1RHZB

The structure of a protein conducting channel
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
65
structure length
65
Chain Sequence
TDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a protein-conducting channel.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Protein transport
molecule keywords Preprotein translocase secY subunit
total genus 25
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 1rhzB00
1RH5B 3JC22 3MP7B 2YXRB 2YXQB 1RHZB
chains in the Genus database with same CATH superfamily
2KZIA 2OGUA 2D2CD 1NTKE 4UB8E 1PGQA 1AA0A 4WY4B 1SQQE 2B87A 2E74B 5K5GB 1IFMA 1EDIA 2R5BA 3VP8A 2Z4EA 1FOSE 1KV4A 4PV1C 1G2CB 2FYZA 1PGPA 1PP9J 2GUSA 3TYYA 1IO4A 2O01H 1GL2B 1S1CX 2NZ2A 3M0DA 1ZV8A 2C9LY 3FWLA 3C1LA 3SWFA 4GOEA 2V7QJ 1S5LX 3MUDA 3TF5A 2IBZE 1OXZA 2AXTH 2YO2A 5B5EE 1GL2C 1OX3A 1QGKB 1RF1B 1RE3C 2HLOA 2YKOA 5KLIC 1S5LH 2FFDA 1J1DB 1URQD 3R2PA 1SFCD 5CJ0A 3RGUA 3SWYA 3W67A 1SQPK 1VQ7P 1P84H 3H32A 2HR3A 2IBZG 4PD4D 3R4YA 5E79H 2AEJA 1M8OB 1JMBA 5CHXA 1URQB 2P58A 2WSEJ 5M1BA 3VMZA 2V4HA 1WT6A 1LTTC 3CC7P 1FAVA 2H88C 3RK2C 1SLQA 3K5BA 1YBKA 5AW6B 1EDJA 2KXPB 2JEEA 2NPSB 1YQ3C 4HJGH 4PJ0H 3RK3B 1IZNB 1Q82Q 2IDBA 1W5CE 3Q5RA 3VYIA 1E79H 4UB6H 3Q2YA 2A45H 1N7LA 3F5HA 1L0NJ 4GODA 1FZCA 4XFJA 1GL2D 2Y0CA 2VRSA 1ZOYC 3AEFC 1RHZB 3L74E 3V4QA 1T2KD 4U3FG 1PPJD 1L0LE 1RH5B 3HUSB 1AQ5A 1SQPD 2JWAA 3VOPA 3IR9A 1NTME 3WUVA 1P84E 1S5LE 3LW5J 2WZ7A 5AVZB 1SFCC 3HE4A 5BU8B 2BCCG 1ZXGA 2CK3H 4H0LC 1NTZK 3V2NA 4N6JA 1KB9I 2P1JA 4HYTB 3TGUJ 2OYIA 1CI6B 1J1DC 4IL6H 3CCMP 1DIPA 2FY8A 1T8ZA 2AXCA 3JSVC 3TDKA 4H44B 2ZYAA 1ZLLA 3FWNA 1VQ5P 1KC8Q 2WQYC 2HPCB 1L0ND 4K35A 1JCCA 4RO0A 4XA4A 2QIWA 1G2CA 3AE7C 2B88A 1S72P 4U3FJ 1QLED 3EWKA 2CPBA 3O6QB 1JMMA 3I5CA 4H44C 3EFGA 1JY3N 3AE9C 1JY3O 4BRYB 4EOTA 1JUNA 2Q6QA 1EQ7A 5KLIB 3PRJA 3HTKB 1BE3J 1ZP0C 2BCCJ 4JYCA 1LT9C 5AVSB 2OYIB 2O01N 4CPGA 4L75A 2ZAEB 2C0XA 2L91A 1P84I 1NTZD 2ZVOB 2B9BA 4NPFX 3M9HA 3H1KG 2M0BA 3H1IE 3H1JE 5DJUB 2WT7B 3AE2C 4H0LD 1FDMA 1KILD 2FYNB 1ZN5A 3RBXA 2C9NY 3GHGB 2QA4P 2R3SA 3D70A 3HE5B 3HD7C 2HODB 3AE1C 1J2JB 4L76A 3P8CE 3HTKA 1KN7A 2ZJSE 3L75J 4R4MA 1LJ2A 5KLVJ 1L2PA 1BGYG 1OVVA 3MGNA 3TSIA 1M1JA 1VQ8P 2YXQB 1NKZB 2NPSA 1Y47A 2IBZD 2WMMA 4ZNCA 4H44D 1G1JA 4W80A 4C7RA 2A06E 1KQSO 1NU1K 2LKMA 3BCCD 1W2BO 1N7SD 1H0TA 1IFPA 1SFCB 5GTIE 2KS1A 2PAJA 3D6ZA 2BCCE 1FZFA 4M3LA 1LP1A 4KT0J 1N86A 2HG5D 2YO3A 2YXRB 3HUSA 1M1JC 2JP3A 4LGDE 4HH2A 2FFDB 1DH3A 1KYOE 1OWAA 2JJLA 2K88A 5APTA 1SQBE 1RQUA 2N1TB 1KILC 1LTIC 2JDIH 3H1LG 1S9KD 1USEA 4WVZA 1ZW0A 1VQKP 1VQLP 2KSJA 3WU2H 3FX0A 2R3CA 1SQQD 3CPWO 2GA1A 1YYCA 1DEBA 2OYHA 2N1TC 3TNUB 1FZBA 2D2CB 2KNCA 3CX5D 1BDCA 2QJYB 1NU1D 2XNDH 4JF7A 3RBZA 1S9KE 1KD1Q 3LIEA 3SWKA 2W83C 1M56D 3M9QA 4TT3H 1S2EA 3V6IA 2WVRA 3CLQA 1L0LD 3D71A 1MKMA 1K05A 4JYBA 2QRXA 2K9JA 1Q2NA 2SPZA 4LLHA 2FXOA 3CX5E 1YI2P 3E1IA 2M5AB 3WMM0 2C0WA 1KYOH 2XV5A 1VPCA 3BCCG 4HKZH 4N78E 3ABVC 2FKWB 2XNXA 3VN0A 2LXBA 1FU1A 3Q5SA 3GLMA 2KLVA 1WMKA 2V7QH 5APSA 3V5BA 2Y0EA 2M3BA 2Q9IA 3NFQA 1HWTC 1BCCD 5TISH 1SQVJ 2WSFH 3B5NC 2KB7P 1LT9A 2Q5UA 2G8YA 3PP5A 2N1TD 2YIUB 2E75D 3B8EB 2OYHB 2ITAA 1SS1A 3H1KD 2O3JA 2H43A 5CCGC 1NTMG 3H1HD 3P8MC 1URQA 1VQNP 3H25A 2RMZA 4ZMDA 2WPQA 3H6PA 2MJZA 4W7ZA 4RJTA 1NYHA 2R44A 5AW8B 3T97A 2OYHC 1NVOA 1QVFO 2H7HA 1TU3F 2NPSD 2HYNA 4GIFA 1YJNP 1NU1G 3IF4A 3QH9A 2Q3EA 4D6TD 3RL0g 1H8AA 2QJPC 1SQBG 1BDDA 5AVRB 1VQOP 2Y0DA 3CX5I 3OJAB 1EZVI 1SQBK 3V2RA 1VF5D 1A02J 1URQC 1QX8A 4N3YB 1L0NG 1XTGB 2WSFJ 2W8ZA 5AVUB 2QJPB 3CD6P 3O8ZA 1ZMEC 1NTMJ 2E5YA 1ZRTE 4HB1A 1JEKA 4WWIA 3CXHE 1DX7A 3T97B 1YJ9P 1RF0C 3L72J 5CJ4A 5KLVE 2QJKC 3B5ND 1MZ9A 2R5DA 1JB0J 2E5TA 2E75C 1OMIA 4DJGA 4UB8H 4Y28J 3JC22 2XDJA 4GT1A 2AEFA 3KPEA 1CI6A 1GTWA 3HD7B 1K73Q 2K9YA 1SQVD 4GKGA 3H1IJ 3QWOC 1JTHB 2KOGA 2ZYDA 4DOJA 3VTPC 1AFOA 1FJPA 3KQGA 3RK3E 1LNQA 2NRGA 2P67A 1RE4A 1RF0A 3U1CA 4JBZA 1K9MQ 1CSBA 1SQPG 2A45G 5C39A 4BXLA 1VQ6P 1IFIA 2W6AA 1J1EC 1SQVE 1QL1A 2M5AA 2M8RA 3L72G 3USSA 3WUTA 1EC5A 1KMIZ 3CI9A 1MFZA 2JKVA 2K1AA 4WY4D 1AV1A 1Q81Q 3EQ2A 4C7NB 1R5LA 1BGYJ 5GTIH 1LTJB 5KAIE 3CCUP 3MZWB 1NKNA 2M3EA 1OW6A 2BCCD 2ZT9B 3G9RA 2H89C 3FGAD 2OTKE 3H1IG 3P8CD 4Y99B 3SSUA 3L36A 2FYUD 3L75E 3MTUE 4UB6E 2OQQA 5KJ7D 4BWNA 4EDFA 3CMAP 1NAYA 1DEEG 3MUDC 3PTZA 1PGJA 1FBMA 1FZAA 2WPSA 4I1LA 3CXHI 1CZQA 1NOHA 2QVAA 3HRNA 1HVVA 1BCCG 2MKVA 2WPVB 3KHUA 2P10A 1JNMA 1OVUA 3CCRP 2WTYA 1OZHA 5APUA 2I8DA 4R4LA 2IX7C 1NWQA 2G3AA 5KLVG 4ZKPA 5CBNA 1SQXG 1SQXD 4IOIH 1PP9G 5TISE 1GDTA 1GD2E 2QG4A 1NTMD 3H1HG 3H32B 1JM0A 1NTZG 2KP8A 2FXPA 5KAFH 3A0BH 1HF9A 3L73D 3GHGC 3I56P 1UIXA 1BGYE 2BASA 5KAIH 4WY4C 1LTBC 2E76C 3M91A 2N9YB 2IBZI 1GK4A 3L37A 3L70J 1OW8A 2E75B 3A0HH 2A06G 1AVYA 3AEBC 3ITKA 1VL2A 3O6QA 4N78D 4A7PA 4EI2A 1RQVA 1PIXA 2QE7H 1OW7A 3H1JG 1LTJC 1X9VA 1EDKA 1NHLA 1SQXJ 1L4AD 2AEMA 2HFED 4PD4H 3TK1A 3TGUE 3Q5PA 1GU4A 1N2DC 4Y99C 1IC2A 1NTZJ 2RN0A 4IFDK 3TNUA 2RH0A 3L71D 4RESB 1EZVE 2KNCB 1MFTA 2N1TA 3KZIH 3SFEC 1HJ0A 2CPSA 1JCDA 2FXMA 2IYOA 3JCUH 5CCHA 1YTZT 3L74J 1PPJE 4DCKA 2KIKA 2ZXEB 3BASA 1SQVG 3L72E 4H13D 5AW7B 3A5TA 3LIDA 5CBOA 2RKLA 1OIPA 1CW5A 3G71P 1RF1A 3CXHD 3KXDA 2E76D 2O01J 3GF3A 5AW1B 1EXIA 1L4AA 1N73C 4EIJA 1MV8A 4C46A 4GOFA 5KKZB 1M57D 1KB9E 4BRYA 1VQ4P 4I7ZB 1EZVG 4O9BA 5AVYB 4D6TJ 4YXWH 1BE3E 3CCVP 1HUCA 1L0NE 3KDPB 4OH8B 3PH0A 1S4XA 2JO1A 3VMXA 3PLNA 5L8RJ 4OGQB 2WPRA 3AE8C 2N9BA 2QJKB 2QM7A 1SQBJ 3HD7A 3TGUG 1L0LG 3OAKA 4L74A 1LWUB 4U3FE 4WBAA 5BU5A 2WITA 1GMJA 3H1JD 3RK2B 1IFJA 3OA7A 1OVRA 3M0DC 4AYCA 5CCGA 1MUUA 2B89A 3F89A 1K8AQ 1A02F 1AQTA 3VMAA 4EYYQ 5APQA 4AQRD 4I2LC 1FOSF 1LTSC 1USDA 1T6AA 1D7MA 1K04A 3E1RA 4KHXA 2Q7CA 3AEAC 1BE3G 1X79B 1JO5A 1ZRTD 1LGHB 1FZGA 2L5GB 1EXJA 3E7KA 1GW4A 3VP9A 1LTGC 3BCCE 5CCHD 1H89A 1ZR2A 2KSEA 3A7OA 3KZIE 1NTKD 3JCUE 2XKMA 4RKUJ 5GTHE 1N73B 2IYPA 5CCGD 3L4FA 5H2FH 1SQPJ 4MN4C 2W6BA 2HPCA 4WY4A 5APXA 1KFMA 3GF7A 1PPJG 5AW0B 3PJSK 3L75G 3UIAA 3L75D 3CWBJ 1Q7YQ 1IFDA 4ASWA 2O1KA 3GW6A 2NPSC 4GDOA 1AVOA 1VDFA 4PD4E 3Q3DA 2QM8A 3V4WA 2KUBA 2IZ0A 2K3RA 1LWUC 1SQQJ 3S4RA 1PL5A 2J58A 1ZR4A 3AEEC 1RE4C 2WT7A 1NTKJ 1YJWP 5BVZA 1FDOA 1VF5C 1NO4A 2Z5IA 1BSNA 4NPEA 3S9OA 4KJMA 2JWDA 1AJYA 2R32A 3A0BE 2YKQA 2D2CC 3HUSC 1KQGB 2I1JA 2E42A 2QJYC 5AW2B 1VF5B 1FJKA 1HGVA 3L74D 2BEZF 4JPZB 5CCHC 4PJ0E 3D6YA 2WSCJ 1JY2P 1NTKK 1HH0A 1KFNA 2WWWA 3C8VA 4H0LB 3WUUA 1DD3A 4B86A 4K3AA 3CCEP 1SQQK 1P84D 2ZYGA 3CL3D 3AEDC 3EFFK 1N7SA 5CMZA 1R8EA 3OW2O 3S1KA 1SQQG 3C9IA 3L73G 1NTKG 4PV1B 1PP9E 3ZDMA 1LTJA 2KZJA 3B71A 1SVFA 4L73A 4NPDA 4PD4I 2B87B 3L70D 3L70G 2O1JA 3AEGC 5E79E 5AVVB 3V2QA 5KJ7A 1KORA 3AE3C 1YIJP 1SQXK 1PZQA 2AXTE 5B5EH 1R5SA 3A2AA 3B4SA 3GMAA 1T3UA 3TGUD 3FXEA 1VQPP 2FBWC 3G6EP 3L71E 3CCLP 1H0TB 1U7JA 3IAOA 3H1HE 2E74D 2LXCB 1LP1B 2OYOA 2PP6A 3H1JJ 2OYIC 3U1AA 1IFNA 1M7LA 1L0NK 1RE3A 2DW3A 3BRVB 3H1HJ 1EDLA 1VQMP 2FYUG 5GTHH 4LC1A 1GW3A 2BEQD 1X0TA 3L73J 4OVNF 5AVXB 2FYUK 2PGDA 3AECC 1JY2N 1JTHA 3GG2A 5H2FE 5KJ7C 2POHA 4YPCA 3NMDA 1W2EA 1Y9BA 3BCCJ 3H1KE 5APYA 3RK2D 3B5NA 2E43A 2ZT9D 5KKZC 1NAFA 1VQ9P 3L74G 2P7JA 5TJHA 1YQ4C 5AVTB 2HODA 3CXHH 3CC4P 1HJBA 3BVHA 1KB9D 1KILE 2PFXA 1FS0E 1BSHA 4OGQC 1JY3P 1KYOI 1OFCX 2E76B 5KLVD 2IFNA 4C7NA 1T2KC 3N4XA 1Y8AA 2FYUJ 2FYNC 2KI7B 3L72D 5AW3B 4ASVA 4U3FD 1U57A 2Q1KA 1X22A 4ZKUA 2KLUA 1GU5A 3NXSA 1WRGA 2E74C 3A0HE 5APVA 4D6TG 1NU1J 2A06D 3CWBD 1RY3A 1SQBD 5EFWB 3KYQA 1SFCA 2UWJE 2XU6A 1XTCC 5AW4B 3G4SP 2H8PD 3IN6A 1FZCB 2Q3IA 3AE5C 3CC2P 3H1ID 3RK3D 1L0LJ 2P2UA 1FDIA 2W90A 2FFDC 5KAFE 3P32A 1HBWA 4I6MC 3VMYA 1L4AC 3M9BA 1N73A 2ZT9C 3CWBE 1JOCA 3MIWA 1GL2A 1YITP 1FZCC 2PRRA 3HE5A 2YNYA 1S3JA 1M1KQ 3CCQP 3BRTB 2KK7A 2Z5HA 4TLFA 5AVWB 4DT0A 2W27A 1FZEA 1HTLC 1J1EB 1NH4A 3M0AA 4IFMA 1L4AB 1X8YA 3II6A 1DD4A 2W6JH 2Y9ZA 4OGQD 4W7YA 2FYUE 1Q86Q 5KLVK 3H1LE 5AW5B 1SP4A 3L35A 1JY2O 1G1IA 3W68A 1GZLA 1KILB 2LR2A 1H88A 2GM4A 4YTPC 4H13C 5B66E 2OARA 2OTJP 3M06A 3RL0B 2IZ1A 5AW9B 1NU1E 3AE4C 4I7ZC 2K9JB 3PHLA 3V2PA 1IJDB 2KS1B 1T3JA 1LWUA 1GK6A 3H1LD 3LW5H 1E5WA 3CX5H 1SQXE 3MP7B 4WB4A 4DZOA 1M90Q 1KYOD 3HD7D 3RK3C 2K37A 3RL0C 1KQLA 4YXDC 4IL6E 2OTLP 3CWBG 2JR8A 3L73E 1KQFB 2ZVNB 1EZVD 1KTMA 3B5NB 1N7SB 3I55P 1N8RQ 1BGYD 2KYVA 2I1KA 2ZXXA 3L70E 5AVQB 1SQVK 2ZFCA 3GHGA 2GUVA 4AUWA 1QL2A 3NTNA 3H1KJ 3CMEP 1BCCE 1N7SC 4D6TE 5KTBA 1IK9A 5APWA 5B66H 2YKPA 1BCCJ 2WSEH 1IK7A 2IFMA 4U7JA 1U7MA 1PP9D 1NJIQ 2Y9YA 2YMKA 1RF1C 2YIUC 1SQPE 4Z1MH 1NGMB 1FC2C 2WSCH 3IFMA 3L71J 1BE3D 1PGOA 4IFFA 2QEXP 4OWFA 1KZUB 1M1JB 4JQ0D 3RL0D 1QVGO 3CCJP 1PFIA 3P7KA 4PV1D 1HGZA 4XE5B 1YHQP 2YMYA 1KB9H 1UIIA 3MD0A 1LT1A 1LT9B 3BATA 5DJTB 1NTZE 3SFDC 3FXDA 4H13B 3N7NA 3G3ZA 1NTMK 1QEXA 3A3YB 3Q1MA 2XZRA 3U59A 3CCSP 3H1LJ 3MHVA 1L0LK 3L71G 1YTZI 2IPPA 3WU2E 1KILA 1FE6A 2A45I 3HE4B 1PV3A 2QSIA 3AE6C 1Q90D 2J5UA 4IL6X 1Z56A 4QMAA 2J59M 1LTAC 2WSSH
chains in the Genus database with same CATH topology
1RH5B 3JC22 3MP7B 2YXRB 2YXQB 1RHZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RH5 B;  3JC2 2;  3MP7 B;  2YXR B;  2YXQ B;  1RHZ B; 
#chains in the Genus database with same CATH topology
 2KZI A;  2OGU A;  2D2C D;  1NTK E;  4UB8 E;  1PGQ A;  1AA0 A;  4WY4 B;  1SQQ E;  2B87 A;  2E74 B;  5K5G B;  1IFM A;  1EDI A;  2R5B A;  3VP8 A;  2Z4E A;  1FOS E;  1KV4 A;  4PV1 C;  1G2C B;  2FYZ A;  1PGP A;  1PP9 J;  2GUS A;  3TYY A;  1IO4 A;  2O01 H;  1GL2 B;  1S1C X;  2NZ2 A;  3M0D A;  1ZV8 A;  2C9L Y;  3FWL A;  3C1L A;  3SWF A;  4GOE A;  2V7Q J;  1S5L X;  3MUD A;  3TF5 A;  2IBZ E;  1OXZ A;  2AXT H;  2YO2 A;  5B5E E;  1GL2 C;  1OX3 A;  1QGK B;  1RF1 B;  1RE3 C;  2HLO A;  2YKO A;  5KLI C;  1S5L H;  2FFD A;  1J1D B;  1URQ D;  3R2P A;  1SFC D;  5CJ0 A;  3RGU A;  3SWY A;  3W67 A;  1SQP K;  1VQ7 P;  1P84 H;  3H32 A;  2HR3 A;  2IBZ G;  4PD4 D;  3R4Y A;  5E79 H;  2AEJ A;  1M8O B;  1JMB A;  5CHX A;  1URQ B;  2P58 A;  2WSE J;  5M1B A;  3VMZ A;  2V4H A;  1WT6 A;  1LTT C;  3CC7 P;  1FAV A;  2H88 C;  3RK2 C;  1SLQ A;  3K5B A;  1YBK A;  5AW6 B;  1EDJ A;  2KXP B;  2JEE A;  2NPS B;  1YQ3 C;  4HJG H;  4PJ0 H;  3RK3 B;  1IZN B;  1Q82 Q;  2IDB A;  1W5C E;  3Q5R A;  3VYI A;  1E79 H;  4UB6 H;  3Q2Y A;  2A45 H;  1N7L A;  3F5H A;  1L0N J;  4GOD A;  1FZC A;  4XFJ A;  1GL2 D;  2Y0C A;  2VRS A;  1ZOY C;  3AEF C;  1RHZ B;  3L74 E;  3V4Q A;  1T2K D;  4U3F G;  1PPJ D;  1L0L E;  1RH5 B;  3HUS B;  1AQ5 A;  1SQP D;  2JWA A;  3VOP A;  3IR9 A;  1NTM E;  3WUV A;  1P84 E;  1S5L E;  3LW5 J;  2WZ7 A;  5AVZ B;  1SFC C;  3HE4 A;  5BU8 B;  2BCC G;  1ZXG A;  2CK3 H;  4H0L C;  1NTZ K;  3V2N A;  4N6J A;  1KB9 I;  2P1J A;  4HYT B;  3TGU J;  2OYI A;  1CI6 B;  1J1D C;  4IL6 H;  3CCM P;  1DIP A;  2FY8 A;  1T8Z A;  2AXC A;  3JSV C;  3TDK A;  4H44 B;  2ZYA A;  1ZLL A;  3FWN A;  1VQ5 P;  1KC8 Q;  2WQY C;  2HPC B;  1L0N D;  4K35 A;  1JCC A;  4RO0 A;  4XA4 A;  2QIW A;  1G2C A;  3AE7 C;  2B88 A;  1S72 P;  4U3F J;  1QLE D;  3EWK A;  2CPB A;  3O6Q B;  1JMM A;  3I5C A;  4H44 C;  3EFG A;  1JY3 N;  3AE9 C;  1JY3 O;  4BRY B;  4EOT A;  1JUN A;  2Q6Q A;  1EQ7 A;  5KLI B;  3PRJ A;  3HTK B;  1BE3 J;  1ZP0 C;  2BCC J;  4JYC A;  1LT9 C;  5AVS B;  2OYI B;  2O01 N;  4CPG A;  4L75 A;  2ZAE B;  2C0X A;  2L91 A;  1P84 I;  1NTZ D;  2ZVO B;  2B9B A;  4NPF X;  3M9H A;  3H1K G;  2M0B A;  3H1I E;  3H1J E;  5DJU B;  2WT7 B;  3AE2 C;  4H0L D;  1FDM A;  1KIL D;  2FYN B;  1ZN5 A;  3RBX A;  2C9N Y;  3GHG B;  2QA4 P;  2R3S A;  3D70 A;  3HE5 B;  3HD7 C;  2HOD B;  3AE1 C;  1J2J B;  4L76 A;  3P8C E;  3HTK A;  1KN7 A;  2ZJS E;  3L75 J;  4R4M A;  1LJ2 A;  5KLV J;  1L2P A;  1BGY G;  1OVV A;  3MGN A;  3TSI A;  1M1J A;  1VQ8 P;  2YXQ B;  1NKZ B;  2NPS A;  1Y47 A;  2IBZ D;  2WMM A;  4ZNC A;  4H44 D;  1G1J A;  4W80 A;  4C7R A;  2A06 E;  1KQS O;  1NU1 K;  2LKM A;  3BCC D;  1W2B O;  1N7S D;  1H0T A;  1IFP A;  1SFC B;  5GTI E;  2KS1 A;  2PAJ A;  3D6Z A;  2BCC E;  1FZF A;  4M3L A;  1LP1 A;  4KT0 J;  1N86 A;  2HG5 D;  2YO3 A;  2YXR B;  3HUS A;  1M1J C;  2JP3 A;  4LGD E;  4HH2 A;  2FFD B;  1DH3 A;  1KYO E;  1OWA A;  2JJL A;  2K88 A;  5APT A;  1SQB E;  1RQU A;  2N1T B;  1KIL C;  1LTI C;  2JDI H;  3H1L G;  1S9K D;  1USE A;  4WVZ A;  1ZW0 A;  1VQK P;  1VQL P;  2KSJ A;  3WU2 H;  3FX0 A;  2R3C A;  1SQQ D;  3CPW O;  2GA1 A;  1YYC A;  1DEB A;  2OYH A;  2N1T C;  3TNU B;  1FZB A;  2D2C B;  2KNC A;  3CX5 D;  1BDC A;  2QJY B;  1NU1 D;  2XND H;  4JF7 A;  3RBZ A;  1S9K E;  1KD1 Q;  3LIE A;  3SWK A;  2W83 C;  1M56 D;  3M9Q A;  4TT3 H;  1S2E A;  3V6I A;  2WVR A;  3CLQ A;  1L0L D;  3D71 A;  1MKM A;  1K05 A;  4JYB A;  2QRX A;  2K9J A;  1Q2N A;  2SPZ A;  4LLH A;  2FXO A;  3CX5 E;  1YI2 P;  3E1I A;  2M5A B;  3WMM 0;  2C0W A;  1KYO H;  2XV5 A;  1VPC A;  3BCC G;  4HKZ H;  4N78 E;  3ABV C;  2FKW B;  2XNX A;  3VN0 A;  2LXB A;  1FU1 A;  3Q5S A;  3GLM A;  2KLV A;  1WMK A;  2V7Q H;  5APS A;  3V5B A;  2Y0E A;  2M3B A;  2Q9I A;  3NFQ A;  1HWT C;  1BCC D;  5TIS H;  1SQV J;  2WSF H;  3B5N C;  2KB7 P;  1LT9 A;  2Q5U A;  2G8Y A;  3PP5 A;  2N1T D;  2YIU B;  2E75 D;  3B8E B;  2OYH B;  2ITA A;  1SS1 A;  3H1K D;  2O3J A;  2H43 A;  5CCG C;  1NTM G;  3H1H D;  3P8M C;  1URQ A;  1VQN P;  3H25 A;  2RMZ A;  4ZMD A;  2WPQ A;  3H6P A;  2MJZ A;  4W7Z A;  4RJT A;  1NYH A;  2R44 A;  5AW8 B;  3T97 A;  2OYH C;  1NVO A;  1QVF O;  2H7H A;  1TU3 F;  2NPS D;  2HYN A;  4GIF A;  1YJN P;  1NU1 G;  3IF4 A;  3QH9 A;  2Q3E A;  4D6T D;  3RL0 g;  1H8A A;  2QJP C;  1SQB G;  1BDD A;  5AVR B;  1VQO P;  2Y0D A;  3CX5 I;  3OJA B;  1EZV I;  1SQB K;  3V2R A;  1VF5 D;  1A02 J;  1URQ C;  1QX8 A;  4N3Y B;  1L0N G;  1XTG B;  2WSF J;  2W8Z A;  5AVU B;  2QJP B;  3CD6 P;  3O8Z A;  1ZME C;  1NTM J;  2E5Y A;  1ZRT E;  4HB1 A;  1JEK A;  4WWI A;  3CXH E;  1DX7 A;  3T97 B;  1YJ9 P;  1RF0 C;  3L72 J;  5CJ4 A;  5KLV E;  2QJK C;  3B5N D;  1MZ9 A;  2R5D A;  1JB0 J;  2E5T A;  2E75 C;  1OMI A;  4DJG A;  4UB8 H;  4Y28 J;  3JC2 2;  2XDJ A;  4GT1 A;  2AEF A;  3KPE A;  1CI6 A;  1GTW A;  3HD7 B;  1K73 Q;  2K9Y A;  1SQV D;  4GKG A;  3H1I J;  3QWO C;  1JTH B;  2KOG A;  2ZYD A;  4DOJ A;  3VTP C;  1AFO A;  1FJP A;  3KQG A;  3RK3 E;  1LNQ A;  2NRG A;  2P67 A;  1RE4 A;  1RF0 A;  3U1C A;  4JBZ A;  1K9M Q;  1CSB A;  1SQP G;  2A45 G;  5C39 A;  4BXL A;  1VQ6 P;  1IFI A;  2W6A A;  1J1E C;  1SQV E;  1QL1 A;  2M5A A;  2M8R A;  3L72 G;  3USS A;  3WUT A;  1EC5 A;  1KMI Z;  3CI9 A;  1MFZ A;  2JKV A;  2K1A A;  4WY4 D;  1AV1 A;  1Q81 Q;  3EQ2 A;  4C7N B;  1R5L A;  1BGY J;  5GTI H;  1LTJ B;  5KAI E;  3CCU P;  3MZW B;  1NKN A;  2M3E A;  1OW6 A;  2BCC D;  2ZT9 B;  3G9R A;  2H89 C;  3FGA D;  2OTK E;  3H1I G;  3P8C D;  4Y99 B;  3SSU A;  3L36 A;  2FYU D;  3L75 E;  3MTU E;  4UB6 E;  2OQQ A;  5KJ7 D;  4BWN A;  4EDF A;  3CMA P;  1NAY A;  1DEE G;  3MUD C;  3PTZ A;  1PGJ A;  1FBM A;  1FZA A;  2WPS A;  4I1L A;  3CXH I;  1CZQ A;  1NOH A;  2QVA A;  3HRN A;  1HVV A;  1BCC G;  2MKV A;  2WPV B;  3KHU A;  2P10 A;  1JNM A;  1OVU A;  3CCR P;  2WTY A;  1OZH A;  5APU A;  2I8D A;  4R4L A;  2IX7 C;  1NWQ A;  2G3A A;  5KLV G;  4ZKP A;  5CBN A;  1SQX G;  1SQX D;  4IOI H;  1PP9 G;  5TIS E;  1GDT A;  1GD2 E;  2QG4 A;  1NTM D;  3H1H G;  3H32 B;  1JM0 A;  1NTZ G;  2KP8 A;  2FXP A;  5KAF H;  3A0B H;  1HF9 A;  3L73 D;  3GHG C;  3I56 P;  1UIX A;  1BGY E;  2BAS A;  5KAI H;  4WY4 C;  1LTB C;  2E76 C;  3M91 A;  2N9Y B;  2IBZ I;  1GK4 A;  3L37 A;  3L70 J;  1OW8 A;  2E75 B;  3A0H H;  2A06 G;  1AVY A;  3AEB C;  3ITK A;  1VL2 A;  3O6Q A;  4N78 D;  4A7P A;  4EI2 A;  1RQV A;  1PIX A;  2QE7 H;  1OW7 A;  3H1J G;  1LTJ C;  1X9V A;  1EDK A;  1NHL A;  1SQX J;  1L4A D;  2AEM A;  2HFE D;  4PD4 H;  3TK1 A;  3TGU E;  3Q5P A;  1GU4 A;  1N2D C;  4Y99 C;  1IC2 A;  1NTZ J;  2RN0 A;  4IFD K;  3TNU A;  2RH0 A;  3L71 D;  4RES B;  1EZV E;  2KNC B;  1MFT A;  2N1T A;  3KZI H;  3SFE C;  1HJ0 A;  2CPS A;  1JCD A;  2FXM A;  2IYO A;  3JCU H;  5CCH A;  1YTZ T;  3L74 J;  1PPJ E;  4DCK A;  2KIK A;  2ZXE B;  3BAS A;  1SQV G;  3L72 E;  4H13 D;  5AW7 B;  3A5T A;  3LID A;  5CBO A;  2RKL A;  1OIP A;  1CW5 A;  3G71 P;  1RF1 A;  3CXH D;  3KXD A;  2E76 D;  2O01 J;  3GF3 A;  5AW1 B;  1EXI A;  1L4A A;  1N73 C;  4EIJ A;  1MV8 A;  4C46 A;  4GOF A;  5KKZ B;  1M57 D;  1KB9 E;  4BRY A;  1VQ4 P;  4I7Z B;  1EZV G;  4O9B A;  5AVY B;  4D6T J;  4YXW H;  1BE3 E;  3CCV P;  1HUC A;  1L0N E;  3KDP B;  4OH8 B;  3PH0 A;  1S4X A;  2JO1 A;  3VMX A;  3PLN A;  5L8R J;  4OGQ B;  2WPR A;  3AE8 C;  2N9B A;  2QJK B;  2QM7 A;  1SQB J;  3HD7 A;  3TGU G;  1L0L G;  3OAK A;  4L74 A;  1LWU B;  4U3F E;  4WBA A;  5BU5 A;  2WIT A;  1GMJ A;  3H1J D;  3RK2 B;  1IFJ A;  3OA7 A;  1OVR A;  3M0D C;  4AYC A;  5CCG A;  1MUU A;  2B89 A;  3F89 A;  1K8A Q;  1A02 F;  1AQT A;  3VMA A;  4EYY Q;  5APQ A;  4AQR D;  4I2L C;  1FOS F;  1LTS C;  1USD A;  1T6A A;  1D7M A;  1K04 A;  3E1R A;  4KHX A;  2Q7C A;  3AEA C;  1BE3 G;  1X79 B;  1JO5 A;  1ZRT D;  1LGH B;  1FZG A;  2L5G B;  1EXJ A;  3E7K A;  1GW4 A;  3VP9 A;  1LTG C;  3BCC E;  5CCH D;  1H89 A;  1ZR2 A;  2KSE A;  3A7O A;  3KZI E;  1NTK D;  3JCU E;  2XKM A;  4RKU J;  5GTH E;  1N73 B;  2IYP A;  5CCG D;  3L4F A;  5H2F H;  1SQP J;  4MN4 C;  2W6B A;  2HPC A;  4WY4 A;  5APX A;  1KFM A;  3GF7 A;  1PPJ G;  5AW0 B;  3PJS K;  3L75 G;  3UIA A;  3L75 D;  3CWB J;  1Q7Y Q;  1IFD A;  4ASW A;  2O1K A;  3GW6 A;  2NPS C;  4GDO A;  1AVO A;  1VDF A;  4PD4 E;  3Q3D A;  2QM8 A;  3V4W A;  2KUB A;  2IZ0 A;  2K3R A;  1LWU C;  1SQQ J;  3S4R A;  1PL5 A;  2J58 A;  1ZR4 A;  3AEE C;  1RE4 C;  2WT7 A;  1NTK J;  1YJW P;  5BVZ A;  1FDO A;  1VF5 C;  1NO4 A;  2Z5I A;  1BSN A;  4NPE A;  3S9O A;  4KJM A;  2JWD A;  1AJY A;  2R32 A;  3A0B E;  2YKQ A;  2D2C C;  3HUS C;  1KQG B;  2I1J A;  2E42 A;  2QJY C;  5AW2 B;  1VF5 B;  1FJK A;  1HGV A;  3L74 D;  2BEZ F;  4JPZ B;  5CCH C;  4PJ0 E;  3D6Y A;  2WSC J;  1JY2 P;  1NTK K;  1HH0 A;  1KFN A;  2WWW A;  3C8V A;  4H0L B;  3WUU A;  1DD3 A;  4B86 A;  4K3A A;  3CCE P;  1SQQ K;  1P84 D;  2ZYG A;  3CL3 D;  3AED C;  3EFF K;  1N7S A;  5CMZ A;  1R8E A;  3OW2 O;  3S1K A;  1SQQ G;  3C9I A;  3L73 G;  1NTK G;  4PV1 B;  1PP9 E;  3ZDM A;  1LTJ A;  2KZJ A;  3B71 A;  1SVF A;  4L73 A;  4NPD A;  4PD4 I;  2B87 B;  3L70 D;  3L70 G;  2O1J A;  3AEG C;  5E79 E;  5AVV B;  3V2Q A;  5KJ7 A;  1KOR A;  3AE3 C;  1YIJ P;  1SQX K;  1PZQ A;  2AXT E;  5B5E H;  1R5S A;  3A2A A;  3B4S A;  3GMA A;  1T3U A;  3TGU D;  3FXE A;  1VQP P;  2FBW C;  3G6E P;  3L71 E;  3CCL P;  1H0T B;  1U7J A;  3IAO A;  3H1H E;  2E74 D;  2LXC B;  1LP1 B;  2OYO A;  2PP6 A;  3H1J J;  2OYI C;  3U1A A;  1IFN A;  1M7L A;  1L0N K;  1RE3 A;  2DW3 A;  3BRV B;  3H1H J;  1EDL A;  1VQM P;  2FYU G;  5GTH H;  4LC1 A;  1GW3 A;  2BEQ D;  1X0T A;  3L73 J;  4OVN F;  5AVX B;  2FYU K;  2PGD A;  3AEC C;  1JY2 N;  1JTH A;  3GG2 A;  5H2F E;  5KJ7 C;  2POH A;  4YPC A;  3NMD A;  1W2E A;  1Y9B A;  3BCC J;  3H1K E;  5APY A;  3RK2 D;  3B5N A;  2E43 A;  2ZT9 D;  5KKZ C;  1NAF A;  1VQ9 P;  3L74 G;  2P7J A;  5TJH A;  1YQ4 C;  5AVT B;  2HOD A;  3CXH H;  3CC4 P;  1HJB A;  3BVH A;  1KB9 D;  1KIL E;  2PFX A;  1FS0 E;  1BSH A;  4OGQ C;  1JY3 P;  1KYO I;  1OFC X;  2E76 B;  5KLV D;  2IFN A;  4C7N A;  1T2K C;  3N4X A;  1Y8A A;  2FYU J;  2FYN C;  2KI7 B;  3L72 D;  5AW3 B;  4ASV A;  4U3F D;  1U57 A;  2Q1K A;  1X22 A;  4ZKU A;  2KLU A;  1GU5 A;  3NXS A;  1WRG A;  2E74 C;  3A0H E;  5APV A;  4D6T G;  1NU1 J;  2A06 D;  3CWB D;  1RY3 A;  1SQB D;  5EFW B;  3KYQ A;  1SFC A;  2UWJ E;  2XU6 A;  1XTC C;  5AW4 B;  3G4S P;  2H8P D;  3IN6 A;  1FZC B;  2Q3I A;  3AE5 C;  3CC2 P;  3H1I D;  3RK3 D;  1L0L J;  2P2U A;  1FDI A;  2W90 A;  2FFD C;  5KAF E;  3P32 A;  1HBW A;  4I6M C;  3VMY A;  1L4A C;  3M9B A;  1N73 A;  2ZT9 C;  3CWB E;  1JOC A;  3MIW A;  1GL2 A;  1YIT P;  1FZC C;  2PRR A;  3HE5 A;  2YNY A;  1S3J A;  1M1K Q;  3CCQ P;  3BRT B;  2KK7 A;  2Z5H A;  4TLF A;  5AVW B;  4DT0 A;  2W27 A;  1FZE A;  1HTL C;  1J1E B;  1NH4 A;  3M0A A;  4IFM A;  1L4A B;  1X8Y A;  3II6 A;  1DD4 A;  2W6J H;  2Y9Z A;  4OGQ D;  4W7Y A;  2FYU E;  1Q86 Q;  5KLV K;  3H1L E;  5AW5 B;  1SP4 A;  3L35 A;  1JY2 O;  1G1I A;  3W68 A;  1GZL A;  1KIL B;  2LR2 A;  1H88 A;  2GM4 A;  4YTP C;  4H13 C;  5B66 E;  2OAR A;  2OTJ P;  3M06 A;  3RL0 B;  2IZ1 A;  5AW9 B;  1NU1 E;  3AE4 C;  4I7Z C;  2K9J B;  3PHL A;  3V2P A;  1IJD B;  2KS1 B;  1T3J A;  1LWU A;  1GK6 A;  3H1L D;  3LW5 H;  1E5W A;  3CX5 H;  1SQX E;  3MP7 B;  4WB4 A;  4DZO A;  1M90 Q;  1KYO D;  3HD7 D;  3RK3 C;  2K37 A;  3RL0 C;  1KQL A;  4YXD C;  4IL6 E;  2OTL P;  3CWB G;  2JR8 A;  3L73 E;  1KQF B;  2ZVN B;  1EZV D;  1KTM A;  3B5N B;  1N7S B;  3I55 P;  1N8R Q;  1BGY D;  2KYV A;  2I1K A;  2ZXX A;  3L70 E;  5AVQ B;  1SQV K;  2ZFC A;  3GHG A;  2GUV A;  4AUW A;  1QL2 A;  3NTN A;  3H1K J;  3CME P;  1BCC E;  1N7S C;  4D6T E;  5KTB A;  1IK9 A;  5APW A;  5B66 H;  2YKP A;  1BCC J;  2WSE H;  1IK7 A;  2IFM A;  4U7J A;  1U7M A;  1PP9 D;  1NJI Q;  2Y9Y A;  2YMK A;  1RF1 C;  2YIU C;  1SQP E;  4Z1M H;  1NGM B;  1FC2 C;  2WSC H;  3IFM A;  3L71 J;  1BE3 D;  1PGO A;  4IFF A;  2QEX P;  4OWF A;  1KZU B;  1M1J B;  4JQ0 D;  3RL0 D;  1QVG O;  3CCJ P;  1PFI A;  3P7K A;  4PV1 D;  1HGZ A;  4XE5 B;  1YHQ P;  2YMY A;  1KB9 H;  1UII A;  3MD0 A;  1LT1 A;  1LT9 B;  3BAT A;  5DJT B;  1NTZ E;  3SFD C;  3FXD A;  4H13 B;  3N7N A;  3G3Z A;  1NTM K;  1QEX A;  3A3Y B;  3Q1M A;  2XZR A;  3U59 A;  3CCS P;  3H1L J;  3MHV A;  1L0L K;  3L71 G;  1YTZ I;  2IPP A;  3WU2 E;  1KIL A;  1FE6 A;  2A45 I;  3HE4 B;  1PV3 A;  2QSI A;  3AE6 C;  1Q90 D;  2J5U A;  4IL6 X;  1Z56 A;  4QMA A;  2J59 M;  1LTA C;  2WSS H; 
#chains in the Genus database with same CATH homology
 1RH5 B;  3JC2 2;  3MP7 B;  2YXR B;  2YXQ B;  1RHZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...