1RHUA

Crystal structure of the complex of caspase-3 with a 5,6,7 tricyclic peptidomimetic inhibitor
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
140
structure length
140
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 140
sequence length 140
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rhuA00
1K88A 2Y0BA 1GQFA 1RWNA 2FQQA 3OD5A 2P2CA 1SHLA 4EJFA 3D6MA 4QUDA 5H0IA 4JQZA 2XYPA 3K7EA 3GJRA 3R6LA 4QU8A 1RWMA 4QTYA 1RE1A 1NW9B 5IAKA 3V4LA 2C2KA 1F1JA 3UOAB 4EHKA 2H4YA 2CNNA 4JJ8A 3D6HA 1PYOA 4FXOA 4NBNA 3S70A 4EHLA 4N6NA 5IBCA 3H13A 4ZVPA 3DEHA 4DCJA 4QUJA 5IAEA 5IAGA 1NMSA 4ZVUA 1F9EA 4PRZA 4JR0A 2CNLA 2QL5A 3R5JA 2Y1LA 1SC3A 3RJMA 4EHDA 3E4CA 4NOJA 4QULA 3NS7A 4JB8A 4PRYA 2H54A 2C2ZA 1RHUA 1RHKA 2K7ZA 2QLFA 3R6GA 2HBQA 1ICEA 5LU9A 1RWXA 4LSZA 3GJSA 4I1PA 2J30A 4JJ7A 1IBCA 1SHJA 4NOMA 4EHAA 3PD1A 5IC6A 5LU8A 3NR2A 1RWOA 1I4EB 2QL9A 1SC4A 1RWVA 1BMQA 1M72A 3D6FA 1PAUA 4HQ0A 4N6OA 3GJTA 4EHNA 1NMQA 3KJNA 4ZVTA 2H65A 3SIPA 3R7BA 1QTNA 2HBYA 3NKFA 1SC1A 4ZVOA 4M9RA 4N7JA 1NMEA 1RHRA 4FDLA 3R7SA 3V4OA 2H51A 4QU5A 4FGUA 1CVRA 5IBPA 4QUEA 4NOKA 2XYGA 3V55A 1RWKA 3R7NA 1K86A 2H5IA 3H11A 4IYRA 5JFTA 5LUAA 3H11B 1RHMA 5LUBA 2HBZA 3EDRA 4N6GA 4QUGA 4N7MA 2CDRA 3IBCA 5IC4A 5IASA 2XYHA 4ZVQA 3SIRA 4EHFA 3BIJA 2HBRA 4HQRA 4JR2A 4QU0A 2FP3A 2NN3C 2H48A 2XZDA 5IARA 5K20A 4NOLA 4QUAA 5I9TA 4PS1A 4AWAA 2QLBA 2XZTA 3P45A 5IABA 3QNWA 2CJXA 3V6MA 1KMCA 3IBFA 4JQYA 1RHQA 2CJYA 3UO8B 3KJQA 4QUHA 2C2OA 4DCPA 1I51A 3P4UA 2FUNB 4QUIA 5IBRA 2WDPA 2J31A 4IEFB 5I9BA 4JJEA 4NBLA 2C1EA 2C2MA 4QU9A 3V3KA 3ITNA 4QUBA 4AW9A 1QX3A 1GFWA 4PS0A 3V6LA 2J32A 1JXQA 3S8EA 3H0EA 2H5JA 3H1PA 5IAJA 1RWPA 2AR9A 3DEJA 5IANA 4ZVRA 3GJQA 4DCOA 2H4WA 4EHHA 1QDUA 3DEIA 4FEAA 4NBKA 2CNKA 2J33A 3EDQA 3PD0A 3R5KA 4JR1A 4AWBA 4D3ZA 4D3YA 4D3XA 2DKOA 3KJFA 2CNOA 4N5DA 4QTXA 2QL7A 3PCXA 4HVAA 1RWWA 4I1RA 1I3OA 2QLJA 1CP3A 4ZVSA 3DEKA 1I4OA 1RHJA
chains in the Genus database with same CATH superfamily
3HI4A 3ZKWA 1FFGA 2VK2A 3BJRA 3SYNA 4B83A 4CTKA 1FFBA 3L7KA 4KO2S 2R96A 4MB6A 4BMZA 3B12A 5CIYA 4ZGBA 1US8A 1QGDA 1LPMA 3CX4A 4JP1A 4IFTA 3IEMA 3PFIA 3L05A 5CVDA 1HEYA 4J03A 3FDZB 4Y18A 4ZZ3A 2IY9A 4AMGA 3HLYA 4JVLA 4WK0B 2O9JA 4IVQA 2JGMA 5TR9A 5DM4A 1PR5A 3ZOKA 2G9ZA 3G1UA 2Q7DA 1RLMA 2BDTA 1PDWA 5ALEA 2ODNA 3BERA 3PPYA 1UBSB 4Z3DA 1X1BA 4S1WA 3K5PA 16PKA 1DCKA 3F6PA 2M98A 2VZ9A 2EKLA 4KLRA 5KSPA 5E3IA 1USGA 1JPUA 3R24A 4GZMA 5KX5F 3S5JA 1E9BA 1H4SA 3PNOA 1HG0A 3OM1A 3REFA 1DO0A 4XSVA 2YIVX 2B1QA 5G4KA 4CF6A 3ECAA 1C8BA 2GD2A 2EEZA 3Q98A 5E4FA 4L27A 1NQVA 1F60A 2EW1A 5B4VA 4WZAA 4KPYA 3FVQA 4DC9A 5SY6A 3KEGA 4ZDJA 3WBKA 2P9GA 3FMPB 2A9PA 4HAIA 3RFCA 2EQAA 2YMQA 3KNZA 1ILWA 1L5GB 1D3AA 4E31A 3BD9A 2GRJA 2V55B 3JZAA 4EPRA 3PNBA 5EMKA 4MYDA 2RKWA 3OX3A 1IIBA 1KI2A 4Y7DA 1LK5A 4FOOA 2GNOA 2ZIXB 3NKFA 3UQZA 4CR6A 2W4QA 1MXFA 1N92A 1JJ7A 2E49A 2XY4A 4N3BA 1T6NA 2Q50A 2ZCUA 4P4LA 1N33B 3G8CA 4PVCA 8MHTA 2I6UA 2PJZA 4TYPA 1KYXA 4DT1A 5CBKA 5IT4A 5K0JA 3AWIA 1UMBB 3PRKE 1XMIA 2OCBA 4RC9A 5EUBA 1CJMA 1RYFA 2GRUA 2XYVA 1QKJA 1G3MA 2QL6A 3K20A 5CITA 1T8RA 3CA8A 3U3OA 1GT6A 4EY5A 5TJHA 2RONA 2BMWA 4MHSA 2BSQA 3HKEA 4FJ0A 3RC3A 4JU8A 5FTLA 1VJRA 3ABSB 4Z4CA 3ENNA 4PBSA 2JDIA 2A57A 2OCGA 2VHUA 4QBKA 1JQAA 5AUOB 2GT1A 5K6RA 2QGFA 3B20A 4QDXA 2R60A 3FDJA 1TIBA 2AJ8A 4RKWA 2WKSA 4ZAFA 5DLEA 1MO5A 3C2QA 2GM5A 5HGXA 1D6JA 1ZIXA 1G20A 1LVHA 2PZ8A 2QN8A 3OZVA 4NV0A 5ECYA 3UN1A 1N3YA 4FEYA 3TINA 5I3CA 5ITWA 2GR9A 2P4EA 1UK7A 3ZHZA 4ZQGA 2JCGA 3MCVA 2HI0A 4GYWA 4TRNA 1GL6A 3ESDA 4FFOA 4FT2A 3KKPA 1U0BB 4BMOB 1F6BA 1GPDG 1JDZA 1S2NA 2BGKA 2W0MA 3CX3A 4PLTA 1S8AA 4HWTA 1JXQA 2WD9A 5LXTA 2RCNA 3V9AA 1TKBA 4KQCA 3GFGA 3FTPA 4YT2A 4O4IB 4FEAA 5HIJA 4FDVA 2JLCA 2OP0A 4GBJA 3TCNA 4GLFA 2P9TA 5JZOA 4YRKA 5DGTA 1JDNA 1OUMA 4M0MA 3WOVA 1S8OA 1XTBA 1GKIA 4FX5A 4UU8A 3QHAA 5AW2A 5FBWB 2Z83A 1LTHR 3EARA 3I6ZA 2IUSA 4URUR 4U5XA 4KQ9A 1VSTA 1BA3A 4J75A 3V4OA 3FRHA 4GEKA 3MAGA 5TMEA 1UK8A 2ODBA 4MRSA 3WRYA 3ZW7A 2A4MA 1UBGA 3R3XA 1VP9A 1MB4A 2YVKA 3KCNA 3U3JA 4RQBA 1H3NA 2HA3A 3DBOB 4IXMA 5A1TA 4K9QA 1ADFA 2FTKE 1F8UA 2LGJA 3RS0A 4JJ8A 1R0SA 1XUOA 2IGBA 2W6OA 4MGHA 2O3QA 4DKJA 3GEGA 2PEZA 3THWA 4F4CA 1SCUB 2DP4E 3R6WA 3KZNA 1X9IA 4DY6A 1OV6A 1GKUB 4E09A 2WTBA 3HJBA 3ZI7A 1TKRA 3TLMA 4KWEA 2VJDA 3VYSB 4LE2A 3IIEA 2PUHA 3F5QA 2AL7A 1HE3A 2HK6A 3S55A 2C03A 4PRKA 4UC0A 3UYLA 4ALJA 3ENWA 2GZHA 4LJ7A 3F5MA 3RBVA 3UJDA 3LTNC 5HSGA 3IESA 4DQVA 5F9HA 4S12A 1LLUA 2C84A 4G86A 3T3EA 3HU5A 5KNBA 3VTAA 3W5CA 2AFIB 4A5OA 1H22A 3CLVA 5AIAA 1UBRS 3SXUB 3JWHA 1ZIPA 1TJYA 3OAAA 3VPFA 4RQAA 1OAAA 3STYA 2HDHA 1TECE 1UR5A 2I4IA 2YN2A 1U2RA 1YIDA 1RXVA 1ZKMA 1B1CA 3N2NA 1OU0A 2IPXA 4NXMB 5AKYA 3JTMA 3AHGA 2PZMA 3ZWPA 2AOTA 4BVBA 1K5GA 1JLSA 2AZ4A 4HMPA 4N7JA 1NJ6A 2X9NA 2FK7A 1WXDA 2G9VA 1EXDA 1R16A 1Z45A 2YJ5A 2GO1A 1E2GA 3I4CA 1G5FA 2HWUA 2FPIA 3Q6MA 2QQ0A 1DBSA 3F2IA 4DNOA 1PZMA 2EU8A 3S6JA 4BVGA 4K3UA 2XSZA 5HFNA 4Z4EA 5IJWA 5IW8A 2F3RA 1YJAA 4PXYA 4IVRA 1KC3A 3HKBB 2ODQA 1HE4A 3C7KA 3PR2B 4B85A 2DWUA 2G5PA 3QX9A 2H8GA 2Y99A 2V8OA 4HTFB 4KQFA 4HDNB 3AP2A 1HEUA 4YAFA 1M2HA 1L5QA 3VPDA 4B8WA 3H9CA 1QFXA 5AOVA 3E6AA 1XF9A 4HQLA 2EDAA 3QX7A 2H9YA 3E53A 2PRSA 1TM7E 3G8BA 5JS8A 1HGXA 2IXTA 4AJPA 4CM7A 1KMCA 3PEFA 2X0FA 1ICIA 1TTQB 1I8TA 2I3ZA 4BNVA 4F21A 4IUYA 4P4GA 4R0VA 3RVJA 5CFRA 2Z4RA 4LE0A 3AIIA 3EJWA 3A1TA 4EM6A 1NULA 1TUBB 2XE8A 3KAKA 4L85A 5CXQA 2VVTA 3QEMB 1ISFA 5JT1A 1NI4A 2J07A 4KVFA 4UUAA 1L4BA 1A04A 1BEZA 1I9CA 1MFZA 2WNHA 4KYVA 5J5CA 4ITUA 2NT4A 3IAHA 2A9OA 2BCJQ 4AW9A 4BN4A 1X80A 3QVKA 3B7GA 4BDTA 1PT6A 5CVUA 5G1PA 4RGQA 2FF7A 3BMNA 3V7UA 4EL5A 1ATIA 5D6NA 4X8MA 4HZUA 2XB4A 5C1DA 4JXZA 1I1OA 3R5KA 2ISSD 4HQ6A 3PC2A 1LUAA 2P40A 4S2UA 4WNCA 1QLJA 2XQFA 3R0JA 4A16A 2W6ZA 1QFZA 1MOSA 2YXEA 3R5SA 3W5SA 1EX9A 2PXAA 5KC9A 4H7KA 3JD0A 2P8JA 1TQ4A 1PT8A 1F9AA 3GAAA 4Z5XA 4WERA 3A1DA 1NW6A 4HYQA 1U2GA 3W0LB 3JTEA 4N1AA 3O83A 1VMAA 1UZMA 5KYYB 4G0QA 1RWMA 3OF5A 4ARZA 3H5RA 1S2MA 4JJFA 3VX3A 4BAUA 1J7KA 1TK3A 2EBHX 1F1JA 4P38A 3I53A 3R5TA 1OTXA 2BTQA 3VR2D 5IHPA 1W85A 4MI6A 2V97A 3ZHUA 3D3EA 1ENZA 4P34A 4PSUA 1YDEA 2Q0SA 3D3NA 3K6RA 4E7OA 2VQFB 3BK1A 1Y7HA 3KOXA 4MS1A 4AQYB 1BRMA 1DIAA 4EG5A 5B7GA 1E0DA 2B78A 5ALYA 1I80A 2RCYA 1U8UA 3DCYA 1A7KA 1RRVA 2Q2NA 2QUAA 3EC2A 2HXYA 1TEHA 5B53A 5C9ZA 1GLGA 3RSHA 3SXJA 4TVSA 4Z4GA 4OD0A 4D43A 3G2PA 4CEHB 2IS4A 5JJIA 4R41A 4I55B 4NDZA 4E2ZA 2LR0A 1SULA 3UXYA 2BGMA 4AUNA 2Z4SA 1GYQA 3WGIA 1E2DA 1R15A 2P7IA 3AMVA 3QHPA 2JJ1A 4ODIA 1D2NA 4UZSA 3W4JA 5D5QA 2IYZA 5C3MA 5BOSB 3WBFA 5IWCA 1AKNA 1E2EA 4NJMB 4O2RA 4P92A 5IXYA 1J42A 4XGQA 1OY1A 1Q50A 4JUIA 4MRAA 2I91A 1PR1A 4N0MA 4C4XA 2Q5EA 4NCKA 4RHCA 4C1BA 2R1TA 3NHYA 5ALUA 4RDXA 2XR1A 3E9RA 1LVGA 3OQVA 1MCZA 1P39A 1T8SA 3OJOA 5J4VA 1J70A 2Y67A 1JMVA 1TF7A 1V4NA 1YR8A 1ZHFA 4P7GA 3HNPA 2Z43A 2C5GA 3V80A 3ZNPA 5IC4A 1SZJG 5DI3B 5C5IA 1X7YA 3OM0A 2ACEA 3SHFA 3V2HA 1F0YA 2WTXA 4JR2A 2O14A 1X7WB 4UM9B 3S40A 2JCBA 2W71A 4KI0A 4Q4HA 3HUEA 4TXNA 3KKNA 1R8QA 3KYIB 4I8DA 4BNMA 4FWBA 5EIBC 1AQNA 3UC5A 4F46A 2QBYB 1WHSB 5IDWA 2BDUA 3R7LA 1ZWLA 2CCJA 3GQBA 4DPLA 2QRLA 3AB3A 5CFZA 4OJKA 2ZE6A 5KNLA 2VDOB 1XJ0A 3DFZA 5JRDS 2GN1A 4Z4QA 3QA9A 3HO8A 3ILHA 2FG6C 2H5LA 4ZI7B 3QX3A 4JV5B 2I1LA 1RLUA 2GKSA 5TLSA 3U61B 2ZJ4A 1I1HA 1Z5VA 2EWVA 2FQYA 4OI4A 1JEQB 4REQA 2CJWA 1FX0B 1XYVA 1NRXA 3OSZA 5FRDA 3T1NA 4JR1A 3W6ZA 5AKIA 4EW3A 5BUSA 4OHZA 1E94E 1M6VA 3B52X 1W8DA 3IAS6 1FDSA 3KKOA 4DRYA 5BSEA 1P1KA 2WW8A 4JWKA 5DIZA 1G16A 1X42A 4GYKA 2OKCA 1MR3F 1O94C 2ZDHA 3NHMA 3G8AA 3C6BA 3RRZA 1BW9B 5AHWA 2FG7C 2P27A 5F98A 1ZD9A 3QXHA 1D2GA 2JGDB 3OICA 3GD5A 3MJSA 5AOAA 3WP1B 3W34A 1AGYA 2DZDA 4EX7A 5G2OA 1Z25A 1CV2A 3D64A 3THXB 2XECA 4CKWA 2Q4DA 4F7WA 2PXCA 4CU2A 1CUBA 3FKSD 3ZBQA 3PGVA 2QE7A 2QKYA 5CK5A 2PUBA 6REQA 3RGGA 1YRWA 1XMXA 4CUKA 4NICA 2PT6A 3X1JA 2HCFA 5CNMA 3GEEA 3QWAA 3O2SB 4KUEA 2C8LA 5ILGA 3H6HA 1WPRA 5F5XA 3H2ZA 2GQ0A 2VUHB 4UHCA 3MTDA 1U5BA 4RNDB 4TUYA 2P0AA 4Q82A 4UJ3A 1ZLXA 3FNGA 1E2LA 2WT9A 4YXWA 3B78A 1TJNA 2VPQA 2ZRCA 4TWJA 4NFLA 3O21A 2H4FA 5L53A 2VL7A 3U5TA 4I50B 3DZ8A 5JAMA 3N7UA 3M3DA 1GUAA 1XK6A 2BKUA 2G36A 3LPDA 4ZDIA 1Z0JA 1NRWA 3T7SA 1LBEA 1EGVB 1Z13A 3GJTA 1CR6A 1QV7A 3LXMA 3BE4A 1E9RA 3DYIA 4BWFB 2UXCB 1UEIA 4U2CA 2AC4A 4RY0A 4MLCA 5JH7F 1YQWA 4IKOA 3W5JA 1NBMA 4EY3A 5JC8A 3M5CA 2DPLA 3AIOA 5D1HA 4JIMA 2FPKA 2QVYX 4ZV9A 1XBTA 3WGHA 1XPOA 5LJLA 1IJEA 1A1VA 2WAAA 3T54A 1SUCA 1QHHB 2PMKA 3LX6A 2XMBA 1A4RA 2A3NA 1RZ3A 1VYHA 2HWWA 3RIEA 1DWPA 2D2XA 2CVQA 4U9HS 3C45A 3IKJA 4RA6A 2H5IA 3ZK8A 4M7PA 4TLEA 3T5CA 1FQWA 3GCGA 2YRFA 3WK5A 4ALMA 3NOXA 3Q6IA 1SXIA 5LIPA 2TMYA 1KZ9A 4MUNA 2N75A 1VI2A 3RVOA 3CF4A 4DUPA 3C3EA 1OYYA 4JFAA 2E5WA 1TEVA 1NFQA 1TK2A 4D8VA 3FIJA 4WUVA 4G81A 1V96A 3I72A 3IEKA 2AIRA 3JVDA 1MRSA 5DOZA 4ZAXA 3KPJA 4GAEA 5BWBA 4UNPA 3C14C 1GLVA 1MW9X 2POCA 1GU7A 4TZTA 4H17A 4FINA 4E5PA 1CK4A 2I67A 4PTZA 4M8SA 4Q9IA 5KOHB 3OQ1A 3WGVA 1GPAA 2FR8A 3E9QA 4G4SO 4WCFB 4ZKEA 3SJ7A 3I76A 4G9BA 3GX1A 3VRHA 1GOTA 2LCQA 1G5PA 1J2JA 3TRHA 5HIKA 5BWLA 4N82A 2P2YA 3U4AA 4CM9A 1UJMA 3TD6A 2IXEA 4KBFA 3ZIDA 1UP7A 3VR6H 4TV9A 1GUZA 3GBSA 3QEJA 4GSYA 4Q5IA 5IANA 8ADHA 4RTJA 1VDZA 4NBKA 1E4EB 1KK2A 1Q3HA 3C4JA 1CFZA 3UWDA 1K7EB 1YBAA 2NSJA 3ET4A 3P9RA 4AJ4A 1SUSA 1QHXA 2AOXA 3JYNA 3KVOA 3NYRA 4HLCA 3P4XA 3EMBA 3EUAA 3CZRA 4BUZA 2I5PO 3BL8A 4RPJA 4FYYA 4RHUA 4QSHA 2HT6A 4TS1A 3PFCA 2BLLA 3L18A 5EKUA 5HE8A 3ANSA 4RPKA 1NQAO 1MLDA 1O6CA 3D6MA 1R5BA 4YJFA 3GLIA 4GLBA 4Y2RA 5CFLA 3I37X 3K70B 1X1AA 2BJVA 2GB4A 4MVJA 4DAOA 1CUVA 5J1TB 1QZXA 1JHAA 1W4BA 1RE1A 3HY3A 1URPA 2HRBA 3FZEA 2HU5A 3V4SA 4YVFA 1K5DA 4IHJF 5KYKA 3HCPA 2H9AA 5E9QA 1QH0A 3OZFA 3GGDA 5ES3A 1Q7GA 4KQWA 1FDOA 1OAOA 2YMPA 4WMLA 5HUHA 1NT4A 4L8WB 2DFLA 2FPLA 3AEXA 3JRXA 1SB8A 2D00A 3CLHA 3M6VA 2WTAA 1XCJA 4M0PA 4XUEA 2OXTA 2DECA 2VH2A 4CNQA 2I03A 2VUUA 1FU7A 1QONA 2FRDC 4FMDF 4QVGA 1UFRA 4X24A 1SKBA 3TRKA 3BSWA 3PVCA 1KK0A 4G5HA 1QCDA 3PP8A 3V34A 5DCWA 1OPRA 4TM7A 3B6EA 5C37A 1UBMS 3TZQA 4EVRA 5KTOA 3L41A 2QAJA 1JIIA 2A2ZA 4ZD6A 4G23A 4OMUA 2Z2ZA 2AUNA 4HKTA 1CETA 3CW2A 5AJXA 3MGAA 1VGVA 1F8FA 1GVNB 2LKCA 3ACBA 3O0TA 3Q3VA 2XAAA 4IQ0A 4M4SA 4YI3A 2P9ZA 1P6QA 2CUZA 1C3JA 1A0OA 2TS1A 4Q9NA 4WKBA 3TQCA 4YAGA 4Y9SA 3EMVA 3D54D 4QAQA 5BV0A 1KP9A 1T9CA 2OILA 4G01B 3UHJA 3N76A 3WK7A 3UVEA 5ICMA 2OXCA 1GKYA 2GBPA 2B4RO 1VIAA 1E1QA 1HMPA 1RPZA 1OLOA 3GGSA 2V54A 4ZT6A 1WB4A 3TE6A 4JUBA 3PWZA 1RPTA 621PA 4LDRA 1T6BY 2O2YA 2OV8A 1JR4A 3GXBA 4N3GA 3RTGA 4BYGA 2FYTA 3FBTA 4LCEA 3EC7A 4MR8B 4GKVA 1DVRA 4KHZA 2Y2VA 3UANA 1O2DA 4RTRA 2H1LA 3LIPA 3O4RA 4DV1B 5T57A 5IJZA 3UCFA 3HL4A 2ZB3A 3A9CA 3BWYA 3DEZA 3TJZA 1BFUA 4BNUA 4ROSA 1EXNA 4BJ3A 5BUZA 4HQFA 2GAFA 4I9NA 3SC6A 2IBSA 2AKEA 1P80A 3ZLTA 4G5OA 1NAHA 2Q5FA 2X8WA 4GOKA 4CG0A 1KOLA 3CFYA 1RMQA 2GH1A 3E3OA 5D3QA 3E5RA 4U7HA 1IH8A 1GEGA 4QXRA 5HGJA 5FUMA 2PZGA 3IQHX 3CURA 2Y9PB 1P7ZA 3OURA 2CXUA 2J87A 3MD0A 3O1LA 4KQMA 3WYGA 3BD7A 1UWCA 3A4LA 1MPXA 2IX9A 2OOKA 2EFJA 1H2HA 5B2FA 3SR4A 3OOSA 4ZCPA 1P5ZB 2O07A 4H0NA 3GFSA 2P3QA 3E2MA 4JC5A 1KKUA 1HURA 6LDHA 3MRTA 1VTKA 3ND7A 5DGIA 5EXEA 2HSZA 4CMJA 3G2JA 1K6EA 4IV0A 2PUVA 2Y68A 1X77A 4I46A 1OBOA 4I1YA 1DUSA 4EMUA 1ZH0A 3B36A 4CODB 4AKHA 3PUVA 5F2NA 1OLXA 1BEUB 2PAAA 4LOKA 1GZ5A 3PXDA 4KFUA 5KOIA 2R44A 3ITKA 2CC2A 5SYMA 1WAMA 3T7JA 3PQ6A 2CLHB 2H18A 4HDRA 1QPBA 2ZUTA 2FPGB 1EQ2A 2ENWA 4NZMA 5DDIP 3BGIA 5G0SA 3TXXA 3UB2A 1BYIA 1SVNA 1KBOA 1PX2A 1IN5A 3RASA 4HOYA 5LZ2A 4FU0A 3GLFE 4XEUA 1DWUA 1ZN9A 1A4IA 3T99A 3SDBA 1SOAA 2Q6LA 4FJ2A 3M5WA 1KDVA 1CULC 2P68A 1UIMA 1R0LA 3LP8A 4UHHA 1I30A 1RSZA 2B34A 3I6BA 4V0NA 2C3PA 1JHYA 1GCGA 3M1AA 3VPCA 3WIOA 4G89A 5FX2A 1LLFA 4X62B 2EX0A 1E7WA 4ICIA 2VJOA 1N0VC 3EVEA 3QV2A 1H2XA 1OWMA 1RKQA 4DR4B 2A3RA 2EF1A 3JWPA 3VO8A 4CL3A 2B8WA 4XB6B 4GD3Q 4WXMA 4YRMA 1BVHA 1UQTA 2R4UA 2VTDA 2X5OA 4F7DA 3GMSA 5T4BA 2HRDA 5DRYA 3C8ZA 3KWFA 4RZHA 2XCTB 1M2OB 3LY8A 1Q16A 4O8ZA 6GPBA 3LT5A 1LH0A 5LOVA 3QLUA 1WW3A 2J5KA 1Q2XA 5MN4A 4UCXA 3INRA 2Q21A 1Q7CA 2R6DA 3FMGA 4R1UA 3TOVA 5ES4B 1G98A 1C4OA 2QSZA 2B8JA 1PWHA 3GP5A 2VYND 3ZQ4A 4CKEB 1DFGA 4XD7D 3X1WA 1M1ZA 4X1KB 2W6PA 5F7XA 3PCTA 2FN9A 2WMOB 2Q5QA 4MUMA 3I6MA 2IHKA 2JCVA 3JS5A 2I6FA 4KQ1A 2OOSA 2VCYA 1W30A 3NYWA 1TAUA 1U0EA 2QN9A 4QU5A 1P1HA 3K0KA 1G9XA 3BFVA 3KQYA 1CF9A 4CN8A 1I2ZA 3AEUA 5JWHA 1PTKA 2PA3A 4HI0E 1UL1X 4EKDA 4G4IA 1L5FA 4RPGA 4CTNA 3CBGA 3L7MA 4JNKA 2R86A 2F64A 3MTEA 1YZTA 4G4JA 1F2UA 1Q7EA 4G97A 4P80A 4R1PA 4ZANA 1X6VA 3V4FA 1QJ4A 3A1VA 5EHQA 5KBYA 2ZRDA 4ZHQA 1A2BA 2VNHA 1J49A 1ODIA 4Z2YA 1BCRB 1Y7IA 1P1BA 5SICE 1Y82A 2PS9A 1MOPA 1SU6A 4KK3A 3HKCB 3BJEA 1ZOSA 1VKJA 2B5VA 5EPUA 4R83A 1W5BA 4IKPA 3RR2A 3R44A 4DARA 1U8TA 1EP2B 3QKWA 1W5EA 3GEDA 1JA9A 1O6ZA 3CLTD 3LT4A 1IUKA 4MTCA 4NEGA 3W6UA 2VCHA 5CYOA 1IL0A 2G9UA 4EDFA 5J2UA 4NS1A 3R41A 1F7VA 4PLGA 3U7HB 1MO3A 5K3FA 1E77A 2GRAA 1QQ7A 3IT1A 1Z7WA 4LV6A 4Q0MA 3T95A 2I3GA 3GRCA 1CZRA 5C8DA 1I2DA 2W6NA 1KKMA 3L06A 1EZZA 2X9VA 4GH5A 3RSCA 3ILVA 1L7NA 3OKAA 3LOPA 3RVBA 3TAXA 3BWMA 4JT8A 4RA9A 1GNSA 4D7AA 1E1LA 3IJRA 1ZD5A 4B4KA 3FOBA 1QIFA 3HBNA 1QU2A 2C78A 4IWYA 4TSKA 5H68A 3HJRA 3HM9A 2Y93A 5JFOA 3CLSD 2DFNA 2UZ1B 1CP3A 1QH1A 1JTFA 4BATA 3B8HA 3RE1A 1Z6PA 2REOA 3P2MA 1EFDN 2R751 5ECGC 2G3YA 3DE2X 4PPFA 3GPLA 2R47A 1KAQA 2JBAB 2WSMA 3LDFA 1NU6A 4U7WA 1QBGA 3HUTA 2XITA 1T4CB 3QX8A 5T6MA 3VJKA 1YB6A 3HO6A 1PFKA 1R8XA 1SD5A 1Z73A 2JHCA 2RH9B 3C3DA 3KXPA 4NJEA 4BGIA 4C07A 3SOZA 3ZV5A 2ZAMA 2Z8ZA 2DH6A 2YBEA 4OO3A 5E0OA 5L6LB 4ZVPA 3LF2A 3M5PA 1GY8A 5CA0B 1IXRC 1QZUA 4DLLA 5AHXA 1DFHA 1NVUQ 2SICE 2ZTMA 3AUSA 3JVUA 2GBLC 3L6RA 1MA0A 2QAIA 5EMNA 4UTNA 1X14A 3ZE6A 3TKLA 1PNVA 1MC1A 3MMSA 1YJXA 2X0JA 4TMFA 1XCLA 2HEGA 4IWXA 3ME5A 4LJ5A 4MGKR 1KYQA 1WP9A 3HCNA 1IBCA 5AW5A 5CB6A 1U90A 3WDMA 3SC4A 4MWDA 4EG7A 5G0VA 4ND2A 4H7IA 3EWNA 5FUQA 4QGAA 4DUZB 3BRWD 3CG4A 5JHGB 1BVRA 3KKEA 3O2QB 1E8NA 2DPGA 1RWVA 2AW3A 1VCIA 4UEOA 4CGZA 4D6PA 3FZNA 5AKGA 1WZIA 4ZI3A 4CM5A 3PEVA 3OQIA 4YO7A 4DVJA 3IHLA 2IYSA 3GJYA 2E89A 2VP4A 3RARA 3W05A 3U0VA 5LQNA 1KO5A 1A9SA 3FAZA 3L43A 1EUCA 2IBMA 3LPAA 1KDZA 1ML4A 2DR3A 1QYIA 3DMRA 1WMBA 4J8PA 1E3WB 1XZ8A 2CY0A 3N2IA 4PAWA 1R4AA 4AKIA 4OHCA 4TL8A 1V8BA 4DQ0A 2GXAA 1N75A 3VR2A 1CR2A 2IU4A 2IUYA 2O8EB 2GEJA 2DQYA 5BN5A 1W5AA 3BF7A 4HYTA 5E1OA 1DAHA 5DLYA 3FIUA 3KQMA 2HREA 5ENDA 2I8AA 5BXQC 3RPEA 4MZDA 3HWSA 4FLMA 3ZR4B 2KQUA 5AP9A 3OC6A 3SIRA 3E9NA 4CRWB 1FMFA 5I7SA 2ORYA 4BO0A 4L2IB 1JQDA 3FFBA 1F4LA 2XZDA 4LEIA 4MUIA 3OF2A 3TW8A 1XZGA 2IRWA 4I4CA 2GXSA 4BGDA 1YASA 3V1LA 1P33A 1A9TA 3QFFA 3L79A 4PONA 4UM5A 1E2QA 1W36C 1VPTA 5AK6A 3COYA 3A7EA 5AI4A 1KKLA 4IPTA 1ZM7A 1DAGA 3OKCA 1BKDR 3L0CA 4D81A 3I04A 1YRLA 3T1TA 4RMHA 4WOJA 4AF8A 1KTIA 4OX9Y 5C52B 1QIJA 4BO9A 4J49A 3LX5A 2W2OA 2GYYA 3V5NA 5SY9A 2J09A 1IXYA 4QDKA 3J7TA 1UP6A 2PSSA 3T5AA 4BEJA 4TV8B 4WPGA 1RWPA 3EFBA 4OUDB 1PBTA 3D2AA 1YAHA 3C48A 5EHNA 1GTRA 4XX0B 4AWXA 2OAEA 4MUFA 2W0SA 4OAQA 4IZHA 3NHRA 1XHLA 5TQ0A 4O3MA 4UVIA 5CA1B 3ZWKA 4LYJA 2FHPA 3BZWA 4EVIA 1QK4A 3T1VA 3JQEA 1AZLA 1OB2A 4PNPA 4ZTUB 3AM1A 4ON9A 1XVIA 1MJGA 4WOKA 4G8JA 1YCGA 4TWIA 3D5TA 3T9CA 4FFRA 1EZ1A 2A5LA 3WB2A 3TO5A 3EVZA 3FGOA 4R1LA 5DNUA 4OREX 1FF9A 3U37A 1V6SA 3D8SA 4QNMA 4D3SA 2ZUVA 1H6DA 4OHPA 1Y6FA 3OEYA 3L02A 1C2TA 4G5GA 3X44A 1E5VA 1JDVA 1SKUA 4PC2A 2G8NA 3T5DA 2P1DA 1IHYA 5EQTA 1BS9A 1Q12A 4Q6WA 3DDWA 1QS0A 1YMVA 4Z7JA 4BUJA 3OZIA 3W78A 3T9FA 4ALLA 5FUYA 2C3MA 1SAYA 2IU6A 3UT5A 1EYZA 1LJUA 4DCJA 1QORA 3V1KA 1ZCAA 1C7FA 1DXHA 2FWNA 3DZKA 1CEXA 1R64A 4PRZA 3LUDA 4OL9A 4E14A 5F1OA 4G0NA 2BM0A 4K2AA 4A26A 4L0QA 2BEUB 1LPBB 3PNLA 1QM5A 3IPRA 4F6RA 1V7ZA 3LK7A 3VYTB 1PWZA 1KE1A 3OLCX 2HBQA 5E8RA 4UPEA 1T36A 1DO8A 3GGGA 2C04A 4HDQB 5AVOA 2OAQ1 1SK8A 5KHOC 2JIDA 2GVNA 1N8KA 3A11A 3LSYA 4QQFA 5EPOA 5K3DA 3W5HA 5C7YA 4YAOA 1UMDB 5ALXA 3AI1A 1E0AA 3D6FA 5F7ZA 3USCS 4AECA 3PFFA 1U2DC 3PGKA 2PIAA 4BZZA 5JNSA 2IYQA 4KDCA 3I6QA 1PQYA 2FETA 5EZQA 3KR9A 3BMQB 5K05A 1LD3A 1U2QA 1OBCA 3JAKA 3RSSA 1VSQA 1R5JA 4RIIA 3JQDA 2EP7A 1DO2A 2XTMA 4D8UA 3QE4A 1NBWB 4QQKA 2HMWA 4LXQA 3U1BA 3TOCA 3FGZA 2R6AA 3MPUA 1HDXA 3VBCA 5THKA 1GAXA 2BBTA 2AYZA 3C0KA 2QTCA 3FKSA 5JY6A 4M9XA 1DAOA 1IOVA 1XYGA 1G3UA 4JEUA 1BHSA 3LX8A 4MIOA 4EYEA 1NSFA 1GRVA 1RHMA 3DQQA 5K4GA 5IT9A 1RKUA 1RW4A 4FW8A 4NCBA 1P29A 5CLLA 5LYJA 1A97A 2XYHA 1L8OA 4EHFA 1GGJA 1RABA 4LXHA 5G1OA 2ZWOA 3GDOA 4K6CA 4BN5A 2R7LA 2XUQA 4KNYA 1SCAA 5HM8A 3GJ7A 3OUZA 4E5KA 5EJ6A 3G9XA 4KYTA 4P6VF 2BEJA 1THZA 1B8OA 1JU4A 5KAMA 1B43A 3AF3A 5KJFA 3WICA 1BN6A 4EW2A 5FP0A 1ZDMA 1ZPDA 3EIHA 3F49S 2H8KA 3OZUA 5SZJA 1Y8ZA 3LTEA 3O92A 4Z9YA 5FOVA 4QT4A 4PFSA 4B40A 2DUUA 4X6UA 2GFQA 3W8DA 5KTTA 5KMGB 2FOIA 2QVXX 2QGZA 5FA5A 3RC1A 3VC2A 3KTOA 2ZUFA 2IYNA 4B6EA 1HQCA 2X8JB 1JW9B 1XJ5A 2PRYA 3DOHA 3EQ2A 4GWGA 3PKZA 2BMDA 5EJFA 3I1FA 4ACAA 1PBNA 1EE2A 4MKGA 4LF4B 1QO0A 4S24A 3DAFA 4L95C 1XRJA 4XIYA 1RNLA 5EMMA 2QAGB 1EUQA 1IULA 2R6JA 2RGNC 1L5NA 4BTLA 4E5UA 2ZVDA 2FDRA 2FOXA 2FFHA 4NK5A 5I4CA 3OX1A 3KZCA 2O8BA 1GTMA 4RPLA 3CF0A 3TD2A 2IZZA 1K88A 4D4JA 1AGRA 2ZYVX 4FKMA 4HAXA 1XRSB 3GF4A 4HB2A 1QPZA 3VNQA 4MUAA 3RK1A 5A2QA 3QVGB 1FP1D 3ZBTA 4ZAVA 5IX8A 4F3RA 7REQA 1A7JA 4B2LA 2EVWX 3EGCA 3K0HA 1EQUA 3S1AB 4KIWA 3CPHA 4JU9A 3KQSA 4OXKA 5JQGA 5FJIA 1ST2A 1J2TA 1O95A 3Q5GA 4H3KB 4KOEC 4ARVA 2Z6UA 2OY0A 1AHNA 1GGEA 1SQGA 2M1XA 4MP8A 3L4BC 4Q7KA 4RACA 3N74A 3W8FA 3GGPA 1MMFB 4L50A 4G6ZA 3JY6A 3O7WA 4LXTA 4WN9B 4JSYA 4NENB 1YDGA 3BM5A 1OWLA 3K5WA 5E3HA 4Y2VA 2YNMD 5HJEA 1TZCA 3R5JA 4CXMA 3UW3A 1D4ZA 1A8UA 3NS7A 4DQDA 5I5GA 2XT9A 2KHZA 1VJTA 3AY6A 4ZO4A 4JEHA 1G3QA 3KALA 1BH2A 4CTJA 5C7LO 1PUJA 5CHYA 2JI9A 2P8SA 2QMHA 4X1OA 3FCUB 3RIYA 2PJDA 4GBGA 3WNCA 4N01A 2WRZA 2AFHA 4I3GA 4NMHA 3ZQUA 2FF5A 4NH0A 4EK9A 2J7PD 3C6ZA 3MJDA 1AT1A 3CN9A 5SZKB 2BTEA 2AOUB 5JCPA 2Q6OA 2OFXA 2VAPA 1N5OX 3BQNB 2J3EA 2JF0A 1L4KA 3MTQA 4KAXA 3PPWA 2ZQYA 3NVDA 3W9SA 4QVIA 1SO8A 4F3YA 1TCBA 3L1VA 2FSPA 4DA0A 2M2IA 4KN6A 4OI2A 1RYDA 1ZMOA 2I7VA 3EF1A 1P1JA 5FEMA 5KQRA 1MGOA 3NCTA 5LQUA 4YI5A 2ODWA 1QH8A 1W1UA 5E8JA 4EY6A 1QOZA 2YWBA 3E9CA 4X44A 3A3PA 1GGFA 1VJCA 2GPJA 4UXIA 2I2DA 1YNOA 5KYXB 2GILA 4I4TA 4CM8B 4ZCQA 1QWSA 1K98A 4BBAA 1CU1A 3NJ8A 4X20A 5TB5A 3T12A 1U8CB 1K9SA 2A0KA 1Y9AA 3WK4A 2WFLA 1DC4A 2B4TO 4PXAA 3NC1C 2RGDA 3B38A 2NO0A 4C06A 3CWZA 3I0ZA 1IB6A 2XZTA 4V3CA 2EFHB 8ATCA 1ONPA 4FS3A 4TSFD 3GLFB 4KXVA 1V6CA 2ZE8A 4PC3A 1KEWA 1QP8A 3AIMA 3OPXA 4H4EA 1NX9A 1O96A 4G5YA 4BMPB 2VYVD 3FFXA 5FWNA 3JQ8B 3FPKA 4NDAA 3MRXA 2QVGA 3DUFB 1MJNA 2DWCA 4OBEA 3MAAC 4EHJA 3W3AD 4EPXA 1TZMA 3D8RA 1GWNA 2BP7A 3GEMA 3A4MA 4RFSB 2R6HA 2D7DA 2FPPA 1GL7A 3K5IA 2XLBA 1V5IA 4Z49A 3MWFA 1JJIA 1ODSA 1W29A 4O08A 2PGIA 4YROA 4A8PA 2ZCVA 1P2GA 2EHDA 4MTLA 3W06A 2PKWA 3NUGA 2KBFA 4M6WB 1H93A 2JAWA 2VNSA 3FR7A 4AS3A 3IOCA 1EAYA 1NWCA 1TGVA 4PU0A 2ALJA 2ZYTX 3DMTA 1O9HA 3BD8A 3UMRA 4XPIA 3JVEA 4IMPA 5HILA 4N48A 3R8XA 3WMEA 1FMTA 4G09A 3K1AB 3VKWA 4PN3A 1MV8A 3OD5A 3CE6A 3O95A 1I6MA 3LCUA 3GT0A 1GKLA 2PBZA 2VXCA 3K32A 1TA4A 4BYMA 1LDNA 3QM1A 3AB7A 4W6QA 2HK9A 4JHLA 2FFAA 4HRYA 1V2HE 5IAKA 3VU3A 3EZGA 1MDBA 3PDUA 1KJ8A 2VDQB 1DI0A 4QOFA 1K3TA 4BRSA 3QBVA 5KYNA 2WM9B 1VQ1A 3D6HA 1Y8QB 4JXJA 3JV7A 3IRVA 1BROA 1FTSA 3RIGA 3A2MA 5LKRA 4R2IA 1EK0A 3L7LA 1AUXA 2JIBA 4ERNA 3HADA 3HP4A 2BHSA 4LRQA 1UBFA 4MS4B 1NI3A 4V0QA 2ZBRA 2FMFA 2NYRA 2P9EA 5KO2A 1QRDA 1NIPA 3C3YA 3UWPA 4BNDA 2JZNA 2ZPUA 2XYQA 1VPEA 2RC5A 1EFRD 2WMDA 2OESA 3H05A 4NBSA 6ABPA 3LPMA 3THYA 3U9LA 3HU1A 1H2EA 5LVAA 5AXCA 2I6SA 2J30A 4HDSB 3WKCA 1WF3A 2WKPA 1NM5C 2QX9A 1RRKA 1YZYA 1JAYA 4UVDA 2RFLA 3AUTA 2X0KA 1WMDA 1SOUA 4BGUA 3Q11A 2CEAA 2QLMA 1QRAA 3IPXA 3C4QA 5JECA 1U0RA 2BEWA 1QUEA 4G3XA 1ZNQO 2ZG6A 4KW7A 2WQ6A 4R8RA 5E6SB 3AUFA 4BY9E 3BAZA 3QOFA 5ER6A 4BECA 2V45A 3JCZA 1P2VA 3N28A 2QU8A 1DBQA 1U9IA 3F97A 5JBNA 5IJ9B 1K08A 1QGAA 1Z06A 2V5UA 1NBAA 2AKAB 4WFIA 3D6VA 4DCMA 3KTDA 3ZTTA 4EAAA 2NP7A 1YO6A 4NARA 2XCIA 4YQFA 4ZRNA 2FPRA 4M3NA 3CYFA 2QVLA 1YOVA 1X0XA 4N8DA 3QG5A 2EG5A 1YZFA 1JPNA 2R8XA 2X22A 3CPSA 3KKZA 4FMBB 4GMGA 2GKGA 2QG6A 4K1LA 4DWOA 1P1FA 4AYWA 2VDVE 2JCXA 2WKWA 3KZMA 4TMYA 3IKVA 4PQRA 1TYCA 7ADHA 2PL3A 3HCFA 3OIWA 3SG0A 4TMTA 5M7EA 3S8YA 5C80A 1D8TA 4ZZ1A 2X8AA 3R76A 4PSKA 1E1RD 4JROA 1LNZA 3AV0B 3G8DA 4ZOAA 1OXTA 1KYVA 3HXPA 4W7HA 4RL4A 1C7EA 1KIMA 3Q2IA 2G80A 2DLCX 1J9ZA 5TPWA 3ZJUA 4IDGA 2ZJ6A 4QVKA 5HKLA 5AI6A 2NU7B 1AMNA 3FMIA 5DM1A 3V4ZA 3ZK7A 3HBMA 1E1CB 3TIVA 2VAVA 3B48A 1MBZA 1OFVA 2Q4OA 2VYNA 3PGA1 4DA7A 5HK8A 1JTEA 3RG8A 3L9WA 4UBLA 4TLAA 1B8VA 1K8XB 2C1XA 4UKDA 4HGQA 4BX3A 2NUTA 5LSAA 4KPEC 1OXMA 3I05A 3KCQA 4LHEA 3GK3A 2DU8A 5IYZF 2HGZA 3MWEA 1OROA 2G8LA 2OENG 5DW3A 1OBHA 1FW6A 2G1UA 3N2GA 3L49A 4CIVA 1T2DA 4RM3A 4Q03A 1JE1A 5IM4F 5FNVB 2PKXA 1B16A 3ZE1B 2RH4A 5LL6P 2J9FB 2WWRA 1T9KA 2PL1A 2VBCA 4JLUA 2Y3IA 3HR8A 5JSKA 3VKFA 5A9RA 4WRRA 3BSSA 5CVCA 1KI7A 3WLIA 3UFXA 1CY0A 2D1YA 2GN4A 2YC4C 4D45A 4ZAYA 1TYZA 1RXYA 2ZB2A 2JIMA 5DHQA 2FEOA 5EP1A 3TGLA 1C9DB 1JEAA 1F3LA 1VA5A 3D4IA 2QM3A 3HN6A 4L28A 4G1MB 5EQJB 5AJZA 1C7JA 4HNQA 2IS2A 1SUAA 3QYAA 4C0HA 2ZJ3A 4KR6A 1S02A 4N6NA 1T1IA 2Z95A 1NC3A 3E2IA 3TZKA 4OF4A 1G9SA 3TR5A 1PJ4A 1EK5A 1N7GA 4IJ5A 5L4SA 4IQFA 1QZZA 3ICVA 4ZT7A 1HUQA 2CVPA 3ONFA 2QVZX 3K1TA 4Z6KA 4RMJA 4RVDA 1Y3FE 4YNBA 3SK0A 1FYWA 5LU9A 3SZLA 5CW2A 1WVGA 1IWPB 4W5NA 2QW1A 3E7XA 2Y0CA 1X7ZB 1IY2A 2MYTA 2YJGA 1BA2A 4QFDA 4ARAA 3A6PC 1W9HA 2AHOA 2H00A 4PLFA 4AY2A 4PICA 1Z5OA 2QRQA 3QNMA 1HBJA 1DQYA 1FSSA 3UFBA 2GAAA 4FFWA 3KQHA 2JLUA 3DXXA 1AZWA 1QG0A 2ADOA 1Z2OX 3SWWA 1IVNA 2D2EA 1U1FA 2F7SA 2H63A 3BILA 3EYAA 2F62A 3AQ4A 4GG1A 5J4KA 2CFCA 2FW7A 2PV0A 3ETCA 1S7CA 4LTNA 4AZ3B 4X92A 4N54A 2JPDA 4GR4A 3OOYA 3JQPA 2NSDA 2JFVA 3JQGB 4XIGS 4RS4A 3F6EX 4D42A 3G5TA 5AVTA 1KHHA 3SQDA 1P44A 3SF8B 1FB5A 1YHYA 5EXPA 1E1MA 3PX2A 4EA6A 5IASA 3JZDA 5KNDD 4RWZA 1UMCA 2JZOA 4EECA 2Y0DA 2XD4A 3CNEA 5CURA 3BZUA 3WV4A 2V7GA 4PPQA 5CB4B 9ABPA 2XQVA 5HYVA 1S2OA 4H9GA 1GPYA 4IIDA 3ZVRA 4MWSA 4CIBA 5EXDA 1PYGA 2HGSA 1JHOA 5EWJA 1NVGA 1A2KC 1CRPA 4Q3DA 3HXMA 5FV4A 1RAFA 1XRPA 2EJVA 3C5WP 1U7WA 2PN1A 3I4LA 3BRWA 2GD0A 4M1ZA 4Q16A 2H1RA 2V03A 2VOEA 3SQXA 1GM5A 5I8PA 5CT6A 2VHTA 4WVFA 1O8BA 2GS9A 3C3JA 3C97A 1Q1GA 3GJXC 3HDHA 2IHUA 4FOLA 4ES6A 3V1NA 4TTRA 1E2MA 2C7GA 1WU8A 2EEPA 1B00A 2JFBA 3ACDA 3GVPA 1TCUA 2WNIA 3EEQA 1PT7A 1V48A 3EH2A 4RLQA 5DKFA 1IB0A 2ZS7A 4JEIA 2TMDA 5KYUA 4ME6A 1CJCA 4N5LA 5H16A 2OCKA 2C9OA 2EIXA 2IVFA 4X95A 1Y3CE 4QECA 1U0LA 2L0XA 3MCWA 1OFHA 3S28A 4TKUA 3L1JA 2ZI3A 2ZTHA 4P08A 3ZZUA 1WKVA 2GPYA 3JASA 2QM8A 1MORA 1FVFA 1UBNA 4IDOA 5E9WA 3DHEA 4GGOA 1UOEA 2EZ4A 4HS4A 4MLPA 5LDHA 3U7QA 4DBLC 1Q22A 1PZHA 1L8XA 4QYSA 2B20A 1Z0KA 2ECQA 4V1CB 4HVTA 2AE2A 2H0RA 5EIBD 4YDQA 3GFRA 1G4AE 2FR0A 4XJSA 3VI4B 3VX4A 1H1DA 5H83A 1FFXB 2B2NA 3R3UA 1H65A 2ZRBA 4GNKA 3IEUA 4HDCA 2NU8B 2JJ2D 2DFVA 3IA7A 3DYBA 1IHXA 5C8YB 1ISSA 4EHKA 2PZLA 1GKKA 3ZHBA 3ITEA 2HTFA 4UCFA 1LDYA 4MMXB 5TJ9A 3REQB 3I64A 1CS0B 3IT0A 2C7BA 4Z54A 3PJFA 3K4PA 4XWTA 1V8OA 1X87A 3Q3JB 1CZHA 3ZXYA 2NP6A 4OQ4A 2YDXA 4EJ2A 4A6EA 4LNAA 3GAZA 4RVSA 1EBUA 4TT8A 2Y92A 4KMRA 2XMCA 4MCAA 1L5LA 4MQMA 4BQSA 2WT8A 1YI1A 4H08A 3ZHXA 2O6LA 1B6GA 2Q9UA 4DXHA 2H31A 1K4YA 4QYTA 3KJEA 1ZCJA 4YASA 1DJNA 4QWMA 2WHPA 1HM5A 3A6ZA 3ROEA 3VJLA 2DWPA 3CCFA 4A91A 3WJAA 4YAIA 2QMUA 1GNRA 3EIOA 2WB4A 4OK3A 5JWOA 3LX4A 1YJCA 2PBFA 3L7NA 1H69A 3JPYA 1GXSB 4M8NE 4PFJA 4QLAA 5E2IA 1I2MA 3MHPA 2AFRA 1GZVA 2GPWA 1RAEA 4A92A 1SBHA 4BO5A 4ASUD 3OPVA 5CBPA 4W5OA 3UHFA 3ZHCA 3H5AA 3V8EA 4URXR 3GLGA 4FYHA 1JQ5A 4KE7A 5ICFA 3EGXB 2DHEA 3F7NA 3KSMA 2MU1A 1N5RA 1XALA 1B4DA 2HTEA 3THOA 1WKBA 3KOWA 1Q11A 1K06A 3WQHA 3ZDZB 4Z99A 4LRXA 2V7QD 4GLJA 2G06A 1YVUA 4QUGA 2DHDA 3I6YA 3A3KA 2JGLA 5IKMA 2C2XA 4AURA 5A1JA 3IDOA 2AVDA 3RFVA 3RT7A 4DJEC 4YRAA 5H82A 3P5SA 1ORDA 3KYJB 3VR1A 4BVKA 2OHVA 2QV7A 4ALKA 2XUFA 1QRUA 1XK7A 1VM6A 3H2SA 3PPIA 3UATA 3H87A 3NT4A 3LLMA 4EI8A 4DW8A 1JIKA 2P9HA 1AUPA 2QIPA 4MI1A 5HX7A 2VSXA 3VR6D 3Q3CA 1BQ3A 1T5IA 4IZ6A 2NMVA 2QTHA 3GEHA 3WNZA 1RQ2A 1P3DA 3EGVA 3PLNA 3CIFA 4LI3X 3EFOB 1NFFA 1UXJA 4EENA 4FR2A 1GA6A 4TSRA 5AO9A 2FJPA 2H5JA 2IUFA 8GPBA 4A0SA 4INPA 3PYXA 5BV1A 3G9ZA 3I42A 3QUTA 4J91A 3S2YA 1IM8A 2TMGA 4KXXA 5CT4A 3UPTA 1KI6B 5A2GA 1IRXA 2J5XA 1FNDA 4N5DA 4UE6A 2IKSA 2Y71A 3SDZA 5C32A 2IU3A 1RE0A 4KO1S 1J09A 1DWQA 1V1JA 3A9UA 5LXTF 1FCJA 3CXUA 4RTQA 4LDPA 3RF6A 2ZANA 1P0IA 1Z68A 2BFAA 2I2AA 3KJGA 2ZIAA 1YVEI 4M0LA 4LUCA 4NV1A 2BGUA 2P91A 1H85A 1M2GA 1PR2A 2G71A 3TSYA 5REQA 2YS6A 3AINA 3DL0A 2OZPA 4QNNA 4MGZR 3HZHA 1QP0A 2I3DA 1BD3A 5DSZA 3MERA 3EXG2 5TS3A 4AJ2A 2ZJ0A 1SKMA 4LGCA 3VPXA 1QRTA 4CGYA 4P4SA 3RS7A 3FPJA 421PA 3O8QB 1RCTE 3UWKA 3WGTA 3HP7A 4Q3EA 3VR4A 4ZCRA 3I5MA 1KAHA 3P5BA 1UBHS 5I7HA 2C4VA 2Z4TA 3FAKA 3OZWA 1WBJB 3QKRA 1E3QA 5EXXA 2XQIA 1P2UA 1EVJA 4P4TA 3WGUA 3ETLA 3T3GA 1JDBC 1Q0SA 4LOHA 3RRMA 5CM8B 4WFQA 4PCUA 1T0JB 3NO4A 1QH9A 3LZCA 2WR8A 3DE3X 3PUYA 1RIFA 4LYEA 5AKZA 3N6RA 3ILYA 5D84A 2GNAA 4ZEWA 3JALA 3D5EA 1R5NA 3MRVA 4YWJA 1P1RA 4FOSA 2H11A 4IL5A 3R1IA 3IUYA 4I1VA 3B53X 4H6XA 3HVKA 3P4YA 2IXBA 1TF5A 2WJZB 2ZQ5A 3JARA 3O8RA 5FL3A 4L73A 1TU0A 3QSYA 2NNWB 3E03A 4LECA 1K86A 3CIOA 1E2UA 3TDMA 2ZE7A 3Q8WA 2I66A 1I4TD 1OIXA 4OK6A 4CU5A 1F8YA 1W4CA 8AT1A 1WCWA 1H6BA 3NUZA 2YNMA 3KVVA 1K4MA 3K30A 3B1KA 4LY0A 1P6XA 5EI5A 4R5HA 1FYFA 3KSAC 3NDIA 4RH0A 4X84A 1L5RA 1ES9A 3OIFA 2VCEA 5ALOA 4CETA 2ZYWX 3CLRC 3FUUA 4GW3A 4E51A 3VO2A 1U7ZA 2W83A 4NMWA 4W8HA 1EFVB 1RHQA 2WWFA 3BTOA 4EZBA 5M04A 1JWBB 3MSCA 2Q3DA 2CEKA 3H6GA 4UVHA 2CT8A 4JZKA 1I2CA 1PZEA 1RYHA 1L5OA 1Z7YA 3RLFA 3MBKA 2DQSA 1EFKA 5T8KC 1HZZA 1O9BA 4NBLA 5JS2A 1W46A 1XTUA 3DFIA 1V7QA 4TLLB 5CG2A 3KZXA 3TRFA 4AN4A 5FOTA 4RK7A 1CQXA 1E2JA 4ESVA 3LKBA 2FDXA 3I09A 1CE8B 1JLRA 3UJ7A 1SXHA 3ZJTA 2OBNA 4OIMA 4Z51A 3LL4A 1PVOA 1J8YF 1G8PA 1MZPA 4NY1A 2OLEA 4YAJA 3GT3A 1D2MA 2QTBA 3WX0A 3ZPXA 4XIIA 3U48A 3CR3C 3RT1A 3HM2A 5FTJA 5HR5A 5L51A 4KMSA 4HV4A 2JZCA 1OLSB 1UANA 2JFPA 4L9AA 3WHKA 4A03A 4CR8A 4DADA 5A4AA 1QP4A 2WU8A 2WYHA 3EIEA 5E6RA 1OE0A 1P0FA 2OXEA 4G41A 2QG9A 2VYQA 1AS0A 3GUHA 3DR5A 4UXHA 4CKBA 4MKHA 2XVMA 1ORTA 4KC0A 4XGKA 5A03A 2H4YA 2UVPB 4TSFA 2P0YA 4ZU6X 1F14A 2X6QA 3D1JA 5CCBA 2Q41A 1XCGB 2JH8A 4MS3B 2CW5A 3H5OA 1YNSA 2ZR8A 5G53C 1XZDA 2X0IA 2BHNA 2CCKA 3SYKA 4EFNA 2NU6B 2YV4A 3DONA 3QE3A 3C3KA 2COKA 3ROPA 3CG0A 3K2QA 4U8GA 2LW7A 4PINA 4QLOA 1V6AA 1R0WA 1C1XA 1QDEA 5A71A 3NBUA 1U28A 5CM9C 4J4TA 3FUVA 3NBYC 2RI0A 4HNAA 5CXXA 4I8IA 2HWYA 4B4VA 3CX8A 4FGZA 3VNBA 3L46A 1T10A 4YP1A 1CNEA 5JJCA 3PL5A 5BRNA 1F6DA 1IFXA 4Q4CA 1ODCA 1PD0A 2IYXA 2R66A 3MWDB 4LTMA 5FWDA 5IJXA 4I8XA 2W6IA 3OLVA 4L0MA 4OA8A 4G5XA 5KSWB 2PKYX 3BA1A 5DTMA 4YJGA 3GJ3A 5J5VA 1N4AA 1NE2A 2IZOA 4JB0A 2OD7A 3SSNA 3V1YA 4AG5A 5AVUA 5K0SA 5CD1A 2FPSA 3L7CA 3RW9A 1RYZA 2ZWIA 3EXIB 1KERA 3TFWA 2HFKA 3LC0A 5J40A 3SZ3A 3Q5EA 1L4MA 1L4NA 2XMPA 3EASA 2VDUE 2E55A 3EGDB 5JCJD 3HVJA 3DXFA 4W5QA 1FOEB 4C4TA 1BVUA 2R2GA 3C7CB 4JN6B 2ASEA 1GQSA 4LC0A 3SSAA 3QVLA 2EGUA 2BI4A 2ZR7A 1TVEA 1NSTA 3ROXA 5JAOA 1OJ7A 4HFRA 4UVEA 3ZLUA 2R5WA 4EKEA 1PWXA 3CNBA 2QRVA 2WM8A 1Z8DA 4HAVA 3ELBA 1XRNA 1Q1NA 4LAFA 2JLYA 3ZDYB 2MT9A 2PA0A 2R00A 1KMNA 4IGKA 4OQZA 1S9HA 3M3PA 5DGDA 2G82A 1FSZA 5K7SA 3QY0A 2BZSA 2VG8A 1P0MA 4KXMA 1XDZA 1GNQA 3M89A 1CUXA 3PB3A 1I32A 4O4JB 3T7CA 3BMCA 4DA6A 3WKEA 2BKVA 1HDYA 3G3EA 5GTDA 4IXNA 1U3FA 2QMQA 2WPNA 4JBHA 2G08A 1OJLA 1U1GA 4WZBA 1C9NA 5LP6F 3AR8A 4ZIRA 4ZOLB 2VTBB 3TVDA 1SBCA 4HNTA 4P33A 1UDRA 1XZQA 2VR1A 1W44A 2QVBA 4G1VA 3T9AA 5BN3B 2VDWA 1QE3A 5TVKA 5KQMA 1G2QA 1PG5A 3MOSA 4C9BA 5KSZA 2GERA 4E32A 4F9GA 3D3WA 3RC2A 1KJNA 2HSEA 1ABBA 2IYVA 3O2NA 1FX1A 3PDIA 1C7ZA 1N6OA 1XAJA 1DC6A 2ZXUA 5IKEA 1Y3IA 4Z7QB 3LQKA 1G7CA 3I34X 4FMPA 1B8NA 4YN3A 1R8JA 1QB8A 4O4HA 3K0BA 5CP8A 3MTJA 3QRWA 2QM7A 5CH5A 2XCRB 1KOGA 1E9CA 1K1EA 5CVTA 3K4QA 2Q29A 3AV3A 4IO0A 3OIYA 1GPNA 5ALFA 5JJ5A 1XHFA 1M1YE 1ODKA 1MQAA 1FZQA 2QVCA 3WNVA 1U7TA 4W5JA 2IV3A 5J2TB 3IOMA 1R12A 3GJ0A 1L4LA 4DIOA 7MHTA 2QT1A 1E5LA 3IVRA 3K2EA 4YMGA 4R9SA 4LXYA 1E1RA 5K8LA 1P9RA 5M5BA 2RGRA 2W2KA 2JGFA 1J0DA 1AK2A 3IUMA 2HNKA 3BHJA 4X7PA 4ARZB 2ZSAA 4YBRA 4X65B 1OA1A 2IWRA 3UK7A 1KBQA 2HPVA 4O0LA 4BJ6A 2IL1A 3WWCA 4KG7A 5FORA 3D0QA 1E2NA 5K0LA 3UMCA 4AMBA 3L0ZA 2H2FA 3QVUA 1ECBA 1RHKA 2OP1A 1NG1A 4PYOA 2IWHA 1SFRA 5KHLB 4AJ9A 2YH2A 5JH7B 4L6CA 4IGEA 4BNIA 3TSCA 4L08A 2XUKA 3AFHA 2AKYA 3JW8A 5A0VA 3OZAA 1J1IA 1QYRA 3ZHYA 3NEAA 4YRZA 1GGHA 4LDJA 4BV9A 4D0NA 1YMUA 1N0HA 2FP4B 2I3AA 1N2XA 3KAJA 2P5UA 3P9ZA 1UBEA 3W2HA 4DREA 5DLQC 1KEEB 3C5EA 4UZFA 2QENA 1KS9A 3TZLA 3MW8A 4I6JA 2J6HA 3GR6A 3ED1A 2V74B 3O5AA 2FEPA 1G2PA 1XLWA 1QE5A 3VXKA 4PZAA 4RV9A 1QANA 4MLZA 3WDLA 1DJPA 1Z38A 3OJXA 4H16A 1PW7A 2IXGA 4E5VA 2GFHA 3MGBA 1W19A 4F71A 4CIAA 3LGXA 1NOKA 3VKHA 4A23A 3TZ6A 2BGRA 2RAPA 1RI1A 1XLTA 5TARA 4GICA 2V0NA 4YMIA 3I9NA 4KXQA 3R3SA 4BFLA 3S81A 1E3JA 1TU3A 1OXVA 2QT9A 3CO5A 1IN8A 3IMFA 4HBZA 1C0IA 3CCCA 4NCXA 1NYRA 4RIEA 5I4IA 3ROTA 4MQ4A 2B6HA 4QU0A 2H2WA 2IP4A 4KQEA 1EEXB 1YL5A 1ZJ4A 5BYKA 2GF9A 4DR7B 2V58A 3QLEA 4RUKA 2QSJA 1Z2NX 1XD8A 1W36B 5IKOA 4HN9A 2NUPB 4X9XA 5KKAA 3VKVA 4JLDA 1NOIA 1G64A 4TYYA 3C7TA 3HN7A 4PZDA 4BJ5A 1I0LA 2FEWB 1H23A 3EQ6A 4JJEA 3Q0EA 5HBGA 3WJ1A 1LSJA 1QG4A 1JEYB 4TMWA 4ZHSA 3CR8A 4PLCA 3TNFA 1ZIDA 4QOIA 2NU9A 3N53A 3ZQ6A 2O6HA 3KDAA 4HFNA 1XZHA 1L7QA 4DWVA 3VAAA 1MD9A 1O0CA 5FWXB 3DD5A 4B74A 2QA5A 1VCOA 2RHJA 3TYXA 2X0EA 1EK1A 4PYNA 4MGYR 5DYTA 4PSCA 3RYIB 4TLMB 5NULA 1EX7A 3PUIA 1V1MB 4XGIA 4DIBA 2G1PA 1W5SA 1W6RA 3COWA 4IHJB 4U7FA 1EX6A 3LQFA 1A8IA 1IVSA 3NT5A 1IHPA 1MJHA 1HDEA 4F0JA 5IMBA 4NVRA 5KNDA 2F8SA 4CUJA 1SIUA 5TQVA 3WRYC 1EIZA 4TV9F 3AERB 5LA6A 1I01A 1CTQA 1DL5A 1UT8A 2BUAA 1E18A 4CCYB 1M83A 3GJRA 5JXWA 1GFSA 1VHDA 3HBLA 4LYYA 1KZ7B 1KOJA 5TDHA 4ZOQI 2JGJA 3P9CA 3ID6C 1ARZA 1PNOA 1KPIA 1OXSC 2H4XA 3GJ6A 4S0XA 2OO7A 4X63A 4DCTA 1U7HA 1Y80A 3SSMA 3WQRA 4GMFA 4P86A 1JT9A 5D5HA 1DKUA 1U0OC 2R97A 3H8WA 3Q9LA 4LRWA 2ZQZA 1ORVA 4QQNA 2BM8A 2X2EA 1S0UA 3DWFA 1FXWA 2HA6A 4GRIA 2X76A 4UEKA 4DBVO 3UOGA 2QL5A 2VPIA 3S44A 2BISA 1DT3A 4WBNA 4MVJF 4H27A 2JK0A 4TGLA 1HYEA 3NXKA 3FHCB 2L17A 2WJ6A 1PEKE 1V1RB 1N9GA 3CRQA 1WXEA 2GF2A 2NTNA 2YCLA 1ZXXA 4NFYA 4H59A 5E1MA 4HADA 1NV8A 2P6UA 1TL7C 1Q5PA 1U9JA 3LHKA 4C3ZA 3P71T 5LIRA 2NVOA 4FPXA 1VMIA 3FDZA 1NUHA 1J0EA 1SC4A 2VPZA 4PZZA 2M9MA 1Q74A 4DBLE 3PRYA 3KR1A 2ECKA 5H3LA 3EOZA 3K9CA 4BTVA 3A06A 2YWHA 1E4VA 2FOLA 2PPVA 1TNDA 4L8GA 5D8DA 2AN1A 2QX6A 3M0EA 4RH3A 4KRGA 2WWXA 1CUEA 5BV2P 1VIDA 2WUWE 1M2WA 2ERYA 2OFPA 4N0DA 10MHA 5CVVA 2XNHA 1AGNA 4H7DA 3UAXA 4D8XA 2HSWA 4HWKA 5C35A 2PL9A 2J3JA 2ID9A 4BVFA 5CU7A 3IALA 3KQNA 2H1VA 4JUDX 5DX0A 4A8JB 1Z6XA 4I7EA 1L4YA 3FKJA 4LJAA 3OZ7A 4MARA 5A05A 1XWFA 2W2LD 4DDMA 4ZICA 5A3QA 3IV9A 1Y7LA 2DBZA 4JXXA 1RAHA 2B9EA 1UPXA 2YICA 2EJCA 4RJLA 5CYPA 1MAVA 5HFAA 4C3UA 4P3OA 3D6NB 2OWEA 5L95A 5IH3A 1KMHB 4COOA 3TEJA 3IPLA 1O54A 2BGWA 1N5KA 5K20A 2D7JA 3GWGA 3TUJC 4NOLA 3S2EA 1YDWA 1LBTA 2WHYA 2WZQA 5CLHA 1P73A 2ZIXA 1BMFD 3B1YA 4A4DA 4BB5A 5IABA 5B4TA 1ZR2A 2I6XA 1W0KD 2XEDA 1AXEA 2MINA 4GR5A 4RK5A 3TNYA 4PX5A 1VLJA 4B43A 4ZCMA 5E4JA 1M6NA 5IJ0A 5HNKA 3K0FB 1WM1A 3VNSA 4LGYA 5K3OA 2VT3A 2G9RA 1B41A 1NRJB 2C2MA 2ICAA 3B82A 4WESB 4JJ4A 1PDVA 5DM2A 3ZWMA 3L40A 2FUG1 5AHOA 3O8CA 2D5BA 2XGOA 1BS2A 5DT2A 1NURA 1NC1A 3MELA 4HGZA 5BSTA 3DEJA 2LRHA 4F06A 5JSYA 4LX8A 1SOMA 1X70A 1BQEA 1VRWA 4QPJC 2G1AA 2NZ2A 3U7GA 3C7DB 4KO4S 2IYPA 3WIBA 1IATA 4DDTA 2NADA 1O89A 4L0DA 1VI5A 2VHZA 3RS2A 1KQFA 1CDOA 4CKCB 3UKOA 3A10A 3PDJA 4X7MA 1UFVA 5IPFA 1P74A 1U2GC 2D7CA 3PJDA 2ZIEA 3TLEA 2PSDA 3ADOA 4G4SP 4HHEA 1DCMA 4MWOA 2E4UA 1XJQA 4R9NA 1L5YA 3UK2A 3D02A 1U9YA 2YUIA 1C3XA 4EPWA 4QTYA 2DSNA 2WE8A 1VLLA 4EEZA 3KXIA 3BB3A 2WMYA 5ALLA 2C4KA 3U44B 3NHUA 1HO3A 3NBAA 2BI8A 5K0FA 4XM1A 4DIDA 3L0IB 3LRTA 3ZE7A 5CMLA 3VR6A 3D59A 1P2FA 1L1FA 2O50A 4F04A 4EEXA 4U7DA 4DR5B 4A7PA 4B80A 2ZGVA 4AI6A 1E96A 2TSYB 3EIXA 3HI6A 3MBOA 4GLLA 2X9QA 4ENWA 2Z2IA 2BFPA 1EGHA 4NU0A 1ZI6A 2QLFA 3R7WB 2QRPA 1WD5A 2BH9A 3F3SA 4D5GA 1MF7A 3RFFA 1SUDA 3RSQA 2R8OA 2GM3A 2JFQA 5I47A 4QJ3A 3BDVA 1FYXA 1SQ0A 4FE7A 4QASA 4S1VA 5BXYA 1SXGA 1SVKA 3PWTA 5I01A 3PJEA 1SVUA 1J2UA 5AT1A 2BMAA 3MB8A 4HYEA 1TU4A 4X85A 3N8DA 5I7WA 1E98A 5AW9A 2HZBA 1QBKC 2J4FA 4EHNA 1SCUA 4UHEA 2CK3A 1NP6A 4U0JA 5HCIA 1JB9A 2H65A 2O4UX 3EXAA 1ADCA 4QPCA 2HBYA 1A69A 1L8AA 3EW7A 3GBPA 1W2GA 3L84A 3I9FA 4OQFA 4Y67A 2YINC 5M3BA 5AK0A 3U1TA 4ABYA 3PJRA 1LX7A 3OH8A 5DCYA 4B3XA 3DYVA 3T61A 1S4MA 5LOVF 5B37A 5BQXA 5IBPA 4BMDA 3AEQA 4FB5A 1JFSA 3WTCA 1AXRA 1P19A 2AFIA 2D0OB 2JGRA 1K8YB 2YFHA 5DMXA 3SXUA 3JYPA 1UM9B 1YWGO 2GDZA 3O94A 1CDDA 3KB1A 5DGXA 5F2EA 4EJSC 3UJAA 4IHQA 3MGGA 2H7YA 1IMOA 4V0SA 4V3BA 5CDGA 3D7KA 3QJYA 2A9RA 5FXMA 4FR5A 1REQB 5LP6C 1FZTA 1LWOA 2I2WA 1L2TA 2NLOA 4K9MA 4Q1EA 5HWSA 2VRNA 3ESRA 3DSRA 5KWIA 1LZLA 2AQIA 2XD9A 4H4DA 3C15C 1B0ZA 3E82A 1OFTA 5AFSA 2CJXA 2P65A 2WWTA 4QDZA 3QVJA 3USES 3X0DA 4ZCSA 2P7HA 4OFWA 4DCUA 5INTA 3V00A 3RVPA 4P3NA 5ESRA 5F4ZA 4ZHQF 1ESNA 2JAXA 1KGDA 4F1KA 1DX6A 2PLRA 3KJZA 2R84A 5D3MB 1G63A 2ZB4A 2YFYA 5G0TA 2V1XA 1RDFA 1L7XA 2V65A 3ECCA 2XJ4A 3HKBA 3ITNA 4IRUB 4F86A 1I3KA 1QZTA 4M98A 4MKZA 1LTQA 3N75A 1TCCA 4RD2A 4KEAA 4DLBA 1ISPA 4HTFA 4HDNA 3WO1A 4O33A 5AI0A 4DV3B 2Q1SA 1ID1A 3L6DA 5J2UF 3RF7A 1NYTA 4W5WA 4DWJA 3DKKA 3N6VA 4RY2A 3SFTA 1Z2PX 3ZG6A 4IG9A 1SQ5A 2Q3CA 1MC4A 1SJ9A 4DQLA 3R9WA 2R6GA 5ELXA 2OTCA 1F12A 1I4OA 4BMVA 2C8VA 1T5LA 1UC4B 2GEDA 1SPBS 1XHEA 5CB0A 1V16B 3CF6R 4GDFA 1ORHA 2HJ9A 2NXJA 4RVNA 3QEMA 4AY6A 3KU4A 1SBIA 4LBWA 1L5VA 2FSSA 3SEFA 1NNI1 5ALQA 4B7UA 1EUDB 3OZXA 2ZYHA 3KB2A 3ZY2A 4RD4A 1OGJA 3ER6A 4L5AA 4UQPA 4BGVA 4KAFA 3WMFA 4LSMA 4ZAZA 1ODTC 3E5HA 1Y3AA 3T35A 5JO9A 3TSAA 4CR7A 2QSUA 4ZRDA 2O5EA 3NNSA 2WYVA 3FWKA 1MZVA 1JH8A 1Z7EA 1SHTX 4ZO9A 3M6FA 3RJMA 1CUWA 1CR0A 2J3IA 1G5QA 1WDTA 2ETVA 3QMVA 3SMVA 1XFDA 1SPXA 4BVHA 1R50A 3K71B 3HNOA 2QTGA 1VB5A 3IJPA 1AQYA 4J2OA 1YD7A 3L6OO 3AJ9A 5KYYA 1N2CE 2FXVA 3WHLA 4IQ8A 3NIWA 1ZEMA 5FPPA 1PQ4A 3I01M 4BLTA 4JD5A 4U39A 2J1LA 3JYLA 4BRWA 5HRAA 1QIGA 2W9XA 4M2LA 2H1IA 2PR7A 1THTA 2NXEA 3BMXA 5GOTA 5J5AA 3RROA 4BCDA 4CQMB 2XWSA 1M2EA 4BVEA 1KH1A 3W8EA 3E70C 4D4IA 2MSLA 3IQXA 4OYYA 2Y05A 4Q3OA 4OQNA 4DJDC 2HWXA 3D7RA 2PKEA 1P2SA 3PUZA 4CI9A 1VYUA 1X2BA 3H9EO 3QF4B 4P0QB 4YCLA 3DXYA 3JZFA 2WVJA 5BW6B 2BELA 3Q7EA 3RS4A 2XDQB 1XSEA 2XODA 5H02A 3WA6A 3ZJVA 4BC0A 4CMBA 2B98A 4JJZA 3FLBA 1CLUA 1ZK1A 2GZMA 5DHPA 4CEHA 3E1KA 3QWFA 1R6AA 2IW1A 5LWHA 4XWOA 1E63A 3IUNA 4Q9LA 3IBSA 1NJSA 3IX7A 4LJRA 3W5IA 1LW6E 1VG1A 1AE1A 1B2LA 3CH4B 2RK4A 4IICA 3K6SB 2O19A 1FK8A 1FSGA 1YA8A 4R8VA 1M1YB 5BOSA 1ZX1A 3RJ9A 1N1GA 1V9CA 2X9GA 2HJSA 1KSFX 4B7CA 1Q0ZA 4ZFNA 4KQKA 3OE4A 4G63A 2IIQA 3U3MA 5FA8A 4M1MA 4BMNA 3ZYCA 3KUKA 3DUWA 4XDZA 3GFBA 1RWBA 3ZDAA 3WOHA 2GNPA 2C7RA 3DDSA 3RS9A 2PO5A 5SZIA 4YY3B 5AUPB 5KDLA 4I9HA 2VJNA 5B6PA 5KX5B 4MI9A 2FR8C 1V3TA 3C3MA 3INTA 4K05A 4LRTB 1YUMA 1ZD1A 3CGGA 3ZLVA 3U4QB 3KZOA 5I6DA 4Q4JB 2L19A 2J6CA 3HTXA 3HV2A 3QZUA 4LKRA 4Q4LA 5DI3A 1A96A 3ZHRA 4BFVA 2JLRA 5LQSA 3LDUA 5C4IA 3DEAA 4BX9A 4N5IX 1U2SA 1T0UA 1X7WA 1UH5A 2GWRA 4JJ6A 4MW5A 4GI5A 2ZAYA 5AXBA 4BO8A 5K9ZA 2H7VA 4RTMA 4OHMA 4RVFA 2UYYA 5JCJA 2ZCJA 5F1KA 5BSMA 2QBYA 5FEUA 2CLSA 5D3KA 3CJQA 2OGWA 1WHSA 2I4MA 3FCYA 3W04A 1PT5A 2QUJA 1IIRA 1FTWA 1R0BA 3CXRA 4D57A 3RK0A 1ISIA 1L7MA 1H6CA 3HGMA 4Y2YA 2G4CA 1MO4A 5LKAA 1YTLA 3OIUA 3PUXA 3GLKA 1SCNE 2EP8A 1JSZA 1P1IA 2PXHA 4OB8A 1II8B 4K6OA 4RLHA 5DN6A 2AX3A 2VSOA 3B85A 3BXOA 4RSGA 2A7QA 4HRXA 4C5AA 4IJKA 2PHZA 4ZI7A 1MIHA 2XXAB 4C05A 1RMTA 3TX2A 1O5OA 2JHPA 4IGIA 3LVFO 5T4EA 2AD5A 1WXHA 3M49A 4WZZA 4QOGA 4EWLA 4KUHA 1JEQA 2ZDQA 5C34B 1FX0A 1E9AA 1OAOC 2HU2A 2PGJA 3LJKA 1DRWA 3TLGB 5IULC 2A1UB 2K2WA 3QU2A 2J0QA 1NMSA 3ER8A 1UT6A 1J97A 1ZEJA 4FNGA 4JQSA 1XTKA 4OJNA 2DE0X 2DVMA 4FCVA 3WGNA 1JX6A 5AVWA 1C3OB 3FPCA 1NXWA 1O4VA 3JQQA 4E2WA 2PRJA 5TIIA 3KYCB 4NLLA 1JVSA 3TR0A 1BW9A 2H06A 1BSVA 4TVKA 2Z1DA 1TGYA 3IJ5A 1NLFA 3ZCVA 1GRQA 2JGKA 1AK9A 2JGDA 1MRZA 2G17A 3O3MB 2F48A 1A4XA 5C5DA 3SQMA 1T3GA 2NPOA 2GJAA 1TM4E 3QNUA 1JI0A 3FTDA 3THXA 1RXIA 2CWWA 4UNNA 1O97C 2ONCA 1D09A 2J9GA 5TMBA 2JANA 4IYJA 3PVZA 4RZQA 3W90A 2IOQA 2X8LA 1IPHA 4WJLA 4KXYA 5A3JA 5JOQA 2Z5VA 2XWPA 3DTVD 3H9JA 2QRHA 1DEAA 1GR1A 1PUXA 2YV3A 4OBXA 4C6TA 4F9EA 5AW6A 2K2QB 4OYLA 3KV3O 1ABEA 2BHRA 2CZGA 2P5SA 4PSAA 1BU5A 1E92A 1NJGA 3D7MA 1Y48E 3NCHA 5EIWA 3TW0A 4B3FX 4HUTA 3TCXB 3VI3B 4JJKA 2X58A 3H2JA 5DYYA 2O3TA 3L0SA 1TK9A 2QD1A 3T4UA 1ZOIA 3LIIA 3U4HA 3G8YA 5LMNB 4E94A 2AT1A 3AGPA 4MYTA 1M6HA 3SS9X 5LUAA 1M6YA 3V8PA 1Q57A 4I50A 1MKYA 1GHTA 2PRZA 4G9EA 3IXQA 4N7MA 4BZXA 3OMXA 4PZCA 1VSVA 1WXWA 3BICA 5CT8A 2H4ZA 1JPJA 3WV5A 5BVGA 2WPDD 4G2NA 1VKOA 2JW5A 2QJFA 3BWDD 3GHHA 3LXUX 1Z4OA 3KUUA 3B6JA 1Y6ZA 3D6TB 5CD9A 4DM4A 4MA5A 1WXXA 5L7TA 4DR3B 1GG5A 1WD7A 4GIBA 2B4KA 2C95A 3Q9NA 4S1OA 1XP5A 5FBQB 3V33A 4IW3B 5JD5A 1QHHA 5CVEA 3RKRA 5IKXA 5LYJF 1H8HA 2P41A 4Q9JA 2QP9X 4TXHA 2H7CA 3H4MA 2P3SA 4JS0A 1Q95A 4URYR 4ZVVA 3E0QA 1CEQA 1SK9A 4L8YA 4PR0A 3QFSA 4KSCA 3QLTA 1EUYA 1WMFA 3A6LA 4WV3A 5A06A 3RRJA 3CW8X 1LQ2A 4IIBA 3OA2A 1RC0A 4EZIA 3D4NA 1NMXA 4P35A 2JHFA 2AK2A 5DEOA 3G2IA 1GSOA 2ZRKA 3NI2A 3SBEA 3L8ZA 4LVNA 3BCSA 1C9MA 4OAOA 3IP8A 1JSLA 3IURA 3JR3A 2YVAA 4FFBB 4II3A 2GXUA 1JB1A 1SVIA 4WKGA 1DOHA 4MW4A 5A5FA 1WEHA 2KM1A 2ZJOA 3ROMA 4YK7A 4EUFA 3ZH2A 4DMCA 1GQQA 4JFRA 3PC4A 5KTSA 2YZNA 2CBXA 2Z04A 3E18A 3G2OA 4G0ZA 3C4VA 4L5JA 1FRZA 1HLPA 1NW7A 3S99A 5KOHA 1Q20A 1QOPB 4KRXA 4QOJA 3O1JC 4UUOA 3HWRA 4WCFA 3KM0A 1E89A 5AQ1A 4U3JB 1ZM4A 4ENSA 4LVCA 1IK4A 1T2UA 3BTSA 1PLLA 2X0DA 2EOAA 4PHCA 4LSWA 1CUIA 2HLDD 5B1EA 3UMMA 3ZEAA 1N34B 4GPEA 1Z63A 4UTVA 5HTOA 2UXBB 1E4EA 2IHTA 3Q3HA 5AW4A 3AJEA 4LXXA 3KAQA 2QD2A 2VPTA 3DTYA 3GA5A 4O1IA 1Z6YA 1M5TA 2H0AA 2IEZA 2WSSD 3DMGA 3DLAA 4KPUA 4W1QA 2C4TA 2OZLB 3AVQA 3AW9A 3JWEA 4GRAA 1F0NA 4JOSA 3FYHA 4MRPA 5H3HA 5JJBA 2PT9A 2Z5FA 4R6WA 4F2GA 3D8NA 1CW2B 3H2GA 5G41A 5BWCA 5JQGF 2POQX 5FCDA 3QVWA 3CE9A 2JKZA 1Z74A 4QSMA 1OZHA 1FJGB 1CQJB 1DIGA 1RZVA 3OJWA 2YYYA 2DQZA 4G36A 4LQ4A 3UCXA 3I5XA 4CCAA 3QLUC 5F77A 4B32A 4ESEA 4PPNA 2FPOA 4GOND 3TM5A 3AFGA 1RYYA 1KSHA 2LD4A 2W7TA 4J4HA 1TAHA 1T9ZA 3A28A 3B2QA 3E61A 4X1YB 3MN1A 3ETEA 4IIUA 3QA3E 1DJMA 5H4HA 1SIOA 2ODPA 3T0IA 1Z82A 2GBFA 4EYQA 2Q6TA 4CEJA 1Z0UA 1YBHA 2CLKB 4Q3AA 2G09A 3KSZO 5U9CA 3H7AA 1VPDA 2XT0A 4RD3A 1PHPA 1RM0A 4HPWA 2OAGA 1DCFA 2JFOA 5H3CA 2AI3A 3ZWWA 4BFCA 3ZVNA 4PR3A 2OHJA 4RVGA 3KX2A 2J9RA 1YZ3A 3ORSA 2QYOA 2XB2A 4W9RA 3AUJB 3GNTA 3M81A 3V7WA 3P0IA 2CXOA 3AKYA 3H11B 3K72B 4I1SA 3UAYA 3VR5H 1CWUA 1SNYA 3VM6A 4OHKA 4C0QC 2ZTSA 1CHDA 3WGJA 3GPBA 4XYLA 2G0NA 1YGYA 1K2WA 1DTSA 4ENVA 2NN3C 2J6IA 5C1IA 4P84A 5BY2A 3NAZA 4OLBA 1EDOA 2CVOA 4MP6A 2Z09A 3OCUA 4AUEA 4WE3A 4MINA 4I4TF 2REXB 3EAFA 3ZGNA 3O03A 1OU4A 3ZDCA 1ZRNA 5IBRA 5DYWA 5AXAA 2JI6A 2H5EA 5CNKA 2HIHA 2QEQA 2HLNA 5FLXA 2PMCA 2VRWA 1Z16A 2F17A 1WZCA 4KQGA 5T4FA 4ZQBA 1QHGA 3LGAA 3GIWA 4I2VA 2QNIA 4HH3C 5JANA 1VCHA 2VHWA 1FFCA 1M1NB 1Q0TA 4MYSA 3WHPA 3O3NB 5I4BA 4DCOA 5CCEA 4JYZA 1AU9A 3BPSA 3T3NA 1FFAA 2V7TA 4H4CA 3TCKA 2XKKA 2LXNA 2V3VA 3EWIA 1COWA 1CX9B 3LUJA 3H8JA 5EE3A 4KO3S 4RE6A 5T64A 4LF9B 3ZHVA 1UINA 2LBPA 1NXVA 1SZCA 1TM5E 1LPOA 3G0DA 3GPDG 3IP3A 4KNWA 4MUYA 3CM0A 4N7BA 4JMLA 4PE5B 4UCWA 4D74A 5K45A 3P2JA 3W77A 2VJCA 5FTMA 1H9CA 1P9LA 2PG3A 1UBOS 4PHHA 4LDAA 4YRGA 1C80A 2NOAA 3EUWA 3K7EA 3R9IA 4C21A 3TH5A 1BFKA 3CNHA 4PAOA 2XTNA 3BEOA 1BMFA 5F3DA 2PCLA 3AT1A 2ZSEA 1BN7A 1V35A 4CKYA 1C1DA 1ZSVA 1VKRA 2HCBA 2QQGA 4ESOA 2KE5A 1V4VA 1N6HA 1CJVC 3E7DA 3FCXA 4N8EA 3D4PA 4U6SA 1FRQA 1T5OA 4WDQA 1R0XA 3TTSA 2VI5A 4LZZA 1SXQA 2WIFA 1NQUA 7YASA 1NNLA 2OC9A 2DTEA 1W93A 1ZQ9A 2PH3A 5GWXA 5DBEX 3IE1A 4K6MA 1KF0A 2GFIA 2I0FA 2OLKA 1LX6A 3NKLA 5EJIA 3BN3A 2Z8YA 4N5HX 3ZCQA 2ZREA 2Y1KA 1LK0A 5I7UA 4MITA 1SHJA 4EG0A 4C3VA 1L8LA 2FZEA 1G42A 1OV4A 3A4YA 4G0YA 2FPGA 2MSNA 1QAOA 4YRCA 1VGRA 4MV1A 3HKDB 4ND8B 1SM4A 1JDBB 4UHJA 5AM5A 1ORWA 4WFKA 2YASA 3HJHA 2Z8XA 3KJNA 4PCAA 2PUCA 1Z37A 3V97A 4C30A 2J0UB 3WE7A 3K8YA 5EE0A 4YAKA 1HDIA 3F90A 2I65A 1DJQA 3LUGA 3RU3A 2LV8A 3WGGA 3WI7A 1KL7A 4CM4B 1LS1A 4AMVA 4F4HA 5EJMA 4DTCA 3C24A 1P9OA 2VDKB 1XL1A 4BFYA 4GI3A 2CB9A 4UD6A 2GEBA 1CVRA 3TNLA 4B46A 1ZNXA 1FJHA 1L7EA 3P9YA 1P4GA 3HG7A 3LUFA 4X5OA 1LSSA 1Q44A 1U3VA 1QHFA 1M2OA 3IMGA 4HVCA 6YASA 3EDRA 2FN7A 3V3TA 2ID8A 4P3XA 1OPXA 2H07A 3EJ6A 3HZRA 4FD2A 2ZRQA 5JTUA 3UGTA 2Z2JA 3TPCA 1JR3D 2CVZA 5GZ1A 4JAVC 2BM9A 4CHGA 4Q47A 3L93A 2X8BA 4G0XA 2IYFA 5BT8A 1HE1C 3TTVA 3FHJA 4AWAA 2VSFA 2XGGA 3OFSA 4X1KA