1RHUA

Crystal structure of the complex of caspase-3 with a 5,6,7 tricyclic peptidomimetic inhibitor
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
140
structure length
140
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 140
sequence length 140
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rhuA00
1NMEA 3S70A 1QDUA 3D6HA 4FXOA 3P45A 3V6LA 5JFTA 2CJYA 1SHLA 4N7MA 4QULA 1RWOA 2CNNA 1RWKA 2C2KA 4N6OA 2XYGA 3EDRA 3ITNA 5IAJA 4AWAA 3S8EA 4D3YA 4PRYA 4HVAA 3BIJA 4JR0A 2CNOA 4IEFB 4AWBA 1RHQA 1ICEA 2XZDA 3GJTA 4QUIA 1CVRA 4DCJA 2DKOA 4N6NA 3GJQA 2CDRA 3V4OA 1PAUA 1SC3A 1K86A 3DEKA 2J30A 2HBZA 1GQFA 1RWNA 1RWVA 1SC1A 3IBCA 4ZVQA 2H4WA 2J31A 3R6GA 1RHMA 3DEJA 3R7SA 4DCOA 3QNWA 1I4EB 4EHDA 2Y1LA 4JR1A 2C1EA 3UOAB 1NW9B 4PS0A 3DEHA 5IBCA 5K20A 4ZVTA 3GJRA 3R7NA 4D3XA 2C2MA 4NBLA 4NBKA 3P4UA 1SHJA 4ZVRA 3KJFA 3KJNA 4QUBA 4EHLA 1NMSA 3NS7A 1SC4A 1NMQA 2C2OA 1K88A 5LUBA 2J32A 3SIRA 3V55A 5IAKA 4I1PA 2QL7A 3E4CA 1I4OA 3IBFA 1KMCA 1RHJA 3H13A 3PCXA 2XYHA 4M9RA 4ZVPA 2CJXA 2CNKA 4QUGA 4LSZA 1F1JA 4EJFA 4EHAA 4JQZA 4QU0A 2NN3C 3D6FA 1F9EA 5IBPA 3V3KA 2H5IA 2J33A 1RWWA 4DCPA 3SIPA 4JQYA 5IABA 5I9BA 3OD5A 2FP3A 5LU8A 4QUHA 3RJMA 3H11A 5IARA 4N6GA 3UO8B 2P2CA 4PS1A 4NBNA 4HQ0A 2C2ZA 4PRZA 2H51A 4I1RA 5IANA 4N5DA 2K7ZA 1RHKA 2WDPA 1RWXA 3PD0A 3R7BA 2HBRA 4QUDA 2H5JA 2XZTA 4ZVUA 1QTNA 2FQQA 2HBQA 4D3ZA 5IC4A 3NKFA 1JXQA 2QLBA 5I9TA 3H1PA 4FGUA 5IASA 2XYPA 1CP3A 2Y0BA 1RWPA 4NOMA 4NOKA 4NOJA 4FEAA 4QUEA 3PD1A 4IYRA 4QTYA 3K7EA 4JJ7A 4JB8A 5IAGA 2AR9A 4QU5A 3V4LA 4JJEA 3H0EA 1RE1A 1M72A 4FDLA 3GJSA 3R5JA 1IBCA 2CNLA 3D6MA 4QUAA 1BMQA 5IBRA 3EDQA 3H11B 5IC6A 1GFWA 1RHRA 4EHFA 2H65A 4NOLA 4QU9A 2H4YA 4QU8A 4JJ8A 2QL5A 4AW9A 1QX3A 1PYOA 3R5KA 3R6LA 5LU9A 4ZVSA 1I51A 4ZVOA 2H48A 3KJQA 1RHUA 1RWMA 4JR2A 3NR2A 4N7JA 2QL9A 5LUAA 2H54A 1I3OA 2FUNB 5H0IA 4EHKA 4QUJA 2HBYA 4HQRA 3V6MA 2QLFA 2QLJA 4EHHA 3DEIA 4EHNA 5IAEA 4QTXA
chains in the Genus database with same CATH superfamily
1EGQA 3L43A 3NT5A 1F3OA 4N5IX 3PWSA 5HW0A 4YDHB 4B47A 3THYA 2Y99A 3S2SA 1ZICA 4WUTA 3TQSA 2SKCA 3KPVA 1BVUA 4ZYLA 1X74A 4DLNA 1RJGA 5E6SA 2AG1A 1KAOA 2JPDA 4ZTBA 2NNLD 2EARA 4P58A 3VPXA 1XQYA 3CBQA 1F2UA 4IMIB 4MB6A 3EVBA 1UJ4A 3K1JA 4Q4JA 2ILTA 1EIZA 2ZJ7A 3D3WB 4JXJA 4PCVA 4F4HA 1NTRA 3CXRA 3VC7A 1BW9B 1YJ5A 1DARA 1JEQA 3EDMA 3JYNA 1JHMA 3AL0C 3TZKA 3ANXA 3IFSA 2R4TA 1ZD3A 4KPUB 5A0FA 2CSXA 3WQHA 3ZYZA 5DASA 3AUSA 4YALA 5FDFA 1FVFA 3AETA 3DMYA 1W2GA 1QAQA 2HPZA 4QAQA 4R7TA 4TQUS 1Z28A 3ES9A 3R3ZA 4LJ7A 2WPNA 3DMPA 2IZ0A 1A8HA 2J85A 4CGYA 1XJWA 3GRVA 3MWJA 2BFMA 1H6CA 3GY0A 4QGAA 4JHLA 3BEOA 2G04A 4BPRA 3QKSB 3DZGA 3ZVMA 4AY2A 4JL6A 2PRSA 2WNSA 1R0ZA 2G5GX 3P5BA 2GXQA 4K0KB 3LOQA 2I1VB 5ES4B 4H6VA 4XDGA 1T1RA 4I2VA 4XYBA 4CMAA 5MGBA 5I9LA 1E2IA 3GZNB 1QYDA 1EXMA 1CQJB 3CSDA 3H5TA 3PNLA 1URPA 2EJWA 5K8LA 4KDEA 5KNCH 2GF9A 2WWXA 5EEHA 1XZHA 5FLKA 1LDNA 1GLVA 1FUKA 1WUHS 1UKYA 2O3TA 2ZRMA 3NHSA 1Q2XA 2BZGA 4TV9F 1XZGA 3REFA 1PSDA 4DF3A 4LGMA 4KE8A 1GNTA 3IIJA 1XO1A 3MJ4A 3E3OA 3BULA 3R5XA 3RUAA 4TZ0A 3OP4A 3ND7A 1SVLA 4ZI2A 3EYWA 4CTJA 4G09A 2LWIA 2ATCA 2HAEA 2QV7A 1JR3A 4IMPA 1K7EB 1DLJA 3UF0A 2KI5A 4KR9A 3ED1A 4O4IF 4I55B 2GVZC 1QU3A 2JI4A 4C0KA 1N7HA 5KQGA 5SY9A 2F4NA 5A1TA 2IH2A 5J1TB 3R7WA 4HDMB 1T8RA 3C6KA 4C0QC 1DWUA 3CCBA 3EXAA 3RG8A 3OFSA 3LCMA 4RV5A 2IUFA 4CUZA 3IP7A 1SB9A 2C9OA 2OZLA 1YBHA 5B58T 1J2UA 4NYIR 1JQKA 5EZSA 1F4VA 1XHFA 3H2SA 4WFIA 1PEDA 3VTKA 3D3KA 3EUAA 2R97A 1QTIA 1X7ZA 2II6A 5LBUA 3FHTA 3QF4B 4RMNA 1TA0A 2I4LA 4MYCA 4P33A 1EK6A 3GJ5A 2ZTVA 2QT1A 1BCRB 1CZNA 5EPEA 3UAZA 2Z4TA 1N3YA 4KRYA 2CV2A 4ZEOA 3HA5A 4N7BA 3IQWA 5A9TA 4LJKA 3OTGA 4NS4A 4S35A 3IA7A 3NR2A 3H3XA 2A5FA 3ZDAA 1E58A 3HB1A 3F3SA 3UYKA 5M5BA 2O1EA 2IPNA 1QHHB 4BN0A 2QTVA 3ME5A 2FZCA 4DZRA 5G4KA 2P8JA 5JMOA 4Q7QA 5IPFA 1V39A 2ZT7A 2BR3A 4E5UA 4H1VA 2AFHB 1MD9A 1E9VA 1TQHA 2CMKA 5PNTA 5B6PA 4GRDA 1P5RA 1EP9A 3I2YX 1N6RA 5EJEA 3GIWA 3QJGA 2TYSB 2QORA 3RVSA 4AJIA 4X95A 3DMNA 3GQVA 3WIOA 4TKLA 4DCSA 4A36A 2ZTMA 4XJSA 5L3ZA 4S1NA 1Y5RA 1C8VB 4JWKA 1U28A 4U2KA 4UHFA 4EGFA 3EPLA 3COJA 2QYHA 2OXCA 5AW6A 1MCZA 2MINB 4REQA 1UEXC 1C9YA 3C3MA 3CO5A 3KKQA 3NRBA 4MV9A 4NJMA 1NYRA 3Q10A 3QF7A 2LKCA 3AO0B 1JBKA 1WUJS 2FY8A 1NLZA 3L1UA 5K0ZA 2RMKA 2GNPA 1D7AA 3E6AA 1E2LA 2ZB8A 4I4LA 4MQ4A 1NPDA 2XDWA 4J0HA 1T8PA 1TC1A 2AG8A 2R62A 1OC2A 3E3MA 3KT3A 3SJBA 1SHJA 1BO6A 2I7DA 1T6YA 2IC5A 3UJAA 3KR9A 2PRZA 2GXUA 2C61A 3USES 5JT1A 3IR6A 4AJEA 2AOUB 1YRQA 1QGED 5K8VA 2BR5A 1N7GA 2ZIXB 2XJ4A 1YZGA 2GZ3A 1AGXA 3R4CA 1VBNA 3GJ3A 3ZH2A 4F1WA 2O8CA 5SYAA 1Z5PA 4MPPA 3DW3X 4PFSA 4DIBA 2IYNA 5G1OA 4XOIA 5L8VA 3FVTA 3URMA 3DOCA 1UBUS 1T3TA 1M74A 3EZ2A 3W6ZA 1K8YB 3DOHA 2BN4A 5GMOA 3RJTA 3TNFA 1L5GB 2XUZA 3FPGA 2B92A 1SXJE 2C20A 3KPWA 4LBVA 4MUXA 5EMJA 4ACAA 1WLYA 4B2PA 5ALUA 4LV8B 3GZJA 3UTDA 2Q0QA 5HKBA 5KSZA 2CBGA 1RM4A 3ZD6A 4LY3A 1RWXA 4Z7OB 4ZRMA 2Z2XA 2A0YA 4LRQA 2NYUA 2P0EA 1H3EA 1L5QA 1LDYA 1KC1A 3U7JA 3IPCA 1XQ6A 2CLIB 3DKVA 2DT8A 1GAQA 4BQSA 2F17A 1R5JA 5EP1A 3SGLA 2O8EA 1OWLA 1PEKE 3TR0A 1E9EA 2QIPA 3TSZA 2VSOA 1NR5A 3ZDEA 1KR2A 2GN1A 3SMVA 3ZS8A 5K51A 3B3AA 2V5VA 1JHQA 1N9KA 4A2QA 4BLOA 5M34A 2DM6A 2ZXUA 1ZJ6A 1IRXA 2EZ8A 1ZD9A 3HLKA 3JU3A 1NP7A 3MCZA 1XZNA 2C29D 3RSSA 5BSWA 1DV2A 4JVLA 2X42A 3KS9A 4M7PA 4GG1A 3V8NA 1WMFA 4OMUA 4JJAA 2R6FA 1SVSA 1E4EA 4HDQB 2QN1A 2A0UA 1R7RA 2YWHA 1W9MA 3KXPA 4POAA 4R8MA 4NXMB 2F4VB 2CVOA 1DKOA 4M60A 1SIWA 1GRRA 2CJFA 2J6HA 3FFAA 5JC1A 3QBVA 4G5FA 5F7XA 3W5CA 1FS4A 2XB8A 2CLSA 2ZJ2A 2IYPA 4QPNA 4EF6A 2EVWX 1BGVA 2QVXX 3SSNA 2WTMA 3K53A 5E1DA 8OHMA 4QUJA 4OLBA 2DZDA 3T3EA 2E1PA 4FNGA 1GOTA 1W87A 2H85A 3OZXA 4RV9A 4L4UA 5HBGA 2EKQA 3ET4A 3OURA 2Q41A 1UQUA 3A3OA 4R68A 4ZOEA 1G38A 2OZPA 2BEUB 4PAQA 4C0HA 3ZU5A 3ER9A 3I01M 1XAIA 3EVEA 3C7TA 3OSZA 5IMBA 3RARA 3ZV7A 1MP0A 4CV2A 4H7FA 1YJQA 1ZC4A 3P9QA 1KRWA 2GA9A 2RARA 4KXFB 3ZTWA 5L4LA 4QTTB 3K1TA 3ZGLA 5CEFA 3A6JA 1WCIA 1YZVA 1QH1B 1UP7A 1U9CA 1BJTA 3IMEA 3PNYA 2QT9A 2MR6A 4UXJA 3PHCA 3TI9A 2WUDA 2CVQA 2B4AA 3WBBA 3HKCB 1T43A 2Q49A 4WLNA 3F5DA 1E1LA 1C1HA 4B81A 3NWEA 4AP6A 2CF5A 3DEKA 2B1GA 2HLHA 4II2A 3I6IA 4DVGA 1F6DA 2X23A 1P2FA 1VLVA 3IDFA 2P2SA 3VU3A 4AKIA 3C0KA 4WESA 3QPBA 3ZK8A 4YMTA 4GS5A 1PQYA 3A6PC 3R9WA 4WK4B 5D6NA 4GOLD 5FOXA 3E0XA 4OOEA 4EW2A 4B17A 1XDDA 1XRMA 1B6TA 3IV6A 2WKSA 5ADWA 1JLSA 3KJNA 2VQEB 1QR6A 3PB3A 5KEIA 3BRWD 4Y2JA 1PZGA 2EJTA 3SOZA 1ZAKA 3R7DA 4JUAA 4F5ZA 2J3HA 4X90A 4CUJA 3UGQA 4IHKA 3HJHA 3LP5A 1CPYA 4YRAA 1GVHA 2X8AA 2W48A 3L7MA 1KAEA 1B0PA 1MXFA 2OT3B 3JYPA 4HEA6 5EZQA 1O0BA 5AXDA 3V2GA 2FSVA 2VP6A 1I13A 2LBPA 1TIBA 4DR6B 1H8HD 2WSIA 4MYHA 5DDIP 1Y0BA 2DR2A 2X2EA 3TZCA 2H1RA 1GQRA 1ZUHA 4KITB 1GDDA 1A4UA 4PS1A 3L1KA 3DYIA 2Z6QA 4L07A 2P9BA 2JH9A 5EAIA 3HCRA 3NZEA 4OAQA 1AGPA 2W2LD 3KE8A 2H17A 5LM3A 3Q3CA 1HT0A 1ZL0A 1ECJA 5AW3A 4UVEA 3ZDXB 3GGDA 2Z95A 2O0LA 2PZKA 1S3FA 2CLOB 3A8TA 2IYQA 2Q5HA 5T6MA 4PR0A 3EW7A 1KO8A 1CZKA 3KU4A 5BMVF 1E0AA 1NL3A 2Q5QA 3EISA 4FYKA 1E1KA 4F7WA 4LJ6A 3RF6A 3ZV4A 1NY5A 4H08A 4LOLA 3X1DA 2VZ0A 3SZRA 1UZNA 1GFZA 2QZJA 1TZKA 3CLHA 3OOJA 3SJAA 3U7EB 5D86A 2QX8A 4P86A 3VH2A 3PX7A 1C0PA 1X7YB 1H6AA 2WHEA 3PICA 4J16A 3DVAB 1EFPB 3O8RA 2I2AA 1Q95A 1GRQA 3EEQA 1TMKA 2VEOA 4A0RA 3E9DA 3U19A 1ECPA 5CA0B 3FSEA 2GPTA 1G8PA 1R6BX 2ZRQA 1IWPB 3PLNA 3NAGA 4WOJA 1LD3A 2H7XA 1X1SA 1OUMA 1GRCA 1HV8A 3HRIA 2FYTA 5TE9A 1WIWA 1XTPA 2JC3A 4UDYX 4C7MA 2ZG6A 1SUBA 3PNVA 2REOA 4KR0A 1P9LA 2C78A 4GMKA 2O8NA 3KLOA 4FWTA 1CUWA 1HRDA 5BV2P 2UDPA 5BMVB 2CBXA 4PZ0A 1WL8A 4U7JA 4YP5A 4YRTA 3GPDG 5ADVA 1H22A 3EASA 3LG2A 3MUNA 1I94B 1NFFA 1XDSA 5HKLA 2W2KA 2YHIA 2FR8A 1H5UA 2G8NA 2YHSA 4Z4QA 1JHDA 3O84A 2XIQA 1C8BA 1ISSA 1CJVC 3E70C 1G8MA 1IEVA 1FTWA 2QVYX 3DBRB 3H2YA 1UADA 1HYEA 2XMGA 2YYYA 4GLFA 3HBJA 1M0WA 5F12A 5JLAA 2YUIA 1B15A 4YT8A 4HS9A 4OMDA 1E6UA 1D6NA 2RHTA 5C3UA 4B6PA 1S6YA 4K26A 1UBHS 4UNPA 5D3ZA 1J8DA 4HKTA 1T0IA 5LP6C 1VHTA 1M2VB 3K9GA 5IBQA 3N86A 2QX7A 1KEEB 3ROEA 2AI3A 1CUVA 4XB2A 2Q8NA 2C2YA 3NANA 4FFRA 1ZM3A 1E89A 4FOLA 4PV7A 3WTCA 4D8TA 1EIWA 1SOAA 1DEKA 4GE0A 1WXIA 3K2BA 4HATA 4IWNA 5CYGA 3DZCA 1A98A 1VA4A 4COKA 4DWOA 2PGXA 3ICPA 4UULA 1FYWA 4OAOA 3ETGA 4PRLA 2C54A 3BRWA 3SLKA 4EEXA 1LZKA 3F6PA 2PXXA 5FPTA 3PK0A 4BP8A 3ESAA 3IVRA 1U8YA 4MDHA 4DA9A 5K8IA 1WO8A 3RADC 2VDNB 3C41J 3C16C 1UM9A 2BGGA 5JS2A 4XYEA 4DT1B 1IE3A 4RTPA 2A67A 4QXRA 3OQIB 4E2YA 4ZOCA 2POCA 4ZCIA 4RBNA 3G5AA 3OO0A 4BB0A 2DWUA 3FCAA 4IH4A 3HI6A 1OZFA 4EWLA 1GG9A 5BSKA 3VNVA 3RR2A 3EARA 4RK4A 3M6UA 1ESEA 3NKLA 3DP9A 2OZVA 5DGCA 3RGWS 2TMGA 4I1RA 5A5GA 3DBIA 5TMPA 1L4KA 3D3EA 4DPKA 4BLQA 3BTUA 4PLVA 1FW6A 1OH8A 2O7QA 1VP3A 1J7KA 1H6BA 3LW8A 3ULKA 4OXQA 1KH1A 1CUEA 3H1EA 3JVEA 2QZSA 2XZTA 4BEJA 5KSOA 2EF0A 2YIDA 3AEKA 2NZ2A 3DE2X 4M8NE 3T9EA 4BLSA 3N7AA 3D3WA 5KOJB 2W2LA 1FUIA 1G21A 2VQSA 1W34A 4NNJA 3M7IA 3R6DA 2XE6A 3CEPB 3FD8A 2GA8A 3ZWXA 4ESEA 3HS3A 4LJLA 4D56A 5LR6A 3NDPA 4KXUA 1ZGZA 4PR3A 5IUJC 3I5UA 1NJ8A 3GAAA 4RQBA 5EYPA 4EJSA 4GZMA 1NE7A 4CF5A 5KS2A 5LKRA 3EMVA 2V0CA 3OIGA 4XLTA 1S3GA 1J5XA 4YAKA 5M04A 3LV8A 5AJVB 4C3ZA 2MMGA 3BOSA 2OO5C 3NBXX 1Q11A 2XODA 3C3AA 4YAIA 3RO7A 4V0KA 2RAUA 4D46A 3EXG2 2NV0A 3ZCTA 1RKVA 3MBKA 1IHOA 5HIKA 2QV0A 3IIKA 4EHBA 4F6RA 5I7FA 1XZPA 4FKBA 5A5EA 1DAEA 3WSVA 3M8KA 1PHPA 1KEZA 2FFQA 3HJRA 5EXDA 4BE7B 4ND1A 4OUKX 5TX7A 1NJFA 4ND6A 5ILOA 4K1LA 1I3NA 3OLWA 1G1MA 3WO1A 2ZIAA 3SEFA 1B23P 1V4VA 1Q15A 4QM6A 2RK3A 3PDWA 2CNDA 1XLTC 4AG6A 4EHHA 1TIPA 1SR8A 5EY5B 4BWFB 1CLUA 3ZWYA 4N48A 3QWAA 4X71A 2GJ9A 5DBGA 4H60A 4AJ2A 5CCBA 3RSZA 4OB8A 3GVIA 3NCTA 4Z2AA 5TV2A 2V7GA 3TNLA 4BN4A 3BTVA 3PDCA 1FX0B 1Z2CA 4NBWA 3EPPA 2NZ8A 2I4TA 3PD7A 1MW8X 4KEAA 2FZKA 2UV8A 3RVNA 1ZRMA 1AV6A 2WP8J 5IH3A 1LS6A 3AMVA 4P34A 3BFPA 3ZGOA 4JYBA 1E0DA 2R1UA 1U4NA 3AR5A 4QNNA 1U3WA 1OLSB 5DU2A 3TOXA 2FXIA 3V4PB 1JE1A 5HK8A 1TD9A 4B4UA 3R7SA 2BLLA 1LC0A 1D5WA 1L1EA 1YRBA 2EQAA 2I4NA 1MGOA 1R8YA 1ULSA 2L18A 3AFGA 3IBGA 3NBYC 4HO1X 4BRWA 3UOAB 1NBIA 3A1CA 3LY8A 5D87A 1XL0A 2ISCA 1POWA 4OHKA 3WGJA 1KZ6A 1Z5UA 1SB8A 4RABA 2XRZA 1FIUA 2I2DA 3QX7A 1O9BA 4IH9A 4NFHA 5LOVA 1ZD1A 2YVQA 4HXGA 5A4IS 1YGPA 4R69A 3AEQA 1SCNE 3L6CA 1INLA 4Q6WA 2GXSA 9GPBA 5BV7A 2ZS9A 3K05A 5JDIA 4OPMA 2NQ2C 5E9JA 3S1LA 5T67A 4PPNA 3IKJA 2CJXA 4CHGA 3CUEF 2AJLI 1C1XA 3ZDFA 4EHAA 3VAZA 4B74A 1H69A 2YHAA 4GNRA 1Z0DA 1P5FA 1S1CA 2GR9A 13PKA 1JKIA 1WHTB 4CRWB 3JZDA 4OL0A 1RKBA 2WMOB 1UK9A 3V9PA 4EGCB 5AKIA 4HUQB 4TQGA 1DTEA 1RBYA 4YFYA 3ECAA 3WL8A 3QLEA 1S4MA 4X1IA 4BAZA 1D2EA 2QJOA 2ZYRA 3GLHE 4MAAA 3VHRA 4JA2A 1JI3A 1P1BA 3CGGA 3KQSA 5A5VA 1Y98A 3KVRA 2JGEA 1NXTA 3HXTA 2BM1A 2FQ1A 3TPCA 1HQKA 1HL7A 3L82B 2NWQA 4D57A 4P9NA 1E3LA 1XEWY 2YFHA 4Z0HO 3VHXB 2Q4RA 5A05A 3NWOA 3ANNA 1GSAA 1YB7A 3NNSA 4HYTA 4NOMA 4WUVA 5CW1A 4ZT4A 3ZZ0A 4AZ0B 4FEAA 3HM9A 4MI9A 4M98A 3W2HA 1Q3HA 1CF4A 2V97A 3DBHA 2QX4A 1YOVB 2QU7A 2XUIA 4C6RA 5KX5A 2QRGA 2D59A 4J0FA 1QH9A 2PZAA 2XE8A 3D5TA 5A7GA 4B7XA 2ET6A 1U2SA 1ZK4A 4R9NA 5DLYA 3L7LA 1CJUC 1KMNA 1PJSA 3A04A 4MDYA 4D3FA 4LY9A 1P7YA 1XNJA 4G0QA 1QO9A 3KEQA 3MSCA 5LWQA 2ZSHA 3DZKA 2WVHA 4WX2B 1ZMOA 1WU7A 6YASA 1MX5A 4YJ2A 1NVTA 4DG8A 1RHRA 2A9OA 4GOMD 2P30A 2VZ9A 4TRNA 4E6PA 3WYAA 3KNZA 3PLAE 2WU0A 4BLWA 2EP5A 3E5RA 3C1TA 4DQVA 4W7HA 3FYTA 2IYLD 4E4TA 3I30X 3ZHTA 2IU3A 3Q87B 1G55A 4Q1CA 2RHGB 1YMQA 3LRXA 1MO2A 1H1TA 1U9IA 1Z74A 3B8EA 4G5XA 4QASA 1OTHA 5B3JA 4CZ2A 3AVTA 2XUDA 4K8OA 3Q7RA 1ILWA 1NVMB 2ORIA 3QXJA 2HWXA 1TL7C 1X94A 2IHVA 3NHLA 2VJPA 2IP1A 3DTNA 2NQ8A 1GO2A 3IX7A 1HTTA 5I5EA 3SKXA 1XGKA 2E21A 1UPFA 2P91A 1CT9A 2YBEA 1B6SA 3F3YA 1DSSG 3SEAA 2DBQA 3UCXA 4QQFA 1O94C 3NO4A 4NX2A 2HQSA 1YAHA 3MAJA 4QSHA 1PKEA 3M82A 2PKXA 4WIAA 2W6ZA 4IQ0A 1BMDA 1C4OA 1R16A 5NULA 5JYBA 5KNBA 1JJVA 1H94A 4LRXA 4NV0A 1B74A 3I9JA 4A8JC 3HDGA 3HK2A 1E1CB 4KPEC 1UT5A 5DM0A 1AB5A 3R3JA 5EIXA 5EWJA 4OQNA 4YMWA 1Y8RA 1RQLA 2FA9A 1GTZA 1MOQA 9ATCA 1MIOB 2JAPA 2HT6A 3GNLA 4XEUA 1ODLA 5EQDA 4MVJD 2XCLA 4O59O 5KC9A 3BRCA 1ECGA 4C88A 4H3SA 3I92A 1VMEA 4EOGA 4ZVTA 1S8FA 3KQLA 1VIAA 1Y5IA 3DMDA 2FUG1 4IHAA 4EDHA 3IAS6 3UCFA 2BFNA 4I1SA 5HQJA 2P6UA 3ED5A 3EC2A 4C4SA 3GOQA 3L6DA 3VR0A 3OTQA 4JV5B 3HA3A 2OV1A 3MVEA 3G0BA 4POOA 3II6X 3RBXA 4DMRA 5DOVA 1X92A 2DQKA 3X2FA 3K0BA 2AI1A 2NVWA 3C3EA 2H1VA 3DS8A 4CMIA 4HT3B 4CMEC 3O21A 2AE2A 3HUTA 2P9HA 1MV8A 1SKAA 3FB4A 4ZT6A 3CZ5A 4C2BA 4UU1A 1C80A 4IDNA 3W8EA 4DR3B 4IHJB 4DHEA 4GL2A 1B2LA 4XM0A 1QUFA 3FHOA 3ZD9A 3AP1A 3FPFA 5T3UA 5GGXA 1UPCA 2E4AA 2Q3DA 2BZSA 1DJPA 3FB1A 4MTCA 3HN2A 3RSCA 4DJAA 3S2YA 2XKBA 4IGEA 2Y0CA 2CFSA 3RJMA 1E9FA 1Z2DA 1VBFA 2GCIA 2IYAA 2ZZNA 1VL1A 2H51A 3WL6A 1UOQA 1MB3A 2V8BA 1FZQA 2NX2A 3FSGD 4KNWA 5HKOA 4AMBA 4R1TA 1NLFA 2EW8A 4GWLA 5AIAA 1HOTA 5ALIA 2BMVA 1IEXA 1VSVA 2ERXA 4JOBA 1VLQA 3QK7A 5GWXA 1Y9DA 3DFIA 3OJWA 3DLBA 3CUKA 3E2IA 1V43A 4RJTA 1NM5C 2FG6C 3NH9A 2JAQA 4PG5A 3P71T 5T3YA 1IJEA 1FNBA 3D6AA 4EIWA 5BQ5A 3SHVA 4O4HB 2X41A 3GMTA 4E07A 1Q7GA 3ZU2A 3VA7A 3PC2A 5EQFA 2KSQA 2QQGA 1Y3AA 2A7QA 3OKCA 5BW5A 5ELMA 3G0GA 3NT4A 2I6GA 2R60A 4AJNA 2GKOA 4NBVA 4M9UA 1OBVA 4B3FX 1SQSA 4FB4A 1IATA 4NZOA 5TGZA 3V9AA 2WSBA 3BRQA 2O8FA 1UKVY 3ACBA 1BA2A 1T1IA 2FKAA 2PSFA 1L7PA 1N6NA 5H80A 2CFOA 4NATA 2FOXA 4MWGA 4LF4B 1ECBA 2FPIA 4GI5A 1XAGA 2H4ZA 1CX9B 2PKWA 2XDYA 3HLTA 5IT5A 1EP1B 4TMKA 4AURA 1EK0A 3P2EA 1JFSA 1YCGA 2C7RA 4F45A 4X1KA 1NJ2A 2UZIR 3ORRA 1DRJA 4RYLA 2XQIA 3MJSA 4FZ5A 5H0IA 3WS7A 1YA8A 2HO4A 2WICA 3INGA 2QLJA 1EP2B 4Q37A 3B6IA 2OILA 1WVIA 3IIMA 2VA8A 3WGNA 3A4YA 3WRYA 4DUZB 3B9PA 5JALA 3STYA 1RXCA 4P2GA 4YCSA 1PI3A 3DH0A 3ENVA 3LZCA 1RJFA 1F8XA 3JZMA 1JQBA 3OUZA 2Z5GA 3BSFA 1H8ED 1Z35A 4D3YA 3RFFA 2JCYA 2JW5A 2FUKA 3H83A 1IUPA 4RGVA 1YS6A 1UWVA 3ISJA 3T6KA 1I2DA 2PANA 1W1UA 3GEHA 1RPAA 1TVKB 1EJBA 1B6GA 1FS6A 3LYHA 4KXXA 4MQBA 5EUMA 5ILGA 1QQTA 4PSCA 2O3SA 1BX0A 3F3MA 4PZEA 2B1JA 1N2BA 2XUHA 4BJHB 4ZYZA 2C3OA 1RVV1 3RFUA 2AN9A 2EAUA 2LUOA 5J9FA 1EFPA 4QTZA 2XGJA 2GO1A 2IYOA 2C1EA 1JQJC 2O5RA 3B36A 4I66A 4H6WA 4WZAA 2J6BA 1N0WA 4EEZA 3COPA 4LZWA 3HWSA 2VDMB 2IEGA 4MVJA 3EG9A 2FW9A 1UQTA 5JAHA 2XNSA 1PFUA 2OCXA 3M4NA 4KSBA 4YWHA 4B73A 4D3DA 4G1EB 5COQA 4BQNA 2FI1A 1DUVG 3PE4A 4CLHA 3N6RA 2DWQA 5JJLA 1TAQA 5K8JB 4Q1AA 3JQGB 1JHZA 2YC4C 1U11A 2GAFA 3AWIA 3CB2A 3I34X 5K4AA 3DVQX 4HXFB 3IT3A 1EDDA 2IIPA 1ZCJA 4FDVA 4BO3A 2O19A 3FFBA 1RCFA 3AHHA 1KA9H 5C7OO 4J2TA 1F9EA 3MFQA 5L7YA 5HRUA 2M6SA 5DHRA 1LQTA 1ZIDA 5K0FA 1VCOA 3O0TA 2J3KA 3Q1KA 4G0OA 3BJZA 2DUMA 1EVLA 4AICA 3SHFA 2FP3A 1FTYA 1QBKC 3HFSA 4I6JA 4JDPA 5E3IA 1RXSA 4LHXA 1KVQA 1YVEI 3ZZUA 1E9BA 2WWFA 3SFVA 3KL4A 2ZDHA 4UPVA 2EFDB 5FWDA 3J7TA 1P4RA 1LRLA 4LNAA 3PNOA 4BY9E 3OETA 2JK1A 2YDYA 1JDUA 4FK8A 5FNZA 5I9TA 4TLAA 4HAUA 4U9UA 5GPBA 4FDTA 1CP3A 1F2TB 1H9BA 1H93A 2IA5A 3BB3A 3ICOA 3KB6A 4JLSA 3BWXA 4R54A 2Q7OE 5LMZA 3JQQA 3NIWA 2WIAA 2AOWA 4IEEA 4QPCA 3ZNOA 2B2XA 2CNWD 1D03A 3HKDB 4OJNA 1X1TA 5TT1A 2ZKLA 2W2MA 5CX1A 3OQPA 1QGYA 4D99A 3FE2A 1OXXK 2RHCA 3CY6A 3QRWA 4LMBA 2QVZX 4X0EA 4HLUA 3DHNA 4BGUA 1TLTA 3IEXA 1E3EA 4F21A 3HXOA 1VYTA 3KX2A 5FULA 3B7WA 1C8LA 4XKJA 2M1XA 3SMQA 4CKCB 2B0CA 3TQRA 2HKIA 3J80A 4EBBA 2O2ZA 2I4RA 3K0EA 4Q3DA 5F2KA 3T3HA 1GA6A 5DLDA 2Q9UA 1L5MA 1RZ3A 1MA0A 3GNTA 5JXJA 4H1UA 1WD7A 2QL9A 3IERA 3NHZA 2YWGA 1XCBA 3D9QX 4PLYA 1XB2A 4GUAA 2KHZA 1QMGA 5C1DA 1AKRA 4LI3X 2Y76A 2YQ5A 3DBLA 3UMBA 4BLTA 5I01A 4FXOA 4B33A 1Y3IA 4MUMA 1I2AA 1ABFA 4X6LA 1M1UA 2GETA 3L7KA 5DSXA 4KQIA 3SZ3A 4G1FA 1RLMA 2QTFA 5GGYA 3Q7PA 4GQAA 4AQDA 1H2RS 1T9CA 2N1MA 5JIBA 4PRYA 1QS0A 1TO6A 4IUDS 5FT9A 5BT9A 3X3HA 3OKAA 3S2ZA 3IDQA 4HVTA 3D81A 1GUYA 2OD9A 1H8EA 2YASA 3QSYA 4YPVA 2YN4A 2XCRB 4LDPA 4O4LB 3HJNA 5DGHA 4CR6A 1OPRA 1Y7HA 1G5PA 4Q4AA 4BP1A 2BRUA 4UDOA 1B41A 1QHFA 2EWMA 2IP2A 3PFKA 1WHSB 3BJEA 4UAVA 4BZQA 2WTUA 4MRAA 1QVAA 5DX8A 4TL7A 2QM0A 4RETA 5AQEA 5LB4A 2A0KA 9MHTA 4WN9B 2FZVA 3G8AA 4II3A 4M46A 5AM1A 3WNQA 1O96B 3MJEA 5EZ5A 2D6FA 1ZZEA 2QKYA 3T7AA 5EIWA 3IPXA 3EXEA 3S68A 3S2IA 5FL7D 2WVGA 2ZPUA 3OZEA 5CFRA 1OYVA 1U28C 4PXAA 4BRZA 3HCFA 1WZNA 2INGX 2ZVJA 1UDRA 5SY6A 1JB9A 1YBAA 2ZRAA 3KELA 3SOPA 1QORA 1VXRA 1R4NB 2FUCA 3B9QA 2G0TA 2H4XA 3QQPA 3UC9A 2VUSA 1GNVA 3TYXA 2BVNA 2V65A 1ZR2A 1VJ1A 5E2BA 3PTAA 4BDTA 2J46A 1W0CA 3KZXA 2XOKD 4AMVA 1Y8AA 3FSRA 3UHJA 2FMIA 2ONYA 4GKBA 4N41A 3D7LA 3K73O 3NTQA 3OUUA 4R5HA 1Y89A 1ZP6A 1NN5A 3L18A 3P9YA 4X44A 4A16A 4CV3A 5L51A 1ZK3A 2BUAA 2FRDC 3PXGA 3JRXA 4UATA 3NVKI 4TXMA 1M33A 5DCWA 2W2NA 2YRXA 4OEHA 4BLVA 4F3NA 3B5JA 5LZ9A 1PU2A 2D1FA 1K66A 4BNTA 1MFPA 3PUZA 4IBOA 1J0CA 4C4YA 4QBGB 4RZ2A 3STUA 3H6HA 2E5LB 3CZRA 2DSTA 3NUQA 2RE8A 3AR8A 3NRJA 3UPUA 5C80A 4YR9A 2CNWA 4PZDA 4Q7KA 3FIUA 1PSWA 5CDFA 4OB6A 3UC5A 1LLFA 1Z12A 2XLBA 1AQLA 2IXAA 1XU7A 4AYWA 3U56A 2EHDA 2FVXA 4TWJA 4YRNA 1JH9A 4C3VA 3PRKE 4HMPA 3RVJA 2HHAA 4DQUA 2CXPA 4MEBA 2JAHA 2QNBA 4TVOA 2VJOA 4NCKA 1WHTA 3D43A 3VR5D 4ZDJA 3TTXA 4UPEA 2B7CA 4XD2A 2XH8A 3S1AA 1YNSA 2BGMA 1D8AA 1E5QA 2Y1XA 4OD0A 2QLFA 3BSSA 1PJTA 2E18A 3HBNA 3O4GA 2QDXA 3GLGE 2KLBA 4MJ7A 5CFNA 1A9SA 1F38A 1AK9A 4UU8A 5JDCC 1AOXA 1IOVA 2P9EA 1YU9A 5F2OA 1Z4MA 2PH1A 4EARA 2ZR0A 1BN7A 3DZJA 5CIWA 1M2OB 2GFIA 4YMUA 3UMYA 2IDJA 3U26A 4C7JA 2HPHA 2RB5A 3OM0A 5B58C 4AZ0A 1J07A 5CU7A 3LLMA 1ZK0A 3C39A 3UY4A 1GY8A 4IKPA 5ALVA 4RM3A 1N6IA 1A9QA 2GBLA 4TKZA 1XJ0A 3TFQA 4FDAA 1REQB 3G5UA 3QKRB 1J2TA 1JBQA 1DTSA 1RHMA 4JLKA 3RTEA 1R0XA 2I1LA 3K6JA 2W6QA 2ACWA 4XFJA 3UT6A 4PS0A 1V8PA 1AURA 2IPAB 2FGKA 4G2NA 3ZKWA 2ENUA 1ESZA 1T0JB 1H0HA 5HIIA 1CU1A 2ZR8A 3G7NA 1GGMA 2GWRA 4KYUA 1PWZA 4NK4A 2FFHA 2ZSJA 2L42A 3OQ6A 3CW8X 4I19A 2X2FA 2GMWA 1KOLA 1XVVA 2ZSAA 3FFXA 3IBFA 4RLHA 2WF5A 1PWEA 5AVJA 4BJ6A 2JI8A 5KWEA 1XELA 3SXJA 1XCMA 1SXJB 1MX3A 2XF8A 2B3TA 3N3BC 2OAGA 2NUTB 3LWNA 1JA1A 5C34B 1WW2A 4KSCA 1EB8A 2GOYA 3P32A 3SHTA 3AR7A 3OEEA 2QF7A 3PT9A 2GM4A 4AG3A 4G0VA 3U17A 1P17A 1VMAA 3OX1A 4D0NA 2QP3A 4MWTA 3CSUA 5T64A 5L95A 1J99A 4JENA 3CX8A 1Y63A 2JIOA 5I6DA 1ENYA 3OE7D 1O97C 2CMHA 4ZZ0A 4PNHA 2O0JA 3AF3A 1IJFA 4I6GA 4LHEA 2EZ4A 2XOKA 5FBZA 4DLYA 1AZSC 2ODEA 3TSAA 2C5AA 5I7AA 1LPBB 4K6HA 4OL9A 3STWA 2HGSA 2LXNA 2J5KA 4W7IA 4KMRA 1DC4A 4WNAA 4HUJA 3N8GA 1THMA 4E12A 4MUNA 1XDZA 4JBLA 4K5QA 1K7YA 3TKLA 3GJ4A 3RYTC 3HI4A 3BKWA 3ZD8A 3OPYI 3T52A 2CLFB 3LFHA 4JB8A 3HC7A 5CB4F 3K5HA 3PPWA 1DAIA 4H59A 3AIOA 4BU0A 4BXOA 3M0EA 2HFKA 3W5BA 2WF9A 4W9NC 4ZCSA 4JD5A 2XA1A 2MSWA 3K32A 5KPDA 1VCHA 3EHDA 4WV3A 2QBYA 1GILA 4GVPA 4O3MA 1A9TA 1FA9A 1JLRA 1ZJ5A 2IUEA 3FHCB 2QVGA 2VOEA 3PUYA 1P19A 3K0FA 4FTWA 2BHSA 3GLRA 4BNJA 1VLMA 3IULA 3FLMA 1ODKA 3M5CA 3GXBA 4NVRA 3IEVA 2NTVA 4IHJA 4UVDA 3LOUA 5TQJA 3HXMA 1ACMA 3ILYA 1E94E 4KQMA 3BMCA 2QRPA 5ENZA 1R9JA 3G9ZA 1VKZA 3SYRA 4DC1A 3HDYA 1PJ2A 3CLSD 1GAXA 5GINE 4TSFA 1DX4A 2QT0A 2V58A 3O95A 3KD2A 3NDJA 2P62A 4QPPA 3PZRA 1JALA 3KZNA 1HRKA 3OZUA 3L8FA 1JKFA 2EXXA 3ESRA 3TKAA 2WT8A 3VR5A 5BYAA 4ZAYA 3L9XA 3NGXA 3OLZA 4G1BA 1W85B 2NNWB 3P45A 1W49A 3QE2A 4LHWA 4XR9A 3EB9A 3FF1A 4OHOA 1C7ZA 4G97A 3JATB 4D7AA 1QANA 4Q19A 2RONA 2PHZA 3CX4A 5FUVA 3A4IA 2A0FA 1WG8A 1R6UA 2R85A 3COYA 3O92A 5DRTA 3ONWA 3BIJA 2PZBA 4QRHA 3ZVRA 3GRYA 1I6KA 2D1RA 2VN8A 3BERA 3H4TA 1CUUA 4P80A 3AF1A 4MJXA 3AIKA 5EIFA 1P6QA 1XAJA 2HBZA 3KIPA 4ZVQA 1IQ0A 5IKXA 3ESZA 1XCLA 1YE5A 4D25A 3MWYW 1YACA 4TS4A 1KYQA 5CVCA 1ZWLA 5FO0A 2BSQA 3W78A 2VPIA 2E0IA 2VNIA 5H8WA 2YJ6A 1MT0A 3AG6A 1GCOA 4YCBA 3CTMA 2IKQA 1YR6A 3JQ9C 1DQPA 1FVXA 1QIFA 3KLMX 1JIXA 1HLDA 1NLYA 5FTJA 3K9HA 2WB2A 2DT5A 1BQEA 4DJ5X 3FROA 3N2EA 4M1ZA 3FOCA 4JLJA 1OFGA 1JSRA 3PCTA 4BUCA 1AGYA 1TK3A 2VAXA 2VHEA 4FILA 3ZW9A 1TU3A 5C8YA 3TS1A 5CJ2A 1RMQA 2CHUA 4IJKA 1OA0A 3SZLA 5FWXB 4U1RA 3AU8A 1L1FA 3HDQA 2R00C 3UWKA 4JUFA 5DM4A 3DWEX 3G89A 1TQ6A 3WP1B 1P1HA 5AO9A 3SLRA 2NZYA 1BA3A 1FP4B 1O77A 2QENA 1B26A 3GEGA 5AW4A 4I8DA 1O54A 3UO8B 3DAFA 4WBNA 3C7CB 4AIIA 4DRXB 2ONJA 2OE2A 2I9KA 3QIAA 1DX9A 4I2NA 4FIDA 4YUWA 2CXNA 1WUIS 4QGBA 3JAWB 3ZCVA 4E7OA 3DYBA 5JSZB 2VP4A 5LA6F 2DTDA 4LHYA 4TWAA 1X80B 2FZ4A 2QGFA 3M70A 3QKUA 2XBLA 1A71A 2W11A 4AJJA 4GR9A 3PIRA 3VGJA 4P0PB 5AJZA 3HACA 2UU9B 1KERA 4BFVA 3G6KA 1QFMA 3RFXA 3FI0A 1RWPA 1V7PC 1VZ2A 2NT3A 1UWKA 4CCYA 1X7HA 1PEYA 2QP4A 2BFBA 2V6BA 5TS2A 2HNBA 1FFEA 3G68A 3LX6A 1DQZA 3PHGA 1KL7A 3QX8A 4GXTA 5K0NA 3KZMA 4CKXA 5BUZA 4KI7A 2FF5A 4IAOA 1ZUWA 1M8PA 3FMGA 4YEDA 2EKZA 4L8FA 1OYOA 1SBCA 2Q3EA 3VJKA 1CDEA 3AC0A 4PZCA 3PDIB 4IDCA 1G4HA 1UK6A 3ACDA 2GWHA 4LXQA 3AHDA 3GA5A 2P3LA 2CMGA 4WOPA 1ISGA 3Q11A 4R7GA 3BXPA 1DCFA 1NF9A 3JQGA 2W6JD 4DIOA 1HE1C 1FY2A 1E5VA 1MVLA 3NVAA 3LCUA 5B57C 5FWAA 1OKKA 1QX3A 1DKUA 2IPMA 2QZ4A 1GQ2A 1HE4A 4AUKA 4DUPA 4EVIA 2QAGB 1ZGJA 1EBUA 1H2XA 2QWXA 3KWLA 3V8PA 1GTJ1 2GD6A 4MGEA 1EXVA 5F3WB 3KJGA 1UR5A 5AVTA 2BEVB 5LQRA 4G4IA 2BI8A 4MINA 1ID8A 3MCVA 1AS3A 4BMNA 4QTXA 5LIPA 2JAXA 1N6KA 4GYKA 2AL7A 4PC2A 4ZQGA 2CV0A 3G9UA 5JZBA 3JYOA 1XJQA 2Q2VA 2VJDA 3A9TA 2O0HA 2OHIA 3RSHA 2Z58A 2PMWB 2VZ8A 4BQEA 5JZ9A 2VBFA 2NPIA 1K4YA 1OGYA 2KBFA 2FOLA 3BBLA 2IEAA 3O8QB 1NVEA 5CBPB 4F8EA 5LFAA 2A9VA 1HUQA 1Z16A 3GDOA 3HZHA 4FHDA 1YIOA 2P78A 3KKNA 1VG8A 1WZ2A 3LPCA 1XOIA 3G2MA 2IU0A 3S0JA 5L3SA 5A02A 4KXNA 4MUHA 2VLBA 3WLFA 5HNKA 1Z4KA 1SWWA 2J0UA 3QLVA 3O2QB 3GUVA 1FTSA 2CEKA 3VYTB 2M9MA 3BXFA 5ENDA 3B1XA 3J81k 1E6LA 2YN0A 1ZZGA 2PDAA 3PUKA 2XVXA 3TO5A 4NLLA 4BTVA 4JYPA 5DHFA 5C37A 1X7XA 5DN6A 4JUBA 1PTKA 1C50A 2EX1A 4ETIA 3GAZA 4I1PA 2LP4Y 1Q14A 2EBWA 4LE2A 1NW6A 2E4YA 3UJ7A 2JLAA 3QE4A 3OIDA 2G4VA 5BNWA 1MH9A 2NGRA 1F1JA 4NS1A 3VYRB 5F2NA 2W90A 4H16A 4W5NA 2GS9A 1HEUA 5AUQA 4TLDA 1LI5A 2YIJA 1CDOA 2FSUA 1WUTA 5A0TA 2D3WA 2O50A 3TLZA 1X19A 3UUEA 4ICIA 5L4NA 2VNSA 5C1PA 1CRZA 3FYCA 2VT6A 1XZMA 2P0YA 3O8OA 4TLLB 4OFBA 3UB4A 4LK3A 2EQ5A 1WP9A 2CDCA 2ES4A 2PKCA 3BB1A 4J0KA 1PVVA 3RUEA 4X6UA 2J4DA 3KYJB 4J49A 5IC4A 2ODNA 4HWOA 5KJFA 5JRZA 2E55A 5LB2A 3O9VA 4WFQA 5AXCA 1FSFA 1F06A 1IZYA 1NPYA 5BN4A 2H0QA 5H82A 1D2MA 5B3AA 2DQ4A 3NONA 3B3QA 2B3DA 3PD1A 3RUFA 3AVXA 4H7HA 4FP9A 4PLPA 2G88A 4EZBA 3HCWA 3JD3A 4M1YA 1IMJA 4RLFA 4URWR 1IZ7A 1UK8A 2QTGA 4HXYA 5EJ8A 5I7RA 3M89A 3FWKA 3UN1A 1SXJD 3W6PA 3DV9A 4ZO7A 5IBRA 5C81A 2J7KA 3ZGVA 3LVQE 2XQKA 3RIMA 1GFWA 3V33A 3X2SA 5JY1A 4KQGA 2GHQA 3F8TA 1NW5A 3G5LA 3UANA 4ZMRA 3RM3A 3B78A 2I6XA 4KIFA 3U4CA 3WIVA 2JJYA 2JKVA 5EQTA 1QE3A 3WYGA 1PNTA 5C4IA 2W6JA 4HLQB 2D1TA 4I99A 1S8OA 4JHXA 4IQGA 3I9OA 2BGLA 4MEAA 3GMIA 4PO8A 1L8AA 2BFEB 1TTTA 2YJ3A 5I5GA 1JI0A 5GZ3A 4KMSA 1P2VA 2HBYA 1LW6E 4ZARA 4B34A 5IAEA 1DIHA 1JNYA 3O94A 3K8OE 3ZHUA 1FP1D 4AUEA 2MSCB 2QN7A 4RZIA 4QVKA 4MRSA 3ZWQA 1F12A 4M1MA 3SZOA 3ADPA 3W1EA 3JD1A 1M10A 3F5QA 2OXEA 4Y0VA 1BS1A 5BNFA 4E5KA 3FNEA 1HDIA 3MJTA 4UEWA 4XE5A 1KARA 3BWDD 1YS1X 1U7DA 2DOKA 4DCNA 2ZM6B 3P0EA 1O2DA 1O4WA 2C7VA 3GROA 2QLMA 1ZEJA 1GUFA 1U8CB 1IN7A 1ZIOA 3AF0A 3GT3A 2DAPA 3RK0A 3EVFA 2AYXA 4NSNA 1ZVMA 3W3ZB 3HVJA 4DCOA 3KUXA 4EB6A 5JH7A 4JI7B 4AN0A 4JLOA 3T5CA 3BDAA 4J1TA 2F9MA 2FLWA 1EAYA 5CDUA 5K20A 3JASB 3QOXA 4TZKA 1EUDB 1T9GR 3SJUA 1KKLA 2QUAA 1J33A 1NQXA 1W1WA 3C14C 2PV7A 4CNQA 1QKKA 2K2WA 2OHVA 4JBIA 5CH3A 3V2HA 4XWOA 5EIHA 5FUMA 1GZ5A 5FPHA 2O8DB 3NDBB 1ADBA 5F1YA 1DG3A 1XZKA 3Q9LA 3THXB 3HWX1 3PFIA 1GNRA 3M5DA 1TYCA 3ESYA 3ORHA 3REOA 3TSCA 4E2XA 1LNZA 2CHVA 4O63O 2NZJA 1DRWA 1SA0B 3CZAA 1QE5A 1UZMA 3GRRA 1SBQA 1MO4A 2CCJA 1W48A 2FFJA 4NFSA 4AECA 2FG5A 4EPRA 1RYMA 5FUBA 2RBEA 1J21A 4RPLA 4RIFA 4FEYA 2VF5X 2VP5A 5L6MB 2CLDX 4HWRA 3GLHB 4ZTUB 2W43A 3RVQA 2C3UA 3CPEA 1I1NA 2GAAA 1I30A 1F20A 4KX5A 1A72A 1O87A 4RY2A 4WY5A 3RDPA 3W9UA 1YRYE 2OB1A 3KLBA 2DPGA 2DHDA 2IL1A 4FMCB 1NYTA 2AUMA 1JKJA 3FYUA 3C24A 1EU1A 3N0RA 3TCXB 1OCEA 3WQQA 3KWMA 4N9QA 4Y6PA 1MGPA 4D3ZA 4MLDA 4Y1FA 3TD9A 2XD9A 3MNFA 3RBZA 1C4XA 4PIPA 4JELA 3COSA 3IURA 3ZN2A 2AK2A 1DI0A 4G65A 4RF3A 2JIDA 2PX4A 1GTSA 3UEOA 2HA0A 2IUTA 4HGQA 4NBUA 1CUZA 3V00A 2AOTB 2KJQA 1R2QA 3NDIA 5HFAA 1JQDA 1Q19A 1XZDA 4R1SA 3STXA 2JGAA 3INYA 3WNBA 1BE0A 3RFTA 1OIVA 4FWIB 4JKIA 2WLTA 3CVYA 2XF2A 4HAVA 3TQHA 1QP0A 4OSEA 4Z6KA 1T8UA 3A4NA 3GD7A 4W5TA 1NRIA 3GCXA 2PBFA 5I7VA 3QZUA 3PXEA 2G7MC 1TEVA 3PA8A 5IC6A 2BY4A 1RMTA 5I7WA 1K3UB 4H35A 3IE1A 4YYZA 1ZU4A 4RFLA 2WRZA 1I9CA 3OHPA 2ZQ5A 1ZM2A 4PYMA 4AP5A 9LDTA 5JY6A 2JLBA 1R0YA 1YFJA 4KXWA 2WA1A 5M29A 1PL7A 6NULA 2FQYA 3CF0A 1HE8B 3QLUA 2JIRA 1P60A 1XD9A 2AA3A 4OYYA 1AZWA 3IA2A 4P82A 4CEIA 1WW3A 1PS0A 2QD1A 2C94A 3OD1A 3NV9A 1FRFS 3ADKA 3IAAA 4RZ3A 2Z2IA 1OFIA 1PW5A 3JAKA 2XZLA 3EXIB 1LW7A 1VG0B 2CUZA 4RIIA 5JCOA 3W2FA 4CG0A 5JFOA 2AEMA 3QTTA 4KO8A 4B3XA 4D82A 5IAOA 3EFHA 2VC2B 2UZ1A 3ZU6A 4OHBA 1F3LA 1N1EA 2A5GA 2PEZA 1R8JA 3G9TA 1ZLXA 2ZYAA 2FMHA 5G53C 3CV3A 3TQCA 5SZHB 4DV6B 3L0IB 4WT7A 2R6HA 2H2IA 3SIWA 3NBZC 3QXCA 3GL9A 2CNOA 4LRUA 1A96A 1Z6XA 3CNLA 2Q4OA 4P7FA 1P44A 2QPLA 2DY0A 3ISVA 3VU9A 2A7XA 4CN9A 1B7GO 2Q21A 4FOSA 5FNVF 1PK7A 3LCJA 2QHXA 3LC2O 3MQ4A 2M98A 3PDUA 4O2AF 1J90A 4UZEA 4Y9SA 1O9HA 5AK0A 3ZIUA 2H1WA 3EVNA 3IBTA 1W6UA 3UGJA 9LDBA 4D81A 1KFCB 2FVYA 3KQVA 4WAUA 4X8HA 5BRAA 4R1MA 2ISQA 1OAOA 4IX9A 1M6NA 3C3BA 1E5DA 3LC0A 4WTOA 5J4VA 1JDNA 2FZWA 3NYIA 3RYIA 3MRSA 4L7QA 1NMSA 3MUOA 4G4SO 1YBMA 2RGUA 4X20B 5LWHA 1VHDA 4P98A 3BH0A 1FRQA 2I2FA 5IZCA 4NENA 3PHIA 3K0AA 1KZ1A 3TE7A 4TL8A 1UFRA 3T4UA 5CLIA 4Z1OA 2OHFA 4I36A 1RAGA 4PTZA 1QP4A 2FTKE 3NNNA 1MRZA 4ZAGA 3LSTA 1R6VA 5ALFA 2VZLA 3E9EA 3TM5A 4I3FA 3MGAA 2F8TA 3SR3A 3BZWA 1EG7A 4IUYA 4ZRNA 3VYSB 3ENQA 1XPOA 4UU0A 4JC4A 7AT1A 2XXAB 1TF7A 3B3FA 1L5RA 4YNBA 2WI8A 3GC6A 2EATA 4YK7A 2JGRA 1T5IA 4O2AB 4A2WA 2V6FA 4QFMA 4DDMA 2X0IA 3KDAA 4ITVA 4Z4EA 3G9XA 4B3HA 4W5HA 3ZW7A 4N1AA 3VPHA 3Q6MA 2HBQA 4EA7A 3VVBA 5HZMA 1FJGB 3FUWA 5D00A 4R3NA 1ZITA 1YO6A 1YZUA 5K0SA 2ASEA 3GJ8A 4DR1B 3CTPA 3OMLA 4YT4A 4BLPA 1GPNA 4F9TA 1PZHA 3QU7A 4FLFA 1GGKA 2WG0A 4RELA 2PL1A 4QLAA 5A06A 1ML4A 4AQ7A 2I0FA 2JATA 3FKJA 1BS2A 1NVVQ 4P54A 2AG0A 5LDGA 3AJ8A 3RT1A 1VE6A 3T3IA 4M21A 3THWB 1U7ZA 1U1FA 4M87A 2DBZA 4PY2A 2JBAB 4BLRA 2PMDA 2PLWA 4Y2TA 1FDVA 5CB8A 3UGKA 3R75A 2HMVA 3AI7A 5B5SA 5KUTA 4JC5A 2V4ZA 4FR5A 5CXSA 1JE0A 4DXAA 4QXMA 2X15A 4UMVA 5I7EA 3PWTA 5L53A 1MVNA 1U04A 1PZMA 2FWIA 1P2TA 5A1JA 4PNPA 1U7OA 1TEHA 2NXJA 2PWAA 1H3FA 1FP7A 1EE9A 1Y3CE 3UKOA 2R84A 3FPSA 2R8EA 1FP4A 3U49A 4D4HA 1UEIA 3KLNA 3HH8A 2WC1A 3LYUA 1OWMA 4L0CA 2R87A 5ECDA 3I6MA 1Y48E 1ZH8A 3AUAA 3D6HA 3NJ8A 4L0DA 1XIVA 3K1ZA 4ZEWA 3PG5A 3TXYA 2AX4A 5AW0A 1JR2A 5FA5A 4XSVA 4EPYA 1VE3A 1A9RA 2XMSA 2AFIA 4L9SA 4LY6A 2FZLA 2VJBA 3HNPA 4L51A 1SHZA 4MVWA 2G1UA 1YR9A 3ZE0B 1UZUA 2OO7A 2PEYA 3FAKA 3FFWA 3JQFC 4FZRA 4AM8A 1EVKA 3EFOB 4O08A 4Q03A 5JU6A 4M6WA 1ODFA 3LCCA 4RDHA 3G8BA 2JGDB 4WNYA 2WY2D 1BDHA 5CIYA 2BGIA 1PAUA 2D06A 2V9ZA 5IKEA 5JCJD 1DGQA 1Y6RA 2IODA 4HAXA 2P5SA 2PMCA 4PZAA 3DXFA 3DE4X 3B1VA 1E0JA 3KUKA 1RAEA 3PDIA 4Q00A 1EZ4A 4H4EA 4UBMA 4ZEXA 2WIBA 2NO4A 3DBVO 8ATCA 3F6CA 4RKRA 4V24A 3R7NA 3SDSA 4A8PA 5CITA 1YR8A 1I7LA 4B8YA 3PYLA 2BR4A 1OILA 4MLCA 1NMQA 4XJTA 2CK3D 3KQWA 1QGZA 3EOAI 4MW7A 3T5PA 5IU6A 3OU6A 1IG0A 4KV7A 2W0SA 1TAUA 2GYVA 2FMFA 4NCJA 3O82A 2RGCA 1J97A 2NZXA 1ZGGA 3HUFA 3ZZMA 1VI6A 4E5YA 4F3KA 10MHA 5G41A 3VTFA 4F4DA 5KREA 3LNTA 5AM5A 2FEKA 2X4IA 3O4JA 1KQGA 2Q27A 3SYKA 3HKEB 3BILA 1PYGA 5H3HA 4CGZA 1BD3A 2JB9A 2LV8A 5EKSA 4L2IB 3TD6A 1CUAA 2BM9A 1NR7A 4XSHA 2VBGA 1GL6A 2COKA 4RGQA 3ANLA 4UEJA 2C9DA 5DSTA 1H2AS 2R8BA 2NU8B 4DSUA 5JSFA 4GVLA 3M81A 2N0SA 3W77A 4QBIA 1WCYA 3K6KA 4LXUA 1SUAA 4C5BA 4D74A 1OH6A 1ZL2A 4LA4A 4OXYA 2Q5OA 2I3DA 3HMQA 1YUBA 4UE2A 1GZVA 1DVRA 4TROA 1A1VA 3G0HA 4JI5B 3UKJA 4BV8A 1W9HA 3H9BA 1WZCA 2C0CA 3RWOA 3B12A 5HWSA 2AR9A 1ZJZA 3TLMA 3H0EA 8GPBA 2P2GA 1KI7A 1U31A 1ZUIA 2XNDA 1BDBA 1J0XO 1EBBA 1V3UA 1VLZA 2DY1A 4ZYXA 4LNHA 1BXGB 3SBEA 3DOOA 3OOYA 1AXRA 2IIBA 1RNLA 1N5OX 1E6CA 4NYMQ 2ADMA 4TMXA 1KH2A 1DINA 3M3PA 2BDUA 3K9LA 3LZ6A 4GPZA 3QVOA 4YJ3B 2FW6A 2M2IA 3L0ZA 2BCJQ 3M6WA 4HX9A 1EWVA 3AHEA 2PH7A 3K6RA 4PTLA 3X2EA 5B1EA 1GEGA 1U2PA 3VISA 1C3JA 3N28A 3F0TA 4Z4IA 3MQFA 3I45A 2PXCA 3SNKA 2FK8A 1GPYA 1I3OA 2VJLA 3M4YA 4RIGA 4HS4A 4A9AA 2OQVA 3QOYA 1T3HA 1IG3A 3EEFA 1E2EA 3R3XA 3KKEA 3SFTA 2WJIA 3FZQA 2NTNA 2BC9A 4PPFA 2PUEA 3WJAA 1KMHB 2BKAA 1EVYA 1ZH0A 1F4PA 1NY6A 3IOMA 1C9DB 3QU9A 3CE9A 3O2SB 2C8LA 5DP2A 4JL5A 4A10A 1KNXA 3U1BA 4DSZA 3W6OA 3HGTA 2VZEA 5B4TA 4DMKA 2RIPA 2HD4A 4UOEA 4HFMA 4UD6A 3A11A 1JVBA 1FLAA 1Y6QA 1JW9B 2JFOA 1E3WA 4BNDA 5A9SB 2AD1A 5CW2A 4NU8X 4PG8A 3U44A 1JEYB 5TGDA 3ZEIA 4REOA 4MVJM 5MFZA 2GRAA 2HT1A 3T1NA 4PFKA 3EGWA 2FPRA 1TW2A 2H9IA 2VATA 1RBMA 1X0VA 4PWZA 3STHA 1W4CA 3PGXA 3RD5A 1S02A 1SHTX 4UHHA 5BUSA 4M9QA 1DCKA 1ZXBA 2AOVA 4P2BA 1KIFA 1AUQA 4J6FA 3TLYA 4AJLA 4D6XA 3AR2A 1KAHA 4G4JA 1QUEA 1I2CA 3G59A 4TN5A 4NZZA 4GYYA 1HORA 3H5LA 5JNUA 4H0NA 2OXTA 2XWSA 2G63A 2BGJA 2J4FA 3L1JA 4WLFA 3EGDA 1CIJA 2FP4A 1MC1A 3THSA 1LLQA 4TYQA 4AVYA 1Z39A 2R8OA 1GIAA 4G01B 4MGHA 1I4OA 5TQ0B 1M3SA 2PJZA 4YAOA 3RU2A 1QONA 2WAAA 3EULA 4MW5A 2Q8PA 5DP1A 4N8EA 5FTWA 3HYTA 1DLIA 5JPDA 5LQNA 2A9JA 2VH1A 3CNOA 1G16A 3QW2A 4J7UA 2D4HA 4TT3D 4TMFA 5JASA 1Z33A 5BR1A 2PUDA 1ONOA 2D13A 2J7PA 3I8XA 2R1VB 1JXMA 3DUFA 4K9DA 3CVWA 4A0QA 2JG3A 4NDZA 2JHAA 4G0UA 2WHPB 1TYAE 1WNTA 2D5IA 3KZ1E 3LNCA 4YRGA 3OZGA 4F72A 5HQ3B 3KYCB 4WADA 3BF8A 3T9DA 1N0VC 4JJFA 4PGGA 2Q3CA 2VT2A 5BV8A 3DWGA 4N5DA 5J23A 2EKBA 3Q6NA 1SCBA 2WJAA 3RI3A 3JTMA 1ZNZA 1EGVB 2GD1O 2I3ZA 1N4AA 1YRLA 2A1TS 2F3QA 3AY6A 3RV4A 2A59A 3O3NB 1C7FA 1N5KA 3Q4GA 2AEFA 5CH8A 3UZUA 1NV9A 4YFVA 3MPUA 2TMDA 3N0TA 3R3HA 2XE4A 1A2KC 1T1SA 2XYPA 3DFUA 3NOQA 5G0TA 5EJ4A 2FMTA 3NBQA 2Q3LA 1PL0A 1W52X 3KSDO 3PFFA 4RXUA 1GSOA 2GJAA 2FKNA 5DTRA 1TKAA 2VNHA 2P9FA 5DYTA 3UVEA 3EF3A 3EA5A 3VQTA 1G2IA 1Q7BA 1G5HA 1UBRS 3PPVA 3F71A 4P36A 1WMDA 3KHUA 2FN8A 2O8DA 4KXQA 1ORIA 3EXHA 4OJQA 3L0BA 3FUUA 4OHCA 1OLOA 2VAWA 5IXYA 3JWJA 3AEXA 1UJBA 2ZR7A 3AW8A 3PC7A 1ANKA 4YLGA 3ZE2B 2CFIA 1C29B 4G24A 1SA0A 1VSQA 2B8WA 4MWOA 2J9YB 4TV9A 5JPIA 4RK1A 1R4AA 2JLZA 3WVNA 2OCPA 5B6IA 4IOLA 4LJ9A 5M2QA 5TLSA 1F14A 2V8OA 5IF3A 3H3FA 1X7DA 3EZNA 2P4UA 1P0PA 3I2FA 4HN2A 3UOWA 2Z98A 3QKIA 3GLGB 1KNQA 1KYVA 3WBKA 1DQYA 3UFXA 4CKWA 1KDOA 1TJ5A 2GGSA 3NORA 2C2BA 3TVTA 1PW7A 3P26A 4NG4A 1T4GA 4CF4A 3PEYA 3LHDA 3QJYA 1IDN1 1XALA 3VPDA 2VT3A 4KREA 1J9EA 2I03A 4M2LA 3MSXA 3CF4G 2HC9A 2C0PA 4MWEA 2ZSDA 4N7MA 1XFDA 2F43B 2X0KA 3AQ4A 3D7KA 2FMKA 4R81A 5ECYA 3L7IA 3GFQA 3PFCA 1LBEA 1Q7RA 5IT9A 3EDRA 2BMEA 1XD2B 2WEKA 1W4BA 5JRJA 4M7OA 1RLJA 3ITKA 3I2GA 4MGZR 4HMOA 4RK0A 4B4OA 5IT4A 1E2BA 2P67A 4P3NA 1KY2A 5E1BA 2B69A 3WDKA 5E0OA 2WYOA 3IUNA 1KY4A 3M6AA 1TAGA 2ZT8A 5EWMA 3RFVA 4L6IA 5JS1A 2OLJA 4MAMA 6PFKA 5HF9A 7REQB 2H2FA 2BI7A 3OKPA 4YJDA 1Y1PA 4LDZA 3C8HA 3AXTA 2I4OA 3G49A 4FGWA 4ZT5A 1IBKB 4LFBB 1SD2A 4AL4A 4AULA 5DYYA 1RYYA 1W59A 4C3OB 3GBVA 1NX9A 2JIQA 4MIEA 3R5TA 1BN6A 4KYTA 1GZ6A 4Q48A 1FQJA 1P2GA 2JHCA 4IIXA 2F3PA 3R7FA 1N2EA 1OZGA 2BP7A 1Z6TA 5AKZA 3V55A 3L4EA 1U3TA 1JEDA 1ZVJA 2VFAA 3UMRA 2EDAA 2WSMA 1DXOA 1IAVA 1BEEA 4Z3DA 1W36D 1L4YA 4CM1A 2WKPA 2BFCB 3BD7A 4OMCA 4DUGD 2V3CC 3E7XA 1KKUA 2RGRA 3EQ7A 5HE8A 4NZMA 2E85A 4QU0A 1TUGA 2R6JA 3H65A 2WZQA 1YJ8A 1C0LA 3C6ZA 4EG5A 4PQRA 2I55A 1O0SA 3TIVA 2PSEA 2YNMD 3EVTA 4EYGA 4TT3A 1Z62A 2QUHA 3LD9A 3BCSA 3HBLA 1XR3A 4TMZA 1G9XA 1NFRA 4EGAA 4F0JA 3GEEA 1LF5A 1YFLA 3MW8A 1YQDA 1PGQA 2H2WA 2H9YA 2ADOA 4YJHB 3ER8A 1TUIA 4BMCA 4I4CA 1WPRA 1PV2A 2QYOA 3BTSA 3QGMA 2NP7A 2Y6VA 1G3RA 4EA6A 3RTCA 5IJ0B 2ZYWX 3RTBA 5DM70 2IYRA 5J5AA 5EJAA 1XKXA 3PXCX 4P0TA 2QIOA 1C7RA 1AT1A 1EMDA 4R2KA 3ZLVA 2X14A 4YO7A 4O4JF 3VNAA 1E5LA 4TTTS 4X92A 4JP3A 3QVWA 5IASA 1F7VA 2J6CA 3AM1A 2QTTA 3PITA 2D2VA 4WDRA 4YBRA 2C96A 5KYNA 1A7JA 4JC8A 4CM4B 3GO4A 3QLTA 3O7MA 4UM9B 3N6VA 2UXBB 1H3NA 2ST1A 2F55A 3L07A 4JSRA 5JAQA 1U0RA 4EUSA 4PN3A 7GPBA 3IALA 4B6OA 4R0VA 1EHYA 4EMTA 1QCZA 4Q3AA 1MZPA 1ND6A 3ZGXA 4JLDA 1QIMA 1TUBB 2WDZA 4ZK6A 4JXZA 1HR0B 3C6QA 4P32A 2Q0XA 3I5XA 4FFBB 5K6AC 3B48A 1NPTO 2UKDA 2XB6A 3ICWA 3DYVA 4FE3A 4KCGA 4WERA 2B7BA 3LQFA 1THGA 1VL8A 3KQUA 5A03A 2ZRIA 3RIXA 3AJEA 1CHNA 1ADGA 3C4JA 3R4VA 4P38A 3UJPA 4BZXA 3VPAA 4DLVA 4ZJUA 1XNRB 3LUDA 1SC9A 1ZM4A 3UIEA 2IOQA 3OLYA 3R20A 1D2AA 3M9XA 1DBVO 1WF3A 5AKKA 3OEYA 4PLHA 5D01A 5DW3A 2DPXA 3CWQA 3GI1A 2Q46A 1XP5A 4YC7A 5J2TA 3Q2KA 3VC2A 4O4JB 5I9BA 3PKIA 3D3QA 4IWXA 1RR6A 2JFNA 3UMCA 3WYNA 1FYDA 2QUZA 2RH4A 5EMKA 1KHHA 1V5WA 3A9UA 3NYRA 3T38A 1YD7A 3EH1A 2XQGA 5ESWA 5BQFA 2Y1OA 5HK9A 4MB0A 4NJEA 3SG0A 4CLRA 3PNSA 5L3RA 1DDGA 4O5OA 1HLFA 2A9FA 4OUDA 5AKGA 4IIFA 2VCEA 4BRUA 2HMWA 4FIZA 4J3FA 1EUQA 1YQUA 3KC2A 1UAGA 3S2GA 3K71B 1YT5A 4L3WA 4XVUA 2RHHA 2OORC 2EW2A 1K86A 3IUJA 2XDQA 4MUJA 1B4DA 2JHGA 2X8BA 2UYYA 2WJHA 4ESOA 3CLSC 4R9RA 2QOEA 4GL4A 5FI0B 4C2AA 2CDNA 4MRPA 2FN3A 3PQFA 2F59A 3ESBA 4K9MA 1BQ3A 1M5TA 5KWVA 3CX6A 4Q21A 2Q28A 1OBHA 4DPLA 1TPZA 3DTVB 2X5OA 4I50B 4OP1A 2F67A 1P4GA 2BTOA 2HO5A 1L4LA 5MFPA 2Q1YA 3ENKA 3PYXA 4MKGA 4FBLA 3KOMA 3KQNA 4FU0A 4N8DA 3X1KA 1J25A 4EL0A 5C8XA 3KKKA 4B09A 2D00A 2V6JA 3GCWA 5GY7A 1KZ4A 3PXAA 1T25A 2OGSA 3AUJB 5LZ2A 1BD4A 1AKYA 4JI0B 5HIAA 3PPXA 1NE2A 1IK6A 2C4UA 2IYVA 3L7NA 4LC1A 2IS4A 2QI9F 3E35A 1IZ0A 2IOYA 3BAZA 1I0ZA 2A4KA 1NQUA 1TW3A 3JQCA 3QENA 5CT8A 6CHYA 1PUXA 2VYND 3GQBA 2K2QB 3COZA 1WBJB 4E32A 2A9PA 2IF2A 3G6WA 3KT0A 4U2FA 4QRDA 3RGGA 3VC3A 2OKCA 2QXTA 3OPNA 2P2CA 3OWXA 4BNYA 4D9BA 4BUJA 2G3YA 4DLTA 1ETUA 2YNMA 2ZIZA 1ZWKA 4YT2A 1E99A 4GXRA 4OI4A 4YHHB 3IOEA 5BORA 1GPDG 4WPGA 4I4IA 2W4IA 3KQQA 5A62A 1GN8A 1TM7E 2FQQA 2D8MA 1M73E 2AEEA 3NVDA 5THXA 4LDAA 3T7IA 3H1PA 2CT8A 3J7AC 4UCQA 1X1AA 1MH1A 5KVCA 1CS0B 3EX7C 5KTMA 5DBEX 1NQ5A 4DRYA 4BBAA 1U3GA 4X45A 1U3VA 1WMSA 1MPXA 3H5AA 1M2GA 2I8AA 3R0IA 2FSPA 4MQLA 2M6KA 4ER0A 1MEOA 2VHJA 2IOHA 4MGKR 2ODTX 1TZ2A 1FFBA 4J1QA 4UU7A 1MQAA 1NN0A 1V7CA 2WV7A 2ZI7A 1O95D 2JFUA 4FCCA 3SSMA 4C7OA 4NC9A 4AF8A 4RUKA 2BCGY 2ZWVA 3OHMA 2WUWE 4ZJPA 3AQIA 3P4YA 5BPFA 4RXTA 3T7SA 4LI0A 1NI3A 4J3JA 3RS2A 4MCAA 1J0BA 5IKOA 4LF6B 3LWZA 4JNKA 1YC5A 4W9MC 4CQLB 3AOEA 2TSYB 2FSIA 4WXMA 1MN6A 3QFSA 4GM0A 1W0KD 1T35A 2I2XB 3MYYA 1EB9A 2DFLA 2FW7A 2JZCA 2VSQA 3IQEA 2JA2A 1GCAA 4UXIA 4YECA 3PR3A 4L57A 1JR6A 2OHHA 1MOZA 4OHFA 5JMTA 2HHLA 4HQRA 1FFXA 3ITEA 3HJCA 5I9MA 3PQ3A 2AG6A 3ZJUA 1T1EA 2Q1WA 3IS3A 1VYHA 2YH2A 3EBLA 5E38A 2VR1A 1K6MA 5K3BA 3OZTA 2NU8A 5EERA 2AH5A 2PJDA 2XTMA 3QEMB 4GH5A 4ND5A 1DUIA 3RJ9A 5TY0A 3V1TC 3ZC3A 2ZWAA 2FXVA 1Q20A 1V8BA 1FFSA 3BHMA 3MHTA 4DDHA 1R0CA 3LUGA 3L8DA 5BUQA 3CLTD 3L93A 1HDGO 2DFNA 4MIOA 3RPEA 3H99A 3LWDA 3WKDA 2C77A 3OIUA 1ST2A 2IIVA 4BQRA 1NLUA 3TFOA 2HYIC 4C6SA 2QVBA 2IBMA 2DX7A 3NCHA 1NV8A 2YWFA 3ST7A 1FTNA 2ZKIA 2TMYA 4EB8A 4M0MA 1W19A 5AHWA 3RB8A 4OI0A 2CYBA 1LKZA 3GGGA 2Y1GA 3JQBA 5ALWA 1BXGA 3P1JA 5JXGA 1JXAA 6ABPA 2K5UA 3DQZA 4C7KA 1C9JA 4CT0A 3ECCA 4NBLA 4EFMA 3QTLA 3P4UA 3PJFA 4UVGA 4LZZA 1TA9A 4QPZA 4XJVA 4CWAA 4BKOA 1EK1A 2GJ4A 2QTWB 5D6OA 3BVPA 4Y2HA 3JSAA 4OJTA 1PLLA 4M1SA 4M8LA 3VR3D 1AA6A 4KPGA 2DWPA 1Y6ZA 2WTBA 5IAKA 3VZQA 3CT4A 4ZVPA 3GFRA 4X6XA 3S3TA 3WDSA 3EGXB 2GDZA 2J08A 3Q3HA 1XNGA 1BKSB 1UXJA 2NU6B 5TJHA 1U2GC 1Z68A 1WXQA 1ORTA 1U5BA 1R27A 1M76A 4EI2A 4I1VA 2WPDD 4LRWA 1SVMA 3SIPA 4UBLA 1T4BA 4LC9A 2W6PA 4N0EA 3GGCA 3HCAA 2QMUA 4ZC8A 3TE6A 3G79A 1QV9A 3KTAB 3A4LA 1L2TA 1IY8A 1R4MB 4UFNA 1D1QA 2CFRA 1IOWA 2VYNA 4K9KA 1D5CA 4I8IA 4TYMA 4D9JA 1OV6A 3G0DA 4IFTA 4ZZ1A 4LRYA 2O23A 4E70A 2H59A 3NH6A 3CR7A 1C0EA 2GK3A 4BX8A 1VL5A 3HBAA 4DMUB 2HHCA 1HYHA 2QUKA 4UHDA 4IOJA 3ZUPA 3ZLJA 3OTWA 4HX5A 1JXQA 2PUAA 4A7PA 3H84A 1R9GA 4OQPA 2E4VA 4OH1A 5F4ZA 5JROA 4ABTA 2APJA 2Z4SA 4B8WA 3Q0TA 4PX5A 1O1YA 4Y67A 1ODTC 5H81A 4V1CB 3IAS1 1G2OA 5AWFC 1XYVA 4IIBA 2RI1A 1HQYE 2GO7A 3AI3A 4XIIA 3VTAA 1UDWA 2QRVA 1SQGA 1ZMXA 1O95A 1JMYA 3BAFA 3WK7A 5TQ0A 4LXHA 1U63A 2QRKA 2GRJA 4P4TA 2ZBFA 5FCDA 2PX6A 4ND4A 3GT0A 3AF4A 4H2DA 5KSWB 2GN6A 2QDKA 3NM5A 5DNAA 5FTMA 4WK0B 4B3BA 2JLYA 4IGFA 2HWYA 3ON5A 1QZUA 1PJ3A 3L0DA 1W1IA 3IKLA 2QG9A 1NT2A 2WHPA 3PNPA 1ZCBA 1U0EA 3K4PA 4BQIA 4BFTA 5HQ3A 1L8XA 4NKRA 4KV9A 3G8CA 5EE0A 3N2LA 4DV1B 4Y9UA 4QWWA 4TWRA 1NI5A 1Q1QA 5TSDA 1EK5A 2PS0A 5LZ7A 2JIZD 1TGYA 1NNLA 5CLJA 4TRRA 1V8OA 2CJYA 4Q9HA 4Y2PA 4RVUA 1UC9A 3P0JA 1DO8A 4D1YA 1SXJC 2Q3JA 5EIOA 1ZI6A 4HEJA 1S8NA 1NWCA 5FBLB 3AKEA 3LBNA 1QVZA 3C8DA 4JP5A 4UM9D 1US8A 1VE9A 2QYTA 2OGZA 1N3IA 3BHJA 5E7MA 4C05A 4F1KA 5KOIA 2PZJA 5AVRA 3OJOA 1ZJYA 3ORFA 4IGAA 3KKPA 4PQYA 5EGSA 1JAZA 2WTXA 2Y92A 1Z8NA 2HIGA 3B5IA 2M1ZA 2ECKA 4F60A 4ARBA 5KINB 4E1AA 1ZUNB 4ZHSA 1GGJA 1U9YA 2V7UA 2ZUSA 1DPGA 2V4MA 3PXUA 2IHBA 4O8ZA 1AH2A 4WKPA 5FPKA 1T10A 5KU1A 2EJVA 4MKFA 1WB5A 5EIBD 2COUA 2HRQA 2QM8A 2QW0X 3D8HA 2BHRA 5GAJA 4CV0A 1WBBA 4NTZA 4W6ZA 2SNIE 3NHFA 2XXJA 3RYHA 3UJ8A 4RPJA 3IODA 4BEVA 4I9HA 3GLGA 1EBFA 1XDWA 4IJVA 1XWFA 2DUWA 2YV2A 4BE4A 3LCRA 3IV9A 1XCOA 1VSTA 3VR3A 4MQFA 4RAQA 2QYSA 4M0FA 1QIIA 5AI4A 3WI7A 1F8FA 3WKCA 3KU1A 2ABWA 2DEUA 2Y2UA 4Z4HA 5CJPA 1SVKA 2F43A 3SBDA 2XB4A 1B16A 2XA9A 4HMQA 3P9KA 4MRMB 3H11A 4CM8A 2WPDA 4FQ8A 1XD2A 1PGPA 1FSZA 2PUTA 4NEQA 3M6FA 2CE7A 4JVMA 5CNIA 4QEKA 3VFDA 1OI4A 2ZSIA 1JHXA 5JTUA 4HPWA 1Q12A 3A2LA 5FBQB 4O1HA 1EFLA 3L5KA 1USIA 1TT7A 1MX1A 1OXVA 1T36A 3LL4A 3OF2A 1SUWA 3W5UA 5EXSA 4ZI7B 4QELA 3VX3A 5LP1A 1J8MF 4LF5B 1PFVA 3QNMA 1XV5A 1E9RA 1DBWA 2QLBA 3N6XA 4YJGA 1LK5A 3IH5A 4FOTA 3ZY4A 2BKEA 5AD1A 4FX5A 2V7BA 2AK3A 1UXIA 1R66A 5TDHA 4CKZA 2ROQA 1TXGA 3ZXIA 3MOIA 1Z2PX 1EEHA 2UZ3A 4H1HA 3ABOB 1P9NA 4LSWA 1N3LA 1E64A 4IO1A 1D2RA 2WTAA 2QEQA 3PEUA 1GNLA 5BN5A 3H4MA 3ZDYB 4NNOA 1EHCA 4BJ3A 3HV0A 1Y34E 3QYFA 3IPRA 4RPIA 4BNLA 1FNMA 3D3JA 3HB7A 1Z36A 4N40A 4RVHA 5E6UB 3OZSA 1ITZA 1SIUA 5FXMA 3TW4A 3WB9A 4EJ0A 5JO0A 2LR0A 3G2PA 1JMVA 3IKTA 1XZLA 2AZDA 4NECA 1Y7PA 1E2DA 3FKSD 2G1PA 4FHZA 3D4OA 1IXZA 4W4TA 3HYNA 3RVMA 4OIFA 5E0KB 2R0QC 2BGTA 3TN7A 3U4IA 1E1DA 2R68A 1RU3A 2ZB2A 4U7PB 1SXHA 1RWMA 3BUSA 1AUXA 4TVKA 4YGXB 1H2ZA 3RAJA 4C7BA 1TMYA 1WKBA 2VDWB 1P33A 3OQOA 1V1JA 5C52B 4Q47A 5C7IO 2X58A 3H8SA 5E8JA 1LJUA 3GP5A 1VJ0A 1P7CA 4GMFA 3DL0A 2AC4A 1TCCA 4OQFA 5ICGA 1L4GA 4CYMA 1R0RE 1P1IA 5AUOB 4JASB 3EDOA 4ALMA 1F5NA 1RLTA 1PR3A 2JIZA 2O48X 4GF5A 4M1KA 5DGIA 1BHO1 3WADA 3DDHA 3LX8A 3T54A 4AWAA 4BVFA 5LMUB 2REQA 1Z5VA 3HFGA 3OMXA 1SUEA 1GXSA 4K9LA 5HPYB 1WSAA 6REQA 4M7WA 3IPLA 4HXEB 1JSZA 1QAMA 3IPYA 2XZDA 1JEJA 4P5PA 4XIJA 4EG8A 5JBIA 4QM7A 1JFTA 1IOZA 3DAGA 3EZ9A 1RCUA 4MQEB 2EP7A 4BWVA 4EDFA 1P1CA 1XMSA 2HOQA 3RKSA 3WGQA 2R8YA 3MXOA 3ZPXA 4MHSA 3F7NA 1N5MA 1T0UA 3O6VA 2A78A 1R5NA 1M2NA 2NSLA 3JR3A 1NVFA 3K96A 4L28A 5HILA 1DZ3A 3DXYA 3PZBA 3OA2A 3U4AA 4B44A 5DZSA 3H5IA 3WL4A 1HNXB 3U09A 3JQ7A 3NIDB 1EE1A 3KCNA 1ULBA 4FSXA 4KK4A 4RKFA 3ZHRA 1QLWA 1P80A 1RAFA 2UUCB 2PD4A 3A1VA 4GM1A 4ER6A 3MBIA 2CDAA 3C1UA 1D0VA 3BQMB 3MIIA 5KNDH 1SOWA 2PGNA 2HLPA 2FPXA 4X41A 2I6FA 2DUNA 3VOAA 1RQNA 3OWHA 1YUMA 3FMIA 3QU2A 3H75A 2VJMB 4BZWA 2ZROA 1KSHA 3I42A 5FI1B 5H9WA 3TZLA 4DA7A 1YZYA 3GJ6A 2FDRA 2QD2A 3HLYA 5TT0A 1CY7A 3FHLA 4LOJA 4KACA 2OGTA 1Z8FA 3RHTA 5CDTA 4AKHA 1T2EA 1YKFA 4X64B 2HH9A 4KLCA 1I36A 4ND7A 4AS1A 1NF3A 3GFVA 1B42A 3U9SA 2QAGC 1YB2A 2G82A 4UPDA 5REQB 1GUBA 2NAFA 1M8GA 1BX1A 1GZHB 1RE0A 5EPUA 1QRTA 2X6QA 3AVVA 4UVIA 1MB0A 3WGIA 5EE9A 3QPUA 4I1OA 3DC7A 2PZMA 2FUG6 3LVFO 2HK8A 2A2ZA 2OLKA 5CG2A 5LKAA 3D2BA 3DCJA 2CW5A 2H1FA 2WJ6A 1Z5OA 2XCOA 4MW1A 1E1RD 4R31A 5B2ZA 4OSOA 1GYQA 2JFZA 2RCYA 1H0KA 2H9AA 3ND5A 4CMGA 1AKEA 2GKGA 5B1DA 4X3PA 3AUYA 5ENVA 4N82A 4B3TB 1B43A 4ERXA 2NUPB 2W6MA 4I50A 4E5DA 1E2HA 5F21A 1P2DA 1T9AA 2I33A 4IQ4A 4GECA 4NBRA 4OU5A 1NNI1 4PCAA 1UJ2A 2NVUA 3T7RA 2G9VA 2DCUA 3GR6A 5FWYB 2OGWA 4G4GA 3EDQA 1PR6A 2IXFA 3EXG1 5AHRA 5IZ4A 2H4YA 4L6CA 4CLEA 2WYVA 2YXNA 4QEZA 2G9ZA 2ZYGA 2VBCA 3K16A 4WNCA 4YXWA 4JJ4A 5PGMA 5BRJA 1NQOA 1Y3HA 2AMYA 4QBKA 4FT2A 1SBYA 1I01A 2HU5A 3CF4A 3KJQA 3MJHA 2OFXA 3N2GB 4GI3A 4L9RA 4LZAA 4M3NA 4CIXA 2RC6A 3HXPA 5ICSA 2RI6A 1R1DA 4MI3A 2ZJZA 4NMMA 4QPDA 4XPIA 5DWVA 4RS3A 3M33A 2PD3A 1XBTA 4OGFA 3ZHVA 2CZCA 2W4QA 3H4IA 2DFDA 1E2MA 4AJPA 1G21E 4IIDA 4BO2A 5C8ZA 4KVGA 4XIYA 1C41A 1XG5A 2EHJA 2VJKA 2C9CA 3AJ9A 1X1EA 3ITNA 4J4BA 2WR8A 4K6FA 2R1TA 2HA3A 5BOVA 3AIMA 3ZS9A 4PFJA 4FNAA 2B8EA 4A26A 1QRRA 3R2JA 3A27A 3RUIA 1MB2A 2XB9A 4D9CA 2PA0A 5DEOA 4DC9A 1HDCA 5LZ5A 2X7XA 2Y1EA 2BTQA 3O26A 3TQTA 3FW1A 4TL6A 1CEEA 4ZCRA 1EFCA 4D45A 1TM3E 4BJ5A 1IXSB 3T95A 1M1NB 2O2YA 2EBUA 3QELA 4IIYA 4LFCB 3IBCA 3C6YA 2OESA 4HC4A 3B60A 5DEIA 1KPHA 4C4PA 2XAUA 1AJEA 4HAYA 4MRRA 2MCFA 4ZA2A 4CLXA 4DY6A 3U4MA 1VJDA 4MW2A 1ZHHA 1A9PA 1CY1A 1Y5LA 2ID4A 1NBWB 2QD4A 3B52X 5FUWA 4Y6QA 5KYKA 1V8ZA 2I6UA 3TL3A 4EHLA 2P3SA 1X1QA 3F7TA 3Q7SA 2VTBB 5ALYA 2HWKA 1SC4A 5BY2A 5KBYA 1ZJJA 3E05A 1W30A 2RFLA 1C3OB 1QF7A 3HUEA 3ONVA 3UK1A 4B4KA 3O3MB 1DIBA 5IW8A 2I54A 2Y77A 4JP8A 1NBEA 3SHOA 2CNKA 3A4MA 1NVGA 5P8WA 3NAMA 3JYQA 2WJVA 3D7RA