1RHUA

Crystal structure of the complex of caspase-3 with a 5,6,7 tricyclic peptidomimetic inhibitor
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
140
structure length
140
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 140
sequence length 140
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rhuA00
2DKOA 4NOJA 4QTYA 4PRZA 4QUJA 4HVAA 2C2MA 4AW9A 4N6GA 5IAGA 3D6MA 2XYHA 2XYPA 4QUEA 3R7BA 2HBYA 3NS7A 4D3ZA 5IC6A 1RWMA 1SHLA 4NBLA 4ZVUA 2XZDA 2H4YA 5LU8A 3DEIA 4DCJA 2CNLA 2NN3C 2FUNB 3P45A 1I4EB 1RWWA 4HQ0A 4ZVQA 4FXOA 5IABA 1PYOA 3H13A 4JQZA 4ZVTA 5IANA 1RWOA 4NOKA 2K7ZA 1QTNA 2QLFA 1SC3A 4NOMA 4PS1A 4QU5A 5IASA 3DEJA 4EHHA 1RWXA 3GJSA 3QNWA 4LSZA 2C2OA 4AWAA 2J30A 2AR9A 4I1RA 4EHKA 1CVRA 2H4WA 2H51A 4NOLA 4QUDA 1RHMA 3RJMA 1NMSA 2HBQA 2P2CA 5IAJA 1KMCA 1RE1A 2Y0BA 1RHKA 5IBCA 1CP3A 3E4CA 3H11A 4FGUA 3EDQA 4JJEA 4QUIA 4I1PA 4QUAA 2QLJA 1K88A 2C1EA 4JR2A 2QL9A 3V55A 2CNKA 3UO8B 1RHJA 1BMQA 5IC4A 4QU8A 3SIRA 1F1JA 4QU9A 1QX3A 3R7NA 3SIPA 4QUGA 3PD0A 4EJFA 4PRYA 1K86A 4JR0A 3K7EA 4QU0A 4ZVSA 4DCOA 3V6LA 2HBZA 1NMEA 2J31A 1SC1A 2XZTA 2C2KA 2WDPA 3R6GA 5H0IA 1IBCA 4JJ7A 3OD5A 2H48A 1RWNA 1I3OA 1M72A 4FDLA 4N7JA 3V4OA 2J33A 5LUAA 4JQYA 2CJYA 2FQQA 1I4OA 4QTXA 5IAEA 1RHRA 4N6NA 1I51A 4D3YA 3H11B 2H65A 3P4UA 1ICEA 1SC4A 3R6LA 3PD1A 4ZVRA 3KJNA 3IBFA 4JB8A 5K20A 3DEHA 1SHJA 1F9EA 2J32A 1PAUA 3GJTA 4QUHA 5IBRA 5IARA 4D3XA 4EHNA 4EHFA 1GQFA 1RWKA 5I9TA 3GJRA 3KJQA 5LU9A 3D6HA 3R5JA 2QL5A 1NMQA 4IEFB 2CDRA 3ITNA 2CJXA 1RHUA 4N5DA 4IYRA 2HBRA 3NR2A 4QULA 3EDRA 3V3KA 4DCPA 4QUBA 5I9BA 3BIJA 1GFWA 2CNNA 4N6OA 2QLBA 4JJ8A 4JR1A 2FP3A 2H5JA 4NBNA 4AWBA 3PCXA 5JFTA 1RWPA 1NW9B 2XYGA 4ZVOA 3NKFA 4EHAA 3R7SA 3D6FA 4PS0A 4EHDA 1QDUA 2Y1LA 3H1PA 3KJFA 3H0EA 4ZVPA 4FEAA 2H5IA 2CNOA 4NBKA 3S8EA 3DEKA 3R5KA 5LUBA 2H54A 3V6MA 3UOAB 1RHQA 3IBCA 4M9RA 3GJQA 4EHLA 2C2ZA 5IBPA 3S70A 1RWVA 1JXQA 4N7MA 5IAKA 2QL7A 3V4LA 4HQRA
chains in the Genus database with same CATH superfamily
5KX5F 4RSGA 4DZZA 5LLDA 5LMUB 4X64B 1Z83A 1U9IA 4L5AA 2GLXA 3H5NA 5H83A 2GYVA 4Y18A 2QN6A 4JJAA 4K6HA 4CNQA 1CBUA 4YV0A 4FLMA 3BD6A 2G7MC 1HA3A 3V8RA 1TO1E 3T52A 1O6FA 2I66A 4PAOA 1XDZA 1BYUA 1OLOA 1DV1A 4H31A 1IEVA 3CONA 3RANA 1GFSA 1Z15A 1XN4A 2Q2WA 2P75A 2ZAOA 4LJ9A 5FI3A 3WZLA 4Z53A 1Z5ZA 2FUNB 4LZZA 3CJTA 3IESA 5JTUA 5AI4A 1BJTA 5KC8A 3LLSA 4CFYA 2Q1WA 1V96A 1OH5A 3LBYA 1N9ZA 5C4GB 2WQ6A 3RUCA 1TQ6A 1W94A 4MW0A 4UDYX 3VVCA 4E94A 3D8UA 5DW3A 2GMWA 3EOAI 2JCGA 4OMDA 5GGXA 3MGBA 3WFZA 2GFHA 2NUTB 1PNVA 3RFCA 4G5SA 3SFTA 4M8IA 3LOQA 4RF3A 3I3OA 3JAKB 1K7EB 2P9QA 5KNCA 3TH5A 1R27A 4BO2A 3BH0A 1EK0A 3CUSA 1OZ0A 4A23A 2EG5A 3HU3A 1B3BA 3ZCUA 2BGJA 3G2PA 2VDPB 1YQGA 3UYLA 1F8GA 1RZRA 4QDOA 4AX4A 4I36A 4JKOA 4BNLA 5F5XA 1IE3A 1H1TA 4O4IA 4F4UA 1ZCBA 1GR1A 1TW3A 4JB0A 5KU7A 1FP4B 2PGNA 2QTHA 3PX7A 1TO6A 4YQFA 3PX3A 4YX9A 1E4YA 2B35A 2E87A 2XB6A 3CXUA 3S4YA 5BYBA 2YWFA 5ALZA 1MIHA 1UJ5A 2V98A 5DK4A 4BASA 4DVJA 2NTEA 4C7XA 1JFFB 2IUYA 4WECA 3WLJA 4YP9A 1Y8CA 1A7KA 3AGQA 3LTEA 3QEMB 5ALYA 1EB9A 3PE3A 1ZCAA 4L5CA 4NYIQ 4CLHA 1JZTA 5KUTA 1VLQA 4Z4QA 1VCOA 1ZRSA 5FNVF 2OGZA 1WPRA 3GFPA 5LU9A 1SOVA 3UFXB 2ORIA 2GTIA 4LAFA 2PZMA 5IYZA 1EA7A 3F5QA 4R2MA 2QGZA 1OBCA 1VFPA 1YMQA 2Q1SA 1SJ9A 3HMKA 1R18A 2YIJA 1W0CA 1Z5OA 2VN8A 1YNOA 1M73E 4HAIA 3PR2B 7REQA 1YB5A 3C87A 3CUUA 4G0QA 4J2HA 4KXMA 3RSSA 5B3LA 3WX0A 1VECA 2C9BA 1VG1A 2G9UA 5HPYB 3ZHYA 1P2DA 2OBNA 2W6PA 2K7FA 4RVDA 3WMFA 4RVFA 3FWPA 1BOOA 3W8RA 2W42A 1RMTA 1FU8A 1OHHA 1RLOA 1CSEE 1SBHA 2CLFB 3HJTA 5H59A 3HLYA 4N1AA 2EC5A 3WQHA 2M1XA 1PFUA 5KYUB 1OZFA 1B42A 3FCXA 5CD1A 4X90A 3UN1A 3ZLUA 1LPNA 4QFBA 4JFAA 4Y7CA 4BMZA 4ZCTA 3N6VA 3UCXA 3WIEA 2E82A 5BOSA 4HQOA 2V7GA 2X8BA 3G8CA 1RPNA 1ZD2P 4GS5A 5L6MB 2Q46A 4RK4A 3EEQA 3PHBE 2XRMA 1XLUA 2ZR0A 4D9IA 2IX3A 4NYMQ 3C8DA 4OYHA 4C29A 3I1IA 4RVHA 1IN8A 2OCYC 4TMKA 1NJ2A 3D6MA 4HB2A 1T3ZA 1JNXX 1T5DX 5THXA 3MCUA 2NZUG 2HYIC 1T9CA 2HQOA 4P3OA 4W6ZA 3GHYA 2BCGY 3PPYA 1FVHA 5L3SA 4C0SA 4MB6A 3WLQA 1CB7A 3GLGA 1CP2A 4R68A 1CY4A 3MMZA 2FSUA 1M5UA 1R4MA 1RLTA 3FTPA 4EY6A 3QUSA 5I8WA 4HRYA 1P1HA 1GDHA 2FYTA 4UQPA 2OZLB 4Q9LA 5D00A 2ZU6A 1BVUA 2ZUDA 3F7NA 1PD1A 3HWWA 4HRVA 2IZ7A 1CY6A 1E60A 1ZK1A 2A9KA 3K4QA 3MFYA 4K0RA 1GPBA 2XYRA 5BV7A 5IG2A 1CZRA 2A86A 1PUIA 3OHSX 3VC1A 3OQJA 4I8DA 3T9BA 1DXOA 4O4JB 1QGUB 5H68A 4CKWB 4R0MA 4Z9AA 2ID7A 3PI7A 1EHIA 3C7CB 3DFIA 3FNBA 2O1XA 4M7RA 2P9BA 1PZGA 1BW9A 2VUTA 3LZCA 3RG2A 2HN9A 1P4JA 3EAGA 2W6QA 3WO1A 4CMGA 1J49A 2FW6A 3IR7A 2QPLA 1LFAA 3C5WP 5CXXA 3ZDQA 2QAIA 1SQ6A 3WL7A 5AW4A 1LK5A 4GLBA 3BKWA 3DBIA 2G07A 1V7CA 3WNBA 1EWTA 2J07A 1AQYA 4BVAA 10MHA 1X80B 1M3SA 4L95C 2PV7A 4B3MB 1PL6A 1I4TD 1XD8A 3H05A 3OAAA 2VKQA 2ZIXB 3OM0A 4I46A 2R8PA 4D8VA 4QECA 4Q9KA 5KNLA 3KLMX 5LA6B 5GZ3A 2Y0PA 3KHTA 4Z86A 4R7GA 1MO4A 1IEWA 1NATA 3A6LA 3H9JA 1PNRA 2UUBB 1PN3A 1LBIA 5A62A 3R9XA 2H2HA 4MIEA 3A14A 4DIEA 2PFKA 2PQ6A 3DZBA 2FEOA 3LX8A 4RCVA 3U60B 1P5FA 4UFNA 1V9CA 2R5NA 2EZ9A 3PNQA 2W6OA 3HY3A 1T0HB 1JIJA 3A4NA 5DTJA 3W6NA 3QPCA 4L8LA 1CE8B 1XDSA 3S28A 1PQYA 4TKUA 4X8LA 5L3VA 3LCRA 1UFOA 4Q9HA 3RF7A 3H3JA 3CX3A 3AUAA 4HG2A 1DKQA 5TF0A 4C4TA 3ZGLA 4D96A 3TK1A 1SA0A 3IQDB 1N2IA 1GWNA 3F3KA 3BORA 4LNHA 4IRXA 4PZDA 1V4NA 2DPMA 4BWFB 5EP2A 4YCNA 5GAJA 2IDJA 5FUVA 4UTPA 2JAHA 3I9OA 4HADA 5JY6A 3D3JA 2UZ0A 4WXPA 4LGMA 3RBXA 1UP6A 2FEXA 4HAUA 4HVCA 3GRAA 3W9YA 4ZPJA 5D1HA 4EFKA 3KZ1E 1P75A 1S2DA 1G4UR 4I3HA 2ZUEA 3FXAA 3KQLA 1CXZA 1JJBA 4TLLB 4RLHA 3LC1O 4P8RA 3CH4B 1GPKA 4QDKA 4UOEA 2IZ0A 5LUBA 1EH5A 5BSMA 1KSFX 3IEIA 4JLWA 2V0NA 4LWOA 4DLPA 2CN1A 5WRFA 3HWX1 1RHQA 5E9JA 1Z8HA 4M9SA 2E85A 1WHSA 2YYSA 3T06B 2WMOB 3MJHA 4OLAA 3V4SA 3TZHA 2R6CA 1F2VA 2A5LA 5K8TA 4PLHA 1T0JB 1VSTA 2BF7A 4CZ2A 2O2IA 1OV6A 2UXBB 621PA 1KEZA 1PWXA 2W2PA 4M53A 4QAQA 5G3ZA 3KXDA 3WB9A 4PO8A 4TN5A 2GAAA 1GNPA 1N6PA 3JYQA 3ONVA 3QKSA 4IJWA 3SHOA 5A0TA 2JF0A 2C4MA 2V4UA 2IT1A 1QOZA 2M9MA 3RUAA 2R7AA 1XPJA 3BWVA 3EUEA 4F96A 2C4WA 2HRRA 1MB2A 3IT3A 3ZZNA 5JCZA 1OI7A 4NMXB 1KEUA 1W8DA 2G36A 2Z5LA 3M6IA 2HUPA 4XKJA 5DYGA 3E9QA 1F12A 2NQTA 3CLUC 5IABA 3EWIA 4P33A 3TZQA 1SO8A 4CMKA 4DAOA 5C80A 3D8TA 1RRPA 5AK4A 5LYJF 2ID8A 3LS2A 3T0FA 1YZLA 4PV7A 1DWPA 2AOTA 2XT6A 3Q85A 2D54A 3JATA 3IJ5A 4DB4A 4PG6A 1V5EA 4IEIA 4Y3UA 5C1BA 4O1HA 2P8JA 2H1CA 2XDQB 4KXFB 3WVNA 5AIBA 3PXCX 1T8SA 4FB4A 4ENPA 5K6AC 3PFHA 1F8YA 4F2WA 4FGUA 1P6UA 4EFLA 1M9NA 1S2GA 1IRIA 2IY9A 3Q98A 4RTPA 3NTRA 2VWGA 2RAPA 1F51E 2W58A 3N7TA 3VZDA 4BO6A 2IODA 1QQTA 3M4ZA 1RJFA 2GN2A 1NMXA 5DYNA 1AKYA 1JHAA 3PQFA 2LR0A 1Q91A 2XMRA 2OWEA 3G0DA 3IHWA 1ZVQA 3LBFA 1T2UA 3DYBA 4E3WA 3VR0A 5JXIA 1N78A 2CNWD 2ZB8A 5EG5A 1EK2A 3A25A 3KFXA 3MJSA 4QRDA 2GRJA 1KDYA 1Y4ZA 4M8SA 2IYSA 3KT8A 4AUKA 4EX7A 2VHJA 2DR3A 4Y9RA 4MX8A 1C3OB 1E32A 4UUMA 6GPBA 4P7KA 1XFAA 3O03A 5KOYA 1E61A 3UAZA 2F4VB 1G5RA 5IFLA 4Z9YA 3T61A 3NM6B 1TZJA 4HAXA 5K20A 4F4HA 4LFAB 1DO2A 3ZN2A 2I7CA 5DCUA 2X8WA 5CA1A 1LJ8A 3GPDG 1I30A 1CLUA 4KJXA 1ML3A 5EFOA 3EG9B 3L4BA 2B0CA 4BXOA 4B32A 1UK7A 4YRAA 1JAXA 1HQDA 3ADBA 3IQWA 3GROA 2EHJA 4MV5A 3GP3A 5HCNA 4RFVA 5AUOB 3KDPA 3ADCA 3E9RA 4V0QA 3MUFA 2CMDA 4HNGA 5EZYA 4COKA 1I94B 2HDNB 4H1TA 1ISMA 4AF7A 1PFWA 5ESWA 3VZSA 4B7UA 1X74A 4DJ5X 1PYGA 3EGVA 2DERA 1UPFA 2GHRA 3PUYA 1VMIA 3GMIA 4BVKA 3TG2A 3OX4A 4L5BA 3KT3A 4URWR 3RS0A 3MTGA 4CM9A 2CNOA 4H18A 1MC8A 1OD6A 1ZXBA 4TSFD 2VTBB 3KEQA 4XUEA 3CRNA 3OF5A 4A4DA 3BTVA 2PMKA 2IEZA 1FSZA 3C4VA 1AUPA 3DPSA 4DLZA 2ZPTX 1DBVO 3G9XA 2G5PA 2IPMA 3ILXA 1CQIA 4KQEA 3BOSA 3W8DA 4EJSC 4GVXA 1Q2UA 2XX3A 4R6XA 2QG6A 3NZEA 4MMXB 1JRLA 3NEPX 3FM9A 1Y33E 4PC7A 3VHXB 2WWWA 2CJPA 5F73A 3M5DA 5EESA 2BFOA 3SXPA 4H1HA 2WMYA 3VYWA 2BLLA 2V58A 1PTKA 1EYZA 2HBYA 4KXLA 1GIAA 4UJ5A 1DKOA 1G55A 1UQRA 2BFCA 2XT0A 5KNDH 3OZSA 5AKHA 1G3MA 3E05A 1CRPA 3HSKA 3AI3A 1EJ0A 3CQ9A 4DAEA 4O2AB 3SZOA 4AJEA 3O8LA 4YAGA 3PGMA 2I4RA 4KXUA 3O8QA 5IUNC 4N5HX 4FKMA 3BXGA 3LYUA 1Q95A 1NLZA 2GARA 5K4HA 1TB4A 1PKEA 2ZJ5A 4KWTA 2G1UA 1XAHA 1HT0A 3K92A 3LZDA 4UARA 6LDHA 2CKDA 5LJIA 4K9MA 1A5AB 1E9SA 1W88B 3CLTC 4E1BA 1T25A 1LLQA 2ACKA 1IOLA 1KPIA 1ZKMA 2PFSA 5AHOA 4CTKA 2ADFA 2MJLA 1UPUA 2ZFUA 3H4VA 2H5LA 4RSRA 4BLPA 5CB8A 1T2EA 2W2TA 2XUZA 2UZAA 3NAZA 5LZ9A 1EWQA 3IMGA 5CT8A 5KYGA 1J7JA 4QEKA 2H92A 4Q9NA 4J0QA 1T8WA 3EPHA 3I53A 2OT3B 4AJ1A 4MIYA 4RHXA 1KPHA 3OU7A 3QVMA 4XUGB 1QHEA 1TGYA 2CYCA 2WE7A 1HORA 3FGNA 4KJZA 5DM2A 3ANYB 3HNRA 4Q01A 5F7XA 5TVGA 2GZHA 3AYXB 3UQYS 3F1LA 5L95A 3RTGA 2AJTA 3JD3A 2AR7A 1HM5A 3N07A 4Z4HA 4EFMA 5L3QB 3CF0A 1GTL1 3JRXA 1FTYA 1AKUA 3RVKA 1X8XA 1MJGA 2GZ3A 4KLCA 3RS5A 1EK1A 4ZAFA 2ZUSA 1U2EA 3AJ8A 3DLAA 1Q7RA 3NHPA 3PDJA 2FDXA 4JYMA 1PUJA 4LRSB 3I73A 4CUJA 3P4UA 5TQJA 1E1CA 2AUMA 2BJVA 4M1EA 4PGAA 4YB8A 4C07A 4E11A 5IMBA 5AVXA 1CQZA 2ZYAA 5JD3A 4F45A 1EA5A 3OY2A 1OAOC 2EDCA 3DEHA 4UPDA 5HYVA 3QHPA 2I3GA 4QSMA 1VJGA 3R74A 1QP0A 2BISA 5AW9A 3EXHB 4II3A 2PV0A 3DONA 4AMBA 3ZLVA 3CEHA 2G09A 1Z2OX 2HSDA 1RD4A 1JJAA 4JC4A 1PEYA 4U8GA 3TINA 1T5TA 2Q1YA 4EB8A 1IBMB 2GZDA 3X1XA 2AFHA 5L7TA 3KB6A 4PQRA 3GUVA 4JQCA 1ZSVA 3H4TA 1QFJA 3GJ0A 5HGJA 3X1WA 4CEJA 4DC0A 2XGJA 2O8CB 3VR6A 4TRRA 1NW5A 4NZMA 3H7IA 4UVDA 1KMNA 3K09C 1JAZA 4V03A 2VK1A 2YJ3A 1TE2A 5TMDA 1Z45A 4TMVA 2NU7B 1UR5A 4GBMA 3LZ6A 3IVXA 4TX1A 2P2DA 4JQSA 5C1IA 3T3NA 4HPXB 4HH3C 4LXQA 1UXHA 3U4QA 2G5GX 5HDQA 5I9SA 3F67A 1NVWQ 4WUVA 4DJAA 4TYYA 3T7AA 1M54A 2LRHA 1R0KA 2BMJA 2R1TA 1SBQA 4D9JA 5K1ZA 4EF6A 1RPJA 1BX0A 2NTJA 4KTTE 1TCUA 2ZW9A 3KYDA 4NHEA 1ZW6A 2DM6A 4LMBA 3HCEA 1CZHA 521PA 1VCHA 1X7HA 2BZ1A 3A6KA 3IHTA 4BCDA 1TMOA 1WUYA 1U1FA 2P1DA 3B82A 1M8JA 4I55B 2FN4A 3K0AA 3DVAB 3CMMA 4WPGA 3FI9A 4MS1B 2UZ4A 1PJ8A 2FVXA 3PXUA 1ORHA 2OCIA 3LKZA 2E1PA 2I55A 3NUZA 4PSVA 3ROXA 3AL2A 4W99A 4K9NA 4P3XA 3LRXA 3C1TA 3BRQA 4MQFA 2BRUC 4W4TA 3RNLA 3KL4A 2PL5A 1BXKA 4TYPA 5E1OA 4DJTA 3MSXA 2PZEA 5ALJA 3VUFA 4WLNA 5FIUA 3JALA 2JCSA 1FU7A 1Q1AA 3DWIA 4KFRA 1EZZA 2EF0A 5AK5A 1XWWA 5MFPA 1CTQA 4PGFA 4B3IA 3VR1A 2O1SA 3L1VA 2JFXA 2AUNA 2GCNA 4LV8B 4NNPA 5LJLA 4N41A 3MJTA 1ENZA 4MV7A 4DRYA 1SCKA 4KN9S 3FPSA 4BNVA 1H1LA 2EBFX 2ZSBA 3QELA 4N3NA 4G84A 4Q1DA 1JG4A 1KSJA 3KAKA 4J03A 1BFUA 4UD2A 4DJEC 2Z8ZA 1QYWA 3LCMA 5JAPA 2IEGA 1PR2A 1IBLB 2GB4A 1A27A 1SG9A 5EWLA 2P2CA 5E6UA 5AW1A 4JAVC 4Z54A 5CJ2A 1H42A 2RHRA 3OF2A 1FL9A 4PO3X 4TLBA 3WA6A 1QDEA 5A03A 4D8YA 2Q9CA 5JVDF 4FYXA 4LZPA 2VPTA 2G4CA 3CW2A 4NFYA 1ZD3A 4TMZA 5CLHA 1JR6A 5JFGA 4QD3A 4GQBA 1N2OA 4WEOA 4DYHA 2O05A 4LZOA 3D31A 2F43B 4JA0A 4NXNB 5EIWA 2KLBA 4FFRA 5JNRA 2PSDA 1XTUA 3HABA 3LBNA 2KS6A 4OGGA 4CLOB 1M2HA 4R1UA 3L93A 5BPHA 5I5EA 3RREA 1VBFA 3VPCA 2YWJA 2PQMA 3DHYA 1NVAA 5DHFA 2IVZA 4ZCRA 4LE1A 5IJZA 3OBIA 1UADA 3SHWA 2ODWA 2VYFA 3B2NA 2VJPA 1AGXA 3ET5A 4GMHA 5LCXA 3TMAA 4DRXB 2PH3A 1WNTA 3I39X 4RXTA 1ZA1A 2ODEA 2G0AA 2O7QA 2QRKA 3PJDA 3QUBA 4IVNA 4Q16A 1L4FA 3OM1A 5FV4A 1UWKA 1DQSA 3IOBA 4ND2A 3CM0A 4DLAA 2QMZA 1B8OA 4UM5A 1XDDA 5A04A 4GI3A 2RAFA 1AS2A 4YV1A 4MIOA 1ACMA 2GA8A 1LGYA 1L9XA 1ZM3A 4EK9A 3PIIA 4HGYA 2NVOA 3HZRA 2ZIUB 4HEHA 2FFHA 2GCIA 2PS0A 4MW9A 2FE1A 1MAUA 2RHMA 2CSUA 4TV8B 3RABA 5FAKA 4KAXA 3R5SA 2AJCA 2X3YA 4JL5A 3C7DB 4XI9A 1MNAA 2PKQO 4F9EA 5B53A 3A6DA 1TCBA 1P7ZA 3GGSA 5H3HA 1R0XA 3WK4A 2IS1A 3PB3A 1E96A 1Z12A 4OJKA 4II7A 4K9RA 5IF3A 3G0CA 3Q3VA 1SK9A 1U0NA 1DUVG 2QTVA 4RS4A 4O2RA 4RA9B 4XCVA 4KQXA 4OAQA 4ZQCB 4ECAA 1PGNA 4G4IA 1GV1A 3OLXA 4H7DA 1LTQA 1OI4A 2BMFA 3GJ3A 2JD0A 2GXAA 1PGQA 1XI2A 2IYQA 3U7FB 1JSZA 1JN0A 1OIXA 1CETA 1KMHA 1ODSA 2AN3A 3M6WA 2V7PA 3R3WA 4FEEA 4M8NE 4KO2S 4URXR 2QNBA 4IPTA 5K3BA 3ZK9A 4QBGB 3NNNA 1VXOA 2JGDB 2OV6A 2UKDA 3FYDA 1IU9A 3AZQA 3D0RA 3GJ7A 3IP9A 2JVKA 3ZDXB 1HDYA 3EVCA 4Z49A 1K5GA 3KD3A 5LMZA 4FFMA 1VYTA 1XBTA 3FMPB 3FVVA 2VA8A 4ARBA 5A4JA 1PFKA 5HWSA 1W49A 2Z3VA 4ZEVA 4OFBA 1EFRD 2GF2A 1VRCA 3PTLA 2EBHX 2QTMA 4BQEA 5ILOA 2JGEA 1X19A 3WGHA 1YZKA 1IC6A 2HZBA 1E3SA 1K9VF 4NFLA 4PNPA 3MGAA 4KGDA 4PZEA 3EDCA 2GK4A 3DJFA 4N8SA 3O4VA 2HA6A 4AQDA 2QYSA 4ZAYA 4RE5A 3EODA 3LCUA 1S89A 5EYPA 1EQAA 4RH1A 4KK3A 2D1QA 1O9BA 1RT9A 1QS0A 3CS3A 4JITA 4PBSA 2XXAA 1F1BA 4BV2A 3H84A 2DETA 2LKCA 4K9DA 1ISFA 5H02A 5EAIA 5HBGA 3EGCA 1LDYA 2ECFA 2AKAB 1EFPB 4F6LA 1KVTA 1II0A 1QH1B 4LXTA 1BIFA 3HJHA 1XDGA 4RULA 2B1IA 4A26A 1PT5A 4URVR 1JMYA 5DX8A 5DNUA 1OWNA 1KJ9A 4GXQA 2FH5B 2OA0A 2QYHA 1Z0UA 3KJGA 3V4PB 1B6TA 4ER6A 4EVQA 1QCCA 3DV0B 3KWFA 2KE5A 2DFPA 3HJBA 3GHHA 1NV9A 3IUEA 1EDOA 1M1XB 4H1UA 4I9HA 1N2BA 1NBEA 3WIBA 1KGSA 3PP8A 3WB1A 3L1KA 5IAOA 2D06A 4BEVA 5CAEA 1OC4A 2W4IA 4EVIA 5KWIA 5DM0A 1WU7A 1YQEA 3MPOA 5LXTA 1H2FA 1O8CA 1QK5A 3EMDA 1EXNA 5JASA 3P2OA 1U3TA 2PX5A 3L0CA 3OZ7A 4QHSA 1I1HA 1Z8NA 3DWEX 1UPCA 1UBNA 3LDHA 4ZI5A 1N6IA 4V0KA 1QR2A 3WKAA 2JAWA 2P9TA 2RKWA 3C3EA 2AXQA 1QFZA 4UUPA 4LF5B 4UATA 1E64A 4PHHA 3WIVA 1UWCA 1XYVA 5AHKA 3RM3A 2VJMA 1RQ2A 1P7PA 4NYJQ 4B1FA 3PNVA 4JV5B 3NETA 3RU2A 4C0LA 2W6MA 1RU3A 4F12A 2QW8A 4QJ3A 1SVMA 1RWKA 3Q8XB 4LYAA 1ORVA 4RK1A 3RU3A 4EL5A 1XKQA 3NPMA 3U5ZB 2ZR9A 3AFGA 1E2LA 1LDEA 2B25A 4MGIR 1F3OA 1OKKA 3PGA1 1T6BY 1VE6A 1I36A 2YYYA 3VYRB 3G2QA 4G0WA 1W5EA 2IWHA 3RIXA 4AROA 4RDXA 3O91A 1O5IA 4CIBA 4ZU1X 4P6VF 1C9JA 4CM5A 2H5JA 2NO7A 4DA4A 1IJBA 3Q15C 4JXJA 2V6BA 1RWPA 1H69A 1QM5A 3NKFA 2J9GA 1NXWA 3PNYA 3QBTA 5ALSA 3GZ4A 3LDUA 4G65A 5C8YF 5KNDA 1RI2A 4OO3A 1ZM2A 4MCIA 2ZVQX 2R6JA 3L0ZA 1KRWA 5EIFA 1XAJA 5AW3A 1FNCA 1PWZA 3B52X 4B83A 5AK3A 4CL2A 4IINA 3ZU3A 4P31A 4B76A 3ELDA 2ERCA 4HLUA 5LXTB 2W8BB 3D7RA 3RT9A 3TYXA 1BS1A 2YYZA 5F4ZA 2PMEA 3TW6A 1BEUB 3V1MA 1ZEMA 2XSZD 1ULBA 1W0JA 3MJ4A 4URFA 4DBLC 3M4JA 3O93A 2NQ2C 3RE1A 1H2HA 5CX1A 1DINA 3JZFA 2ZSJA 1U28A 2P5UA 3QX8A 1DUSA 5B7PA 3MM4A 4RK0A 3ZU4A 5F76A 1A1SA 2C2YA 2LCIA 5JXJA 3FSGA 1FUEA 4KWEA 2WMNB 4UD6A 1H93A 4EW6A 3KUUA 3IMKA 1V48A 4G5OA 4G5HA 4DNFA 4UBKA 4S35A 2C5AA 4REQA 1K9SA 3JTEA 5K05A 1PK9A 1E59A 5LU8A 5IVKA 3EG5A 4MKHA 1W0KD 1BDJA 1LBSA 1V3TA 4OJYA 1Y4UA 5ALLA 3R3XA 2ESRA 3ZX4A 2R2GA 3VYUB 3LK6A 1YBMA 1AZSC 2O0MA 4M36A 1P6QA 2MHCA 4JGBA 5FBWB 4ZT4A 1WB5A 2R47A 2Z43A 3IDFA 5KJCA 4TWBA 2XWSA 3W2EA 4OB8A 5K8LA 1NASA 4E2ZA 2DBVO 3AQIA 3VU3A 2WWIA 4JEUA 1FVXA 4ZI7B 5E0KB 5CDFA 4M0PA 3NG1A 1VYUA 2BHSA 7AT1A 4LYEA 1RXCA 1RBQA 2XGMA 3O1HB 5EIBD 2XHEA 2Q3LA 1E98A 1PO7A 1SQ0A 4NG4A 4D44A 3W7AA 4EDFA 5I7HA 5C7IO 5JIBA 2ZDGA 4IL5A 4R1QA 2BGWA 4NARA 3RVLA 3TOCA 3DUFA 1XDUA 3JWPA 3T5MA 4Z0PA 5L3ZA 2PL1A 4X20B 3H97A 1P5RA 4CR8A 2E4WA 4G1VA 3UMYA 2ZGVA 2DH6A 2COKA 2VSOA 3E03A 4BN4A 2J33A 2NTNA 2BH9A 4GGPA 4A6PA 1P61B 1R5BA 4HDRA 3BA6A 4QTXA 2CUKA 4PYNA 4RPJA 4N3BA 3U3KA 4BJHB 4BZPA 5CFRA 3JWGA 1X7ZA 3DO5A 4BRSA 2Q7XA 3D5QA 2PXHA 3UC9A 4C6HA 2ZTUA 3NBYC 1PR9A 3EYWA 3CLSD 4JB8A 3ZWXA 4Z4FA 5FBQB 1O1YA 1P9WA 3KZKA 1DAKA 4MQBA 3Q3JB 3NOQA 4KLAA 1UJ6A 3TUZC 2EFJA 2GK7A 1X2EA 4M0DA 4W1SA 5AESA 2EKLA 5KTRA 3C3JA 1H2WA 4G56A 2YJTD 2VK2A 3L5OA 2Z95A 5EWJA 1KZHA 1UXJA 3ZHBA 4PHTA 5A5EA 4Y2XA 5FFNA 4O8CA 5JCJA 2WM3A 2CW5A 4U02A 2Q4DA 4Y2YA 3ZVMA 1I6KA 4S3MA 1AD2A 1XZQA 3F9RA 4KO8A 1HDCA 3WJ1A 4E7PA 4F9GA 5DTEA 5CBKA 221PA 3H42B 4RF4A 1U2ZA 2GVZC 3CXRA 4OIFA 4GF5A 2PGOA 4TLDA 5KTMA 1E7QA 1NFFA 4GX2A 1HDXA 5K0JA 1ZLXA 4FJ1A 4OSEA 3STHA 3T7TA 2IEIA 4DMKA 1MOPA 1XNGA 1YBFA 1Q1BA 1AO3A 1QCYA 1ENPA 1RXIA 1ZUHA 3A4IA 4WERA 4C7KA 4YT4A 2ZBDA 4ALMA 3H2IA 5KOHB 2RE8A 1FXSA 1FFEA 2FETA 1V25A 1PNTA 3O2JA 4PIPA 2NYAA 4H7PA 2B20A 2C7VA 2DULA 4I9FA 5A6SB 3JQPA 3SIWA 3CR8A 1JKJA 4PINA 4QQKA 2UXDB 4HEQA 4Q39A 2PS3A 1GLNA 2YQZA 1XRLA 3TLZA 4N7MA 4CV0A 3TN7A 4EB3A 1OJ7A 3FFAA 2XCRB 2QTFA 2C99A 2ZAIA 2XITA 1J56A 1JXMA 4HQRA 4M1TA 2Q4RA 4QQFA 5AVOA 1JEYB 1J8DA 4AX8A 4QUJA 4MAFA 4D5EA 4IUDS 2W70A 1XZFA 3TMYA 3R09A 4NV1A 5IDYA 4AS2A 3E3LA 3PWZA 2REQB 2MR5A 3UK6A 5IDXA 4Z3OA 4RWEA 3W2TA 4FNMA 1L4GA 1PFQA 2WAYA 5HKKD 5KHOC 1K6XA 4NJMB 5IHPA 1BX3A 1MN6A 3D3WA 4O63O 2DTEA 1GY8A 3HB0A 1H05A 2C9ZA 3W4IA 2YOHA 1LH0A 2R65A 3GA5A 1GHTA 3THSA 3AVVA 2FPRA 1PZNA 1XVUA 2OBXA 3ERCA 1O03A 2VQDA 3NVAA 3ONDA 4W8OA 5GJBA 4RX1A 1ZC3A 1A98A 4WAUA 2FXIA 5IJ9A 1I7DA 4AKIA 4BMSA 1AMNA 1L6RA 3SC6A 4F4CA 1LJLA 4YRBA 5B3JC 2VPQA 4XRRA 5EP3A 4DDVA 1VL1A 1K27A 5F9MA 4OY3A 2VRNA 2YINC 4KLRA 1KWGA 1HFWA 1O96A 1SU8A 4TV9A 3I01M 1U1IA 2MSEB 2MYUA 3E2IA 1IXRC 2BTQA 1P4AA 3BB4A 1GPH1 2JAQA 3ELYA 2V9PA 3UV3A 1Z2AA 1P73A 2ZWMA 2ZWPA 3BSSA 3OX3A 4IW3B 4J1NA 4PZCA 1YAHA 4U63A 3RSGA 4YH1A 4CCWA 5HZHA 4BUZA 3R5HA 2XTZA 3B6EA 3ZWKA 5B2EA 1G38A 2FUG6 4PWZA 1U2DA 5EJ6A 1GPAA 3TRIA 2RI0A 3WDLA 4F7WA 2VP9A 1SCNE 4N5NA 3RK1A 4ESHA 2YYAA 3F4BA 2O8FB 3IIIA 3U13A 4E13A 5D84A 2PA3A 4KDRA 3UKOA 2XB9A 3D2CA 3VR3D 4MR9A 2X14A 1SVLA 1T34A 1V37A 3AW8A 4B45A 3DL4A 3GLSA 5DCYA 3FRHA 3NW9A 1PVOA 3P0HA 1TU0A 4OU5A 4EG8A 1JE0A 2A6PA 2Y1KA 5AVRA 2WD9A 2XRFA 2WIKA 3DT9A 1M1YB 1GV0A 3F5SA 3FDIA 2EHDA 2AG6A 2CE2X 3BWDD 3LWZA 4MQLA 1P33A 4MROA 4Y1FA 4BAUA 4D81A 4F04A 1GTZA 4CXMA 4NPAA 2GBCA 1GPJA 5GOTA 1BRTA 2CNBA 3GGOA 5JS1A 1KGDA 1KMIY 5COAA 1XDWA 4OGLA 3GQBA 4E5VA 2I80A 1NFRA 1OTXA 1JA9A 3IURA 3CH7A 4LKOA 2IV2X 3HKDA 3TKLA 4BB6A 5A4MS 3VSDA 3LQ4A 3B6MA 3QPWA 2ZIVB 3T9EA 5ESRA 3FSRA 4KV9A 1TU4A 1OWMA 1H2BA 4W5JA 3C8MA 2C4UA 3CJQA 3ZGNA 4GVPA 2QSZA 1JHXA 2RK3A 3ZKAA 3E48A 4MAMA 2MCFA 4LYGA 4BO4A 2RKBA 2A4KA 1AGPA 2IGBA 1JLSA 3EQ2A 1YULA 4CDRA 1JHZA 3K9HA 1C1DB 5K45A 3DBLB 3GPIA 4L16A 2F2TA 4PX9A 3NO4A 5DSTA 5JJIA 4FHZA 1L7EA 5T8KC 1KI7A 2VJYA 3ZXSA 4MEAA 4IQFA 4DILA 3T0GA 3I61A 3FFTA 3TQRA 2C2MA 5C32A 3MWDB 5JEDA 1E2NA 3NYQA 1T3LA 2CGEA 3K6RA 1ZC4A 5EKXA 4ZXFA 3I9NA 2CF5A 3PEFA 2VBCA 2V7BA 5FV7A 4FYPA 3RFVA 3STWA 4X1KB 3IIJA 3R3ZA 2ZJ1A 3V1UA 4Q3AA 2QD1A 1EFVB 3NHRA 3ZCSA 4Y0NA 3L43A 1Q7EA 2OE2A 4HMQA 4AY4A 1QH9A 4RADA 4BEBA 4IMRA 1O95D 2FPIA 2H4YA 3CBGA 5EKDA 3OLQA 3BD8A 5G1PA 3V3TA 4I6JA 3RRMA 3QM1A 2F6RA 3LT4A 3CW9A 4LJ8A 2QUBA 5AVKA 1BMTA 1PDVA 3KB8A 4OJNA 3U4IA 2CCGA 4XVRA 3MERA 3IQEA 1U65A 2I99A 4EO7A 4EKYA 2BUBA 1G5HA 3STUA 1ZI8A 3NOOA 1K4MA 3PZBA 1SKYB 3FLMA 4DWJA 1DO8A 5C5EA 4LSZA 4G0NA 1JWBB 1PTJC 2Y76A 1NXQA 4H4CA 1AN0A 4NBSA 5FYQA 5B12A 1IXYA 1ZH0A 3QBVA 4O4HF 1QOPB 4QXQA 3F3MA 2AKEA 2I7VA 4ZYLA 1S3IA 2YXEA 4QXOA 4HPJB 5FR1A 5FUBA 1TMYA 3QYFA 3PR3A 4NDZA 3FPHA 3CN7A 2FW8A 3NGXA 4JVMA 4EJMA 4XFJA 1CP3A 1D07A 5HIJA 5KWEA 3A7DA 1U7WA 2D00A 3I28A 3HY6A 3OE7A 5KQPA 1L7DA 2NOAA 1U94A 2VWPA 1NUQA 3A3KA 4S24A 3UHAA 1M0WA 2AJDA 2Y05A 2EP7A 1Z6QA 3FRJA 5JXHA 3MAJA 5IPFA 4I50F 5EEGA 1WTCA 4HB0A 2Q2QA 4YIKA 3WRXA 1NVKA 2RGEA 2VIIA 1GQYA 2RH8A 3MTEA 4I5FA 4LRQA 3H9CA 1OI2A 2OILA 3KVRA 3KXLA 3BE5A 3PUXA 4FYJA 2AEMA 2WTMA 3P2EA 5JHGB 4IIJB 1Q1EA 4EITA 3U4AA 3PT5A 4C4RA 1Z0ZA 1KA9H 5BQPA 1TCAA 1DG1G 1SB8A 3NBZC 4NMMA 1KORA 5DHPA 4ZDWA 3DMYA 3REQB 3W0LB 4MVJA 5HZMA 4KREA 3A1TA 3JQ7A 1DEKA 1YTUA 1ZMOA 3R8XA 2KPOA 2PBRA 3QTLA 4ACBA 2O5RA 5J2UA 5CTAA 4EHFA 2C9CA 2R00A 3NANA 5FJJA 4JL6A 5CK5A 2FPPA 4CM7A 4MA4A 5KTKA 4DC1A 1DGQA 4C5BA 5JD5A 1IAVA 1M5TA 1QYDA 2VQ3A 1OFIA 3AY0A 4YQYA 3TLYA 4EKGA 2B99A 2YOFA 5FPQA 1YRLA 4WZBA 1KZGB 3SGLA 5HEKA 1DC8A 5M2QA 2IBSA 4WTOA 3T1NA 2QQ5A 3ITDA 4HTAA 5C3UA 3MG9A 1DXHA 3OUUA 3RR2A 3P94A 4X1YB 3IJRA 4B3SB 4U0JA 1MO6A 1AG9A 1WM1A 4HUQB 1DNPA 2Q8QA 2GJKA 1NVDA 3AETB 1UMKA 1KI1A 4BFCA 1WQ4A 2W2LA 4QBIA 4ZVOA 1SOWA 3EC7A 4MCAA 4GE3A 4NENA 4X93A 3VU9B 1OBFO 4CLRB 4EG1A 1PHRA 1XJCA 3ZZ1A 1FFXB 1R8SA 5E1DA 3FWYA 4WY8A 1ISSA 3Q7PA 4DABA 2AFIE 1US8A 2J9YB 4TMYA 4BVJA 2IZ5A 3QFTA 2E4YA 4DCCA 1EM8B 1O9HA 2D0IA 2XY4A 3BL8A 2G0TA 4G5XA 4YJFB 1A97A 1Z8FA 2E0IA 5MFZA 2I3AA 4B73A 5LNK1 5CA0A 4F4FA 4PQYA 1KYVA 4WFQA 3HEMA 2AXNA 2ZJZA 4WJKB 4DZRA 2C84A 2C1ZA 1QKKA 2V7UA 5DN6D 3QLVC 4QODA 1XPUA 4ITUA 1L5OA 2B8EA 1P7CA 1IONA 2ATXA 3MWEA 3WWCA 5LZ2A 3GLKA 4MGKR 4F21A 3GT7A 3QMMA 3MBOA 1PJQA 3I58A 5L6LB 2O54A 1CR0A 3E9YA 3DEIA 5D6OA 4IKEA 1GXSA 2B9EA 5JZ9A 1FTNA 2PWYA 3GFFA 4RV5A 5DSXA 3EZ9A 1UMCB 1YR6A 2VPZA 4AZWA 3R7WA 1KI6B 1A9SA 4L4RA 4AC9A 1XRJA 1FDVA 2WJVA 4OIMA 1MRSA 2GSDA 2JGAA 4IDFA 4J16A 2J0SA 1P1RA 2HLDA 2JCYA 3KPWA 4UNNA 3AVUA 5IJXA 2AVNA 3LY8A 3EPKA 1L7NA 4RMJA 2H51A 4PGMA 1IFXA 1RMYA 2OQRA 4XWGA 4DLTA 3WLHA 1NVGA 1C0KA 2QTNA 4FVTA 2VUIB 3DE7X 4KQWA 1Z08A 1YJAA 2BPOA 1CUIA 3VO2A 5FWYA 4CTJA 4OHXA 4DYDA 4UMVA 4FI3F 2FX2A 3V55A 4XJTA 1GAEO 1WXDA 2O50A 1MAVA 1P8JA 4DLVA 2UVQA 4DQ0A 5BMVA 3TTUA 2A30A 3QI7A 4X3CA 1R8YA 3B1JA 2HF8A 2BGKA 3KPUA 4C7VA 1V16A 4HBZA 4OHOA 1NSTA 5LDGA 3UXHA 1DBIA 1EVYA 1Q44A 1E3IA 4DBLE 8ATCA 3D8NA 1UKEA 4BBPA 2X8AA 5KINB 5IAEA 1OXSC 3VDMA 4RD4A 1QC5B 2CXHA 4IX1A 4F3RA 2C2BA 1QFYA 1R66A 2YXBA 5CDTA 2R6DA 2VZ0A 3HKEB 2OCXA 2FX5A 3PE6A 3C4QA 1RP1A 4KDFA 2II6A 4YT8A 1N6KA 5JSUA 3DSRA 3L4EA 3QLUA 2QL5A 3L8ZA 5TNXA 3RKSA 3CR3C 5JBQA 3REFA 2DUNA 1IQUA 4HEA1 4S2EA 3K6JA 5B2FA 3A2MA 5ALXA 1ZL2A 4ER5A 5BNTA 2ZBRA 2GN4A 1E6UA 3QH4A 1O2DA 5IVIA 1M6VB 2CXOA 3W05A 2HZ7A 4FBLA 1AXGA 3FNGA 1Y7IA 2FWPA 5K6RA 4QGAA 3OQNA 1FSPA 2A0KA 3Q3IA 3N2KA 5T67A 4XPIA 1YZTA 3RSCA 1ECGA 2DP4E 2VJCA 3CPJB 3PA6A 3PBKA 5HQJA 3RS2A 1MU0A 2OBLA 5KX5A 3MT8A 5LOVB 5BORA 3TAXA 1JEQB 1RKBA 4RJKA 1X7YB 5F9FA 2UVPA 4O4LB 2A94A 4B5LA 1AKRA 1AUQA 4FUTA 3TSZA 1E2DA 3GLRA 1H65A 2YNMA 3GCDA 2I4OA 4FFVA 4N47A 1XPOA 1E3WA 5KDOA 4TWRA 1NC3A 2P9FA 3C5EA 4C4AA 5CG2A 2BI7A 1W36B 3TZBA 2R79A 1NBMA 4RGQA 2NO0A 1DX6A 3VKWA 3HBFA 3TLMA 5DHQA 4Y30A 1LK7A 5HQ3B 5EXDA 1GUYA 1WPXA 4KODA 1SUWA 2QXYA 4HFJA 4KCGA 5FA5A 5J4KA 4DM3A 2GA9A 1U8EA 3LOPA 1B2LA 3H9BA 1HSOA 4ZT2A 5CBPA 4TUYB 3M70A 1PLKA 5HCIA 4CM8B 2W00A 3LRPA 4ZFNA 2XNHA 4W5TA 4QGFA 2B6NA 4XW2A 2Q6VA 2GCOA 2I22A 1VGRA 3AB3A 3ZWCA 3LQ1A 3EIEA 4M7OA 1RXVA 2HIMA 4N54A 4HS4A 4C5AA 1A8IA 1WDLA 2E7ZA 3AI7A 3RVJA 4H08A 1SU7A 2VPIA 3I1YA 3NWBA 1KP9A 2F8MA 1Z0JA 1GVNB 1K4KA 2QLNA 3NTVA 4JLDA 2FJUA 3ZD6A 2WT8A 4D4MA 1JDPA 3QKRB 3FCSB 2TSYB 4U6SA 1ZH8A 2HF2A 4OL9A 4L2IB 2HPVA 1WWKA 1UBKS 4PFJA 4JUAA 2W4QA 5JSZB 1TUIA 1F5NA 1GCUA 2NTVA 3BN3A 3C97A 1SCAA 3U80A 5DNEA 3UM9A 5KQRA 1PJBA 3NX4A 1NZJA 3SX2A 2JNWA 1J2RA 1M2NA 1TC1A 3ILYA 5K2OA 5JAUA 1VJ5A 2FUCA 1TK3A 3DZGA 3G79A 3KZCA 1JDNA 4MWZA 4RHEA 4G9BA 3Q2IA 1QX3A 4M9XA 4OUDA 4UCFA 2JD1A 3PVZA 1SKQA 1DQRA 2ERYA 4GVLA 3ISTA 1V41E 1L4YA 5ALDA 4OX9B 5FNVA 4BNJA 5DYTA 3OT4A 4GPTA 3WFJA 3QU7A 3FKJA 3QZUA 4Y2QA 3S1LA 4XM2A 4N0DA 1SC6A 3U1BA 2ADMA 1CJCA 1U0JA 2YQ4A 4H6WA 3U7QA 4QYSA 3NASA 1Z5PA 1ITZA 1QORA 1MIOB 1X3LA 3FNQA 1IZ8A 1B26A 4DMLA 1C1XB 1ZN7A 4DA0A 3M6AA 4QFDA 3K5IA 3V8VA 2B4AA 1U2PA 3DLIA 2B1QA 3Q6IA 4D0NA 3U9SA 2JGRA 3GC6A 2PE5A 1SUBA 2VXCA 4EJ0A 5BUQA 3LHSA 1J5XA 3FWKA 4M83A 2XOXA 1YJ5A 4QJBA 3UC5A 2Z2ZA 3HI6A 1U0BB 5EHIA 3AKZA 1WRBA 2X8LA 1IWOA 3R41A 4PIVA 3DDWA 3IRVA 2AB0A 1AX9A 1SELA 3BS4A 4M1WA 5HRUA 4Q37A 3IP8A 1QRTA 2FP3A 2LP4Y 2HW8A 1VKOA 3WL3A 3OU2A 3ZWWA 1YBAA 5COQA 2IU6A 4BMPB 2B7CA 3MINB 2DY1A 5LQAA 3LY5A 1SC9A 3KO8A 4EHAA 3L0IB 1P60A 1L5LA 1Y5NA 4JJ4A 2EATA 3FPJA 4S1NA 1I1QB 5AJTA 3H0EA 1RAEA 2E21A 2D4HA 2DQZA 2TRSB 4UZSA 3HEAA 3HVHA 4YDSA 1E6CA 4YR7A 3I5AA 3RODA 2JC3A 4PC3A 1KYTA 4PTZA 1CYEA 4CCYB 2GN9A 5I47A 3B1KA 3EVNA 2FOLA 3ZY5A 4ID9A 2C4VA 4MJLA 4EZEA 1J20A 3FG9A 3IPAA 3NIWA 3PRHA 1Y3IA 5KTTA 4YO7A 4LJ7A 5M04A 5G4LA 2CXXA 2VT3A 1UKCA 5EMHA 3EZ7A 4MW4A 4G6ZA 1CVIA 1SUDA 4CKBB 1W9HA 1ZAKA 3T38A 1W7AA 3DBVO 1ZVJA 1PCXA 3KZNA 1D0IA 3GN1A 2A59A 3BMQA 3E3AA 1J5EB 2WSLA 4NEQA 3HMQA 2VP6A 3D2AA 1A8QA 1QB7A 3VZBA 2F48A 2QGNA 5BNIA 4L6CA 1RPZA 1BWQA 1DEOA 2BEJA 3FAZA 3N70A 4TKVB 3DMRA 2HQRA 3PWKA 5EMMA 3O26A 2QLFA 3KZOA 3ZG6A 4DT1B 3T3IA 1U31A 1M34B 1YK1A 3OIWA 3WWZA 4FE7A 1SUEA 4O4JF 5E1BA 5E9QA 4B71A 4COOA 2PUBA 1P3JA 2V4MA 3ZJ5A 2IH4A 1VYVA 2OXCA 3JQFA 1BH6A 2FCRA 2CLHB 3FHJA 2Z83A 1FZTA 3IUYA 4G85A 1N0IA 2HBQA 2YVQA 4BLRA 2PD3A 4BRUA 2AGVA 1W4CA 3AEYA 1BE1A 4MW7A 1ULTA 5K6TA 1QP4A 1Y6FA 2KLHA 2OO3A 2QLJA 2IYLD 2Q8PA 4P5EA 1ZD4A 4B9EA 3R8FA 3K8QA 5EOVA 4C2BA 1ZW1A 1S2NA 1TKAA 3E9CA 2BGUA 5F5NA 4FEYA 5FR2A 3W5BA 1QRSA 3H1BA 3BILA 3LU1A 2XBMA 1ZI9A 5LA6F 5MHTA 3SN6A 2PUHA 4FE3A 1R10A 2W6IA 3LPDA 3QGMA 4LHZA 4NKRA 1E5XA 1DL5A 1JHYA 1KY5A 2OHOA 1DC5A 4JOBA 4NJEA 4J4TA 1C8BA 3U2QA 1JI3A 5ICFA 5FBVB 3U26A 1XEWY 4ZZ0A 5I3CA 2ZRLA 4ZD6A 2PZFA 3TTVA 1CDOA 3F3SA 3GEDA 4WNAB 3UHOA 3LUFA 1RZVA 3OZDA 2Q3MA 2IL1A 2YY5A 3IUPA 2VNJA 1OXMA 2VYQA 3PD1A 5KYVA 3CEPB 4EPWA 2H06A 1KFKB 3B1WA 4KYVA 2RC5A 5ARBA 5MDHA 2QN8A 1IQRA 1OU4A 1Q0HA 4OGWA 5E4TA 3U37A 3INTA 2P3SA 4KFCA 4W1PA 4PGHA 2A9OA 4AXXA 3VI3B 2YN2A 3IQGX 4GX5A 1ZUNB 2CZQA 2OC4A 4ZANA 2VWQA 1FXWA 3SR3A 4G0PA 3DZJA 2RGRA 1G9XA 3A1UA 3HZZA 1XNRB 3OEHD 4GSYA 2GKGA 2YN0A 3UENA 3EXAA 5KYYB 1QIEA 5LZ4A 1C30B 2G28A 1LVHA 2Z1NA 2ZTVA 3HKCB 4UUQA 3W8EA 5IKEA 2EEZA 2V65A 4Q0MA 1JFRA 3CNNA 4XD7D 2AEJA 3L7BA 3MJCA 1S0UA 3CVJA 1QPBA 2BN4A 3AR4A 4WJZA 3AU9A 1HLGA 4Y2UA 3ZCQA 4Q4JA 3R7SA 2QUIA 4BNIA 5ES4B 4QM7A 1P4HA 1CUEA 1M34E 4K9QA 4Z2YA 1X7WB 5TS3A 3HSYA 1KY4A 1UDCA 2NSLA 2QJOA 3D81A 1ZX1A 1QO0A 2YHSA 4L8GA 4MPTA 4NBKA 1HKHA 1L5WA 4RFLA 5FBRB 4DV3B 1K5HA 2FPXA 1G9TA 3D6AA 4N8DA 4Y6LA 3WBFA 2IZZA 5BSFA 5I4CA 3GJQA 3VZCA 2I4NA 1SKUA 5CHEA 1L4EA 1NQWA 4LXYA 5TQ0B 4WLEA 1N4AA 1Q0ZA 2BMWA 5LYJA 4IZOA 3LO5A 2OCGA 2ECKA 2VLIA 4KE7A 3A9TA 3SC4A 5KOIA 5ADVA 4H6XA 3PXDA 1I2CA 2Q0SA 1U3CA 2XYHA 4OB6A 1FX0A 1TZCA 1NLFA 4LY6A 4Y6SA 1P77A 4K8RB 4ZDKA 4W9MC 2PZGA 2EGGA 2JFFA 1Z13A 2Z2IA 4PFSA 1WXXA 2G83A 1ISPA 1SN7A 4YC7A 5FPYA 2RONA 2RH9B 2HMTA 4QDUA 1QHGA 3GWGA 1ESNA 4KO3S 1FFWA 4QOHA 5TGTA 2OORA 5CH5A 5CTJA 2VHYA 3JW8A 3MBKA 4ZI3A 1YGPA 2O2XA 3HDTA 4MWSA 2GDJA 5L53A 2EFHB 4LY9A 5K2MA 4FJ0A 2SKDA 4GX1A 2EKZA 4RD3A 2G25A 1UPAA 1VMKA 2Q6OA 4IY1A 5TQ2B 2H1HA 2PYDA 4XTRA 5ECYA 3SQDA 3OEEA 3P0FA 3K70C 1NKSA 4Q1BA 1QHIA 4LOKA 4QWMA 5D2CA 2O8VA 4D9BA 2IP1A 3E9NA 2WI8A 3AY3A 5GINE 2QMYA 3ZJTA 3KUXA 4XYMA 1W36D 1BA3A 4AU1A 2HADA 1GCAA 2R1VA 5TJ9A 5TSDA 1SG6A 1KZ1A 1KYWA 1JWLA 2ZRBA 1P6XA 3DT8A 2OC9A 2ZRNA 2IIBA 4KXVA 1MX9A 3ANXA 3DHVA 1OXBB 3GP5A 1KQNA 3HK2A 5GZ6A 3RWMB 4B5KA 4RL4A 4RLFA 4W7HA 1U4NA 2QRZA 1NHWA 1U04A 3G7UA 2CHEA 1AA9A 4TL8A 2YZ2A 5CNMA 5J9FA 4H0NA 2NU9B 1ZHOA 3GWZA 1WF3A 1V5GA 1LB1B 4PNZA 3ZHVA 4DSOA 4E12A 3K1AB 4RH0A 1Y6GA 1F2DA 2IK8A 2XCQA 3AJDA 4C7OB 1EGVB 1UBUS 3FWZA 5C0OE 4B80A 1USVA 1IWPB 4DC9A 1GZHB 4R4JA 2ZJ3A 4TL6A 3VR5A 1IATA 4ZJZA 4HEJA 2RGAA 1JYFA 4KPEC 1WCIA 4X3OA 1ZNXA 2O8BA 3ORSA 2HR1A 3CUWA 2B5WA 1L4UA 4EB6A 2CKMA 3GNTA 3H2HA 4N5IX 3H8WA 3FFBA 2G70A 4K05A 4ZWNA 4BE7B 3P9KA 1BYIA 1RI1A 1CPYA 5KSPA 1MHPA 2GN8A 2XUKA 1FDIA 3R0XA 4EI8A 2AL7A 1MO5A 2R8RA 4XASA 2R84A 1WUKS 2R7LA 2OVFA 1I6MA 4XX0A 3K0SA 3LQ2A 1PT7A 2A14A 4MUAA 5AVZA 1B3RA 4XM0A 3RLIA 3IMEA 1DO0A 1Y42X 2XIQA 4XWTA 3S2IA 4C7MA 1R1DA 2VSFA 3QUQA 4OXKA 2HLPA 4MDYA 4QPNA 3CMCO 4HN4B 4OMUA 5DX1A 4ZOEA 3L1JA 4EA9A 1GEGA 1IOVA 1P0IA 1J24A 2XF8A 1WJGA 4P84A 2OM6A 1LW6E 5KNBH 2OD9A 3AEXA 3INYA 4I19A 5ADUS 1W35A 2FE4A 1HDGO 1QHYA 3K0FB 3KQOA 4N9WA 2J3EA 1VHTA 1RYEA 1N8SA 1PSZA 1OWOA 4HB4A 4C88A 2O06A 3BVPA 3WMGA 4BN0A 2GASA 4FS3A 1FS6A 4AJHA 5DNAA 3IP7A 4TMFA 1A2BA 1J42A 2DKFA 4Y6PA 4C76A 2QM7A 1EG2A 4UBMA 4NHOA 4FIZA 4YXWD 2OB1A 4YTEA 4EYKA 2VT2A 4Q9AA 1D03A 4RHCA 4R84A 4OSPA 1ML4A 1PWYE 4BPBA 3HJFA 4U6NA 1C9EA 5BV1A 5AP9A 1C1HA 4O2AF 4E5MA 5FWNA 2ZSDA 2QZ9A 1XHFA 3PSHA 2BYTA 1N9GB 3U7EB 3WHKA 2KJQA 1NIJA 3OFNA 2GEFA 3GU3A 1XD2A 2CUZA 5I01A 2O0LA 5BVHA 4E31A 5IS2A 4DRZA 5LBIA 3PUVA 2MT9A 4KBYA 5LP6C 5EVCA 4TS3A 5K0CA 3H04A 1JVSA 1CKEA 1KAQA 3BMCA 5NULA 1KH3A 3GH1A 3U16A 3IUJA 1IH8A 1ZRMA 2GCEA 3B6KA 3HFRA 4IRMA 3H1EA 4L0MA 4AJOA 3U44A 1GKLA 3LC2O 3GUCA 2PH1A 4RCZA 1B00A 4DWOA 4HT3B 1UT6A 3TSWA 2XODA 1CJKC 3LGXA 4M0EA 1ID1A 1OASA 3M6LA 4DJFC 3NHUA 3OSUA 1UZNA 1OCEA 4EUSA 3MT9A 1H94A 4QO8A 2PUWA 3UO8B 4LMAA 3ED1A 1GADO 3MLAA 5L4SA 1VP3A 4J07A 2XMGA 3Q7EA 2J46A 4Q4AA 4JR0A 5GPBA 4Z7OB 1NP3A 1VKJA 2IC5A 2OQ2A 1RYMA 2CVHA 2XTMA 3EOZA 1IVYA 3KSUA 4GZLA 4MVYA 4JB2A 1YHNA 2WKPA 4KIUA 1BFDA 3AHDA 1QV9A 3K9NA 3MQFA 5JW6A 4AKGA 4MITA 1FRZA 1NJGA 2GD6A 5IH3A 4HDSA 4ARZA 2NXNA 3D59A 4JDUA 4KQ2A 2F3SA 4ZJPA 3UT5A 1EI9A 5T6MA 2P5YA 3WZMA 4NXMB 1LY1A 2DFLA 4QBFA 4GEGA 4ZTUB 3W5AA 2D1FA 1YS4A 3WG9A 1O58A 4ZOLB 3V8BA 2E1RA 3QU5A 4N48A 3K3PA 3TB6A 1H6BA 1T9KA 3C1OA 5FKJA 3TTSA 2AK3A 3EUFA 1EU1A 4LYJA 5EPEA 1Y3FE 5E7IA 4M0UA 2X2EA 1GRNA 1R5NA 1YCFA 3OWHA 2PT9A 4OX9Y 3L8EA 2YS6A 3L6DA 2PIDA 2W2KB 4ZO4A 4KE9A 1LLDA 1COWD 3MNFA 1EHYA 3BD7A 4RA6A 1VJCA 2D2FA 4B0OA 1EVIA 3BRWA 4FYKA 3GJ4A 4GOND 3I8XA 2D3TA 3EPLA 3E58A 1E2PA 1SHTX 4HEA6 5G1OA 1ETHA 1SR8A 2W22A 5DISB 3ZDEA 4NH4A 4QQNA 3EEFA 3PEVA 2Y4NA 1CNMA 1IHOA 2FOXA 3KAQA 5EJFA 3W5VA 1C3JA 1JR3A 1SRRA 2GHTA 2ANBA 3G0IA 4R0NA 1VCMA 3P0JA 2JCXA 4NZNA 4MO2A 4W9RA 4CDGA 1QIMA 2YMLA 3M83A 5H70A 4AJ2A 3ZCRA 5HIKA 5KWJA 4S1OA 1ONOA 2QT9A 1BMFA 1KZ6A 4I55F 1KJJA 2WUDA 5BW5A 3HBLA 5FAXA 5B1HA 4OP1A 3QY9A 2WT9A 3INRA 1M7GA 1CQJB 2XVAA 5DGIA 3TNFA 3TO5A 2FMTA 3ONEA 1LPMA 2A9VA 1GA1A 1M7BA 2WJ6A 1ZPDA 1M74A 1E4VA 3C1AA 3MWLA 3OPYI 5CVVA 3GFBA 3HHEA 4JODA 2JLQA 1XP5A 3FJOA 4MWEA 1T5SA 1RI3A 5TIIA 5ALNA 1ELOA 1E9CA 4CM4A 4FX5A 2C82A 1PT9A 2XYVA 1UAYA 2I2BA 3QSGA 3KL2A 4JEMA 1EFTA 1TYAE 2VUHB 1USIA 1GU7A 4KN8A 4J2OA 3TXAA 1HE4A 1J22A 1S8AA 1XMPA 2GYYA 2O7NA 2QZPA 1Z28A 3FZGA 3JQEA 4JQZA 4UE3S 4L8FA 4DLLA 1SXGA 1VGQA 4F3NA 1JILA 2ZRKA 1LI4A 3NP9A 4TKMA 2XCUA 3FCUB 3GRPA 3TE6A 1D2AA 2Q0QA 3RAGA 4EBFA 3TPFA 4UNRA 5EWMA 1CIJA 2E6KA 3SYTA 5ADWA 2H1RA 2J30A 2ZJ8A 1YJ8A 2XEDA 3AUTA 4Z1MA 1NLMA 2JH8A 3I9LA 4YP0A 4GMFA 5C5CA 3HP1A 4CEHB 4P93A 3ROZA 4D56A 1P1IA 1PJRA 4YRIA 2A1IA 5JS8A 4OHPA 2QP3A 1GUFA 3BSFA 1PS0A 5HCUA 5CB4A 1Z2PX 5LZ7A 3ZC3A 4Q00A 4AMGA 1P9OA 2PRZA 4GP7A 4FGLA 2EX0A 3WGNA 1QVAA 2J48A 2P3QA 3WGMA 3OQIB 2OAGA 2ATEA 2H4JA 2KYRA 4I14A 4HWGA 4TMWA 5E4FA 5AOCA 5B30A 3WK5A 4DNXA 1FMLA 2WFLB 4B87A 3GK3A 4IFBA 4BEJA 3M4YA 4OBEA 4RK6A 2BI8A 3AJ9A 3SEQA 4HVLA 5JAMA 2XEXA 5DIZA 2BEVA 3TW0A 5FL7A 1EFDN 2IXAA 4IMIB 5BN4B 2P30A 3W6OA 4KITB 2ZE5A 4J0FA 4BCBA 2HQBA 4UQLA 1I3NA 5TT1A 1IJKA 3I92A 3IP1A 3RFTA 4XXHA 1R0LA 1T8RA 1W5FA 2DUMA 5LB4A 3PXEA 2HMYB 4Q18A 1IN4A 3ZGYA 1DKRA 1N5MA 4HLNA 4DIOA 4N49A 3DULA 4PXAA 1X8JA 4TV8F 5CXSA 3T0IA 2IIQA 2PUGA 4BGDA 5JHHB 1N77A 2CBXA 1HMPA 4A03A 3ESRA 1NI3A 2P6OA 1A0OA 5KWSA 3LKBA 5D5PA 3V3KA 2GAFA 5FORA 1GTMA 4W6QA 1YQXA 3I9FA 2C3MA 1Z7WA 1I33A 5EMNA 2GI4A 2Y0CA 4MH0R 3M6FA 3NDRA 1T5OA 3DDOA 2H1OA 4P4LA 5HMMA 4MPPA 4R1OA 2HT6A 1LNSA 1WZNA 1L5QA 2A33A 2LV8A 5GMOA 1H8HA 4R81A 3CB4A 3WKBA 1ADFA 2P27A 1XV5A 1IG3A 3AEZA 2ISSD 5ABPA 5IFKA 4AK9A 2OGUA 2IOFA 4FMDB 4I4TB 1TLFA 3QWHA 4BNWA 3VPBA 4Z3DA 3LX4A 4Q3LA 2YFKA 3V8QA 3ED5A 2HI0A 1Y9EA 4W9NA 4CWAA 4DLRA 2EW2A 3VKFA 4CKCA 1SZPA 4IF6A 4N40A 4P4TA 4B6QA 5JQGF 2AT1A 2YRWA 3PVCA 4I9UA 4M49A 2PZBA 3EJWA 5H9VA 1XALA 5KQLA 5ALMA 3ZZMA 2V74B 2IUUA 3HGMA 2ZRHA 3FBTA 3IIEA 4J0DA 1V6CA 1XHEA 4ZYZA 4ZO9A 1CFJA 1MJFA 2GNAA 2WSSD 3CFYA 5C7OO 3H86A 4H7HA 3AIIA 3ZY6A 2QN1A 3N7UA 3NAMA 3VHLB 4ZARA 3AR2A 3FIUA 4W5OA 3I4LA 2PBLA 2VZ8A 4QFMA 2JFZA 1SCUA 2JHGA 4ROTA 1FW8A 5A5FA 2AMFA 4JLKA 1IXZA 4R6WA 5DXJA 5A3VA 1OYOA 4PXYA 2X19A 4HKTA 3NBUA 3RRXA 2JI6A 2IITA 1JQ3A 3KXPA 4JA2A 1U90A 5CM2Z 5L45A 4AKHA 2O2YA 3CW8X 4JVNA 2E4ZA 2GZAA 4WCFA 4M9UA 4PLVA 5FI5A 3NHMA 1QHFA 3UV6A 1EX7A 4A0QA 3U7GA 4YWHA 4XQ9A 3EZFA 3VSAA 5CCEA 2UZ1B 1MH9A 1C8KA 1QG2A 1U0FA 2X1HA 2QMQA 3QENA 4JUDX 3WK8A 4BO3A 1NX9A 2XGGA 1JU9A 3NHKA 4MQ6A 3R7DA 4P98A 4EVSA 3FBGA 2PK3A 3BZUA 4FOLA 1JYEA 1QIGA 4KPUB 3PQ3A 1PEDA 2J5BA 4AZSA 4REMA 3UWOA 5JZVA 4FCTA 3FTDA 4C6TB 2HEIA 1YVPA 4IIBA 4UHKA 4P5PA 2EARA 2GAIA 3DWFA 3RTEA 1W2HA 1V7PC 3ABSB 3ASUA 3U7JA 3TIFA 1AKTA 1ORTA 1T1RA 1U8AA 2P7HA 1PK8A 2W0SA 1NN3A 2ANCA 2WHQA 1AVTA 1X8LA 5HZGA 2UAGA 2GHQA 2HMAA 4AN0A 3E15A 4EI7A 4LC0A 3OOYA 2TMGA 4YEDA 5ARDA 1KDRA 3M33A 1SVSA 2XMBA 2ZSUA 1EGQA 3M82A 4PIMA 3VV2A 2I7TA 1D2EA 3O38A 3EQ8A 3EYAA 3O4JA 1SNYA 4QOGA 4QUHA 1FTWA 2FQ1A 3AUUA 2DBQA 4LY0A 1YBVA 1NXOA 5I9IA 3OD1A 1LS6A 5KNBA 1DEXA 2G71A 4XZ3A 4HQFA 4E07A 2X5JO 5J4LA 1D09A 5C8YA 3DTVB 2QR3A 2VPPA 1X8KA 4IEFB 4LDJA 3WLPA 5HDBB 1Q3TA 4EF5A 1OAOA 4I4LA 5I7RA 3G8AA 2ZK7A 3PNMA 4R8LA 5ALPA 2ORYA 4OHRA 1DV2A 1KS2A 4HSEA 2ZIFA 2AWNA 3CZ5A 1TAGA 3T4PA 1A9XA 3P9PA 1Z22A 5CCXA 4UNIA 3SJCA 2ST1A 3VU1A 3SPXA 3UB2A 3V4ZA 5GIOE 5ENDA 3E82A 1BHQ1 3A1CA 3DP9A 3PICA 4MRNA 4QG7A 2VT6A 3QW4B 1W30A 3AX6A 1N1GA 3IBSA 4OA5A 2AF4C 3URMA 4CODB 3R3VA 4WADA 4JYCA 1JKMA 5FQNA 2ZP1A 5GP1A 3EF1A 4RU1A 3K2QA 2KSQA 3TRHA 4YYEA 3PDIA 2IPNA 2IQIA 2IYEA 3K0EA 1YIOA 1QWSA 4GI5A 4GM0A 1L3CA 3CWZA 5LQRA 2X8JA 1XAIA 3KD2A 4JYZA 1G6Q1 5LXTF 1VE1A 1NN5A 2ONZA 3N2GA 5CYOA 3PGXA 4A8JB 3E6AA 4AG5A 4D1YA 1JEAA 1QYCA 1MV8A 5BT9A 3ZDBA 1J0DA 5AT1A 1RS0A 5JU6A 2D0OB 2DVMA 3ON5A 5NLLA 4PG8A 2HA4A 5TRTA 2H00A 3R3YA 1A5ZA 2A5JA 1E4EB 1U5BB 3QITA 3RH0A 3UKJA 4QARA 2CSXA 5H5JA 5CX4A 1VC2A 4P81A 5CLFA 2QQGA 2B4YA 3E5NA 1H2RS 5MN5A 1Y5RA 3G9QA 4ZICA 3MD0A 3RC1A 1MUUA 2B3TA 1KDPA 2HO4A 2J59A 1C2TA 4UU8A 1C8VB 1DTEA 4B2PA 4ZZ3A 3WXBA 2BBTA 3OPMA 3SY8A 5JSQA 2WFAA 3DE1X 1O97C 3OI7A 3B51X 3MTAA 4TMTA 4ZGWA 1RWWA 4NMLA 3E9EA 4KGXA 4NCJA 1W76A 3QXXA 5E7JA 5FO1A 1IAQA 5C81A 2EOAA 3KXIA 1EDBA 5ICMA 3UQZA 4AMZA 1UJBA 1LLCA 1YB1A 2B2CA 4PTYA 1H5QA 3M2TA 5IJ0B 2P2ZA 5C18A 3TLGA 2JLWA 3R24A 1GR0A 2QU8A 2FF5A 2V0GA 2RK6A 3Q7RA 2XI4A 2NXWA 4ETIA 3M7IA 4KK4A 1K5PA 4MLDA 2BEWA 4OK5A 4MDFA 2NYRA 2ZEJA 4ZI7F 3HCBA 2F3TA 4M0KA 2ERXA 2IXBA 4B4VA 4EGAA 1JWAB 1THZA 2W8ZA 4DL9A 2BGMA 4Z4EA 3HA7A 1Z2NX 2W48A 4KUGA 3L01A 5L7WA 4R01A 1TO2E 3NC1C 5DSZA 4MR8B 1LV8A 3BGVA 1JB1A 1G60A 4MEBA 2H2IA 1U6JA 4N3AA 2ASVA 4WY5A 1VI6A 5KMGB 2FZKA 4YO8A 3MCAA 5JT1A 1KJNA 3LUKA 2O2DA 3MCTA 3PZRA 4WK6A 4BP1A 821PA 5B6PA 3HS3A 2EYUA 2MTBA 4INAA 1JVBA 4PHFA 4YR9A 4FXPA 1R8JA 2M98A 4L5IA 1NRJB 2JFVA 4N7JA 1K8ZB 1AE1A 1N2JA 4DMFA 3TGWA 1CDZA 1RDFA 5C52B 2O0KA 1HDOA 1X94A 2J09A 3JYLA 1YI0A 2EEPA 4YMVA 3CCBA 4LRTB 4N6NA 2GEKA 2QM0A 3K15A 5DHTA 5ITZA 1DBWA 1TC2A 2OM2A 4AZTA 4BFUA 5HP4A 3Q3EA 3QXSA 5D87A 4IQ0A 3WGQA 1CJVC 1U8FO 4DXDA 1L4HA 3O9VA 1LXCA 1GZUA 4FDAA 2HNBA 2Q3EA 2IPAB 4GNKA 1YB2A 4WKPA 1X1CA 2I67A 2XNCA 1REQA 2D0PB 3D6HA 5F12A 4NCIA 1QH8A 1Y80A 1NI4B 1P8AA 5TX7A 5LD2C 1CUHA 4CTMA 4YPFA 3FNIA 4FINA 5AM4A 4DEYA 3EVDA 3PC3A 3OOSA 4JJ8A 3KZXA 5REQA 1LBEA 3U62A 4LOAA 5E1MA 4JENA 4MO9A 3L79A 1W4RA 4QOSA 5I8ZA 3WGUA 2GZ1A 4RIIA 4EUHA 3LQFA 2BFFA 5BSKA 4YRTA 3PKJA 1YI1A 1HYGA 1MORA 2VHTA 4V2UA 5DYIA 4Q3KA 3SXUA 3FX2A 3IFSA 4KN6A 3LT1A 3QV1A 4NEGA 3VVLA 1ISHA 1U5AA 5I5GA 2BSXA 1RCTE 3MCWA 4R98A 2K2QB 3DM9B 2OKCA 3REGA 3T4XA 4KHZA 3H5IA 3VNBA 5YASA 3QUAA 4KUHA 3WP1B 1FNNA 5ALHA 2AW3A 1FFYA 2RGBA 1C9NA 2ZCUA 1DC4A 4G0OA 3VNQA 5FA8A 2EF1A 2IZ1A 4E46A 1P9RA 1MB4A 3BXXA 3MK31 4KZKA 4LK3A 4YREA 1RXSA 2B7LA 1OPXA 3GO4A 2BM0A 5EJMA 1G42A 4YA6A 1DXQA 5CCDA 5C37A 4FPXA 4C04A 4E5KA 4EX6A 2EGUA 4KFSA 3D43A 3B9RA 2VOEA 4BFVA 4F7DA 1RJ9A 3HJGA 3RRBA 4ENTA 5H81A 2VF8A 1VE3A 4G1FA 3TZCA 1KZYC 1UINA 2X5OA 4PLCA 1YE8A 4RBNA 3RVBA 5C8DA 5HJ2A 2VDWB 1ZIXA 5HHTA 1J07A 2HPZA 2XJ4A 1X1TA 1RZUA 3H2YA 3CZPA 2C2GA 3M5CA 1E6WA 4AJPA 4B44A 4FIDA 1T13A 2X15A 3O82A 1LKZA 3PDUA 3OMXA 4U3JB 2ZI5A 4CEIA 4ABYA 5HFAA 1YVEI 1ZJYA 1MAWA 2IYWA 2RHDA 1WD7A 1IOZA 3N05A 3WL6A 3T7EA 1DKPA 3JVEA 3Q2OA 4GI1A 4HUJA 3KKLA 3AUYA 3T95A 5EJ2A 3TVDA 1EK6A 3CPHA 1USGA 1NYLA 2QAGB 3GUHA 3L4BC 4MA0A 3RJTA 4IH4A 1K75A 2X42A 4BLTA 5BQFA 2JA1A 3K6KA 4MOWA 5DWQA 4QAJA 4H7IA 2I65A 1NTRA 1AGNA 4FKZA 2PH7A 3FN4A 1H9CA 5LP6B 3LXMA 2DYKA 4G0YA 4D0GA 1II9A 5E4JA 1YMUA 1C14A 1LRJA 4Q4HB 1YL7A 4XIFA 4QXMA 3THWB 1UWVA 4QBTA 2GF0A 1T1IA 3RAFC 1E3EA 5A4IS 3R6GA 3TZLA 3T8YA 4NWIA 5F2OA 1I4DD 1RJDA 2BUCA 1OX6A 3CLHA 2FW1A 2IUSA 4JQYA 4UBJA 5A7FA 1GYPA 2QPAA 1QWOA 3SNKA 2QBYA 1PNQA 3F5DA 4EMSA 1JHUA 2CXTA 2NZYA 2O7VA 1TPYA 5IT4A 3T4UA 4M54A 3HNOA 1A8UA 4ND1A 1RXEA 4D8UA 1HRKA 3N74A 5CB6A 2O3QA 3BIWA 4G2TA 1RRKA 2WTAA 3NU1A 3MTDA 1XDBA 1D4ZA 1AS3A 3ZWYA 1DAHA 3NHYA 2UYHA 3DZKA 3B20A 1TUGA 1MABA 3CRQA 3PQ2A 2WF5A 3BK2A 1EVZA 2GOYA 3QFFA 2P0EA 1CNFA 2DWUA 1IXSB 1QQBA 4DPLA 3NHZA 2I4MA 2WINI 3W77A 1B23P 1GGHA 1T3SA 3FYSA 2IXDA 4G0UA 3E27A 3M89A 4MKIA 1K8RA 2O7RA 3OTHA 2FFAA 2FI1A 2OMKA 4LSWA 4WA7A 2RGXA 4N0EA 2H07A 5B4UA 4RNDB 4INOA 3IALA 4XWYA 4K0KB 1V35A 2X6QA 5JPIA 4ZQFA 4RTLA 4R3UC 2VAVA 5ECDA 1YZUA 1AZWA 1PS9A 1GTSA 4RY8A 4OMCA 3D7NA 4LHXA 5ALVA 1U81A 5EEHA 4WVFA 4C43A 4ZALA 3H8VA 2Z6QA 5HRCA 3G7NA 4AKEA 4L22A 2WU8A 1Z82A 1CDDA 3EVFA 2CFOA 1NOJA 3KJEA 1A88A 3OC6A 1FRQA 3V2HA 3GUZA 1O4VA 1V8PA 3HXPA 3RLFA 1MFPA 2A9PA 2IWRA 3UOWA 5CNJA 2V3CC 2Z56A 4EHJA 1EJ6A 3H16A 1CZNA 1ZNZA 2BUAA 2D7JA 4RD1A 3RQSA 3TRKA 3HO1A 3FJYA 2X4LA 4BGIA 3N0WA 2HK6A 3DZIA 5AR1A 2D59A 3H9QA 3DTVD 2FPWA 1H5UA 3F46A 3KRTA 5AUPB 3IO5A 1T4CA 2CZCA 1YUBA 1N2CE 2P5TB 4MTCA 4OGKA 4QO7A 1FC0A 1AXEA 2QS9A 3HCDA 4HQKA 2HHHB 4HAVA 1NP6A 4M1ZA 1SD2A 1OLXA 2DHCA 2DPLA 2OTCA 3IAAA 5TMEA 1HC7A 1OLSB 1GAWA 3T9FA 1DOAA 2V7VA 5IYZB 1Y6ZA 1AIPA 1QGDA 3IYLW 1GN9A 3C5VA 1BMDA 4K9SA 1LLFA 2FZGA 5E6RA 4CFZA 5LMNB 2NTYC 3SVTA 3JASA 4A1OA 7ABPA 1QOQB 3CRMA 3N8DA 3GDOA 2W6ZA 4I50A 5FL3A 3RYFA 4PY2A 2NVWA 1DQZA 1F6DA 4FFLA 4B81A 2CVFA 1R0RE 4FDTA 5K5EA 1GCOA 2JI7A 1WSAA 3LHKA 4AN4A 3ZDFA 3VKGA 1YC5A 3M1LA 3GX1A 3AO0B 3F1KA 5IKPA 4JMPA 4OH7A 4OMFG 4Z9BA 3HHPA 4P0TA 4D7AA 4MWDA 4YRLA 1FTSA 4UVHA 2X4GA 2QNRA 4MUFA 4OQPA 3TKAA 4JXXA 3G2OA 3VZPA 4WJLA 1LVGA 2A9QA 3N0RA 4KWIA 4K6KA 5LPNA 1F60A 4EB0A 2IGTA 3MYRA 3NBKA 3EZ6A 1B0PA 1P2FA 3DJYA 3DE2X 1VDMA 3GBSA 1WE2A 4E33A 4I81A 1KK1A 4ZQIA 1E9FA 1W93A 1ILWA 3A26A 2VJQA 4AJLA 3QX7A 4CQMB 4EYSA 3LL4A 3GRZA 4IIJF 3ISJA 5KCMA 4UZEA 3SSAA 1JQLB 2JKZA 2LPMA 4ND8A 2YWHA 4L02A 3ELBA 3UK1A 4OXIA 2A0YA 3VC3A 1B8VA 2BM9A 2PHZA 4MUIA 4MKFA 3UJ9A 4BIIA 4BX9A 4WASA 1DCFA 3UYKA 3O3OB 2K4MA 3UWDA 3ESZA 5T64A 1SBYA 5B1YA 2FSVC 3OMLA 4D3XA 1VRWA 5FDFA 1V1MA 1ZUWA 1IUOA 2QK4A 3KT0A 2AD1A 2BFNA 1M67A 1W4AA 4ZHQB 3UJHA 2D5IA 3V8PA 3S55A 3F90A 2R4TA 4OQQA 2PRKA 1U99A 4Q3OA 3BG5A 1E2FA 2K6GA 4NAUA 5KVQA 4FU0A 3SZ3A 1V11B 4N5DA 4B48A 3LQKA 3A37A 5KAMA 1R0YA 4KDCA 1EUDA 3GPCA 3BL5A 1K06A 4DJDC 2QRVA 4ND4A 4Q47A 3VH2A 4LQ4A 1U0EA 4TVKA 2VXYA 4OHVA 5FNZA 2V45A 1IUPA 3D8BA 4A0SA 2ZIWB 4EHDA 1JX6A 3HUDA 3ETGA 4IUCS 1GG2A 2VF7A 2Q99A 3DKVA 1NJFA 1TZBA 5J5VA 2O4CA 3HB4X 1CY7A 1GDDA 1YB7A 3E1KA 3UJPA 3UIEA 2HDHA 1OY1A 2HKIA 3T6KA 5DRTA 3VTFA 4KRFA 1XO1A 3E81A 3QJ5A 4ZMRA 1KJQA 2PGIA 1OLUA 3LUJA 1XK7A 5CYFA 3HRKA 3EQZA 1AU9A 3CNOA 2PUTA 2ECQA 2ZTSA 4B8YA 4EUKA 2ONJA 3Q8LA 4B6GA 3UJNA 1DKUA 1Z56C 2FZCA 3L7LA 3QVGB 4LN1A 2V97A 4J0GA 1D2RA 1YCHA 1TD9A 2AZDA 3OTQA 2V6IA 2ZJ0A 3EEYA 3GLIA 3BWYA 3ZK7A 2WLSA 3EVEA 2IYPA 5F3RA 3X44A 1GARA 2CV2A 1RJEA 3REOA 1RWMA 2IHVA 3OJEA 4YV2A 1G8HA 1JV2B 3P2IA 1CR1A 1MAAA 1E5QA 1N1DA 3GT4A 3HL4A 1EZ1A 2JASA 5GJWC 1UBCA 4B6FA 5ULLA 1JDBC 4D4GA 4BFTA 3OOJA 2O07A 3HFGA 3DOJA 1BXGA 3O7WA 5U4XA 5BWLA 2P6UA 5A9SA 2Z9DA 4FWIB 1HT2E 4C0AC 1GQQA 2IZ6A 2PL9A 3FSEA 1CF2O 2BMAA 3G23A 4LOHA 4P2GA 3WB2A 3AI1A 5IM4F 3MWGA 3GLGE 2FMXA 4BNDA 3KKZA 2QX9A 1AY0A 3SDSA 4RF2A 5IXYA 1H2YA 2NT3A 1UKYA 5L9AA 3WKDA 4M6WA 4M9CA 1JTVA 3PD7A 4Y2RA 5IAJA 4KNYA 3L9XA 3PNLA 2BP7B 3VOSA 4QJ4A 4C0HA 3UTDA 4EABA 5BW8A 1TL7C 3LWNA 4E7OA 4UU1A 2MINB 1XRQA 4ZV4A 4UULA 3HCCA 4YJ3A 5B3JA 1XZAA 4IIXA 3TOZA 3JY6A 2C3YA 1WHSB 3ETJA 4B4KA 1U1GA 1RYYA 3TDKA 4Z7QB 1H2ZA 1DCTA 4Y1RB 1C5KA 1S2OA 1SKAA 1X77A 5EKTA 3PHHA 1BGWA 3B1YA 1F6BA 2E4UA 4UJ3A 3BT7A 4C6SA 1IY2A 4RDHA 3U81A 5JVDB 1DJMA 3HR8A 4D3SA 3PPVA 1VJ0A 5CVCA 2FMKA 1LPBB 1LSJA 2FWBA 4W82A 3O73A 2J3JA 4PLFA 5LYYA 2JIDA 2OCKA 3T1QA 1EB8A 1W19A 1HSZA 3KSZO 1K68A 3F3YA 3K53A 1O6GA 2FUKA 5K3DA 2BM1A 4LA4A 1H3NA 4RL6A 1ZWLA 3WO0A 3H5OA 3HXKA 5UKDA 1SUFA 3B8HA 4DMHA 1WEHA 4IGEA 5FX2A 1JSRA 2Q5OA 2PGJA 4RJJA 2HSJA 2PPLA 2Y1EA 3ZNOA 2PPVA 3E3OA 1VSBA 2NACA 3ORQA 1PDWA 1S7GA 4LX0A 4CKYA 4F86A 2J6HA 2XWBF 3IUMA 3JATB 4FFDA 1W4LA 4UXHA 1VB3A 2F90A 3HKBA 2NVBA 4QYIA 4RW0A 5J40A 2WV7A 2NP6A 4YN3A 3CZRA 4J7UA 2XUQA 1DB3A 5LOVF 4MW2A 1BU8A 4DR7B 2NVUB 1Q12A 2J5KA 4R8MA 2Y4OA 2JEYA 4IG4A 1KIFA 4HFMA 4O4LF 1B1CA 2QM8A 2H1FA 1NRXA 1G20A 1H6CA 2D3WA 3KSMA 2R8BA 2ZTMA 3E7XA 2DY0A 1JJ7A 2GN0A 2DX7A 1S9DA 2CL0X 2EFDB 2FSFA 4I5DA 1TMKA 4MPRA 3IGFA 1H0SA 2UUPA 1JDTA 3WJ2A 1ZXXA 3JR7A 3UPUA 4CM6A 3WFIA 1PQPA 2DJIA 2H4ZA 4RDIA 3GLQA 4AMVA 1ULUA 2EDAA 4W8GA 3NOVA 1NUHA 2Z2XA 3PNPA 3VTAA 4EPRA 4LHVA 3C48A 1KMQA 4X91A 2AQKA 2Z3ZA 5JSHA 1PL0A 2E4VA 2FSSA 3CRVA 3CLRD 3I0NA 4I5EA 4X7MA 4KIFA 4E30A 4TUYF 4HXEB 5IAGA 4ERXA 5K8VA 5KKCA 4AI6A 4RYLA 3MQ2A 2VHQA 3OQHA 1FP1D 3AVOA 3C7AA 1GTVA 1IB0A 5DN9A 1ACLA 2ILVA 3ZQJA 3FYUC 4C3VA 2GZSA 3P9YA 4OHUA 2JIBA 3JAKA 4TLAA 4IDBA 1XZIA 2DWQA 4XSVA 1TVEA 4ZVVA 2OAEA 2YVKA 3BGOS 3DW1X 1F38A 1YO6A 2P9YA 5A9RA 4GECA 1NIPA 1RAGA 1JBKA 1U6IA 4BX3A 1DPFA 3VAAA 4F4JA 4FFOA 1T4DA 3AXTA 3GD5A 4DM7A 5KQMA 3DBHA 3IEUA 4J2TA 2F59A 4OQEA 2OFWA 4QDJA 5KNCD 1UWLA 4HL6A 3R7AA 4LKRA 5C5IA 3PUHA 5B58T