 1P91A 1JG1A 4QJ5A 2JATA 5I7OA 4FHFA 1D0VA 4O2BA 4I1UA 3IIMA 3PUHA 1HFEL 1RI5A 3QJ5A 1ZGBA 3L43A 1ZRNA 5DISB 5JD6A 2FUKA 2QP4A 2EKZA 3JYPA 1OAOA 4GKBA 3BEOA 4PXYA 4D4IA 3ZV4A 1CY7A 2B83A 3BXHA 1P7YA 2G07A 1OXSC 1LXCA 1Y3AA 3HQ4O 3O5AA 3T3EA 1OXTA 2VF5X 3EZYA 4JYPA 3R7BA 3SWWA 3TQTA 3QLEA 2ZKLA 2LUOA 1NW6A 1JDBB 4PCLA 3SAJA 3NAZA 5DNCA 5KZMB 2G9UA 4KFRA 2ZBPA 1X87A 4JU8A 5TMDA 2AFHA 4FFDA 1EZ4A 1NF8A 4A2CA 1R8QA 1XWWA 2OCPA 1OY1A 1V43A 4GU5A 5KJ1A 1XTRA 1XZAA 4A23A 4YP1A 3BHMA 3JY6A 4Z6KA 3H1EA 3L8YA 4A0HA 4NL4H 4KR0A 4XYGA 3RV4A 2CFRA 4UREA 3QBJA 2PEZA 1T6BY 1D6SA 2LDXA 2RKWA 3AETA 2CDCA 1QZXA 2WWWA 3EBPA 3GZTB 1RI1A 3I4FA 4IKPA 3NGMA 2XLCA 4R8KA 3QKSB 2DKNA 1JP7A 4JS0A 1SC3A 4WOCA 1O0BA 3RSGA 5F9HA 4AQYB 2KS6A 5EQTA 2PZAA 1PFQA 2Q6TA 1UJ2A 2FMIA 4LZNA 2GYVA 4GQIA 5ES3A 1AN0A 5EE3A 2ZSEA 3D6MA 1QF6A 3H5LA 3K5IA 1A98A 3JZDA 2XSZA 4OM8A 4B3DA 2H7YA 3EIXA 1T1GA 1KJIA 2PSEA 4OOEA 1V71A 5I8PA 3JYLA 1I2DA 1C3VA 2NTJA 3BYZA 1P81A 4IVRA 4R71A 5CDUA 1QO7A 3R75A 1DB3A 1TYCA 3TSZA 4FNGA 4XSVA 3RASA 2QLFA 1KOGA 1XZIA 4FYHA 4EHNA 5AUQA 2CB9A 2ZUTA 4Z53A 1E2MA 3FSRA 2YQZA 3HUUA 3HBLA 1CEEA 1SCDA 1H0RA 3Q3HA 2OWDA 1M9NA 4ETNA 3GZNA 1EWRA 5HCNA 2FAXA 3AI2A 1IJKA 4NCAA 1MH1A 3R76A 5LU9A 1DS6A 1NPTO 4U5XA 3I6QA 4KNWA 4JOCA 3IV7A 4CKBB 2FPOA 3SSMA 1KZ1A 5C4IA 3C3BA 4DN6A 4DT1B 4LFBB 2QP3A 2BFFA 2BOVA 4H35A 4BVKA 1EDZA 2BH2A 2AL7A 1U5BB 4IXNA 3RBAA 5C81A 1IM5A 3RU3A 4J1TC 4BLTA 2QT9A 2PTGA 2I5PO 4C5CA 4J0EA 1QKJA 1NM5C 3FSGD 3H2SA 3KE8A 3VC2A 1OBOA 1QIEA 3DWGA 4M83A 3MC1A 1EEHA 1Z07A 2JAHA 3H87A 3M34A 3UAXA 3AEKA 4C14A 4NFSA 2POCA 3WGLA 4QAQA 1UJNA 2YXBA 4REMA 3SQNA 4A8PA 2WZQA 1QRAA 1CR4A 1YJCA 1OI3A 3KFXA 4XYMA 3AKYA 3TMAA 1JVBA 3GO4A 1HE1C 1IY2A 1CB0A 1NVFA 4RD6A 2AJTA 1TA9A 3I0MA 1E9BA 3DE7X 4YRDA 5DHQA 2REQA 2XZDA 1BU5A 1H94A 4JU9A 3R8FA 1N0IA 2Z4RA 1T3HA 4GI1A 3A9TA 5BSTA 4D9EA 3EA4A 4PLZA 3L1HA 1IDOA 3UCFA 3TOXA 2QR3A 3HYCA 3KZNA 4E3WA 5HPYB 4YUYA 5LSAA 4CEIA 2VKTA 4LSWA 4FKMA 3GH3A 5AKJA 4M9XA 4ZQEA 3REGA 2J45A 4I7EA 4AY4A 3I30X 3WJ1A 1DJMA 5HTOA 4NOKA 4YCDA 1X3LA 4ARBA 1G8HA 3B60A 5DYGA 1UK7A 1SC4A 4DLTA 4FEGA 4PN7A 5DPMA 1P62B 1EG7A 3DV0A 1GPMA 5I9TA 1IM2A 2D0DA 1G64A 4IHAA 4TV8A 3GBVA 4DPKA 5HZHA 1YJAA 1KEKA 4JI8B 3I73A 1OVMA 3TCNA 4B6FA 1J5XA 2BMDA 2C4WA 3EPLA 2BFFB 2YFYA 3DOOA 3Q5EA 4XCQA 5F3RA 3WL4A 2FLWA 4O63O 4D4JA 4YONB 1IYZA 4ERNA 2Q1TA 4S1NA 3ZH2A 1XDGA 1R6XA 4P3KA 5CU7A 1EM8A 1ZIDA 3D8SA 1DXYA 1WTCA 3KLMX 3PHCA 1C3OB 4KE8A 5TPZD 4TYWA 4QAJA 1UADA 3P19A 3JATA 1U8CB 4LISA 3VVLA 3THYB 5F3WB 1WPQA 3GRFA 3ZLBA 4URZR 3GJRA 2VXCA 1VFPA 2QW8A 5FPPA 4Y2UA 2A30A 2QRUA 1S8FA 1UBGA 2BHTA 2HZBA 1RMTA 3G5AA 2BFDB 4QU0A 1XTTA 2W4MA 2B4TO 1WXDA 1SD2A 1BDJA 2C5FA 2QD5A 3LT2A 1N3BA 2R85A 4DM4A 5JAOA 1XRRA 1G20E 3A7DA 2REQB 3E2MA 2R1UA 2GWHA 2ZIEA 1LF5A 3ICPA 3NIBA 4BIIA 1NNEA 1IXSB 4EG4A 2W7TA 4BMPB 1GGKA 1ST2A 3FLBA 1YB6A 5C8YB 1U5AA 2F48A 4X62B 4C2BA 2OCBA 4MS4B 4PTYA 4MK4A 4WINA 4Q1BA 3SBDA 4CEIB 3KLNA 4WY5A 4KYIB 2JI6A 4EUFA 2PKWA 1U1GA 4IIHA 3QOWA 3DLCA 3TCKA 1SUBA 3CJRA 4C08A 5AKGA 3WYEA 1X9GA 3HJFA 2Q2NA 3FWYA 4YAWA 4Y30A 5CPBA 3PQCA 5ITVA 1OGIA 2ZI7A 5KOJB 2Y0EA 3LXXA 3DV0B 1JWAB 1UQRA 1W8DA 4IVNA 1OPRA 1UFKA 4MROA 4KXQA 3OF3A 4CQMD 1TJ3A 3Q5DA 4TLAA 4Q7MB 1KYZA 3UXMA 1Z47A 1B2LA 3D64A 4YXWD 5A9SA 2H51A 4IUBS 4LJ8A 6AT1A 5AJVB 2HCBA 4GLJA 3PFGA 3DBRA 1TVEA 5FIUA 3H97A 3PNBA 4LRQA 2BFBB 1HNNA 2XWQA 3NAMA 3DM5A 1ZY2A 4BLRA 2PLNA 5EXPA 4NG5A 1JHOA 1HXHA 1OH5A 1T6XA 4G0VA 3QEJA 1DP4A 4YJ2F 4O4IB 2IYWA 1J8FA 3HH8A 4MPRA 1GLGA 2CHVA 3WQSB 2AG1A 4J1SA 1EFPA 1QOPB 3OJWA 2X1MA 1W88B 2J0SA 1Z38A 4J0KA 4AK9A 3F8TA 4R6XA 3RHTA 3BMQA 1BAPA 1JJBA 2YWRA 2O9JA 3TQCA 1XF1A 2D0IA 4BGDA 2O5CA 1DC4A 4Q1EA 2FEKA 1F38A 3KETA 2I2DA 3OAAA 4KAFA 2C1EA 1ODCA 5JXGA 2BR5A 1EUCB 3RSSA 4HAXA 3DDZX 1NWCA 3QUSA 1R3DA 2NZWA 1BHJA 3LHFA 3TIXB 4DJTA 5IF3A 3UQYS 1KI3A 5C8YA 3HXMA 5LD2C 1I80A 1US8A 1RRGA 2GF2A 3BMCA 3OOWA 1RJ9A 5IT4A 2FFAA 1EJBA 2NWQA 1MPXA 3IQDB 4LGCA 4GI7A 5KVAA 1Z63A 1XNQB 1DPFA 1CRLA 1OUMA 4N4AA 2IX9A 2YS6A 1DAPA 5DRYA 3GFRA 1M7BA 2F4NA 3OLXA 2IHTA 3UA4A 1ZGJA 3B1ZA 4W1RA 3KJGA 4UTRA 1DFGA 4MNTA 4ZQIA 1ZXLA 2JDID 2QGZA 3AV3A 4CG2A 4EA9A 7ADHA 4RESA 2GPWA 1LRLA 3CCFA 4D3ZA 2DWPA 1VKRA 3CR3C 3MGGA 3K5PA 2QYSA 1SCUA 4Q1AA 2ZYHA 4ZEWA 3SYLA 3SZ3A 3TLZA 3OH8A 4PNPA 2PO7A 3VZBA 1F2TA 3CONA 1PWXA 5C1DA 2X58A 3EVNA 3QU4A 1EU1A 2EVWX 2VDPB 3HB9A 4LHWA 3B89A 1L1FA 4D9IA 3H3JA 4U8HA 4UDOA 4YRRA 4YMHA 2GN2A 3KG2A 4CKWA 4XEUA 2GS9A 3L07A 1X0XA 1Z83A 4TTVA 4U0KA 2WC1A 3SZLA 2R47A 3ZWXA 1U2PA 5JSZB 3QXHA 1GM5A 1EFKA 4X61A 4NZZA 3JQBC 4M9SA 1DEOA 2J46A 5BNFA 3FBGA 4NEHB 4X64B 1E4EB 2G7ZA 4A82A 5JYBA 2EX0A 1TU4A 3VNQA 3RKSA 4XCVA 5FNVF 1IPFA 3T5GA 4F1JA 3PWTA 4H08A 1YBMA 3WBJA 3VR4H 2CXSA 3G59A 3OPQA 1W0JD 1Z5ZA 1ZD4A 3PNLA 3QJYA 1SUAA 1C5KA 1N6HA 4UARA 1DCTA 1US8B 4BN0A 2GAAA 3N8NA 1QRRA 1T6ZA 4YT5A 4EUSA 2GLUA 4KE7A 2PO5A 2EFJA 1C30B 2CHFA 4BB9A 1TU3A 2YN2A 3CZRA 4ZMSA 3WIVA 4U7WA 2FP4A 1R4NB 4KCGA 1Z35A 5LCXA 3NBXX 3NG1A 4HNRA 3RFFA 3D1VA 4F56A 3GT3A 2IHJA 2YOHA 3EXFB 1XVLA 3H0CA 3N8GA 3BZBA 3KQVA 3OQHA 5KNDA 2JGDA 3ZE6A 1PR5A 4ZN6A 4LJKA 2FP3A 3AEZA 1JFTA 1CUFA 3A4LA 3MPOA 5MFZA 3QEBZ 1MO3A 1E9EA 2D13A 2RKBA 2IOYA 5HZGA 1GP2A 5LVAA 1QJ4A 2LCQA 5JBQA 1Z6QA 4RJTA 4DMRA 2IPOA 1TLTA 3JSXA 3JVIA 4CKWB 5CB0A 3VVMA 4X1IB 5AMXA 1CUWA 1DV2A 3AVYA 1ZOLA 3DZ8A 4M0PA 2P9ZA 5G1OA 5JSZA 2LKDA 4BL5A 1QCDA 3PXEA 1G4UR 4AKIA 1OYYA 7MHTA 2C7BA 2Q5LA 1SR8A 1YS1X 4Q3NA 4OFWA 1IWPB 3RROA 2QEQA 1NRIA 1WEKA 3SC6A 1YZYA 1YT5A 3EQ8A 3N8IA 3NBAA 4IXWA 2D3WA 2OKGA 3ABZA 4UC0A 2IS1A 5KJCA 3PFIA 4PWZA 4WZBA 1XXLA 1GY8A 1OU0A 4EGCB 2B34A 4QLOA 1R1DA 2BJVA 3GLQA 3MQ4A 2GESA 4ME6A 3X0DA 4YK7A 1N0VC 2AQIA 2BKUA 1FDIA 3V7NA 2GN6A 3A6PC 3ROPA 1WHSA 2PANA 1NVKA 3DTYA 1N8SA 5E9JA 4OQ4A 2E82A 4BKOA 1Q7CA 2P2GA 3VJKA 4UQOA 1T2AA 4RVUA 1T9GS 1WUTA 2P3SA 2I9PA 4IXDA 3EXFA 3E4DA 1TJ4A 3AP3A 3GU3A 3I42A 1THMA 4OI2A 5HE8A 2I1QA 3TIVA 3WIBA 4BNXA 3FNRA 1VE1A 4X1YA 2BR4A 2GN8A 1GKIA 1UWLA 2Z8YM 5J4LA 2VLBA 4LJSA 1ICEA 2ZI4A 3UCEA 3F6YA 1NQUA 1DAHA 1UBRS 2P4UA 3B85A 3BQMB 4MXDA 4FS8A 4LQ4A 1P1KA 2CKDA 5CDGA 1HPLA 1YS6A 3CNBA 1G2QA 5TX7A 5EXDA 4CNBA 3IOMA 4DCVA 3THXB 1O95A 3O92A 4AJJA 4DGQA 1IK4A 1D7OA 1U80A 1UEJA 3ESYA 3TZHA 2DAPA 2ZE7A 4MWTA 3NAGA 4DPLA 1GEGA 1AKVA 4YP7A 3MIZA 3ETDA 2CCJA 1AXEA 2I3GA 5FPKA 2V9CA 5LD2B 4ASUA 1RLUA 1U5CA 4G3XA 4PM4A 4MRPA 3VZQA 2OGUA 2C8VA 4NF2A 5IP5A 1N6IA 3MJCA 3C85A 3QMWA 3RE1A 3NM6B 4YAKA 3ZZTA 1Y48E 1LD3A 3JD1A 2OPBA 3UM9A 3EXHB 5GQSA 5SYNA 1IZ0A 2VBGA 3W6OA 1TE2A 3CVVA 2HU8A 2DT8A 1VIDA 1XJ0A 4BVJA 5CVTA 2IYVA 1PR1A 1FJHA 4OVKA 2XNDD 3SHOA 3FOAA 5A2GA 5EPEA 4CCYA 5L3QA 2ZCJA 2X5XA 3DMTA 1P5JA 3WTBA 4L02A 2XNJA 4F6LA 1WXWA 2RGXA 3PXDA 4X90A 5AHOA 1U6IA 2XUAA 1NHWA 4OKIA 1JVSA 1MJFA 1TM1E 2FZ5A 3PQDA 2LE0A 1J0BA 2ODAA 1DX6A 3ENWA 4ZAXA 1QZTA 4JVNA 1O96B 4H6PA 1F9EA 1SPXA 2CNKA 5KNBH 5F5LA 3ZLVA 3NRBA 2VSXA 2J8ZA 5AIBA 3IVGA 1NP3A 3WOHA 4EFNA 3OX1A 1OX5A 6Q21A 3M6LA 3OSUA 1NE2A 4MOWA 5L4LA 3CUWA 3A1FA 2FWAA 3OD5A 3DOIA 1XE3A 2Q1YA 4JN6B 3E3OA 3W5BA 5JNSA 1DAOA 1V11A 2IY8A 1F4LA 5ER9A 3HYSA 4NYIQ 4X3OA 1KU6A 3A10A 4EZEA 1QH0A 2UUAB 4D6XA 3VUEA 1K5HA 1EMDA 3MWKA 3VNUA 2C5GA 2HQRA 2NYUA 2VJBA 2QVXX 4N3BA 3WLTA 4BTLA 3FM9A 2J9XB 2WSSD 1OYWA 1YDHA 4HFRA 4HAVA 4J07A 1X80B 4KGDA 5AK6A 5MN6A 3COJA 4RUKA 1CUBA 1RR6A 1ZCZA 4YRQA 3O8OB 5BYBA 4EYQA 1WUJS 3DM9B 1A50B 1XLVA 2FMXA 1TQ8A 2FN4A 3IUJA 4LZZA 4FXPA 4PGFA 4QVGA 4RMIA 5AHKA 1PV4A 3H0EA 3VGJA 2X7HA 1KZ7B 3HLKA 3QKRA 3KOYA 4G9BA 2FSGA 1KR5A 4KFTA 3H9JA 3HNPA 4R0NA 1D4FA 1UBSB 3S2UA 3ZYZA 1XQYA 1M73E 4W5QA 4LV8B 4I81A 4FYWA 2MHCA 1Q1QA 1WF6A 2CT8A 1ZD8A 1N34B 1O6GA 1TKCA 1Y1LA 2PM8A 4LYJA 4EBBA 5FV4A 1M67A 5CA1B 3GP8A 3V8RA 4Q6WA 1BFDA 1JHUA 2HIHA 4D0RA 1G4HA 1OXXK 1M6NA 1VE5A 4AS2A 4M1TA 3DP7A 2F00A 3LPMA 4F46A 4LK3A 2LW7A 4M1WA 3JWGA 2Z8YA 5IG2A 3JR7A 2PCLA 5IC6A 1BKSB 2Q29A 1WXXA 3LC2O 3DGFC 4YPFA 4CKEB 2A3NA 3K35A 3CY6A 3MJDA 5JAIA 3NS7A 3OT5A 1F20A 3H11B 2ODEA 5DH9A 4ZJYA 1L5MA 3L82B 1KAEA 2NAPA 5GOTA 4RTNA 1ANKA 3ID6C 1FY2A 3OWOA 1UXGA 2PVPA 3W6ZA 3WKDA 1N25A 3QOXA 4CR6A 1Z16A 1AN9A 3QF4A 4FFOA 2IW1A 2A1UB 4LDPA 3VTZA 3TKLA 4F3KA 4IILA 2OGWA 1C9MA 1EX1A 1QZUA 4Q3KA 1PI3A 4OFBA 4YRPA 1N33B 1EWYA 5TB5A 4JI6B 1J0CA 1GNVA 1QQTA 2H59A 1TRHA 3NETA 3PKZA 3WYAA 3VH4A 4F4FA 2AF4C 5CD1A 1AF7A 4N0MA 2VNJA 2YFKA 3FKQA 4K6HA 3P7MA 3RFUA 3DGEC 3SYTA 1U1IA 4LG1A 3TGWA 4YJ3A 1CY8A 1BMQA 1W48A 2X4GA 1H2AS 5EJ5A 2J0UA 1Q17A 1KKUA 1N2ZA 2QENA 3D6FA 3FVWA 2C78A 2X9GA 3EQ7A 4ZGWA 1MVLA 1NLYA 4I14A 5C1OA 2O5EA 4OIMA 1E7QA 3KZMA 4XIGS 3GEHA 3LRPA 4WUVA 4BX2A 5AOBA 4R05A 2W6QA 4MPDA 2WSYB 4MUIA 4MWEA 4HFJA 3VPSA 3CEPB 1XJCA 3GJSA 4MQUA 2MMCA 3NNSA 5TS3A 3PJDA 4K46A 1ZBDA 4QPPA 4R3WA 1RBYA 1OR8A 4RF5A 1SBCA 3VXKA 1F4VA 4BX3A 3AM5A 1JA9A 2NTNA 3RTDA 3CZ5A 7ABPA 3GWGA 4H7KA 3CLUD 4IIJF 4WADA 5FD8A 2H4YA 4ZYUA 4A36A 3A3KA 1AKRA 4M1MA 3ZNOA 4GI5A 3WA6A 1ZMOA 4KPEC 1I3CA 1ZW6A 3X1KA 4E07A 4DLBA 2CMFA 3AVQA 3V7YA 1LFAA 1YOVB 4B8YA 2NUAA 1WIWA 2Z58A 3H4IA 4L2IA 3ZZ1A 4R68A 4FFMA 1IEVA 2V0NA 2OM6A 5FPYA 4YDSA 4E22A 3IQXA 2IYYA 2CHUA 2FCAA 4F84A 3BOSA 1TUBB 3WGMA 1SQ6A 2W0SA 3F5QA 2PA0A 3NIDB 4R2MA 4X20B 2IDKA 4Z99A 5F2KA 1NNI1 1FFAA 3J81k 1MDFA 3UXEA 3F78A 5L7YA 5L4SA 4WHMA 2CDAA 2CV1A 1CJKC 3O8LA 3ORHA 5T4HA 2DOKA 1Q0ZA 2NXJA 3RFVA 2PX6A 1IB0A 5CDHA 5BSWA 3CEHA 3GCXA 2C95A 3HSYA 3PL1A 4MS1B 4M1ZA 4WGGA 4EEXA 4EI9A 1P29A 1VLLA 1ZJ6A 1JHAA 4AZTA 2FRDA 3GHYA 1HWYA 4AF6A 4TMVA 3G9ZA 1G8SA 4XSHA 2BHNA 1G3MA 5LZ2A 3MT0A 4GMDA 3OCWA 2BTOA 2HK6A 4AULA 5TXGA 1ENYA 4YCLA 2XZLA 3BF7A 1CRZA 2C2ZA 1QU3A 1JJAA 1T9KA 3ZV6A 4DBLE 4LX0A 3N2NA 4PG4A 3ITNA 1E0AA 5AM0A 4FHZA 3IVAA 1JYEA 1ULSA 3FOFC 1I3KA 4LWPA 4IUYA 3TD2A 5KTTA 4UUPA 4WBNF 2D54A 1Z37A 2NXWA 3N59A 4FSHA 1T43A 1OIWA 1TRKA 2AG8A 1S1CA 1GNPA 1JPVA 3L06A 4L57A 2WLSA 3DT9A 4FFLA 4URHA 5CGZA 4ZVNA 5E3HA 5CCBA 4S1WA 4QUBA 1JFFB 1VMAA 3J7TA 4G0YA 2HSWA 4AIRA 4DG9A 4EF6A 3GUVA 3I9KA 4H1UA 3RV3A 1KI8A 1WMAA 1V7QA 3KAKA 2Z3ZA 1UXIA 1Q5PA 3MCTA 5L4NA 1D7AA 1AU9A 1KYIA 2J0QA 1OCEA 4ZODA 3BWYA 4JYAB 4FE7A 4YXFA 4LZPA 4F4DA 1PFUA 4CMIB 2XPCA 3QX9A 5H70A 2OHIA 1PLKA 4RU1A 3WJ7A 4C4AA 5C5CA 5BRNA 1AM4D 2P6PA 3WR5A 5ALJA 3KD2A 2XYGA 2Z5GA 4W5JA 1N2HA 4NDZA 5I47A 3S81A 3N7UA 4HYQA 5F1KA 1B0ZA 1Y34E 3FE2A 1R0KA 1ECFA 4M8SA 4WGFA 1LPBB 1YZKA 5B36A 4E3ZA 1MPTA 2RAPA 1I7PA 3G0GA 3ML1A 4L0MA 2OOSA 4MI1A 2FA9A 2Z9CA 3CWCA 1OGYA 5HWSA 1E0JA 2ZYSA 5JOQA 1FSFA 2EV9A 3DZBA 3SVLA 3AF1A 4IIJB 5HZKA 1KL7A 1P4HA 2HV8A 1XMQB 1FYXA 4RVSA 5ALEA 2O8EA 3IDFA 1NX6A 3A1DA 4NE2A 5J2UA 4JBGA 1N3YA 2ACWA 1GA1A 1XL0A 2AEEA 3HB1A 5AKHA 4ACBA 3BL8A 2ODQA 5I5GA 5IVPA 2OBYA 2QD2A 4IYRA 4UPEA 3B53X 2OLJA 1FP6A 4OLFA 5D86A 3R09A 1J56A 4EG5A 2JI7A 4YVFA 3L40A 4PEVA 1A5AB 1ADFA 1L7PA 3QWHA 3S2IA 4KDRA 5HK8A 1R16A 1KWGA 4JJEA 4MZDA 1PS0A 2XTAA 1S9HA 2IWRA 3UN1A 5JD4A 4IX1A 2QBYA 1AA6A 1EAYA 5CCDA 3TRDA 1F8UA 5B7PA 4D82A 2PNFA 3GFBA 1H4TA 1YZQA 3BMNA 4MQBA 2B5VA 3BAZA 3IESA 1Q16A 2YNMA 4WCFB 2VT2A 3I2FA 2CWDA 2OCKA 2WKQA 4EI7A 1VJGA 5BRAA 4E46A 4DFDA 4C4SA 2HJSA 1GTJ1 1SIUA 3BMXA 1JQKA 3B6ZA 3HB5X 3H8JA 3P9QA 4IDGA 3ZU6A 4CT5A 3IQFA 3HK2A 2C88A 3P27A 5JS2A 4NBWA 4LIPD 1PHPA 3LL7A 1TFRA 3V32A 5DM0A 4B3JA 3A4VA 3CH7A 1B3RA 2BDUA 2GZ2A 2VK2A 1LX6A 1YC2A 2ATXA 3MMPA 4QDJA 1Y5RA 2JHAA 2RI1A 3N2IA 3WLRA 3IAS1 3HXQA 3D4PA 2R2AA 1G6Q1 4NZNA 2EYQA 5E1OA 3ZN2A 3OBBA 1YRLA 3EB9A 4LBYA 3F9RA 5KUTA 1IG0A 2YHAA 3SX0A 4QBIA 1XTIA 2Q7XA 2HH9A 3BSSA 2AXEA 5BP7A 5KYNA 4TTRA 9ABPA 3KQLA 4AG3A 4X93A 1M7GA 2ZB8A 3BZWA 2FW6A 5JAZA 4RQAA 3C7CB 4LJ7A 5GZ1A 1EK0A 2PRKA 5BUQA 1Q11A 3P0RA 3P2IA 4UOEA 3PR2B 1MT3A 2VJQA 2ZS9A 2B1QA 1A72A 3ZDBA 1W5AA 2C29D 3V8VA 2XQFA 2ACKA 2JGAA 2QVZX 4Y1EA 3IUSA 2QBYB 1IL0A 3OM9A 5F51A 1JLKA 4L8FA 1EA7A 4LA4A 4MQMA 2H2GA 3G2NA 5JO0A 1IOZA 1A9QA 1T8PA 1C8KA 3SKVA 3VR6A 2DPYA 3DB2A 3GVIA 1XQ1A 3AY0A 3I0ZA 3EFOA 3KWMA 3L7YA 4UFPA 5M5BA 2ZUSA 5SZKB 1R0BA 1AVTA 1XU4A 2Z2XA 3IB6A 4TSFA 3SQMA 4C89A 3B12A 4N6OA 2UXDB 2AV6A 1WUHS 4I2NA 4Q7LA 4C0SA 1K89A 1KQFA 1U4SA 3L0ZA 3UT5A 2SNIE 4GXQA 1W5SA 3OWXA 4JXJA 5E6UB 1XDSA 2VSNA 4D9FA 5A4JA 2JKVA 1NVUQ 2XB4A 2ZCVA 4ZU1X 5KC9A 3I9FA 1LNQA 5BW5A 3RG8A 1HY3A 4FR0A 1DQRA 3KZKA 3LSYA 1MAVA 4KLCA 3TKYA 4AIIA 3ZDCA 1KMHB 1P7PA 3EGIA 4G1BA 4NWIA 1Z28A 1IN7A 3VJMA 2AT1A 4R8SA 3W5CA 2QTWB 3E1KA 3VNBA 2KHZA 4UNNA 5CD9A 5L3ZA 3T1YB 2P3QA 4F85A 5J2UF 1KAHA 3IKTA 1NMQA 1O57A 2DJ5A 3WQHA 4R9RA 2K2QB 3WGNA 2A0KA 4MVJA 2MSNA 4K2HA 1VKNA 3IIJA 4MULA 5FI0B 4B4KA 1QS0A 4CPDA 4QGFA 3H42B 3KXPA 5DX8A 5F3DA 4ID9A 2NMVA 1LBEA 3L7DA 5EZYB 1ZCJA 4EHFA 3LHIA 2FFHA 2QWXA 3A9UA 3QU9A 3LVRE 2LD4A 4A91A 4UCQA 4KITB 2GARA 4L0DA 4A9AA 1HZZA 3E0QA 3F6CA 2A58A 2QQEA 3QKTA 5LBIA 4HDOB 3ICCA 4TTJA 3S27A 2CHEA 5I7HA 1J39A 1O9HA 5DJ5A 3R3UA 3VVBA 1I33A 4QTZA 3DKPA 4D25A 2ONKA 2KSQA 1NJ6A 2VS1A 2PX2A 3MYYA 1H69A 3RWOA 1EVZA 2NSHA 5EJIA 1H1DA 2HUNA 2YHBA 2YNMD 4JLUA 4WN9A 3TSCA 5KVSA 3W5VA 3LMKA 4KIFA 3PA8A 4LK2A 3EFHA 4P5EA 3TE7A 1KAGA 4XVUA 5C2JB 3PHJA 1M2VB 1BWRA 4UZEA 3LHKA 4LAFA 2P30A 4FGKA 3A4NA 4XGQA 2C0PA 4RK6A 3VJLA 1ZFNA 4HGRA 3TZ6A 4EKYA 4ZDKA 3H75A 4MKFA 2I7TA 2ZE6A 1TDJA 2P0EA 1VP3A 4KQMA 4M0MA 3WIDA 3OQ6A 1QIKA 1IPHA 3I9JA 1Z36A 1KI6A 1YZHA 1Z13A 4PAQA 4PRLA 4WZAB 5LZ7A 1ACJA 1SXJD 1XVUA 2AC7A 2B6HA 4WBNA 4X41A 5D6OA 4KREA 4BNHA 1I24A 3R9WA 2C2WA 3K2BA 1KHTA 2AOVA 5AW8A 4RHEA 4MGHA 4CMGA 1W19A 3I76A 5TQVA 4S2UA 3UO8B 5EMJA 5AXBA 5CVJA 2G71A 1T2FA 3GA7A 2HJRA 4M2LA 4LY3A 5I3ZA 1HTWA 3USCS 4R4JA 2BH9A 3UWPA 1D1PA 1DEHA 4PG8A 2X40A 3PGKA 2GJSA 3D31A 2BSXA 1LU9A 2BC9A 2P9HA 2PS0A 3VR5D 4LHVA 3ZBTA 2V0GA 5EHNA 3ZOKA 1GTVA 2QGFA 2DCMA 5KOIA 4XPIB 2IE8A 1K7YA 1VG0B 1VJRA 2IUSA 4OY3A 4P3XA 2X76A 2XKJE 2GTPA 2XUIA 2E4YA 3NM4A 4X6YA 2QLLA 3VQTA 3QU2A 4EMUA 1JBEA 4L9SA 4PYMA 5K0GA 1O54A 2AVNA 4TMZA 3FSEA 1NXPA 1I1HA 1Y3IA 3EGDA 3AVWA 5LYYA 4BB0A 1D6MA 4F4UA 1L3IA 3UMSA 2FLVA 4ITRC 4W8OA 6LDHA 5HIKA 5L3SA 4EPVA 1UT5A 3C3MA 2ZBEA 4XM0A 3VOTA 3CF6R 4D8TA 2BBTA 3C41J 3N8HA 4I36A 4H60A 1K1EA 4BO8A 1ZK3A 1NR7A 1UPXA 1M72A 1XEFA 2AC4A 2H5EA 4D9MA 3MCWA 3I28A 3FWPA 1C0LA 2N9UA 3Q1KA 4B7CA 3T35A 5B1YA 2ATVA 3OPYA 1JWLA 4RTJA 1WE2A 1QYXA 2O54A 5FOUA 5B1HA 4NCKA 3DL4A 4M8NE 4DRXA 3HO1A 1GGJA 1Y7HA 2IPMA 5U4QA 5K51A 3STVA 3ZVMA 1QHFA 3WLOA 2N0SA 4YBRA 1Z0DA 2A33A 3AF2A 1WZCA 4RELA 3KUKA 1U2TA 4JEIA 1A9SA 2JCYA 2V7QD 4BQNA 5D6NA 3II6X 1IIRA 1IH8A 5DB4A 3PVSA 2DKOA 5CITA 4DAEA 4NMLA 1L4LA 2BHSA 2BHRA 3L05A 5D3ZA 5FWDA 4JQCA 7GPBA 2C5BA 4F21A 4DDTA 3GLFB 3TOZA 4BFZA 2ZR9A 4R7ZA 2OP1A 2MU1A 2RC5A 1C9DB 1T1SA 1Y89A 2O3UA 2I6UA 2IW3A 3PQ7A 2ECQA 3JXEA 5CFOA 1PJ2A 5I8ZA 2DQ4A 2AFRA 2XVAA 4TQ9A 1XIVA 4U2KA 2MR5A 3RVKA 1N9GA 3ANLA 3IULA 5MDHA 4I1PA 1T10A 1ZI8A 2BELA 4DEVA 2WNIA 4OGGA 3G49A 4CI0B 1SVKA 2QR2A 3ZGXA 1RRCA 3L1VA 1J8VA 1JEAA 5JAMA 3ANXA 1W2GA 3LDAA 5EMMA 5HF8A 1A76A 3ZHZA 1P7WA 4PIVA 2ZANA 5HS4A 4XOIA 4L3WA 4MI3A 2WU4A 5ITWA 3EPJA 3PIDA 1IK6A 2W6NA 2XIJA 2Q27A 3CWQA 3GDGA 1MKYA 5JDCC 1WSBA 3C5CA 2XF8A 3Q8WA 2Z5VA 3TQOA 3WRYA 4C0WA 4KC0A 3QFHA 3LFUA 1CDDA 1UC8A 2OQRA 4GOND 3ZQUA 2Q3HA 3UJPA 3OPYB 1HOTA 2Q5EA 2IODA 4DRXB 3BM5A 3W5UA 2WFLA 4BECA 1CDZA 2Z08A 3ROGA 2WHXA 2OCGA 3EPRA 2FPKA 2IUFA 3JQAA 3I92A 4Z4GA 3HI4A 3O75A 2QD4A 1Q1NA 2BI8A 3BPSA 5CVUA 2O8CB 1KO8A 2D0PB 5CBKA 2C4KA 3TNYA 1AXRA 4R2IA 5BN4A 1F8YA 2WNHA 4QECA 1NRXA 4Z3OA 1HYGA 4H16A 1AY0A 4GQBA 5FYDA 3T0IA 2PZGA 3PQ6A 1UDXA 2RGNC 5IMSA 4PGMA 1JHXA 4M21A 5JWOA 1XCMA 2CJYA 1FFEA 3ZIDA 2A5JA 2I03A 3B9BA 1DWUA 1I7LA 2X0EA 1RACA 4PNEA 5ED4A 4ENQA 2B3TA 1ZK4A 4OXIA 3HCOA 3GAAA 4XLTA 4DLXA 1DHRA 3K0CA 4DMUB 1E1RA 1G8YA 3BERA 3TINA 2P4SA 2IDZA 4ZARA 3V8BA 5E1DA 2MSLA 3G1WA 1J00A 1TJPB 4N01A 1JEEA 1PG2A 4PHHA 3VV3A 3CHYA 4WLVA 4HZGA 5BYKA 2B20A 3QVJA 4AZVA 2ZBFA 3VKUA 2QN1A 3GJZA 4CNQA 1U0EA 3AJRA 4D0GA 4O4IF 2TMYA 4II2A 5JFTA 4ZIRB 1EUZA 2MSKA 3UMCA 4MV6A 5CFMA 2NQTA 1UINA 1KWKA 2ZDGA 1RW4A 2ISSD 4K1XA 3G89A 3X43A 3NGLA 4C6SA 2ILVA 2PGOA 3Q3IA 4NXNB 2UZIR 5BWNA 3MELA 1TCUA 1GPKA 4EJSB 1SC1A 7REQB 4MB6A 5BPHA 4L15A 4FW9A 5ALNA 4CM4B 2FJPA 4QUDA 1RU3A 4YT8A 1LX7A 1X7HA 3NT4A 4D0LB 5KO2A 1JFSA 4LJ4A 3FNIA 5AJWA 4KE9A 4BFSA 4FW8A 1P7VA 4K03A 1LQ2A 3C4QA 1MEEA 1O9BA 2E0IA 3IE2A 4HK4A 4YRLA 3KELA 1NW5A 4MUFA 5AVKA 3DA8A 4C0AC 4FCCA 3RUDA 2PHZA 2PFGA 1WPRA 2RH5A 3E3AA 2Q9UA 3WGQA 1M34B 4HP8A 1ZHOA 3P0JA 3PXXA 4JSRA 3D3KA 4G8BA 4ZT7A 1TO2E 2E2WA 4IXTA 2GA8A 3QWIA 3ADCA 4HN9A 1NPDA 2ONYA 5C7YA 5AYVA 4E5UA 3CPEA 4TVBA 3ON5A 2D1FA 1T3TA 4JBNA 4OHCA 3U62A 2C1XA 2AMYA 4UXHA 5KQGA 3QLJA 4EG7A 2B2CA 2CVHA 3AHFA 2A84A 3C3XA 3GELA 1JI3A 2QM0A 4N18A 4RPCA 2NXNA 2FHPA 3HO6A 1J22A 1N0WA 3QM1A 5YASA 1EJ6A 3GLHA 3RM3A 2QU8A 2GCGA 2JAPA 4RIGA 2X3UA 2ZBRA 4R2JA 2RGUA 3GROA 1R8SA 3IP9A 4OBBA 1BVHA 1DIRA 2PMDA 1SFRA 1ZXBA 2ZSUA 4WKNA 1HLGA 2VTBA 1YDGA 4LFAB 4MWGA 1F5NA 2YJNA 4MARA 3GFVA 1SUIA 3QMMA 2C2HA 3QP9A 1UPBA 3PEWA 3AT1A 3OA0A 3RKRA 1APBA 3O4VA 1I13A 1KEUA 3NUGA 3SS7X 3C5VA 5SYAA 3WRXC 3ZD7A 3DQPA 3HL4A 3WWPA 3K3PA 1LV7A 4BFYA 4XASA 4CM4A 5KIAA 2G06A 2XMBA 1IONA 3SX4A 3DE6X 4AG5A 1ECBA 2BRUA 4RVOA 5ICCA 3G0BA 1J8YF 2BD0A 1BYIA 5H82A 5IBRA 4EX6A 2XUKA 1KARA 3F49S 1M66A 5EP1A 1L4HA 4BZQA 4U6SA 2ZBUA 4BYMA 1NVVR 1RAFA 2EKQA 2M6RA 5HEKA 3S99A 4BU0A 2VAWA 3MD0A 2WKWA 1TIBA 4IWNA 1YTUA 1UKYA 1EFCA 3JVVA 4Y6GB 2RGCA 2J6BA 4E4RA 2Z6UA 4GZ6A 1N3IA 2IQ5A 4MR7A 2YX1A 2B37A 1EGHA 2JIDA 3H4VA 4KZPA 3BGWA 3GIWA 3HN2A 3BGDA 3TZQA 5EJ7A 3PEVA 4JB8A 5JARA 3CUTA 3DB1A 2NTVA 5GJCA 4RULA 1IVYA 3CNHA 1DWOA 1II8A 2H1CA 2ZS8A 3PJFA 2QTCA 4ZU3A 3AHEA 4RADA 1C2TA 3FOWA 2EJCA 3X1JA 4EO7A 3OJCA 1JAIA 2VPPA 5LKRA 1U0FA 4RV4A 1S2DA 4C1NA 1E79D 1N7JA 1U0OC 2V4ZA 2G9ZA 4MCHA 4GKKB 1DTWB 4J0DA 3PGA1 2GEJA 1TKBA 2HSZA 2ZE8A 1IBMB 2NV0A 4DA0A 1GDDA 1TX4B 4AWBA 3BD7A 4B83A 3CMCO 1R50A 3G8BA 1M7HA 1WMSA 2A9FA 4IGAA 4Q1DA 2B7BA 3RBXA 4AWAA 1FF9A 2PU5A 2WFMA 1MC8A 3O8RA 1JMKC 2JIZD 2XMQA 3KALA 2IXAA 2WYIA 5FBKA 2AN1A 2OE2A 3IP5A 3OQJA 3THWA 1E6EA 3L7NA 1UUFA 3KUXA 3MB8A 2HSJA 3OZXA 4OL0A 4H1WA 2WE7A 3AM4A 3BXOA 3ZHRA 3MAAC 1CRWG 1EVKA 1RRVA 1PV2A 1EFLA 3WADA 5K4HA 2CL6X 2XDQA 3KJEA 3CVOA 1Y80A 4JB3A 2HSEA 5IAEA 3FOBA 3LGAA 1J5EB 2E55A 1BMFA 3L7IA 1RKUA 3HJUA 1JFVA 4GI3A 4DA4A 3V6MA 1RMYA 4CMJA 4F2GA 1TLFA 4QLAA 2QTRA 4CL8A 1T6YA 3CINA 3HYRA 5J23A 4IHJA 2E4VA 2W83A 3PUIA 1FTNA 3OE7A 2YIJA 5EYPA 3GQVA 3W8EA 3X2EA 3ZWWA 5JJBA 3QTBA 1UPAA 2CMDA 4C3VA 1QIDA 5JH7A 1V8PA 1T9GR 5C7LO 5C52B 2ROQA 4UUOA 1CD5A 1DAKA 1E2JA 4MR7B 4TXJA 1D0IA 4ZAGA 2B4QA 3ZWAA 2CXHA 2R8OA 5EZ5A 5CDTA 1RWWA 2JFQA 1XK7A 2PBFA 4D4GA 1YE3A 2DR3A 3FZYA 2A0FA 3M5PA 4CV1A 1SMKA 3NYIA 1G8AA 1FJ2A 4U5QA 3HY6A 3X2FA 1SVIA 5AKEA 5L45A 2Z2JA 2Q99A 3C5WP 2VHXA 1FU8A 1NKSA 1PFVA 1C4XA 3IAM1 3QPCA 1RM4A 2WAMA 2FZCA 3CKKA 4FFBA 4MJXA 4L07A 4DV0B 3VVCA 4ND8A 4EA6A 1MMFB 3MOSA 1P7CA 3CSSA 4GIBA 3MFQA 5ILGA 4X54A 1M34E 1O94D 2W71A 1L5KA 2VUIB 5F7OA 4UDNA 1TO6A 2G1JA 3U7QB 3JQDA 2OEPA 2UYGA 2UYYA 3DAYA 3KJFA 4G1MB 4KQ9A 2ES4A 3KVOA 2R1TA 4QOIA 3R0VA 3RRMA 1TU0A 3MMSA 3FCAA 3CFYA 2PLAA 4YAGA 3BTOA 3DPSA 1WP9A 1NASA 5FTJA 1U0SY 2ZYTX 2HXYA 2Y27A 4O25A 5DP1A 3W4KA 4C7MA 3BULA 1PNVA 3WC4A 2IOFK 4JL5A 2PR7A 3P0EA 3E3LA 1CNEA 1NW8A 2JFWA 4KMSA 1R88A 3O2JA 2F1JA 4KN6A 5JCOC 1M33A 2D1SA 1KMCA 3LUBA 4L4RA 1ORVA 2Z30A 3CX4A 4CM7A 1ZD2P 4M7WA 2WOOA 1DKMA 1U31A 1ZCFA 3FTCA 5CFNA 1N7IA 5JH7B 3SLKA 1XHEA 2H54A 2HRRA 5J59A 4WRRA 1L5NA 1FFBA 1UMBB 1XA0A 2HOQA 4OJMX 1E3IA 4D57A 2VNSA 2V65A 4L27A 1YHNA 3LD9A 3RRFA 3E7XA 1R3UA 2CXXA 5A4DA 2D5IA 1E2EA 1GGMA 3TUZC 1VHLA 1G55A 4X3CA 1E0SA 2OK7A 2RCNA 3LA8A 4J2HA 1GT91 3L5OA 4UM9D 5HQTA 2F3TA 2YMQA 2ZAMA 4WK0B 4BMNA 4U7FA 1EBUA 3TRFA 1ZHFA 3PE4A 4TKLA 2D06A 2RI0A 3EUWA 3FYUC 4UMEA 4YNBA 5AKIA 5GAJA 5BVHB 4BJHB 1KYYA 3FGNA 2YHUA 3KHKA 5AOVA 3UFXA 1RPZA 3JAKB 3PEUA 4BLSA 2Z1MA 4XWTA 3PB3A 2EERA 3FMOB 4GUDA 4BV8A 1NBIA 1T5HX 2FPLA 1LC0A 2R1TB 4B3SB 1QU2A 5HUJA 1KJYA 4NAHA 2QZJA 5C5IA 4A0FA 3IXLA 1JDVA 5JHHB 2JFUA 3EDCA 2XQJA 3P9PA 4Q3OA 4HWPA 4US2R 4MUAA 4UTZA 3IPRA 3ISJA 2VI5A 1Q7BA 4CODB 5HJ5A 5PNTA 2PYIA 2WSBA 3UUEA 3QBDA 4PVCA 5K0ZA 1UBHS 1UC5B 4POAA 5IJWA 3PNVA 2FPUA 3Q8LA 3G0HA 4JENA 3ZEIA 3OUZA 5K01A 4GDFA 1XZGA 2ZAYA 2ZUUA 2OA0A 1E2HA 1PL6A 1Z0ZA 1Z75A 2OB2A 2WKSA 3ZZMA 3NWEA 3FZQA 3JARA 3KOOA 2D2VA 3U0VA 1ISMA 4IJVA 4B35A 3CSDA 1CSEE 2AR0A 2DQYA 3NH9A 5FO0A 3UXHA 2MINB 1UXHA 5BN3A 2Y3IA 1AS2A 1N5DA 3C8HA 3DMRA 3I37X 2O8DA 3WDLA 2EJTA 3ROQA 1DTSA 3FYHA 1C7EA 1HE2A 1RPNA 1S8NA 3KBOA 4RHTA 2NACA 3UOGA 4BZZA 3BH0A 1IN1A 1YE5A 1SBNE 3GJ0A 5DTQA 2ZXUA 1E4VA 3CLTD 3DMGA 3ZBQA 3UFXB 3ZY3A 2JFNA 3TLCA 3HCEA 5CCEA 1PN3A 4DT1A 1KSJA 4QSMA 4D96A 1JAXA 4K6OA 5FR1A 3E1GA 3VYVA 4J7AA 1C7JA 2NNWB 1NVAA 4ZCTA 3HRIA 2V6GA 4HX5A 1F5SA 2WWTA 2ADMA 2NV2B 3IIIA 4TVKA 1SKUA 3B1VA 3RVBA 4F5ZA 2PZ8A 4XCXA 1HETA 1PRYA 5JU6A 1DI0A 3OSZA 4P33A 4ROSA 4XYEA 3A1NA 3NHZA 4YUVA 4QPZA 4UDYX 4ITVA 5HQ3B 1K63A 2ANCA 1SK9A 3BUSA 4UZFA 4TMTA 2X19A 4CM9A 2JLQA 1IBSA 4OJTA 1BVYF 2JKZA 2W93A 4J1TA 2FCRA 4K3VA 5DIZA 5K4AA 4BAGA 2CDRA 5HILA 1KH1A 3H86A 3JPWA 1B2RA 4RD3A 3VISA 3BDIA 2EFGA 3SR4A 5A4KA 3RUHA 3GXBA 5BSGA 2PUWA 1DMRA 3F74A 1E8MA 3MWDA 3ELWA 4C3UA 5LXTF 3ROZA 1R27A 1Q0RA 2FZGA 1JIJA 5DGXA 2EG9A 1OIXA 1BTOA 3EVCA 2XGMA 1N2IA 2WV9A 3IO3A 1FBTA 2XQVA 4BQSA 2GCIA 3L7OA 2CLHB 2JF0A 1WLYA 2RJNA 3KLBA 4YJHA 3T7TA 3X3HA 1PUIA 2WZDA 3QXSA 4CQMA 1XCGB 3B1KA 1NU8A 1T25A 3SJ7A 4Q4HB 1QHXA 2VDRB 1H22A 4BHTA 2JLXA 5AR1A 4PLPA 2O7NA 3MPUA 1BGXT 3PHBE 3ZY6A 5K0EA 5JY1A 3VI3B 2YIVX 4TYNA 1M8KA 2FRVA 1Q20A 1HDXA 4M98A 1YASA 3ERCA 1CB7A 1F1JA 4O59O 2NYVA 1AUOA 1AUPA 1W8IA 1CXZA 3A2LA 3M6MD 3F1KA 1LPSA 3RTEA 3SYMA 1TF7A 4WEOA 3TZKA 2ZLBA 2ID4A 4IH1A 2BE7A 4JWKA 4V3CA 3SM3A 1JZTA 2CYBA 1YR8A 4HDRA 2PRZA 3GNTA 3QHQA 1M75A 3BJMA 3NZEA 3BORA 5DI3A 1SB9A 2DFPA 1NI4A 4X6UA 1F12A 3WRWA 4YRNA 1GNTA 3RC1A 4B8ZA 5T3UA 4U3JB 4DCOA 4KOEC 1QH1B 1ECGA 1CY6A 4O02B 5BR4A 1WAMA 1Z22A 3D3QA 4F4IA 4ZVVA 2JS7A 4K6MA 1CUJA 1S01A 3BXZA 3TIIA 3E0XA 1GR1A 2Q62A 1K86A 1QCZA 2GCEA 5CX1A 4XGKA 5M29A 1N2CE 1WB5A 4J91A 5HSGA 5FWXB 3CW8X 4JHXA 1T9CA 3AR3A 3E5RA 3SOZA 1U3UA 1K0UA 3W1WA 4GYKA 5K09A 1Q91A 4KSBA 1STOA 1VRWA 4GYJA 2VPZA 4GF5A 1FLDA 1EHIA 4N47A 3U4GA 3JQFA 1E5LA 1C9EA 4NOJA 2FWBA 2WPDD 4KQGA 4E13A 1L2TA 1PR6A 1GPWB 3PFNA 4M87A 2ZVJA 3R6DA 1R9NA 4HGOA 5J43A 5JNRA 3U5TA 1XVAA 1ZA1A 2W8BA 1RQXA 2AVDA 3K1ZA 4Q4HA 4C0QC 1T3LA 1LW7A 2IHBA 4J0CA 4NDNE 1S7CA 1VCHA 2X4DA 1ZGHA 4QPJC 5DHUA 1L7DA 4D3YA 1C9KA 1Q0QA 5A1JA 4KE6A 2P75A 4MA5A 1I2MA 1X3SA 2VXOA 4URYR 3A32A 1FFSA 1BD3A 4J9UE 4JJKA 2P9EA 4BE7B 2BGLA 2XUZA 5E9QA 4E2ZA 2P9FA 1J99A 2AI3A 1IZ8A 2QQFA 1YBFA 3MTBA 4I4TB 3OICA 1IULA 3MOIA 3OO1A 4QPDA 3MS2A 4NU0A 1MC5A 1FFCA 3QWFA 1VIAA 4JUCA 4KDEA 2OGZA 1JIQA 1DQSA 2Q3DA 2R97A 1M54A 3DMYA 3HVJA 1UFRA 2FWJA 4JEHA 1UH5A 3R0IA 2BDTA 4EY6A 5JSYA 3HEMA 1OLSA 3DNMA 3NHAA 1BSVA 2A0XA 2YXDA 3C8ZA 1CR2A 3EVFA 1ST3A 3EZXA 4FGLA 3RCBA 3VRHA 5IVKA 4DCPA 1CVLA 5E9AA 1DDOA 4AMUA 4ESEA 5IKEA 2A94A 3W05A 4OHZA 3T7SA 1CUYA 2PQ2A 2HK9A 3RNOA 2BGRA 4JJIA 1B8VA 1G6HA 5KJFA 4PRYA 4YUAA 5DBFA 4NHEA 2AN5A 4D99A 1U1DA 1XA3A 2X9VA 3E1SA 5L51A 5LC1A 5BR1A 1NZJA 2PLWA 2NYRA 3DTVD 1S2NA 1ZONA 1S02A 1EUDA 4HXYA 4Q4AA 4QPNA 1Z12A 4LYDA 4RPLA 4FDMA 2DWCA 2ICAA 4RZSA 3FKSA 1J7JA 4G0QA 3T7KA 1G38A 3KZOA 4NSNA 1AQIA 2GVNA 1SXIA 1WY7A 3KYCB 2AR7A 4ZI7B 4IVPA 3CH5A 2PRYA 3AW9A 4NBTA 1HE3A 3M83A 3PJEA 5BN5B 2XGGA 2WHEA 3OFND 4UEKA 3AJ8A 1M5UA 3O9MA 2PK3A 4QFBA 1RAIA 3I2IA 2VYND 1AMUA 1FP4A 1TAGA 2YBDA 4KW7A 4LZLA 1I3MA 1G18A 3NTUA 4B4UA 4Z51A 4BKRA 5KS2A 3UPTA 5LLTA 2EC5A 2ZSKA 1NG1A 1VRCA 4FILA 3A6HA 1JT9A 2ZR7A 3NJ4A 5EIOA 2G5GX 2GKOA 4QM7A 5JO9A 3PKIA 4M88A 2GXUA 4EUEA 1L7VC 3D3EA 3TN7A 1NR5A 2QRHA 4HQ0A 2Q28A 4ZAFA 5EUCA 2ATCA 2D8MA 3SQLA 3PNOA 1UWKA 2BGTA 3NHUA 3GJQA 1Q1EA 3EIQA 2QR5A 2BUBA 1Q57A 1SHZA 1Z8DA 2WYWA 2IHKA 2YMLA 3I1JA 4NCIA 4BC1A 2Q5OA 1BCRB 2DFVA 1YQXA 5E7IA 4EMBA 3UMYA 4RBNA 2G0TA 5B4UA 5A5DA 3NBMA 2ZQYA 4N3GA 3CZQA 2OVFA 3VKFA 4HAWA 5CLHA 4PCVA 1DKOA 2CUKA 1OT3A 2ZJ2A 4G5OA 1UP6A 1JLMA 2OD9A 3RT7A 4M76B 3AEYA 4YALA 1HUQA 1VLZA 2A9PA 4MW4A 1QRTA 2ZWIA 3LQ2A 4LNAA 5IBQA 1VTKA 4Q9HA 1NF3A 1PWZA 1W75A 4IZIA 3W6NA 2Q3BA 1XJ5A 3IB3A 1R9JA 4CE6A 4XXHA 5EIBC 3KVRA 1DCKA 2Y2VA 4HATA 2P62A 3V7WA 2OMEA 4BFVA 2GLTA 1PGOA 2BBOA 2JLBA 3RANA 4U2EA 4GDMA 1Y1RA 4WKOA 3OQOA 3ONFA 4AJ2A 3EA5A 1F14A 2N1BA 1J2RA 4TRJA 4Y0VA 1G8JA 4CG1A 4D9KA 4EB6A 5JC8A 3ZDYB 1CF2O 4O5OA 1V8ZA 4GSLA 2RK6A 1PSDA 3COSA 4HQNA 3SJBA 4EYSA 2PKYX 4QNNA 2Y1LA 4P5PA 4QOGA 1Y4DE 5B4VA 4Q9JA 1W1WA 5F7XA 1PT6A 2ZTUA 4HH4A 4JP5A 5E8JA 2UXBB 1Z8FA 1EUQA 3CB4A 1WPXA 1CTQA 1EE2A 3GRYA 3AOEC 2ISQA 1FXWA 1QE5A 1YACA 3AWDA 3EYWA 3KDSE 4PE5B 3FPKA 2LDBA 2NSLA 2X9LA 1T13A 4OAOA 4DC1A 3DUWA 5LOVB 1QX3A 4QUHA 4RH1A 2VJLA 4D43A 3L1KA 2JJ8A 1M1XB 2RHHA 3DYIA 3ORYA 5U4XA 1YKFA 3BH6A 1ZW1A 1PR4A 5KQPA 4ECEA 5THXA 4XR9A 2ENUA 1EKXA 3ZBUA 2GQ0A 2PH3A 2D1QA 4OYLA 4CKBA 4MP3A 4NNJA 4DYHA 4RACA 3S68A 4YRMA 1L1EA 3HWRA 4DYVA 3LT4A 3TZBA 3LCUA 3WLLA 4DF3A 1YQUA 2WWRA 1K8ZB 5B7NA 1LLUA 3UJDA 1A2BA 4EOGA 2QTAA 1C3JA 3U6BA 3UATA 5KSWB 2GK6A 3W04A 2F90A 4W5NA 1U2DA 1KVQA 3X1ZA 5DCLA 3FWHA 2LZ0A 4GBED 3AGQA 2JANA 3L7KA 1FX1A 3N0WA 3QMPA 4KVFA 4QDKA 4R9SA 3I2KA 5HF9A 2X77A 2P9BA 2ZRFA 2R25B 4FD3A 3TRIA 4EKGA 5BNTA 2LCFA 2NP6A 2VNAA 421PA 3WWZA 3L8MA 1MO5A 5GWXA 3X1YA 2EXXA 4BOYA 3FI0A 4MZXA 3ZGLA 3U56A 1NV8A 4MJ3A 1DADA 4QYWA 2NU8A 5B3AA 2WP0A 1YGPA 3IX7A 1X6VA 3Q41A 1I1OA 1U0NA 3H1PA 2H2AA 4EB6B 2WKRA 5DW0A 3DVLA 2W6JD 3E18A 5FCDA 1WOMA 3D8UA 1EXNA 1P44A 3JASA 2D2IA 2GHQA 2VYVD 3NHRA 3M1AA 3BIJA 4BATA 4DABA 1J2EA 1XYGA 2VLIA 3I2JA 4IQ4A 1UPFA 1RLIA 2O2HA 1IY0A 1EE1A 3BHJA 4E03A 5CR9A 1X42A 2CVZA 2OR3A 3WG9A 1PGNA 4FHDA 3CGWA 4Q6BA 1SHUX 1PFWA 4J3JA 1VYHA 1ZJWA 1JGTA 1WKVA 1NNUA 3PEYA 3X44A 4RF4A 1GUAA 1O4VA 5EL0A 1GWNA 5EXSA 2CYCA 5TR9A 4ZGGA 1EWKA 2HHLA 1G5RA 4UU1A 4G8CA 5MF6A 1CHDA 4RA9B 4N5HX 4BNZA 3V3KA 4IG9A 2IP4A 1NXQA 2GJ9A 4KBGA 2AMJA 3DL7A 2MYPA 3ACCA 2XD4A 2OXCA 1Q7GA 3H9GA 3T3MB 1BHQ1 2H7CA 3THOA 5DTEA 2MR6A 5BXYA 4V03A 3RVOA 3O8BA 3LUPA 3B52X 1HZJA 3EAQA 3R9IA 1AKNA 2F1HA 2CXTA 5KWSA 5BYJA 5LLSA 2AGVA 2KBEA 5ENDA 1GZ7A 2P9TA 2WD9A 1FRQA 4E2WA 4P4SB 3VAZA 1KOJA 5KAMA 2WT8A 3BD6A 2J32A 4MUBA 1VRVA 1DIOB 2DPGA 3ONNA 4Q19A 1RRPA 4NBNA 3UG7A 3MWEA 3AB3A 3W2TA 2P5TB 1VKOA 3L8HA 5SY4A 5K2MA 5ADVA 4CF3A 3DSRA 2P41A 5C1IA 3KEGA 5IM4A 2J3JA 4F97A 2IPXA 4DIMA 2ZP1A 5FBQB 2NIPA 5LMNB 3WGYA 1U3WA 4G8DA 2H5LA 1GQFA 4INPA 4ALKA 2IF2A 1AZSC 4K05A 1A7UA 1E5XA 1L5ZA 3U80A 4AF7A 2BFAA 1CE8A 1H8ED 2WJWA 5SV2A 3UY4A 3TRJA 5KTRA 1D8TA 2R8PA 3LXRA 1ODKA 3E9NA 3P9YA 5KHLB 2ZRIA 2X9NA 4UHEA 3ZGOA 4EUKA 2QIOA 1SBQA 3MS7A 3IH5A 2VKQA 3AYZB 4FYJA 4DXHA 3NGXA 2CV2A 1OFVA 4V1CB 4PYKA 2R00A 4GXRA 5A9SB 4CBVA 3NC0C 2RDMA 3IBYA 3DBRB 1CQWA 3PNPA 3AEUA 3OIWA 4NNOA 5DWVA 3DEHA 3K0SA 2F67A 1IBCA 4B1FA 2DR0A 1Q22A 2PMFA 2IV3A 1FPMA 3EPHA 1BWQA 2QE6A 5JUWA 2O4CA 1XEWY 2RAVA 3OTGA 3O74A 2GDJA 4GRIA 5A71A 1YTLA 4P4SA 4BV2A 3KKPA 5CVCA 2W2LA 4Y2PA 1ZJ4A 1RBQA 1SXJB 3AOGA 3N2GB 2FZVA 3IOCA 4ZXPA 4LVCA 3KYJB 4BQPA 3UJNA 2J41A 2VP4A 4MDHA 5D5PA 4RANA 2GNAA 4M36A 3RUCA 3FYUA 1JUDA 3PCTA 4ND4A 3ZCVA 1V48A 4JJ7A 3QBEA 2BP7B 3IUPA 2QZ9A 1HLPA 2HF7A 1VSUA 1W0CA 5DOVA 3KU1A 2D7DA 4G2TA 2B1GA 3BMCB 2A4KA 4MRVA 5LA6B 2PPVA 3HO8A 2H6EA 1FTQA 3K09C 4UNIA 5JH7F 4LEIA 5D5QA 1SVLA 1X7WA 5DSXA 4H4EA 1TTTA 3CEAA 5B3LA 2V54A 3O2SB 1I3OA 1ORDA 1XZNA 1YK1A 4X8HA 4WNCA 3U3XA 3ZCPA 4N7JA 2OXIA 1B43A 3EXIA 3DXFA 3QUQA 2A67A 4XLZA 1CEXA 1RAGA 4A1OA 4DLKA 4PBTA 4D8UA 2BYTA 3AZOA 2O52A 3CTMA 4Q9DA 2ZPAA 4LDQA 1S2OA 5DULA 2F8LA 4DJAA 3AM1A 2YZGA 2YJ4A 3VZSA 2Y1GA 3IALA 4X5OA 2A92A 1JEQA 3ZJTA 1PDWA 3M1IA 4DLSA 4KXMA 4X8MA 5K2OA 4GFDA 1GRRA 3ZJ5A 2GTIA 3T3NA 3ZTWA 1SUSA 4QDOA 3EIWA 4C2TA 4A8TA 4C43A 4UTNA 4NNPA 4FMCB 2YW2A 3N6XA 2ZRBA 4U63A 2ACVA 2C4VA 4YCCA 1NULA 3DFKA 1XDZA 2JGFA 3QI2A 3DFMA 3D5EA 3TB6A 4P4GA 1W44A 2C07A 4NMXB 3WO1A 4MDEA 1RM0A 1ZG3A 4DNFA 4JLOA 2BEVA 4QRHA 1FU4A 3ENVA 2ZWAA 4JLNA 2QZZA 4PIPA 4UVDA 3OU7A 4W63A 3T15A 3VO1A 1JBQA 3HDQA 1MO6A 1NQTA 3N53A 1X7ZA 1LA2A 2C96A 1AK9A 1NBOA 3ONEA 4JLSA 5L7TA 3VO8A 2GRAA 4B40A 4EW1A 3EGWA 4E5SA 5LXTB 1X7YB 2QW1A 3OG9A 2MJLA 4F3NA 4RLSA 2HQBA 3NVAA 3TXAA 6REQB 4QBTA 2IIBA 2XTZA 3Q8XB 4PQFA 2GI4A 1I9GA 2IA5A 3AJDA 4LI3X 4WKBA 1CUGA 3PNKA 3RVRA 4QFCA 2WIFA 4JVOA 4DJJA 5HK9A 4HNVA 1WDLA 2FKNA 2HTFA 2ZS7A 1Y9JA 1ZEJA 2P2YA 1WV1A 3DCJA 4LDAA 4TT3D 4C4XA 5I3CA 5JJCA 1MJGM 5KSYA 1PWHA 4Y9UA 4IXMA 4FFNA 1ZUIA 1LV8A 1ZD1A 3KR0A 3MJ4A 2XT9A 3UK1A 4BZWA 4JJ4A 5JFOA 3KIPA 4CM5A 1LBQA 5K6AC 3IEIA 1RCUA 1XZPA 1Q74A 2CUNA 2HI0A 4X1IA 4ZKEA 3K2IA 2REXB 2Y67A 1P4AA 3FYCA 2FSVA 1V3VA 2QUJA 4B47A 1C29B 3OCJA 3PDIA 2DUWA 1JEDA 2E4XA 1J6UA 3DXYA 4LXHA 5AQ1A 4ENUA 1JS1X 3E6AA 3IDQA 1N78A 3B2EA 1Q3TA 2Y0BA 2WAOA 2VP9A 1RQLA 2PSSA 4H4CA 1MTZA 1FYWA 4WZBB 1X7ZB 2XB6A 1UC4B 5K8CA 1KRWA 4PQYA 2GEDA 3G2LA 1K98A 3ZW8A 5KCMA 4C29A 2GJKA 1HMPA 5F2EA 5IAGA 4LJLA 4I6EA 4Z3DA 3WYBA 3KM0A 4R8VA 1X7YA 2TRSB 2YCBA 2ZIVB 2HEGA 3DZGA 1WZNA 3FKSD 3IVRA 4YQZA 4RH0A 3SYNA 2X5JO 4BUZA 5KQSA 1EIZA 1AXGA 3DO8A 4M54A 1L5LA 1N77A 2NSYA 3UWDA 3U9TA 3BCHA 2PGAA 4KRGA 4B4DA 1U0JA 2JFYA 4Q1VA 5JEEA 1ISHA 3QLTA 1J2UA 3DFUA 2H7XA 4U6QA 2VPWA 2P3OA 4JCCA 2PWYA 4DC9A 1Y9AA 3R3YA 2Z0MA 3JVUA 2WDZA 4EY7A 1CP2A 3GGSA 2WTAA 3BA1A 1OX4B 3DMPA 4PRZA 5EEHA 5C80A 4D6PA 5K4GA 4RKQA 3LCMA 3TGPA 3HABA 1TA4A 2J3LA 2HSDA 2JI8A 3DZFA 4CMCA 1IUKA 3I8XA 3R6WA 2QNIA 4HAZA 4R1MA 3RQIA 3OZDA 1LFDB 1V1RA 1I4TD 3WDKA 4V0KA 3L46A 4CKCB 4ENVA 1QVVA 1DAEA 3HKEB 2CDNA 1DBVO 3HCRA 4G4GA 2G5PA 2GD1O 4GBGA 1GTMA 3UMJA 3EBOA 4Q3CA 1BCSA 2COKA 2ZRNA 3H04A 3LP8A 3T4UA 4NJEA 1EVQA 2R6AA 4MGYR 2F6RA 4L5CA 1TM2A 1HTBA 3LI2A 4ESVA 3IMGA 2QU7A 1HSOA 1ZDMA 4L9WA 4KQJA 1H1TA 1GARA 1V4BA 1ZMTA 2Z04A 3DBOB 4IRXA 4ND3A 5FFMA 4EFDA 4IGKA 1TYAE 3FOZA 2WJIA 1YFJA 2W6IA 1KC3A 2BM8A 3NP7A 3JQ8A 4X92A 3OLCX 1JEOA 1HZZC 1PGJA 3OE5A 3B48A 2IPAB 2QIPA 3ACBA 3D0OA 4K6CA 1BE8A 4DZRA 5DZSA 3AH8A 2BUAA 2YWGA 1J49A 3T34A 1OVGA 2F2TA 3ZUPA 5F2NA 1DCFA 4MIYA 3CEMA 2IP2A 3NR2A 2O0JA 3IQWA 1JT2A 4DLWA 1GGFA 4RL4A 6ABPA 3W5DA 1ZMXA 2H1WA 2Y4OA 3E7PA 3QW2A 1N8KA 3D6TB 5TVGA 4CLEA 5K0BA 2P0AA 2X0IA 3EMDA 4ZJPA 1X92A 3GFTA 2O8FA 3GLKA 1WPGA 3F73A 2M1ZA 2YNMC 1RD4A 4KAJA 5DNEA 1E59A 3BX1A 1OX4A 3IMCA 2AI1A 3NDRA 1ISPA 5BXQC 1ZD3A 2FZWA 2YTZA 3QX3A 4X7BA 1DEAA 3VPDA 4S24A 4Y7CA 1TD9A 1K3UB 3U26A 1OH6A 2CMHA 3GFFA 3G6KA 1IUPA 5KYXB 1L7AA 3OOEA 2ZSAA 1DUVG 5D3MA 4MRRA 3HKEA 5K3EA 3JQFC 1NP7A 1Z4OA 3BAFA 3VC3A 1W36D 3OKAA 4WEQA 5EHXA 8ADHA 2WD7B 3WKAA 1IN5A 5JI2E 4EQ6B 1GNSA 5IHXA 2XHEA 2IYQA 4TL7A 3PZBA 4DWWA 2PUGA 3HS3A 1VYVA 2XDYA 3EISA 2V6JA 4FN4A 1P1IA 3RC9A 2HA2A 5DN9A 5DXAA 5JMOA 5CBPA 5JNVA 4A16A 1U7ZA 3U6KA 5JJ5A 1IXKA 3BKXA 1KMQA 1ULUA 3E9DA 4FFWA 1BG6A 1NJGA 521PA 5DNWA 1JLLB 4UAUA 4I4NA 2IBSA 3OEYA 1H42A 2J4DA 2PJZA 1VL2A 2WD8A 3HI6A 3L84A 4ND7A 5AKKA 1R66A 1LB1B 3QU7A 5FUYA 4Z4QA 1HDGO 2EEZA 2F3SA 5AUPB 1T8TA 4ZOQI 3JV7A 2CFCA 2FMUA 5C1BA 1BEUB 4KJZA 4JEMA 3ECAA 2BW0A 1K6JA 2C92A 3HEAA 2LKCA 2W6ID 2JARA 1K7FB 3VJRA 2D1YA 3D8TA 3LC7O 2QMZA 3RHZA 3RYCA 1R12A 2PKRA 5CNKA 4NCHA 2F59A 1XDWA 4BQEA 4DRZA 2V7WA 1PFGA 1KI2A 3H5IA 1KBZA 1FRZA 3RC7A 3QVVA 1IOLA 3D7RA 4RLFA 4GW3A 3RUPA 3RWMB 1QRSA 3FZNA 2FF7A 3O4HA 5K1ZA 5JMPA 3Q6NA 3C98A 1XKXA 2WTBA 4LXIA 1T4CA 4UUMA 1TMOA 1NVXQ 1WVGA 2JBWA 5FL7A 3HYTA 3F4LA 4TV9B 3SF8B 5KYXA 2QHXA 3ESXA 3MT9A 5ALVA 3S1SA 3I4CA 3L0DA 1XJWA 3AETB 3BTUA 4G25A 3RYIB 1O6BA 2XV1A 1OH7A 2JGNA 2LVBA 3HR7A 2OG1A 4ZAZA 1OQAA 5ALFA 3UFBA 4J0JA 4MGZR 3LUJA 1ZWKA 2OSBA 1ZCAA 2JD1A 2WJYA 2V0CA 5CYFA 1NXWA 5ADWA 5IT0A 1JU3A 2OLEA 4RK5A 1VKZA 1Y7IA 4L7QA 1P0MA 1UK6A 2PZLA 5CBPB 2Q1WA 1H85A 4M8IA 1V96A 4P08A 4BMDA 4UAJA 3VYSB 1HNXB 1KJ8A 1DEXA 2RONA 4JT2A 2IE0A 4EARA 1W96A 2OV2A 3EF3A 3O82A 1K27A 4CV2A 1OSNA 1QANA 2A57A 3IPCA 4IH4A 3LUDA 4AXBA 1N8TA 3DMHA 3RIMA 5I9IA 2Y1FA 5CM2Z 1FUKA 4QARA 3W7VA 1RE0A 3HA7A 3O94A 2KE5A 2NSDA 2QRLA 3ANTA 4P7FA 3AOEA 1OXUA 1NRJB 2WG0A 1NVMB 4B3CA 3TMKA 4WDRA 1NUUA 4W4TA 1WF3A 2OM2A 5DGDA 3TM5A 3WLPA 4AT1A 4CW7A 4PG5A 2ZZNA 2VK4A 3I5AA 3SC2B 2JCBA 4ITUA 3IR5A 1TMYA 3EF1A 3GLVA 2OFWA 5K0LA 1HFKA 1ZUHA 1OWLA 1U04A 1Z4LA 2RHCA 2YXEA 3H7IA 3KZCA 3QKWA 4NFYA 3RREA 2CVQA 2WICA 4U7DA 3FPEA 3T8YA 3D7KA 5JDIA 2PYZA 4Q7KA 2V5AA 4LBZA 1YL7A 5HJ2A 2R4TA 3HGQA 1XALA 2I6GA 3AY3A 3Q12A 1DRVA 3HCWA 3JQGA 1CWUA 2OHGA 4PHCA 2OC9A 3TJMA 4X20A 1MVNA 4UOQA 4HWSA 3EUEA 1RKBA 3RYIA 3TRKA 4DUYB 1MV8A 2YV4A 3C2QA 3WBFA 5G40A 1UODA 4HLCA 2QPAA 4AYTA 4BP8A 4HR7A 4RFSB 4BO5A 4KR2A 2QZ4A 1SCIA 2ZUBA 1HDOA 2VH2A 3SBOA 3K31A 4C87A 1VPVA 3UK7A 3V8NA 1RC8A 3UT6A 4Y2QA 2EIHA 3KDPA 3TAUA 3JZMA 3EMKA 5DBOA 1TYZA 5EE0A 3LVFO 2CJWB 2DWUA 4GGOA 4AJKA 2QLBA 1ADBA 3HUFA 4EGJA 4FWIB 1RS0A 4E12A 1PO7A 3CE6A 3VSAA 1Z3CA 3DR5A 4B3TB 1B3BA 1QLHA 3KXDA 2QLNA 3K53A 4G67A 1O6ZA 2F8MA 2NX2A 4HAYA 4PFKA 2X3YA 3LWDA 5T6MA 4Q0MA 2BSQA 3UGTA 2H9AA 2OLKA 4GC9A 4IRUB 1B16A 1CJMA 4TV8B 1DKRA 4L5IA 4ASUD 4FEEA 1G3UA 3SC2A 2AHOA 1FRNA 4ZRDA 5IFLA 1KPIA 2FG6C 2CLIB 4GBJA 4HS9A 4US0R 1BXRB 1WB9A 5G4LA 2ZRCA 2PE5A 5PGMA 1RVDA 4JKYA 4AUNA 1HRKA 2AH5A 2BEUA 1VE9A 3UXYA 3ILSA 4F3CA 4E32A 2N47A 2NM0A 4RA6B 4QXQA 4BX8A 1Z0UA 4KWEA 2V6FA 3OFSA 3AVPA 5EZ6B 3L04A 5HDBB 3RF7A 1EBBA 5T6BA 3VR6H 4A5OA 2GO1A 4IINA 1XGKA 4WMLA 1P8AA 3PGXA 1HEYA 1Q12A 3R6LA 4IOLA 5IZ4A 4QT0A 4KFSA 1I4EB 3U09A 4JGGA 1GFWA 4G1VA 3KTAB 3E82A 1GQRA 3FNHA 3GQBA 4H7IA 1T9ZA 1Q7TA 3KKMA 3KZVA 4Y2JA 4A6DA 4AECA 1GZVA 4EVSA 2XAAA 1ND5A 4N3CA 1PVVA 4CM1A 4DDUA 3IKLA 2E48A 1O9GA 4DL9A 2ZI5A 5C5DA 4G0UA 1OB2A 5DCYA 1CR1A 1FL9A 4QFDA 1DFHA 4OF4A 4W5TA 3O9ZA 3IA7A 1N6OA 2MT9A 3CLSC 2CNBA 1L7XA 1R0RE 1JLSA 2LIVA 4MA0A 1VPWA 1P1HA 1NKVA 4OXKA 4QXMA 5FP0A 1T0HB 4AZ3A 2IK8A 1TAUA 3HBNA 2O8EB 1L7BA 2FOIA 3CIOA 5FOWA 1TUIA 4ZVQA 3UYLA 2P7HA 2WQ6A 3VHLB 2IP1A 3K0AA 1YBHA 3TF5A 4FYKA 4LDRA 4U02A 3OTHA 3W78A 3P9RA 4UHHA 1YMUA 1I51A 4FYVA 3KOZA 3E70C 3KB6A 2PJRA 2WU8A 1T1IA 3RAGA 3S4YA 4EVRA 4F45A 1U2QA 5CFZA 3WGZA 1Y7LA 1P18A 3PF9A 1E1DA 2PVCA 4JNKA 4DB2A 1XEWX 1Y5NA 1MRSA 2Y6VA 1JMYA 3MT8A 2G1PA 5A3SA 1GGVA 1JE1A 1D6JA 4GLLA 1HTTA 1T9AA 1S2LA 3GJ3A 3PEFA 4O4IA 1E96A 2I76A 2X1HA 1B6TA 3F6RA 3AUKA 3OQ1A 3WRYC 3ZCSA 5K99A 2YICA 2QRJA 5BPFA 1EFPB 2MSDB 4FYYA 4HY3A 3ROXA 2PY6A 3T3HA 2BUCA 4PPNA 4IIBA 3KTAA 2KM1A 4ANFA 2J08A 1IXZA 1J90A 3SSNA 3U7JA 3C3PA 4FEYA 2C20A 3WFZA 1C7FA 1QVRA 2KQUA 3NB0A 3NWBA 4L0CA 4DGSA 4G5YA 2VOJA 4OL9A 4BLVA 1RI2A 4AKGA 1N2GA 1EUCA 1RKXA 2YHIB 3DHNA 1I3LA 5AI4A 3DFZA 1M1YE 4J6FA 5GPBA 1GYPA 4DIDA 1QP8A 1V26A 2HNBA 3IELA 2VHQA 3SE0A 3VKHA 2NO6A 4OQQA 3IILA 3AESA 3D4LA 1KMIY 2QJRA 2GYUA 3CH4B 2R6R1 1FNSA 3B3FA 3AY7A 1CUZA 1KP3A 1X86B 1OLUA 1WMBA 2CLDX 2D5BA 4NAVA 4R3UC 4FYXA 2WJVA 5LLDA 4DDMA 2AUTA 4GQAA 4XUEA 1ZXXA 2IYXA 4CIDA 5LP6B 4ESHA 2NXEA 3IE0A 4M55A 1XZDA 4JNCA 2HCFA 5HUQA 5JADA 4E7PA 3VYWA 1E3MA 3KXKA 3AJAA 2C9CA 2GZSA 3WIOA 5IYZF 3GP5A 1X1DA 3F2VA 5J1TB 2EJWA 3TTXA 2FX2A 2PJDA 3MT7A 3OOJA 4HVTA 3P9ZA 5F21A 3GV0A 3WYFA 5JVDF 1A27A 4NQRA 1VA4A 1PT8A 1DGQA 3CZMA 5BSUA 1FJGB 1EQAA 1TT5B 3BJRA 3H2GA 2A9RA 2H52A 3PC3A 4J1NA 2V7TA 2J07A 1YQEA 3A25A 2I4TA 5LJLA 1GVNB 2JRCA 3WMGA 2WR8A 3MTGA 4XZ3A 2YOFA 1W1IA 1P72A 1OBFO 4PPFA 1CKEA 4NV1A 3RYHB 3TLGA 3U9SA 4K40A 5A7FA 2ZDQA 4OYRA 3O03A 3F5MA 2YCLA 4LXTA 4B8WA 4MKZA 1QV7A 2CBZA 1E4EA 1RWMA 3INYA 4GP6A 4NYMR 4P4LA 1E89A 5DLEA 3SGLA 3V46A 4YIHA 1YR2A 3NNDA 2W2PA 3B5IA 2AS0A 1JQAA 3G0CA 2XA9A 3KQPA 4QKQA 2BFMA 4EITA 1GUYA 1K8QA 1YZTA 4GMKA 3TIFA 2IXDA 4E11A 5AM2A 3EJ6A 1V37A 1XTZA 2XUFA 1XP5A 3EXEB 3OMXA 4L8VA 1C4KA 1L5HB 1BX3A 1UP4A 1W29A 1Q92A 1VL6A 2PFSA 3HZHA 3ZW7A 4DWVA 1RZRA 3OFNA 5ALGA 5JFGA 2H1HA 1A4IA 3W1VA 4C6RA 3JX9A 4JT4A 4ZQCB 3L79A 1MF7A 2NV6A 5F1OA 4BLPA 1RXEA 4DV5B 2PD6A 3OKPA 4JJ6A 3QWBA 3ZLTA 2BF4A 1IAQA 2GJAA 3JWEA 4KXNA 3RYTC 5JATA 1JSXA 3FNFA 3I9MA 3Q7PA 3WJAA 1RWNA 3GGOA 4KQCA 4YPOA 1GL3A 3RAPR 1HBJA 1QS0B 1VZ2A 3QPVA 3P20A 4P32A 2RARA 5AQEA 3OJFA 2ZIUB 5EZYA 4AG6A 2M6SA 2Z5LA 4MMXB 1K0FA 2I0FA 1Z0IA 4MQ4A 4YP5A 5BUCA 1PX0A 2P27A 3C1AA 1ZESA 1I2CA 3ONVA 5CFLA 3T95A 4HVCA 5A4MS 1EX6A 1C9NA 2INGX 1WCXA 2Q5QA 4FHGA 1ULZA 3OPXA 1O6FA 2OCIA 2QLTA 3G1TA 4EHHA 3CRMA 1U9YA 4ZJZA 1GKYA 4IQ8A 3RYHA 1G9TA 1Z8NA 1RJGA 2PL1A 1QBKC 2Q5FA 3TLGB 4DNPA 2FW1A 4ZT3A 4KQWA 1UAGA 4J1QA 4YQFA 1MVOA 4ZHQB 1LC3A 1O8CA 2GZ3A 1ZVMA 4PZZA 4W9NA 2HM7A 1P5FA 3Q7IA 4KIWA 1BJTA 2FJUA 3BWEA 1L1QA 4C76A 4W82A 4UQLA 2J7PD 2QTVA 5CT9A 4I55B 4QHTA 5A62A 2PWBA 3OLYA 4GVLA 3CUYA 3L6RA 4LZJA 1RC1A 4WLUA 4IGIA 4KAAA 5EZYF 4DUPA 9ATCA 4LCJA 4D44A 1WO8A 2X5OA 4Y3UA 4Z0TA 4FWTA 1IXRC 1DAFA 2O23A 2SKEA 3JAWB 1S2MA 1KI6B 2JK0A 3EVTA 3N3BC 4HEA6 2AZ4A 1JKIA 4TZ6A 1O3YA 3W6UA 2X6RA 3JALA 1ISJA 4Q00A 3HA2A 4RZ3A 2VDWB 3N58A 4IZ6A 5KOHA 2JLVA 2Q7OE 3OOHA 1AH2A 4HAOA 3L6CA 4HO1X 2H3EA 3DVRX 3LBNA 2ZJ3A 2ZUFA 5TQJA 4QQKA 3ZQJA 2Z98A 3P9NA 3DCNA 4QYMA 1RJWA 4KO4S 3QUAA 2BTEA 2VJPA 1Q19A 4K2AA 4BWVA 2JIMA 2G80A 5J5VA 4TMYA 3I6IA 2C8JA 1WB4A 2HCTA 3THXA 2W90A 4C20A 4OQNA 2WF9A 3OM0A 1K68A 4QUEA 2OBMA 1ESDA 4KQHA 1ZN2A 3U7FB 5I9LA 4H0FA 1GDTA 1POXA 3FDXA 4GX2A 1OXVA 1VOTA 2QI9C 4NU6A 4CDRA 5JLJA 4KN9S 3LQ1A 2NVUA 1KEZA 3KKNA 1E6CA 3N2KA 4M3NA 2O3RA 1K6EA