1RI1A

Structure and mechanism of mrna cap (guanine n-7) methyltransferase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
252
structure length
252
Chain Sequence
b'SKTINIRNANNFIKACLIRLYTKRGDSVLDLGCGKGGDLLKYERAGIGEYYGVDIAEVSINDARVRARNMKRRFKVFFRAQDSYGRHMDLGKEFDVISSQFSFHYAFSTSESLDIAQRNIARHLRPGGYFIMTVPSRDVILERYKQGRMSNDFYKIELEKMEDVPMESVREYRFTLLDSVNNCIEYFVDFTRMVDGFKRLGLSLVERKGFIDFYEDEGRRNPELSKKMGLGCLTREESEVVGIYEVVVFRKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA CAPPING ENZYME
publication title Structure and mechanism of mRNA cap (Guanine-n7) methyltransferase
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transferase
total genus 84
structure length 252
sequence length 252
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2003-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03291 Pox_MCEL mRNA capping enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ri1A00
3B7PA 5EKXA 3S68A 2IBSA 3G5TA 3KQSA 4HG2A 1KPIA 4A6EA 2WA1A 3OZTA 5K01A 5H02A 2WA2A 2FPOA 4DCGA 10MHA 1KXZA 2ZWVA 5CCBA 5GM2A 3SX0A 1XCLA 3ANXA 1HMYA 3MCTA 1NW3A 2P8JA 3FTFA 3ELYA 5LQKA 3EMBA 2EJTA 2P35A 4X60A 3T7TA 3BGVA 3F4KA 3LKZA 1P39A 1NW6A 2PX5A 3O7WA 3MGGA 1BC5A 3QV2A 3M4XA 4PYKA 3P9KA 4PYQA 4C4AA 2GH1A 1SUSA 3MQ2A 2BM9A 1KYZA 3FRHA 4IKPA 5EPEA 4DF3A 2K4MA 3KKZA 1YUBA 4KIGA 4LECA 5BW4A 2YR0A 3UBTA 2C7OA 1L1EA 2YUIA 2UYOA 3SM3A 5GP1A 1QZZA 4C03A 3FPHA 4B17A 2GAFA 2ESRA 2FRXA 2BR3A 2P40A 1MJFA 4M38A 3TLJA 3FTCA 1O9GA 3BWCA 5EOVA 1UFKA 3UJ9A 5E9QA 5DM2A 2I62A 3KQVA 5K0LA 5E2AA 3THSA 1TW3A 3T0IA 3G5LA 4GOMD 5K05A 5K0BA 5LQNA 3GXOA 3LECA 5EIFA 1G60A 3B3FA 1JG2A 4XUCA 5T64A 2XVMA 2P3OA 5ICFA 3BGDA 3TM5A 4ER5A 5EGSA 1RJEA 4HGYA 1NBHA 3HA3A 3LHDA 1KYWA 4C04A 4PCAA 4F84A 2NYUA 1R6AA 2Y1XA 1NT2A 4ER7A 3LBFA 5HOQA 4HC4A 3SGLA 2EG5A 4DM3A 2H1RA 2FYTA 4IV0A 5DM4A 5KVAA 5CM2Z 3PFGA 4YUZA 2PX8A 3LKDA 2YXDA 4K6MA 2E5WA 2EX4A 3DP7A 3LPMA 5E9JA 3UA4A 5DSTA 4OQDA 4GC9A 2IP2A 5DXJA 2OYRA 4EKIA 5FA8A 4E2YA 4YV2A 4U7TB 1RI3A 4ATNA 3VYWA 4ER0A 4PCLA 4HGZA 5FQOA 4E30A 1WS6A 4LWPA 2PY6A 2XYQA 3FUUA 5HILA 3NVKI 3NMUF 3SSMA 4E31A 1WG8A 4NECA 3T7RA 2OZVA 5JUWA 1IXKA 1RI5A 3HA5A 4GBED 1FP1D 1QANA 3LCCA 3M6XA 2G1PA 1EAMA 2IPXA 3EVCA 3FUXA 3HCAA 4AZSA 5CVJA 3ERCA 1NW7A 4XUDA 3A25A 3KQPA 2ZIGA 4P7GA 3OE4A 5FQNA 4CXMA 5DM0A 3BKWA 2YXEA 3FPFA 1L9KA 3EGVA 2ZULA 3NDJA 4HH4A 5DX1A 3TRKA 3UFBA 3NDIA 4KRGA 2PX2A 3C3YA 3RODA 3M6WA 4EMSA 3OFJA 5DX0A 2I9KA 4OX9Y 1Q0SA 1D2HA 5CD1A 3BWMA 3E23A 2VP3A 1DCTA 5EMLA 3B3GA 4FT4A 1U2ZA 4HSGA 3B89A 3PT9A 1ZGAA 1WY7A 1XTPA 5HEKA 4RTNA 2ZVJA 1Y8CA 1SQGA 5ICCA 3FPJA 5ERGB 3P9CA 5DXAA 2AOVA 4BLWA 2JHPA 4PWYA 3FRIA 4GC5A 3G2OA 2BZGA 3KPYA 3D2LA 4PGHA 5F2NA 1PJZA 3FZGA 3TR6A 1NBIA 3P2IA 2OY0A 5EIWA 5GINE 4L7VA 3TKYA 1P91A 5CIYA 3A4TA 3A7DA 3T7SA 4KWCA 4GEKA 2P1DA 4LWOA 4P7FA 2IH5A 2ZZNA 1QYRA 1ZKDA 2CMHA 2R3SA 2NXJA 2PVCA 5E8RA 2O06A 2ZZKA 2AVDA 1JR4A 3UJCA 2VDWA 4DA4A 5G02A 3WSTA 1L3BA 5DT2A 3UJBA 1XXLA 2AOWA 4C05A 2IH4A 2I6GA 3GJYA 3UJ8A 5K0EA 3C3PA 3DXXA 3PTAA 4RYLA 1I9GA 3I64A 4QTUB 2JJQA 1X1BA 1H1DA 4R6XA 2GA9A 1ORHA 4C06A 2JHCA 1FBNA 4RTMA 4ER3A 5GIOE 5KYGA 2IIPA 1I1NA 1AV6A 3B3JA 3KR2A 3BKXA 3BXOA 1IY9A 3A26A 3JWGA 4RVDA 1R8YA 3G2PA 3LSTA 2HMYB 5LR6A 3E7PA 2PKWA 1O54A 4RSRA 5C0OE 1YB2A 4BP1A 4RTKA 3GCZA 2C7RA 3KPUA 2AVNA 5C9ZA 4PYLA 5K0GA 5E1MA 2FK7A 1I4WA 3DXYA 3R3HA 4HTFA 5CCXA 3HA7A 1AQIA 1D2GA 3HCCA 4WXHA 5E1BA 5EEHA 2AOTA 2CKDA 4CKCA 1WZNA 3M6VA 3OZSA 4HTFB 5D1HA 2A14A 3EVFA 2ONZA 2N47A 2P41A 2PXCA 3KQOA 4MIKA 3DMHA 1L3IA 1TPYA 3MB5A 5HIJA 2NP7A 5K0FA 3LX6A 3ORHA 2AOTB 1JQEA 2HV9A 1EJ0A 5FA5A 2AN3A 5EEGA 4RVFA 5FULA 3GRZA 5EQJB 2JH9A 4BP3A 2VZ9A 2G72A 3EEYA 3KPWA 2F8LA 2UYQA 3C6MA 2H00A 4E2ZA 4EK9A 5EMJA 1JQDA 2NXEA 2ONYA 2OO3A 3KQWA 4GOND 3UWPA 1KIAA 1XDUA 2OB1A 3EMDA 1F3LA 1N2XA 2B2CA 2P3LA 3DUWA 4G56A 4X61A 5F2KA 3KQQA 4POOA 1L3CA 4FSDA 4ISCA 3SSOA 1FPQA 1JSZA 3IV6A 4RV9A 4KDCA 1D2CA 2I7CA 4KIFA 3P71T 5ICGA 3EVDA 1MHTA 5U4XA 2PLWA 4PYJA 1NW8A 2V7EA 3CVOA 3VC1A 4QDJA 3DMGA 3E05A 3O4FA 2ADMA 1BOOA 1WXWA 2KW5A 2PT9A 4PYNA 4MWZA 3NTVA 1QAMA 5EHGA 3OCJA 3VSEA 3CBGA 1R74A 3LCVB 3G88A 1XDZA 3DR5A 2P7IA 3CKKA 2XBMA 5HZMA 4BLUA 4RTQA 4RTSA 3ELDA 3KQMA 3FYCA 5E1DA 2QRVA 1G55A 4FR0A 1KPGA 2NXNA 3M6UA 1F38A 4QDKA 5EMMA 3HTXA 5CVUA 4FZVA 4O29A 3B5IA 3GDHA 3I9FA 3SR4A 1KPHA 2QRVB 1JTEA 1VE3A 1NW5A 3HM2A 2UZ4A 3L8DA 1R00A 1M6YA 3PS9A 3KQYA 5KQRA 5LQRA 1V39A 4OBWA 4Y30A 2G71A 3ID6C 5B1SA 2IBTA 3QOXA 1X19A 4P7JA 3MHTA 2ZIEA 1RI4A 3TFWA 4EQZA 1Z3CA 3ME5A 2AR0A 3BUSA 4R6WA 5EG5A 5FTWA 4YUWA 2NNWB 1XCJA 3NVMB 4A6DA 3UJ7A 3G89A 3GGDA 5K0NA 5LQAA 4QVKA 4YUYA 1NV9A 3R9XB 3EVBA 3OPNA 5DX8A 1BHJA 5DM1A 4AZWA 3HVIA 3EEOA 5CVVA 4OQEA 5DRTA 4R8SA 3HCDA 4YUXA 5M5BA 2CWWA 2YX1A 2UYCA 2PX4A 1JSXA 4R8RA 3ER8A 3GRVA 4X41A 3OU7A 5KS2A 1O9HA 3HCBA 1VIDA 3R6TA 4XUEA 3LL7A 1AQJA 1TW2A 2OXTA 1KP9A 4Z2YA 4FS8A 3CJQA 3DXZA 3LCUA 4RTPA 4YMHA 2PSSA 2ZBRA 4RX1A 3EGIA 3VC2A 4PNEA 1KHHA 3G8BA 2PGXA 1YZHA 3K0BA 1JG1A 4AX8A 5EMKA 3G8AA 2HTEA 3P9NA 1INLA 5E2BA 3RW9A 1XJ5A 2PBFA 5DTQA 3SXJA 2BR4A 3GU3A 4QQKA 5EC8A 2BM8A 4CTKA 3HP7A 3IEIA 3PX3A 5MHTA 1SVUA 3NW9A 3GO4A 3PVCA 2PV0A 4OA8A 4BY9E 3NWBA 1JG4A 1NE2A 3LDUA 3MTIA 4PINA 2BH2A 1T43A 2AZTA 1VPTA 3BWBA 1QAOA 3HCFA 4V0QA 3BT7A 1EG2A 5BP7A 3LBYA 1EQAA 2O05A 4OA5A 2JH8A 3GRUA 1DL5A 3SVZA 4C07A 5IKMA 1VLMA 3TOSA 5HIMA 3PX2A 3CC8A 3QOWA 3EVEA 1Q0TA 5FHRA 3P8ZA 3AY0A 3CGGA 5GWXA 4DCMA 3LDGA 4F86A 1ORIA 3DLIA 2ERCA 4YV0A 5HFJA 5EZQA 3TM4A 3PLAE 1SUIA 5P8WA 8MHTA 2XYRA 2AOUB 4CKBA 3AJDA 1HNNA 2HWKA 1UIRA 2OKCA 3C0KA 3M33A 3Q7EA 5T6BA 2XYVA 5D1NA 1X1AA 4PIPA 1FJXA 3REOA 2CL5A 4E70A 4RTOA 2C7PA 3G2MA 4E33A 1UWVA 3PFHA 2O57A 4GUAA 5F2OA 2G70A 4FGZA 3TMAA 2PXXA 3GNLA 5FHQA 2B9EA 3AWIA 1M6EX 2YVLA 5BW5A 2H11A 3H2BA 2ZW9A 2PXAA 3OZRA 4QTTB 1VL5A 2BR5A 3FPEA 5GM1A 3KPVA 5C1IA 4YUVA 3HEMA 5LQUA 4M37A 1JTFA 3DMFA 2V74B 3FTDA 2ZTHA 3OE5A 4P58A 4RTJA 3MERA 2OBFA 3G7UA 1XDSA 1P1BA 2IDJA 2B78A 4GOOD 3KR9A 4ER6A 3MTEA 5DRYA 4PYOA 1VQ1A 3V8VA 5DTMA 4DZRA 2EJUA 2G8NA 3DTNA 1ZGJA 4RWZA 5K0CA 3A27A 3I53A 3X0DA 5K03A 2VDUE 2IFTA 2AS0A 2FK8A 3IYLW 3P2EA 4BLVA 3FUWA 2Z6QA 4F85A 2GLUA 4P7KA 1YZ3A 3AXSA 4AZTA 3TPZA 4RVHA 1EIZA 3DH0A 2EFJA 3M70A 1DUSA 4H0NA 5E9WA 1RI1A 2ZIFA 3EVGA 3FPGA 3FUVA 2VS1A 3GRYA 3V97A 2IDKA 2ZWAA 4QPPA 4RTRA 2GB4A 3OU6A 4AUKA 2O0LA 4QVGA 3ELWA 5DSXA 4E2XA 3PB3A 3JWIA 4CKEA 2IH2A 1VP3A 4GOLD 1G8AA 3MCZA 3THRA 4YV1A 3HNRA 4WVLA 2JG3A 5LQCA 7MHTA 1IM8A 2QM3A 3UA3A 4KW7A 5FCDA 4C08A 1YFLA 2ZSUA 1VBFA 1OR8A 3FUTA 1EJ6A 2YXLA 2P7HA 2B25A 5CUQA 2DULA 3CJRA 2P3QA 4MHTA 5E1OA 3EVZA 3FYDA 1KR5A 5EVJA 5FWAA 2QY6A 5HIIA 2ORED 3C6KA 5E8JA 3P9IA 4UOEA 3HCEA 3RIEA 2ZZMA 2AN5A 3BZBA 5K8VA 3UJDA 9MHTA 3CCFA 5DWQA 2Z6AA 3OU2A 3DLCA 2ZFUA 3FTEA 1SG9A 3DOUA 5JR3A 1R18A 2NP6A 1X1DA 3TQSA 3I5UA 2VDVE 4QQNA 2HNKA 4KVZA 2B3TA 2Q41A 3AXTA 3G2QA 5CVEA 3SSNA 5ICEA 3EGEA 2UYHA 5FWDA 2R6ZA 3R24A 1QAQA 1ZQ9A 1BKYA 5K0JA 2NXCA 3MAGA 1ZHFA 4M36A 3EVAA 4FSXA 1ZG3A 2FHPA 4IWNA 4PGGA 3BWYA 4EVIA 5BXYA 4OBXA 3EPPA 3NJRA 4IV8A 4RTLA 1RJGA 1X1CA 2YQZA 3LDFA 4GQBA 4RVGA 3UZUA 2GS9A 3HVJA 1PRYA 4PONA 2O07A 2CMGA 4MTLA 1RI2A 3GRRA 2OB2A 3IHTA 5EZSA 3UJAA 4GF5A 1G8SA 3LGAA 4V0RA 2QE6A 4FP9A 5T67A 4FT2A 3BGIA 3OFKA 3KQTA 4JXJA 1P1CA 5FADA 3U81A 2AOXA 4DKJA 1WXXA 4CWAA 5K09A 4M7RA 5DLYA 4HRAA 4E32A 3JWJA 1XVAA 4PYMA 3UJ6A 1JG3A 5LQJA 2ZLBA 2PWYA 5HIKA 5LSAA 3GWZA 2FCAA 3P2KA 2JHAA 3E8SA 4U7PB 5DPMA 5IH3A 3TKAA 1B42A 5EKUA 2ZCJA 1JQ3A 4X1OA 3HVKA 5KQSA 3JWHA 1NKVA 4X63A 3KHKA 4E2WA 1AF7A 3KU1A 2IGTA 2LD4A 3KR0A 3HVHA 3Q87B 2WK1A 4LG1A 5GIPE 1RJDA 4CTJA 1M0EA 1R8XA 2AOUA 2QYOA 3KPJA 3R0QA 4PIMA 2AN4A 3I58A 1VP9A 2PT6A 2ZBPA 3ELUA 4XCXA 3NWEA 1G38A 4DMGA 1FP2A 4MQ4A 3KR1A 1SKMA 2Y1WA 4AZVA 4ZTBA 2PJDA 2XVAA 5EHIA 1G6Q1 1N7JA 3SMQA 1YF3A 2HR1A 2GPYA 1NV8A 5DTRA 5CVDA 4DQ0A 4EKGA 3DULA 5FUBA 2DPMA 2Z6UA 2YTZA 3ER9A 4QPNA 1N7IA 4KDRA 3A7EA 3P97A 2PWPA 2C7QA 3CJTA 5GOZA 3GIWA 1YFJA 2OPBA 4Y2HA 3O31A 1RJFA 2ZBQA 4YMGA 3K6RA 4PYIA 1SQFA 4R05A
chains in the Genus database with same CATH superfamily
1GPYA 1OH5A 4J8PA 3DO8A 4KFUA 4DJTA 4KU4A 1URPA 1K9VF 4GWLA 5FTMA 3HWRA 1J22A 1H9BA 2HREA 3INTA 1KFKB 4QNRA 3D8BA 5I01A 1XCLA 5CCBA 2O3SA 3C5VA 2OO5C 3DD1A 1CJCA 1PX0A 4YQEA 3P4UA 4OQYA 4RIIA 1CG6A 4EX6A 5TLSA 4US0R 4C4PA 2P35A 3UTDA 5D01A 2OGWA 1E4EA 1M34E 2WTEA 4LGCA 3VNRA 4G5XA 4C6HA 4E70A 2BRUA 2Z5LA 1PW5A 4Y67A 4N03A 2CXSA 4E3WA 3FDZA 2K4MA 3W2GA 3H9JA 4QTZA 2YR0A 4IHKA 3AG6A 2H2HA 1FFAA 3OOWA 2UYOA 1XOIA 1CT9A 3R5XA 4F2GA 1SC6A 4HBGA 4DEYA 1KFCB 2P40A 2ZYIA 3WA7A 4MR9A 1UFVA 5HG0A 1A77A 5ITWA 1F8GA 2ZWMA 3BWCA 5EOVA 2FSPA 1RZVA 2WWGA 3KQVA 4D99A 5B53A 2LPMA 1WNTA 4WRRA 1O97C 1Z0IA 5JAHA 5KVVA 3L7KA 4N9WA 1E3LA 4OHOA 1KKLA 3ZPXA 1PYDA 4LMAA 5DCLA 5E7MA 3KZNA 3GZJA 3M5WA 2P3OA 4E15A 1WE2A 2FR1A 3CCCA 3E9ZA 1BHSA 1SMKA 3DVSX 3ILXA 1D6JA 1EVJA 2QN3A 2Z83A 4FE7A 4LY3A 1RLIA 4RXTA 1PFWA 1NT2A 3QBEA 3LBFA 2RGGA 3QWFA 4GHWA 5AJVB 4ECEA 2AFHA 2R85A 4IV0A 1HTBA 3V46A 3ZWOA 5CDGA 3QEBZ 4K6MA 3ABIA 5KTPA 2R7LA 2FE4A 1Q1BA 1CEXA 3K32A 3QTTA 3ASZA 3NP9A 4JFAA 5HQ3A 1JEAA 1FYVA 1RI3A 4PZLA 5EUCA 4KGXA 1Z6GA 2QE7D 4I36A 2BZ1A 4YAWA 3KB2A 1I0LA 3N2KB 4RWEA 2PY6A 2NVUA 2G4LA 1YS1X 3RS9A 3SDZA 3MJEA 1X1RA 3UB3A 1J23A 4JELA 4GR5A 4FUTA 3T99A 3C7DB 1RABA 5L6MB 4QDUA 2X9QA 4HDRB 3G9UA 1KI1A 1E5TA 2QK4A 1GZHB 1HWYA 4M3NA 2VK1A 3FDIA 3QVSA 4Z4GA 3V9AA 2CYCA 2EP5A 4J9UE 4EHAA 3FPFA 1L9KA 2Z4SA 3DZBA 4HH4A 2NUBA 3ACBA 4JDUA 5CXUA 1KR2A 1GILA 1XCPA 5A4AA 3IT1A 3VMMA 1JECA 3Q6NA 2WNSA 1XQ9A 1YDHA 2NG1A 3CF0A 4MCAA 3A3YA 1CEYA 1ICIA 1TU4A 4MOWA 1F14A 5J4VA 3NHZA 1R0YA 1DUIA 1ZGAA 4YX9A 3IH5A 4Q4CA 1JVSA 1RYFA 2JLRA 4OL9A 5COQA 1JBQA 2JFNA 1P81A 4Y1FA 1EDEA 2LVBA 1J70A 2JK1A 5DGIA 4D8WA 1S7GA 4QL3A 2RFLA 4DLZA 5ERGB 5ICCA 3RM3A 1C9JA 4LXTA 5KPJA 4ESVA 1NUHA 3BFXA 4DDTA 2XWJI 2KYRA 4B3JA 5REQA 4DUZB 1I1QB 1VZ2A 2J3LA 1CRZA 3RYFB 5DBGA 3ZVMA 3P2IA 5BW8A 3OUTA 5MFPA 3AVTA 4GZ5A 3T7SA 1WL8A 2WTMA 5FI1B 1ILEA 5A1JA 2OGSA 2YJ3A 1BD3A 3QSGA 4L0MA 3RABA 3THWA 4BFLA 3G9ZA 3FCSB 4EZBA 4XVUA 3OFNA 5H3HA 4C05A 1UIMA 4X84A 1GN9A 4BNJA 3GUCA 1D1PA 4R0NA 2OO7A 4ESEA 1DC8A 3RHZA 3ROTA 3PTAA 1RPNA 5BYAA 4PN3A 1FTWA 1JFSA 3RNLA 3UXEA 2GD1O 4WNAB 2WG1A 4YRMA 1PR4A 1WUYA 2O2GA 3I4CA 2C3YA 4JLJA 4MRMB 4XWAA 1N1MA 4L9RA 4C21A 2PUDA 1AV6A 3MCAA 2XQJA 3WNDA 1ZSNA 2ACWA 4JZKA 1L2TA 2WAMA 3Q7PA 4OFWA 1R4MB 2O8CB 3ICPA 4JI6B 2Q5IA 1NA5A 1E99A 3VUEA 4TTTS 1GSOA 1FYEA 2BHSA 1C41A 3COVA 3QV1A 2JBHA 4JROA 5FF9A 1QV7A 1LLDA 4WXHA 1TB4A 1XD2A 3PENA 3HJCA 5TJ9A 2AZXA 3X44A 3R9KA 4K9RA 4GX1A 4IDBA 1KSJA 5JTTA 5EESA 2EU8A 2XUJA 1K6EA 2Q1TA 4CKCB 1N0IA 5TQ2A 1G8GA 5ESDA 2IV3A 4AYXA 5HKKA 2P0YA 1KRHA 3KQHA 2PS9A 1BRTA 3DMYA 4Q3NA 2H00A 5BNFA 3TZQA 1PFVA 3KEGA 2H4YA 5CRIA 1K68A 1YZKA 1KJYA 1VPLA 1ZN7A 4Z7NB 1YOVA 4HAZA 3DAHA 2BT4A 2F3UA 1KAHA 1EFLA 4R3WA 1Q2XA 4EDFA 2JFQA 3T95A 5HK8A 1GWNA 1VPEA 5CB4A 1II9A 3BRQA 3QJ5A 1DG3A 1EXWA 2C4TA 4G67A 4D42A 2GASA 4IPTA 1ORVA 1IZ0A 2WF7A 1XVVA 3L46A 3MGKA 1MX1A 4GZMA 3VJKA 2J7PA 3LHKA 4KAFA 4OREX 5F98A 1E2BA 1HE5A 1KO8A 3TAXA 4LZNA 4BASA 4C4OA 1W5SA 4DDVA 5AQEA 2F3QA 5GZ3A 3A1WA 2P79A 4TXHA 5JG7A 5KKCA 4EHNA 4W1PA 4AP6A 1WB9A 1UXIA 2VNJA 1TUGA 4BS9A 4W9MC 5WRFA 1NXPA 2P7IA 3RYHA 4AJ2A 1YUMA 5LLTA 3RO7A 1YD7A 4NFHA 2F4VB 3LBIA 4CR8A 4NYIR 1TRHA 2DTEA 1HURA 2O9JA 2R96A 1NFFA 3AQIA 2VI5A 1L4YA 3AUYA 4FZVA 4ARBA 2GPWA 3GDHA 4II3A 3OZAA 4X1IA 2PRIA 1KPHA 3UK7A 1TI7A 2DLNA 1P3JA 5IN5A 4EYEA 3JSAA 1J42A 2C31A 2FN3A 1FS5A 2ROQA 4RD4A 1XWIA 4M9SA 4TYQA 4UM9B 3NETA 2EBUA 3DDHA 3M6LA 4S1OA 5LQSA 3ZJ5A 1QONA 3GX1A 3ZE9A 1JEJA 1T26A 3ME5A 1DOHA 1WQ1R 3DBVO 3SQDA 1XZGA 4XZ3A 3PEEA 1ML4A 3EBOA 3AEYA 3OKFA 4WDQA 5KNDD 6AT1A 3D8RA 1K88A 2HQ1A 3D4LA 5IYZF 5KWVA 3BJEA 5A05A 1B2LA 3C48A 3DBOB 1IN6A 2JARA 4QBTA 3EGCA 1HFEL 4G5QA 4WX2B 3KOZA 4QZVA 2GZHA 2NSLA 1E2LA 1E79A 2EGUA 2X4GA 1M73E 2O3UA 4RKWA 3PZRA 4TYPA 5DI3B 4JNKA 4ENUA 1XZHA 2D1QA 4D3YA 5FWYA 1AQJA 4MLDA 2SKCA 3HN2A 1S4QA 4MQFB 5ALNA 3WLOA 1WZUA 1RXIA 1OLSB 1V1JA 4K2AA 2QP3A 5JVDF 2GJ4A 4LA4A 3BMNB 4X00A 1AKQA 2GM5A 2M1XA 2P0EA 1SOWA 2DTDA 3OKCA 5FAXA 2QRZA 2XWBF 5H80A 3N8HA 1KMNA 3P96A 4O4IA 1W35A 1MNAA 3CLVA 1ZM7A 3IQWA 4WVFA 4N5DA 1ML3A 5J47A 2QTNA 4IIJA 4US1R 3F97A 3LQFA 2O7QA 2AJCA 2AFIB 2DJ5A 4LVNA 2J33A 2P2DA 5D6NA 3AZOA 3KOOA 5LP1A 1YAHA 2EHJA 1J0DA 1RCFA 3PE4A 3F8WA 2ZP1A 2UAGA 4OA8A 1KGSA 2PV0A 3AF5A 1P9RA 4L4SA 5TJHA 3UYKA 3ZQ6A 2R11A 1T43A 1OWNA 2GAOA 1JDBB 4OHWA 1SZCA 2RBGA 3GJQA 4V24A 3GFQA 1EQAA 5KJCA 4OX9B 1SVLA 2OHXA 1DL5A 1QTNA 4PO9A 3O0DA 3B2EA 5HIMA 1JL3A 3PIRA 9LDBA 2R7NA 1TX4B 4HWPA 4UUAA 1HTTA 1CE8A 1VG0B 2B7BA 5B4TA 5EFZA 1Q92A 1H3EA 2W4QA 4ZMSA 3NM5A 1W19A 4RIFA 3D1VA 2B5OA 5L7WA 1H2YA 1X8LA 2FLWA 1EINA 4U3JA 3QVTA 2LKDA 1AQUA 2NUTB 4K9SA 4CCYA 3DNMA 4GZ6A 4TMYA 8MHTA 1CZRA 3VR5D 4DV6B 2RK4A 4KJZA 1US8A 4KVFA 1Z4QA 3SAJA 4Q21A 1JWAB 3R5SA 4P35A 5FLKA 3W2FA 2XKKA 4Z3OA 5IT0A 1JSCA 4FNMA 3AEQB 1U8TA 3LO8A 4ENRA 1EVYA 5HRUA 2AN9A 1ZRSA 1CQIA 1AKWA 4GUAA 4IZOA 4JB8A 3GJ4A 2JD2A 6ADHA 5JH7B 1FDIA 1TT5A 2ETXA 2FG5A 2FPPB 1CX9B 5DDIP 5T3YA 2P4QA 2YWXA 3H1GA 2YJ5A 4RMGA 1AOXA 4JU8A 5THXA 5KYXA 5JRDS 3JU3A 5CFMA 5KUTA 1ODKA 1B74A 1OTXA 1U7OA 1T5SA 3GPLA 1I6WA 2V45A 2RONA 4G23A 1ETUA 3LX5A 2FUG6 3I5MA 3MTEA 3UH0A 2C8JA 2V8BA 1J0XO 1EXMA 3HUTA 1E4OA 4RWZA 1YDMA 2CV2A 5K0CA 1P3Y1 1QE3A 2LUOA 3ENZA 3FNQA 4E21A 5KYYA 3A6PC 3P2EA 4KE9A 1L4FA 1FNMA 1C9MA 3LPLA 3DDWA 3L7NA 4CLHA 1EIZA 2PR7A 5B7QA 1ZNYA 2M6RA 2VYND 1YVRA 2BLNA 2DUUA 4F5ZA 2Z9DA 4QPPA 2ECQA 2X4LA 1OV4A 4GM0A 4JJ7A 4BP9A 2FZKA 1EA5A 1HOXA 3R7LA 1UDRA 4OMFG 2JIBA 3L77A 2JFUA 3AJ9A 2WSSD 3QELB 4YRTA 5ALRA 4JBXA 4F56A 2C54A 2PZFA 4IIXA 3D6TB 3PG5A 4IYRA 3KDPA 2P62A 2D1YA 3B36A 3HBAA 4FXPA 1WAMA 5JZOA 2JG3A 3TLBA 4ZCRA 2I8AA 1UKAA 4YMHA 2JB9A 5ALTA 1AA9A 1OR8A 3FUTA 2Z3WA 3H7IA 3RSCA 2Q8NA 3MWLA 1JAHA 4XGRA 3NHJA 5ALZA 4BRWA 1R9NA 3WWOA 1RADA 2HA5A 2Q2WA 1YC5A 4UW9A 3C6KA 5HIIA 5LYJA 4EHBA 3F6PA 3NG1A 4LS3A 4RY2A 5HJ2A 1ZM9A 3G0BA 4I99A 1QS0B 1XLTC 3BZBA 1EWTA 3MYYA 9MHTA 2BW0A 4QHTA 2HL6A 4ODIA 2X0EA 3WMEA 3E3MA 5ULLA 1FEZA 4I7EA 1EM6A 4EZIA 5JNTA 2Z56A 3OE1A 4RA6B 4AXBA 1A1VA 4KVZA 1COWD 3G2QA 3JQGA 1FP6A 4LFAB 3AEUB 4ZVMA 1M66A 2I6UA 1LS1A 2RAFA 2X9NA 2XUOA 4BPRA 4ETNA 4N0EA 1GU7A 2V96A 3MMNA 1PT6A 3IUEA 4N0DA 4QBHA 4ZDJA 4TV8F 4CQNA 3LFUA 4RIHA 3WWDA 5KNLA 2BFCA 4G9BA 2VF5X 5LUAA 1JEYB 4BJ1A 1JZSA 1ZG3A 4J0KA 1K89A 3M6AA 2X5XA 1LPPA 1AKNA 1WXDA 3BHJA 3EQ8A 1FJGB 2LW7A 3WL3A 5JAZA 5KOIA 1VL0A 3CWQA 2MIIA 5IFLA 2YYSA 1THMA 4YAOA 4UCFA 3WV4A 2V5VA 4D6XA 5CDUA 3FCAA 1J6UA 1E5QA 1QQAA 1WPQA 1GPWB 1F48A 1PT8A 3UHOA 1OBFO 1EK1A 1YL5A 3I9NA 1N5LA 4GU5A 2NQ2C 3BFPA 3PWZA 3BREA 4MKGA 3MF4A 1Z4JA 2PKRA 3KCQA 3NO4A 4YLYA 4QUAA 2PU7A 4D8UA 3IQDB 3W8FA 3UJ6A 4RCZA 4IWYA 1H65A 2GWHA 5AICA 4YCLA 1I24A 3P2KA 2JHAA 4MR8A 5G1PA 2VO1A 5ALDA 1X9HA 1XV5A 3L8GA 1JQ3A 1DBRA 2OV4A 1MEEA 3H8SA 4QU0A 5BQXA 4J4HA 3KR0A 3DSRA 3Q87B 1SIWA 3HMQA 1YI8A 4LDAA 4W9RA 2J09A 1GRRA 4RQUA 2QUZA 4ZQGA 4LJ6A 4DCNA 1N9ZA 2Y1LA 5C37A 1R0RE 2QLLA 3LV8A 3NYQA 2C5EA 4QGGA 3TTSA 2BKLA 4UBNA 3RFXA 2FLVA 2R1TB 2O1EA 1U6JA 3AVPA 4PG5A 4N01A 2VBCA 1JP7A 4EVSA 1PNQA 1FFGA 2A2ZA 1PFUA 2QRJA 4PCUA 3IRUA 3C8MA 2YTZA 3BGWA 2OHJA 1E6MA 4JMPA 2WM3A 1N2HA 3HKBB 4YRRA 1CBUA 1PZFA 2IPNA 5FOWA 1TAHA 4KRYA 4FHDA 2PR2A 4GGOA 3O03A 4U7FA 1PQ4A 1GDTA 1X38A 4ZOQI 3JWPA 3IAAA 3PNMA 1IY1A 2CNNA 2XE8A 4KLNA 5K01A 3IAHA 1J1IA 4J76A 2PTHA 4EGSA 5JYBA 1KXZA 1T1IA 3D4OA 4IO0A 1E0DA 2B6HA 3H9BA 5A3SA 1E1CA 1TQ2A 2F1OA 2VDPB 1KQPA 2HO4A 4LUCA 3FTFA 4ZJYA 5LM3A 1AD2A 2Q8QA 5K3SA 2XIQA 2XCLA 1NLFA 4G1EB 5EMHA 1QRDA 3VGJA 5FPQA 1G4UR 3WWCA 3OEHD 4FGKA 1V9CA 1KSHA 1GCOA 1TM1E 1RMQA 3VMFA 1YKGA 5BUCA 1THTA 4HDQB 4Z4HA 1E4EB 3DR3A 2HJ9A 5FLEX 3FPHA 1T2DA 2O7VA 3P20A 5HF5A 2IT1A 2BJVA 2VSYA 2HDHA 3FDZB 3NUQA 3UW1A 2H1WA 3WDLA 1OWLA 3DFZA 5HM6A 3K5HA 1SKBA 5KTSA 1ICEA 2X1VA 1SPXA 1RM5A 4MR9B 2F4NA 5F4ZA 3SOZA 3PF8A 1IPHA 4A0FA 4B9EA 5L3VA 5B3KA 1N6PA 3KV1A 3A9WA 5M29A 4V02A 3LUPA 1ZK0A 5F21A 2IW3A 5KQGA 3R3WA 1EGAA 1NBHA 2R8ZA 4Q1EA 3U9LA 4URXR 1B6GA 1UZUA 1QGZA 4KVAA 4MYTA 3U7GA 3CNHA 4D3FA 5I4CA 1SG0A 2FKAA 3B12A 1U80A 1ABFA 3V5NA 4UM7A 4BU1A 2H5EA 1U0SY 2YXDA 4TTAA 3LPMA 1YQ9A 3H1EA 3HMKA 2IP2A 3X2FA 4RUKA 2HBYA 1PYOA 1QHSA 1P4GA 1QV6A 4WXYB 1TTHA 1J09A 1M2KA 4AJPA 4ATNA 2QJWA 3DXFA 4Y2XA 2FXVA 2D2FA 5F9MA 2C4VA 2YCLA 4JQSA 1O95C 3WC4A 4JLNA 2OILA 2VWPA 1MA0A 4BJ5A 5HQ3B 1BVHA 2IV2X 4BKPA 1S96A 3HBMA 5B1HA 3L2OB 2NO9A 1CUYA 2IZOA 3H2SA 4QX6A 5DN6D 1UF9A 1Q0LA 4PEVA 4DJJA 4XGNA 3W8DA 4DSZA 2P6OA 3QPUA 4KUGA 3FNHA 2FR8C 3LD9A 3UUFA 3OCXA 3EGVA 3OIVA 3NDJA 1F51E 4OSPA 3T4XA 1KEUA 5G2OA 1WZIA 4DSUA 4LQ4A 4K6FA 5IARA 4B6PA 1SUEA 2ZVDA 1GFSA 3D7MA 3JD1A 1IQUA 1Y5MA 2CNWA 1WLSA 1QYWA 2BF4A 3BPSA 4B7AA 4O5OA 4ZIRA 1KEPA 1N7GA 1NXSA 2A88A 3ECAA 4W8OA 1MW8X 1YQXA 3HLKA 2XRYA 3FW1A 4R84A 4J03A 1KU6A 2V7QD 3V1KA 1Y8CA 1UMBA 5G3ZA 5B3JC 1M2VA 1U11A 3C6YA 3Q7TA 2FKNA 3Q8WA 3PFBA 1SK9A 4RC9A 4DLSA 4YT4A 5KSWB 4EG8A 1X7XA 3CW9A 2ZUBA 1MG0A 3IBYA 3SBOA 3VR2A 2O8BA 4BX8A 3G2OA 4ZV9A 2PH1A 1CY2A 1Z6AA 5FBZA 2LIVA 3FZGA 1TE2A 2MR6A 4LYFA 1MJNA 1N6LA 2QD2A 5TGZA 4AYTA 2OZKA 3EGOA 3ZXUB 2B1QA 5JJIA 5REQB 4QO7A 4TOIA 4HAXA 2V7XA 2GCPA 2E55A 1D8AA 2MSKA 4QPDA 1CR0A 4CLDA 1W52X 1NSFA 2ATCA 5E8RA 1MCZA 4EEZA 2ZZKA 1TZCA 4DILA 1CLEA 2Y0BA 4DQDA 1ZY2A 4QDOA 4D3ZA 1E9EA 3DVAB 3PCXA 4GM1A 1ZIPA 1TD9A 4M1QA 3EXIA 4KSBA 5JMWA 3THWB 2VUHB 2ZB4A 3CWZA 1JA9A 2D00A 3I9JA 1X3LA 3I64A 3K6KA 4IHQA 5F9FA 2KI5A 3ZQUA 3PVSA 1HSZA 2XITA 2YZ2A 4NJOA 3SIWA 4C0AC 4RTMA 3D3WA 2XUAA 5JNLA 1L1QA 1HC7A 2WSLA 3PHLA 1Z07A 4G5SA 4RVDA 4RZQA 3IBFA 4YPFA 3G2IA 3WGZA 2W2KA 2PSFA 3QU2A 3ZCUA 5E6RA 1ZJJA 2ZRBA 3AEKA 4B2IA 1ENZA 5KKAA 4BPBA 3GP3A 1QU2A 3WL7A 2OCKA 3Q7IA 2Y6UA 1UQTA 3E35A 2I2DA 4GP6A 1W76A 4QBIA 3ICOA 4U6NA 3B9QA 3M6VA 5EEHA 2IYTA 1L5QA 1YJBA 4ROSA 2PGNA 5EG5A 2J30A 1LV7A 2CK3A 3MB5A 2FSVC 2NP7A 3LX6A 1XD2B 1IWBB 3K1AA 3PIDA 5CP8A 1IQPA 3GJTA 3FHLA 2E5FA 5IC4A 4IGIA 1OFVA 1Y80A 4LKOA 1OHHD 5BN3A 1GKKA 2UYQA 521PA 4GP7A 4ILKA 4MCJA 1XX6A 2HZBA 3KQWA 1EX6A 1U8CB 2HA6A 3PGJA 2YS6A 1XRPA 3NBQA 2HF8A 2CVZA 1KYIA 5TQ2B 1RXYA 1TLFA 1C3XA 3C6ZA 1K7EB 2EZ9A 4C4RA 2JLUA 1KBQA 5I7EA 2H0QA 4U00A 1Q11A 1JSZA 1KMQA 2WHPA 5DHQA 2NAFA 4CN9A 4N41A 1YOVB 2Q6VA 4DLRA 4LF8B 2RHWA 4FHGA 1C3LA 3EEFA 1RLTA 4NBUA 4WOJA 1TA9A 3ZGYA 1L7DA 2QLFA 1EZ4A 1QIGA 4OHVA 4DV2B 4YIHA 2BC9A 2FWPA 4DLUA 4AJNA 5CB4B 5CCDA 3E05A 2WYWA 3KUUA 3U9TA 4QKQA 5FV4A 1HLGA 2HXSA 1AGNA 3S4YA 4WQMA 4URVR 4PZAA 2OC4A 3CS3A 1VRCA 4G26A 5G3YA 4OB8A 2XDQA 2OCYC 4MVJI 4P3NA 1IQ0A 1L8AA 4HCJA 3H4TA 2WJ3A 4UVHA 5G0WA 5KMGA 3LVBA 2QN2A 2JFVA 2B99A 3HDJA 5LP6F 1FZTA 4HS9A 1QB8A 2HDNB 2FCRA 1ONOA 3LVRE 1RKQA 2IC5A 2VK8A 3RAJA 2JGEA 3N0VA 4UBOA 1NKSA 2MTBA 2VP5A 2R25B 4WCFB 3RYHB 2Q9UA 3TZLA 4DLAA 2IELA 1QF9A 3FLEA 1SUPA 2A5FA 2PKXA 1JU9A 4XFJA 2A30A 4I19A 1QIMA 2OQIA 5A9TA 3UMCA 3VTAA 4S04A 5KI6A 2EKQA 3MJRA 2BTOA 2ATEA 3ID6C 3PQ7A 3T3OA 1ZD5A 2IVZA 2FW6A 4X1IB 4HFJA 1JT2A 1PUJA 4C0BA 4BEWA 2P2NA 3PQDA 2DQ4A 1KBZA 4X1KA 2P2YA 1XKLA 4MCIA 2OZPA 4LVCA 3P9PA 4A6DA 1F8XA 2YW2A 3DL2A 4MA0A 2OLEA 1MJGA 1VGVA 4DA7A 1QRTA 3AHJA 1LW6E 3JQEA 3NC4A 3I04A 4AZWA 1YZNA 2G83A 1EK0A 4DSOA 1LSSA 2FZ5A 2OR3A 1P72A 3CEJA 4C6SA 1ZIYA 1PTJC 2DPGA 1LI7A 1A9QA 3CH6A 3SQWA 1HDEA 2TMKA 1QKKA 2FFJA 4ZRDA 4FHFA 3RKSA 1VIDA 3CYFA 1N5OX 1TW2A 2VQEB 3PL1A 1SHUX 3VPXA 5GJWC 4U9UA 1T8TA 3CJQA 5BN1A 1FNSA 4D96A 5AESA 4C0QC 2PSSA 4OQ4A 5ELXA 5FWYB 3GCWA 1P18A 1G5QA 1IAQA 4L9SA 4ZDWA 3KEOA 3CPSA 4MVJE 5FV7A 4F6RA 3ZVNA 2YNMA 3EASA 2BMDA 3FPBA 3GJ8A 4KQHA 4NTZA 1YE8A 4L5JA 5GY7A 1AZLA 2PBFA 1E61A 3J7TA 5AI8A 3R7SA 3LX8A 3OC0A 3M7IA 3HCOA 3T5TA 1O94A 4GMFA 4I9GA 3GAAA 4O4IB 3TTVA 4EB6A 3WK5A 4W5TA 5LLDA 3NRJA 3BS4A 2YZGA 5MHTA 3NW9A 1A7KA 2XV1A 3R7WA 1BH6A 1FBTA 2IE0A 4H6VA 121PA 1Y3HA 3EZNA 1MC4A 1J00A 4G24A 2E3JA 1JG4A 4IIJB 1JEQA 4QXPA 3I2FA 4ERXA 5B5SA 1ZD1A 1ISRA 2JLCA 3C74A 3PXEA 4V0QA 4B3SB 3QUAA 3B6MA 3NUGA 4L75A 3SVZA 1U2GA 1AS0A 3NYIA 2CMFA 3OJ0A 4CBVA 3QOWA 3LLVA 4KX5A 1UDBA 3RROA 3BRSA 3P8ZA 4NZZA 3TOVA 2AKYA 3I1IA 2X1MA 1BFUA 2PJZA 1LRLA 1QE0A 4YV0A 1TLLA 5BORA 2P2LA 1PS8A 1QOPB 2YQ4A 4MUNA 2BBTA 4X97A 5HFJA 5AOBA 4EZEA 3MWGA 5EJ5A 5KYWA 1CE8B 2C8LA 3R8FA 5MDHA 1B6SA 4LXYA 2CJWA 4WZBE 1S0UA 2JI7A 4AN1A 2ZEJA 3ADKA 1L5KA 2ZVPX 4G4SP 4U3JB 5I7RA 5D1NA 5G40A 4ZEWA 3RIYA 4CCYB 3O4RA 1WHSA 1Q84A 3L0OA 2IYNA 3QWHA 1US8B 5F7ZA 1DMSA 2EQ5A 1NFRA 1ECBA 3GF4A 4LZLA 3TLAA 4DL9A 4KO1S 5IC5A 1ZXBA 2YVLA 1V1RA 2EKPA 3H2BA 2PXAA 4LMPA 2ZWIA 2JJ1A 2J9XB 1CQIB 1B0AA 2FB9A 4AC9A 1GNLA 2QZSA 1I2AA 4MVWA 4FMPA 4MVJH 3KZKA 1RQXA 1TT5B 3TWOA 3QTLA 1HA3A 3VZQA 1H2BA 1Q0QA 3MERA 5DOZA 4UFOA 4BX3A 3HHEA 3UJNA 1E3QA 3CLUC 1IBMB 3FCXA 3WGOA 1V16A 1GO2A 3Q2IA 1J97A 3BWDD 4RLQA 5KQLA 5KYXB 3RG2A 2HMVA 1NC1A 1VQ1A 1QZUA 5LDDC 2C3OA 1YBHA 2WAOA 1C0LA 3RASA 1A0OA 2W6CX 3NPMA 3UQZA 6Q21A 4CIAA 3R7FA 1DINA 3OCVA 4H1WA 2GBLC 2IXEA 2A1IA 5BR8B 2W8BA 1W59A 3IHKA 4JNCA 5IT4A 1JQLB 5EP2A 2FSIA 4Z7JA 2QBYA 1MA3A 5ED4A 2FEPA 1HMPA 5H82A 2PQ0A 2VOJA 2OFWA 3E18A 3PD7A 5KYYB 2BGGA 4LRWA 4JJKA 3FMOB 4MB0A 2HSWA 3UBMA 4N5IX 5EJ9A 4Q4LA 3RTDA 5ADHA 3BJZA 4I5EA 1DP4A 1OSNA 4MW4A 2WZQA 1G2IA 4KEAA 2IOHA 3MWEA 2IUSA 4EJ2A 2P9GA 3S81A 1W29A 3QKUA 1OIVA 4E13A 1SB9A 4AFNA 4LOJA 3P5BA 2NACA 3DOEA 1IM8A 3N2GA 5LA6A 1Q7CA 4HB2A 4BMCA 3GAMA 2FFRA 1BWSA 5B2FA 1GZVA 1T13A 1HT1E 4P3YA 3RUDA 2VYVD 3AHDA 1H6CA 1Z47A 3KKQA 2DF8A 2Z4TA 2JW5A 1JBEA 4MCHA 5E1OA 3W5JA 5I8WA 1FXWF 3HXLA 4EGFA 1PGNA 2OAP1 3J81A 3TB4A 3WJAA 1N36B 3B20A 1ADGA 5BSKA 2A0XA 2BLLA 3GMIA 1BROA 4WFKA 4FMDB 2Z6AA 3OU2A 4FGLA 4WD3A 1XGKA 4ZOAA 2XIJA 2XE4A 2A86A 4ZVOA 5LYJB 1B8NA 3K20A 4RVNA 2W00A 5JXIA 4FQ7A 1YU9A 5CNJA 1EFRA 1P4HA 1W8DA 3EEBA 2PFGA 5SYMA 3WB1A 5CB0A 2OOKA 3ZDAA 5JS1A 3K8YA 5CBKA 2DUWA 1ESZA 2E2WA 2ZT8A 2RJNA 3FVVA 1I4EB 2DG2A 1TVCA 3I6MA 3RVPA 2CUTA 2Q3LA 3DKKA 4UNNA 3LLCA 1EH5A 5FFFA 4UTVA 4FI3C 3ROPA 3BWYA 2GYVA 3PUIA 2GZMA 1P9OA 4OBXA 5A4FS 1NQOA 1XRNA 2WIDA 3B1WA 1RJGA 1B41A 1JFLA 3IDAA 1JYSA 3UMBA 2BFCB 3FNBA 1ONBA 2AV6A 1XTIA 2JFFA 2QQGA 3O47A 3WISA 1HOTA 2QTAA 2XMBA 3LO5A 4M87A 4BNGA 1G8SA 2IHNA 1XVTA 2ZDQA 2FUCA 2ZYDA 3PQ6A 5JWRA 3G2JA 3L0CA 4EI8A 2JVIA 2XKAA 3NJ8A 4FYHA 4HRAA 4PO8A 3ZHUA 1SH7A 1KI6A 3PYMA 5TGDA 5F78A 2PMEA 5F1KA 2AKAB 1LWOA 3N7TA 4ETWA 3LY8A 4E1BA 1RTKA 2IIBA 2Q9BA 5IABA 4DR5B 1I7DA 4Q9HA 3SKVA 2ZI5A 1BHO1 1O6FA 2FGJA 1VKNA 2REBA 1JKIA 3PQ2A 3V1NA 4KPEC 4ANFA 2VF7A 1XMSA 3HUUA 2W2OA 2P5TB 4XWOA 4MR8B 4HEA6 2QN7A 4ZVQA 1GADO 2C2OA 5IBRA 1TQ6A 2XQIA 3OOSA 4DZTA 5IZ4A 5A7GA 4JI1B 3WLLA 2ZETA 4DCJA 1VFNA 3JVEA 2WABA 5DM70 4HPXB 1IHXA 4YAEA 3B1ZA 2PJDA 1W1IA 2I7VA 3EUEA 3KDAA 2E1RA 4TL8A 2XVXA 4DQ0A 2ODQA 1H0SA 1NQXA 1RKXA 2QWXA 4CQMD 5HJ7A 4CM7A 5KYNA 3A7EA 2N3ZA 3L93A 1AK1A 4FFSA 1U0JA 2FI1A 2NOAA 2XUQA 4F96A 2Z5GA 3MSCA 4DG9A 4REQA 2WFAA 1PR1A 4Q1BA 4Q9JA 5HVNA 2V7TA 4WJKB 1U1FA 1C9KA 3GRCA 3KQSA 4N6GA 1NYRA 1XZKA 4A6EA 1ATZA 3ZVRA 5LFAA 1ORTA 1CS0A 1CC1S 2DH6A 3IVCA 1OA0A 4C4YA 2E1PA 1A69A 5BRJA 4N18A 2WHYA 4YWJA 3IJ5A 4LAFA 4JBWA 1Y4ZA 4OJNA 2HUNA 3PJRA 5C7OO 3U44A 2DB3A 4C4XA 2WD7A 1OFTA 1U0LA 1SY7A 1VLQA 2C1XA 4IYJA 4RMIA 3WLIA 3DT9A 1JQKA 2VJKA 2A5JA 1E1CB 1FF9A 1N1EA 2AC4A 2P9JA 3AJAA 2BM9A 3LYUA 3SIRA 1RIIA 3Q7SA 1UPTA 5G4LA 3V00A 5JZBA 5BSWA 2IEZA 4QPZA 1YVUA 5EZYF 4DGQA 2DWUA 3LDAA 3I6IA 3OEYA 1TUBA 1QVZA 1YRHA 2GAFA 3BG5A 3EYAA 1DPGA 4R2MA 3B5EA 3C24A 4UE6A 4UQOA 2H52A 5A3JA 3FTCA 4AF6A 2XWSA 3UJ9A 1EXNA 3SZRA 2RJOA 3SXPA 2HB6A 3BJRA 3COYA 1W75A 1P4AA 2BMFA 3CUKA 3GWGA 4YHBA 5FI0B 3WLMA 4FWBA 4EX7A 5ICSA 1ZD4A 3B3FA 1JEOA 1Z8NA 3AR7A 5FBHA 1YXMA 4KV7A 1E1QD 3HH8A 1VYHA 1IK6A 4JJ6A 1N5MA 4MQUA 3WL4A 4D81A 3RRJA 4FU0A 1E62A 2F8TA 1REQA 4CM4A 3KXLA 4N3GA 2FVYA 1I2CA 4LOHA 4UHJA 3WRXA 1VDZA 2IYZA 2NW6A 2QGZA 4ER7A 4UUOA 4KE8A 3TZBA 4EUNA 1IDN1 4DM3A 5TEVA 2XUKA 1EE1A 4MUEA 4OHKA 3RV3A 3WLAA 1PT7A 1Q0RA 2PX8A 3LKDA 5BR1A 1CZHA 2EX4A 5JV5A 1JIVA 1UJ2A 1ZXLA 2QU8A 2B34A 4ZO4A 3D8SA 2TMGA 5FA8A 2FQWA 1P7VA 3HYSA 1DAGA 3O74A 3EC2A 3NNNA 4NZ9A 3WADA 3FNEA 5KSYA 3K70C 2WWYA 4PCLA 1C5KA 3KL4A 3USES 4LWPA 2C5SA 1U0RA 2DX7A 4L5AA 1C0PA 1LSUA 1NVTA 1SVWA 3LL4A 1MJGM 1EBBA 4E31A 3CF4G 3NMUF 1JDUA 1KI9A 1PW7A 2WPDD 1G9SA 3I04M 1OTYA 3Q2OA 5LBIA 3UAOA 2D1SA 1EAMA 2V59A 3V55A 4FFRA 3JQFA 4OHXA 3A25A 1P7CA 4JKIA 5KWIA 4MKHA 1G7SA 2WSIA 1TQHA 1OIXA 4YJKA 3TRKA 1C80A 3QI2A 4BNZA 4JODA 1OUMA 2AT1A 1NJFA 3OURA 3ZHCA 2AA3A 3RODA 2WV7A 5H0IA 1KORA 4R2KA 1Q44A 4U2CA 4UCQA 4KIWA 1DIGA 1WF6A 3GDGA 4F46A 1RZ3A 3BWMA 5BPFA 2OCGA 3EUAA 4IIVA 3W6OA 3AM4A 4YRBA 2VP2A 1THZA 2V0CA 1AGPA 5CIWA 3SNHA 1TEXA 1UKEA 3IOBA 1NUQA 1M8FA 2RIPA 2PO7A 3FNGA 3HB9A 2RB5A 3KT8A 4ON9A 4S2EA 4QUHA 1SGWA 1EP2B 1W0JA 4TLMB 4UOQA 3RJTA 4ZMBA 1D1SA 4XLZA 3RC3A 4ZIRB 3AHEA 2C4HA 2R6GA 4ZVTA 1L8XA 2LXNA 2ZYGA 5A2GA 1N4DA 1NNLA 1V8DA 1CY0A 4EQ6A 2W6JD 3IP5A 5K20A 1UBGA 1P2GA 5B3AA 1UMBB 3KPYA 2QVBA 4A1FA 4C0LA 3DW1X 1CJUC 1O89A 1Z8FA 3IUPA 4W1SA 1DZIA 3IBSA 1WZCA 4DLTA 4MV4A 2VAXA 4KREA 4LFBB 1X7XB 1GU1A 4GVLA 1HM5A 2O8BB 4V3BA 3GHYA 3VU8A 1BZYA 1JZQA 4RJKA 1VHLA 4L78A 1FDSA 4KFTA 5I5GA 5TR9A 3T3GA 1HX7A 1UQUA 5JZSA 3URKA 3S1SA 5G02A 2HA0A 1I4LD 2VWQA 1YJ5A 1D5WA 3ZX4A 2AOWA 5B2ZA 2BM1A 1A5BB 7AT1A 3UJ8A 3IDZA 5C8ZA 4GOKA 2IU4A 5KNBD 1W34A 3CLUD 2BCJQ 3GFVA 2AI2A 1DX6A 5AM5A 2JJQA 2DSNA 5EYPA 1H1DA 1NU6A 2DR0A 4JVSB 5TGTA 4Q1AA 4AF8A 4E6PA 5I6DA 1KVQA 4TLCA 4LE1A 2Q4EA 2QT9A 1X2BA 1TO6A 1Y8AA 3KAQA 4GLJA 4MYDA 4JUDX 1KOLA 5JCOC 2ERXA 5IBPA 3LY7A 1CP3A 3GUZA 3QKRA 1WD5A 3PGVA 4KQIA 1RKUA 3MG9A 5AVUA 1U9JA 2QLJA 3NI2A 1LW7A 2PQ6A 3D3WB 4B6FA 1R0KA 1SUBA 1AF4A 2FK7A 3R3HA 2CHVA 4N0QA 5JWOA 1TGVA 4EBFA 1D2GA 5B4UA 3V7NA 1YHZA 3X2SA 2W2KB 5EWLA 1IJKA 1P4SA 4JA2A 5E6RB 4C9BA 2QTLA 3SEAA 3AEKB 4EPWA 3TZCA 3GLFE 3A28A 3EVFA 4JQOA 3ROEA 3OT1A 3W5SA 4XWKA 4CV0A 2PPVA 2D8AA 3TW4A 4MGHA 2AX3A 2HA3A 1NKTA 4XGQA 4KSCA 4ROTA 1IY0A 1R6XA 4HY3A 1XJ0A 1JT9A 4NQRA 1UJBA 4RMNA 3GRZA 3O92A 4WKBA 4YRDA 5AWFC 4U2GA 5FULA 1UZMA 1QH8A 4EA7A 5HUQA 3K1AB 2R2AA 3BE5A 3L4EA 4WH0A 2D5IA 1XDUA 4BO4A 2OB1A 4BFWA 1GCAA 2C59A 2HNBA 3CB2A 2VPPA 1EI9A 2CBXA 5KVCA 2HQBA 5BN3B 3AETA 1NBME 3QBDA 4GXQA 3Q5GA 3QE4A 4TXJA 3WTBA 4J3FA 4CYMA 5KJ6A 5DCUA 5JAPA 1GVHA 1QUEA 3HXTA 4KDCA 1G63A 5ICGA 3L4BA 3LWDA 1P7WA 3MBIA 5ARBA 5U4XA 4EFNA 2AMFA 3ZJ4A 1QYIA 2PLWA 4C3OB 1ACLA 2Y0DA 2WHPB 3MMPA 2EBHX 3E3OA 3H9GA 4PICA 3WK6A 4OY3A 3R23A 3ZD9A 1GRNA 3IEUA 3F6CA 5EHGA 5IYZA 4D6YA 1EXDA 5CW2A 4DMKA 3NBZC 4BNKA 1WXHA 3GFGA 4YQZA 4RKEA 3I61A 2MHCA 3MQFA 4P53A 5K7SA 2ZRJA 3OI7A 4JT8A 2BFPA 1X7ZA 1DQSA 1V4VA 2XDQB 1F38A 1II0A 2KSQA 3MGBA 2RGWA 1DWOA 4TMVA 1RM4A 2FNAA 2COUA 2W6IA 5F51A 5B64A 5KMGB 1KVRA 3SR4A 4EVQA 2BPOA 2G07A 4HR7A 3ODGA 4OM8A 2QR3A 2O8FA 1J21A 1CZLA 2P5YA 1M76A 5JVDA 2BFBA 5HDQA 2Q29A 3N5CA 4P7JA 1X19A 4IH9A 1G2PA 1G7CA 4RD0A 4KL8S 3UMRA 4BYMA 4EB0A 4ZHSA 4YHHB 3HO6A 1W6RA 2ZYAA 3A9UA 2VCYA 4AO8A 4LHWA 3IEVA 3CRNA 1GSIA 1DS6A 2RB4A 2XCSB 3U7QA 1XB2A 5L3RA 2OV3A 4B2LA 1KWGA 1ONSA 1Z2EA 3G9TA 2AFHE 4QG7A 3HXPA 1LJ8A 4AF7A 1F7VA 1PK9A 4XQGA 1RYNA 3HVIA 4X1KB 3TPFA 2GT1A 1NDQA 2QRLA 1R10A 4LCJA 1AGXA 3I5XA 4LNUA 1A2OA 2VJAA 2GJ9A 1L4MA 3N53A 1A7JA 4H6XA 4NONA 3T6KA 2PAFA 5JMTA 2H1CA 5JXGA 1I3MA 2XSZD 2FPWA 1UT8A 2NU7A 2ODBA 1ARZA 2A5LA 3N75A 3RUAA 4N8DA 2OG1A 1RBQA 2WILA 5CDFA 2L19A 1NUUA 4Q3OA 3MJDA 4DB4A 3N2NA 3LCUA 2AJLI 2I4NA 1VYTA 2CFCA 3EGIA 1MPXA 2H7XA 3RSLA 4K1LA 1SIOA 5D5QA 3L6OO 3WYFA 2E82A 4CQLA 1YGYA 2P1ZA 3GJZA 3O73A 1M5UA 4W1RA 3IILA 1UFOA 3NIDB 3RUFA 5E2BA 2A92A 3ZWXA 2QM0A 2YV3A 4YJHB 3VI3B 4FS3A 4F6RB 3ZJUA 3SR0A 3FKJA 2O6LA 1WJGA 3PVCA 3PXAA 1CXZA 4KDEA 4MUGA 4FBLA 3ZNPA 5C4MA 5JRJA 3DMTA 5BWBA 3N3AC 4EB6B 4JXKA 5AXDA 1K3TA 1QAOA 2JK0A 3EZLA 3TLCA 5K99A 5DO9A 1Y1PA 3H1BA 2PH3A 2O05A 4R9VA 5F77A 3R7WB 4EF5A 4F71A 3BB3A 3K9GA 2ZUUA 1DEHA 3UH1A 1JEQB 2ZITA 3IQIX 5LD2B 1KGDA 1XZLA 3AY0A 3K53A 3OOHA 3CUWA 3KYJB 4KXMA 1DIBA 2XH8A 3AUJB 4WUVA 5JATA 3ZHRA 2ORIA 3ONNA 5TY0A 4DV7B 1RHJA 3CCBA 2ZATA 1WKVA 4ZI3A 1PJBA 3A1CA 7ADHA 1AHHA 4UHCA 3MXOA 1CY8A 3C0KA 4X6LA 3B6EA 1DO0A 2XYVA 1I0IA 1TCVA 3CNEA 3L84A 3NUZA 1E0SA 1P6UA 3DB1A 5KYWB 2WG2A 2CJWB 2C61A 1N1DA 5F33A 1AQ6A 3ZDFA 1NG1A 4YYZA 4JS0A 5F2OA 2ACEA 2GHTA 2J5RA 1ORRA 2WFMA 4O1MA 2BRUC 2PXXA 3F5MA 4B7XA 2UXBB 3WQSB 4E03A 1VB5A 1HO3A 5EXXA 4U0JA 1WHSB 4LRUA 2JI4A 3DLHA 4I1IA 2P2CA 3BXFA 1GRQA 2OHVA 3AZPA 5AJZA 4EUEA 1XI2A 2I3ZA 1AUPA 2YRWA 1V1RB 1ZJ5A 5ALQA 1BA2A 1NW9B 1G5PA 1MF7A 1XCBA 2RGCA 3F9RA 3H9EO 4LHZA 3TJZA 1QYDA 1P1BA 2IDJA 1YA6A 2Y1CA 3KUDA 3GOQA 4JHXA 4BNTA 1AUOA 2P6UA 4ER6A 5HRCA 4U8HA 3AF1A 3SEFA 5LMCA 4UHKA 4BFUA 3E3NA 2Q1WA 1LBIA 3RFVA 2IHUA 3A9TA 1OYYA 2Z6QA 1V16B 1ULTA 1E6EA 4NMXB 4AZTA 3WSWA 4MW0A 1Z15A 5AM3A 1B26A 4M8KA 1VKHA 4M9XA 4JWKA 2R60A 4H0NA 5CJPA 1E63A 1E1YA 1RI1A 4DR2B 4M1OA 4TL6A 1O2DA 2I4RA 2W8BB 2XMCA 3K2BA 4IXMA 1GGNA 4PAOA 3T3DA 4A82A 4DMUB 5KC8A 1J7JA 1VGQA 2IZ7A 2QBYB 4AKHA 4FJ0A 3QPBA 4QAQA 5DSXA 3DE2X 5GMOA 5EUQB 1VYVA 1QO0D 1CLUA 1V8BA 3BMQA 3F6BX 3JWIA 3KAKA 3K73O 3C3BA 1KZYC 3MC1A 3PGMA 2XUHA 2VDNB 1HEIA 3ETEA 1G66A 1S6YA 3I9MA 4FINA 1X1SA 4TV8A 2O1SA 1KDTA 1P2FA 4FDUA 2QVCA 3IJPA 3MWEB 4Y2YA 1EUQA 1CIVA 1DEAA 1T36A 1ENYA 1XK7A 3I0MA 1EJ6A 3AF4A 3IQGX 4BGIA 3TB6A 3GLSA 4DM4A 5BY2A 2FPKA 1EVEA 1LQ2A 1M6VA 3N2GB 5LA6B 2ZRIA 4F04A 3CN9A 2QN6A 1DG9A 3R6GA 3BSYA 4IV5A 5B37A 4RE5A 2HF7A 3HDGA 3S70A 1XD9A 3CZMA 2PVPA 4QUDA 3BJMA 5HM8A 3OH8A 1EHIA 3QVXA 4LRYA 3WMWA 3BRCA 5C81A 4IDCA 1Z83A 4I3FA 2RGNA 1NVBA 3R3VA 3KJEA 1ZGGA 2BFNA 1MZPA 4K9LA 2QYSA 3AXTA 5I9MA 1NONA 5DMHA 1YB1A 4HYQA 2AJDA 2CF6A 1EP9A 3CO5A 1C9YA 1SZJG 3HXQA 1BDIA 3KFXA 1QAQA 5K6RA 1BKYA 2CY0A 1QDEA 3CZAA 2BYTA 4BWYA 4FSXA 4XDHA 1QVRA 4PGGA 5JEDA 1EGVB 1KQ3A 2J4FA 4YDSA 3A11A 4BJ6A 5KTRA 4Q3BA 1EWQA 3EPPA 4KN6A 1Q57A 2YZ7A 2ZIXA 5FR1A 1XZDA 4LI3X 2WWVD 4GQBA 2OK7A 5KBYA 3ESZA 4M7OA 4BKOA 2COEA 2CXTA 4UHHA 4QAJA 3SYMA 1K7FB 3TLMA 1FUIA 2WHEA 4Z53A 2HQRA 1G17A 2OBLA 4FP9A 3KRTA 4ZPXA 4YH1A 4JXJA 5ESRA 3VHRA 3U81A 2PZJA 4ZYWA 1TC1A 2H9IA 3KJIA 4YLGA 3K8QA 4H7FA 4IDOA 3MTAA 4B9AA 4KN9S 1A5TA 2H18A 1KK0A 4IKOA 4C76A 4Y2SA 3KSBC 1WDLA 2PWYA 5LSAA 3RUPA 4I1SA 4U7PB 1A04A 3UJ3X 4HXEB 4GDFA 5E6SB 2AGVA 1FU8A 4GVXA 1IJEA 4TQ9A 4C0SA 4JQCA 1KI8A 1QTQA 1RFGE 2XMDA 3BF8A 3ZZMA 3KU1A 1SXQA 3L7AA 1ESNA 4PBRA 5JI2E 4I50F 4CTJA 1P1RA 1KRXA 4Q37A 2XCQA 4K9NA 2WYUA 3AOEC 5JROA 2BGUA 1SKYB 1NXOA 4YMWA 3JCZA 1W96A 3E4CA 1RE1A 2PA3A 1T91A 1QG0A 1WXQA 4H7HA 4DR1B 2VKTA 1W5TA 5SZHB 4Y0VA 2QAGA 4CGZA 2PS1A 3CFYA 3L6DA 2KHZA 5F5LA 4KX3A 5ALWA 2IEAA 1NWCA 3PRJA 1ZJ6A 2RMKA 2HLDD 5HKAA 2I2CA 1PEYA 1GDHA 5AT1A 2Q2NA 1PNRA 4KDRA 1WSWA 1JMVA 3WJ1A 4OQNA 4LXHA 3SWWA 2AXEA 2QMQA 4Y9TA 3UCXA 1JYEA 1V6SA 1K6IA 4TTVA 4M0DA 3SFTA 2IKSA 4BRZA 2IY8A 1OI4A 3VVCA 1MC5A 2CYBA 2VXYA 1MOZA 2WIBA 4FFNA 3Q1LA 2Q5EA 2AXQA 4H3SA 4REQB 4F4HA 3NATA 10MHA 3NBKA 1HMYA 1T6ZA 1BMFD 2YW9A 3QWIA 1AY0A 3FE2A 2YJ6A 1OH7A 1CS0B 1GAJA 4BBJA 3BFVA 4WK4B 3U0VA 1NW6A 3OM9A 4FE3A 3X2EA 3FKQA 4F45A 4N76A 2OUKA 1TO2E 1GPAA 4DF3A 3ED1A 1OI7A 2WD7B 3BD8A 4U2EA 1DAKA 4RPCA 1P2SA 5CG1A 3MB8A 4M86A 1L1EA 2GX6A 2EWVA 3PFIA 1E94E 3PUZA 4C03A 4A0QA 2V6BA 4R68A 4TRJA 2RH4A 3TK1A 2BR3A 3GXBA 2GUWA 2ICAA 3K4QA 3L1HA 4TV9F 4ARVA 5EUBA 4BMPB 5JJBA 2YWCA 4KB5A 5H1YA 1JJBA 3MSXA 4Y2QA 2PN1A 3NBYC 5CTAA 3NEJA 1B43A 2BFMA 1SU8A 1TUBB 3OLXA 1JNYA 1VE5A 1YIDA 3Q12A 3Q3VA 4DLNA 5IJ0A 1UINA 1NAHA 4HD8A 3V1TC 4PC2A 3AUXA 1UUFA 3ZW7A 1LS6A 4EKDA 5ICFA 3NAMA 3BN3A 4KQKA 4EHLA 1XFDA 1H6DA 4L02A 3V8EA 4AJLA 3BQ9A 3VYVA 4BFYA 1NT4A 4EUHA 1QHNA 4XD7D 3SGLA 1RWPA 1GNTA 2YYYA 3D2BA 4MKZA 3PXGA 1REQB 4CM4B 2E49A 2V9PA 3L40A 1L6RA 4H1UA 1S3GA 3M8KA 4YMSA 4YRSA 2CLOB 2COKA 4P5PA 5MGBA 5A4MS 1PYGA 4MW5A 4KP7A 2O1XA 3DAGA 2JD1A 5IDWA 5TC4A 1ULUA 2B20A 2OLKA 5EL0A 4EG5A 4JBLA 2Z5FA 2C5BA 2UV8A 1U3FA 4RNDB 3QK7A 4C4SA 2G1AA 2HN9A 2QP4A 1XO1A 2Z0MA 2YIMA 1TT7A 1WCV1 2DP4E 1BTOA 4DBVO 1IXKA 5AKGA 2JI6A 4W63A 5IZCC 3I23A 3RJ9A 2CD7A 3M6XA 1Z4PX 1YQUA 1XLWA 2W2MA 2XT0A 4MVYA 4XUDA 2BHRA 3KLMX 2C7BA 5F2EA 4LEIA 4P7GA 1ACJA 1PN3A 4MH0R 4P4UA 1YR2A 3WLEA 3H13A 3V2HA 3K6SA 1D6MA 2E6KA 2PZGA 2QG4A 2R7AA 3DE1X 4GI2A 1OXBB 2H17A 4K6CA 4NCIA 4URZR 3PXDA 1BHQ1 1XQXA 2YMMA 5B1EA 3OFJA 4CMEC 4H27A 1L8OA 2C1ZA 3CPJB 2IXGA 3KKOA 2IHVA 1F60A 1NZDA 1IBCA 1VBNA 4MVJG 3W8EA 3D6UA 2QQFA 4LHEA 3NCTA 5DHTA 3PT9A 1XPJA 2QW8A 3H19A 4HX2A 5K9ZA 1FA9A 3HADA 4JLVA 3L6BA 4CXMA 4LOAA 2WJWA 2B37A 3MJTA 4ZEOA 2P9CA 1FRVA 2NSJA 4CR6A 4AD8A 3ONDA 3WXBA 1MMFB 4BLWA 1N2GA 4JJ8A 4PWYA 1YNSA 2QUKA 4FD3A 3KG2A 2XMZA 1V8OA 3ZS9A 1TLTA 2QQ5A 1T3TA 2B21A 3EF3A 3QE2A 5AK0A 4ZU1X 3X1DA 4W5WA 3C7AA 3KETA 2VUTA 2OHGA 1STOA 4IJVA 5IVPA 4HAOA 3CVVA 3DF7A 2JFBA 2WAXA 1KEVA 1ZRHA 2J3QA 1RWXA 3G82C 3UJPA 4BO2A 4EQ6B 4ZVPA 2NU9A 4C5AA 3RYTC 2KPOA 4BQIA 1ZKMA 2P4EA 4M1WA 5FEUA 2ZM6B 2MSWA 1K2VN 4WDRA 1NY5A 4WBNB 4J4TA 4X8OA 3BMCA 5FPHA 1IBSA 3IMEA 3IVMA 2H1IA 5FUQA 2GXAA 1D5CA 4R7TA 3GJYA 4AAYA 1Z6ZA 4RO0A 1M33A 3C7TA 2DKFA 3WZMA 4FX5A 4C3UA 9GPBA 1SU7A 5I7AA 2GA9A 1ORHA 3UO8B 3A05A 1ZOPA 3GD5A 1DG1G 3A3NA 3V1YA 5DE3A 4D9KA 4ER3A 1X7YA 1RQGA 1EK2A 3BKXA 4FXOA 1LF5A 1P74A 2VRNA 3KS9A 3L01A 5EYPB 4TM7A 3PHGA 4XVCA 3BSWA 2BV3A 3DDNA 2WMOB 4E07A 3EJ6A 1Q14A 4J0FA 4DREA 1DO2A 4XR9A 1V7PC 2IA5A 2Q21A 1N1GA 1NVKA 1R12A 1AXRA 2CMDA 4OKIA 5J2UB 5K0GA 2DWCA 3MGAA 3WYBA 2J5QA 1GPH1 4JP8A 1FS4A 3G3EA 5AMXA 5ALXA 5DTEA 5ECWA 1KTVA 3QKRB 1RYHA 1SVOA 2E4VA 1TEHA 2OCPA 4UE3S 1NRWA 2AXPA 2DRIA 2GN2A 3W6ZA 3HRKA 4S0ZA 4UPEA 4C7JA 3CZ9A 3TQHA 1IOLA 4Z7QB 2P11A 4ZRMA 4LNAA 3QYPA 3GG2A 1E3IA 1F0YA 1DU4A 1USIA 2I3AA 2R6FA 3EAFA 4MTCA 4JB0A 4NPHA 5ELMA 5EWLB 3REQA 4L95C 1RT9A 4C7MA 3QYJA 3JYQA 2ID7A 821PA 2I3BA 1CIPA 4AJOA 1O7JA 2E9SA 1T8RA 3OT1B 5ERYA 1V41E 5EJ4A 1N75A 1WDKA 3Q41A 1GKYA 3SICE 4K6HA 4WBSA 2F3RA 3R40A 4DJ5X 3OM0A 1NMXA 3DUWA 1C0EA 2A57A 3MOSA 1QH8B 4FD2A 5JZVA 1DKQA 3BB1A 4D44A 4WN9A 1FNBA 2IHYA 1BDMA 4HLUC 3DZ8A 5CJJA 4ZI2A 1MQ8B 3IV6A 4YDRA 2JGRA 1X8JA 3MW8A 1LK0A 3I2IA 2PWAA 1TO1E 2ZSAA 3AETB 4JYCA 4PHHA 4D9NA 3IUJA 5BNZA 1A9PA 5I8ZA 4AY5A 1UMCA 1X2EA 2QVYX 3CVOA 3I4LA 3VC1A 3E1KA 5ABPA 4AKTA 1LC3A 3OMXA 1W1WA 5KYVA 3AYZB 3LX4A 1PKEA 1U0TA 4G65A 1FVHA 1QAMA 3GT3A 5FO1A 3D59A 5C18A 5JEEA 3SHWA 2BAGA 2NYRA 1R74A 3HJUA 3TECE 3G88A 3WLRA 1UBHS 4HQRA 3MM4A 3VKVA 1COZA 1XQYA 3HSKA 2H48A 3PGKA 4LYAA 4TTPA 3HUEA 3Q6MA 5IYZB 1H6AA 5C5EA 1A5ZA 1I1HA 3T1OA 5CVUA 5C4GB 2R6DA 3CEAA 1UT6A 3M1IA 4Q3KA 4G0PA 2YWDA 1FSZA 1JTEA 1X7ZB 1YJXA 1SCAA 2PGIA 3HV0A 2XE7A 3L8DA 4OEHA 1WMAA 3A36A 3JQAD 1OASA 5BSTA 3PRHA 3DTVA 3WMRA 1Q17A 2G71A 5TMBA 5LOVF 5FOSA 4BEVA 3IAEA 1OB2A 3L7DA 2IXAA 2OP0A 5DV9A 5LXTF 4L6CA 1G0NA 3CTMA 3KE9A 4IR7A 4U02A 4ZOLF 2OYCA 2O8FB 6REQB 5JVDB 3IOCA 2BFBB 3MAAC 1DIHA 2NNWB 3RS3A 4IGFA 3REGA 3EGXB 4XYMA 4DLYA 4EY7A 4INJA 3HRHA 4DT1A 1IZ7A 3TIFA 4MWBA 1PZMA 3SBDA 2F9FA 2FZWA 3CV3A 4LDNA 4MWOA 2O54A 2C3UA 2ACKA 3IBGA 3QFTA 4RFSB 1KVUA 2FG6C 2VT6A 5DRTA 4Q0MA 3U7QB 3TN7A 1Y7TA 2IF0A 2XA1A 4G3XA 4RESA 4EY4A 3S2IA 1G3QA 1WVIA 2FQ1A 4KK4A 4MS3A 4S24A 3BCSA 3QU7A 3S29A 2FRDC 5LZ4A 2C2MA 1W48A 2QW0X 1B8VA 1DRJA 4LNUB 4RPGA 4Z2YA 2P6RA 1JIJA 1H2EA 1T3SA 4QLAA 2CE7A 1IY8A 1JHVA 4F06A 4MDFA 1V2GA 4FBMA 1I7NA 2NU7B 3FWNA 4YXFA 4GPBA 1U2EA 5I9NA 1KHHA 2OV8A 1JLMA 3CHYA 1BW9A 4HYEA 4RANA 3IBCA 4B3DA 4C78A 4YAUA 3LQ4A 5ENVA 4XGIA 2FZVA 5FJIA 1RW4A 3VNQA 4O2BF 1JDSA 1T5BA 3MHPA 1MT3A 1EFDN 4K0RA 1NMEA 3QLVC 2EJBA 4QQKA 3VR6A 2FEAA 4CTKA 5CITA 3IAM6 3IEIA 3ZQKA 5HKKD 4JBYA 1O0SA 1H2WA 1UXKA 4FYXA 4IHJF 4JR0A 4PFJA 3ZIAA 2OHIA 1Z4OA 3E84A 2ZUTA 1J2EA 5ALOA 3C6QA 2F8SA 1AM4D 2BH2A 4RKQA 4Q03A 3TG2A 2HWUA 2AYXA 3RD5A 1F0KA 2QE7A 5D7NA 1MOPA 4MPRA 5KWJA 1XXHE 1Y6QA 1BDBA 2HCJB 2FEWB 3ETNA 1WX1A 5EIAA 2G1UA 2PFKA 4UVEA 2FFBA 2FQQA 2OEPA 1FK8A 5ER6A 2X14A 5EE1A 4AKIA 1XMXA 3AP2A 1T8UA 4B44A 1AT1A 2CFIA 2J7PD 4QRIA 5D00A 3TGWA 1EESA 2VDQB 3V8BA 5BV8A 5FDFA 1E6CA 2JGNA 2BGRA 5ALEA 1M7BA 3IP9A 5EIOA 4ZTZB 1ACMA 1IOZA 2AOUB 4R2XA 5CXQA 2WIAA 1HNNA 3IQFA 5BUZA 3Q7EA 1CFZA 4CLRA 3WZLA 2R84A 3REOA 1DADA 1MJHA 2QTHA 2NSDA 3LHIA 5B1DA 2C7PA 4Q1DA 4MZDA 3G23A 2V4UA 3U7IA 2QRQA 1QIIA 3BF7A 3C45A 4L1KA 5JARA 4XOUA 3CW2A 4JX8A 3ZE2B 2P9HA 4IIEA 1XL0A 2OXTA 1MP0A 4ZXFA 2BR5A 4YUVA 1XAIA 3H5LA 2Y9MB 2BEVB 5GM1A 5C1IA 4P3KA 4KOAA 4MUXA 1JTFA 4YPOA 4M60A 5H3LA 3U39A 5EXSA 1HZZA 3LT1A 4PX5A 2ZAYA 2FP3A 3PNYA 1ZM2A 3ANLA 3M5CA 1W87A 1B76A 3DOCA 3PITA 3EHEA 5D3KA 4BE7B 1KH1A 1ODTC 3H97A 1DC7A 1DAOA 2A0UA 2ZJ8A 3ICVA 4I81A 3ROKA 4GOOD 4RD1A 1Q0UA 2W6PA 4TVSA 1GGKA 1L5YA 3N2LA 2CDAA 2AUNA 3IGFA 2IYVA 5J59A 2WWFA 3EFOA 4PQRA 4LYHA 2VF8A 4R1NA 3TLKA 4K3UA 3KT3A 3F2IA 1FXWA 2FK8A 1T34A 4P7KA 3RREA 5J23A 4PPGA 1E79D 4NP6A 2I4LA 3ESYA 4Q93A 3VFDA 5J1SB 1G3UA 4IOJA 3UGKA 3USZA 1G21A 2VS1A 3QVMA 4Z86A 3OJCA 1TJ5A 4E5UA 2YASA 4HPWA 4ENTA 1TMKA 3FFTA 1H2ZA 4G1CA 2ZT6A 4G36A 4MWCA 3S27A 1GPDG 1VLLA 3C70A 3PNLA 1UOPA 2R8YA 4RENA 1N2CA 2GTIA 2C20A 4BVLA 1OGYA 5H81A 2IY7A 3H9QA 5C1OA 4TQUS 5JASA 4MV5A 4WK6A 4YRFA 2ZXUA 3HB0A 4K8OA 4NYMQ 1AQLA 4DW8A 5LQCA 2QM3A 1L7OA 3EWNA 2UZ1A 2Q49A 4H4DA 3BMQB 4C08A 3SP1A 1JMYA 2C88A 2CHFA 1P1JA 3VAAA 4P84A 3F7NA 4A8HA 1XTJA 2DULA 3NC0C 4FMCF 4TV8B 4C4TA 3DC2A 5FOUA 4WL0A 2HT1A 1UL1X 1CF9A 1T36B 3HBLA 1CUDA 3Q72A 2ORVA 3WIUA 5IBCA 4WJLA 4AUMA 5CW1A 1ZEJA 4BC0A 2BBOA 2C82A 2JAXA 4L7QA 4MV8A 4KH0A 2X9LA 4V0SA 3OCYA 2CL7X 2QRUA 3F73A 3EQ9A 5CFNA 1ZIXA 1TZ2A 3GA5A 4C3VA 4Q02A 2B3TA 2YOFA 3SSNA 1Q3TA 4TVOA 1RQLA 2VNHA 5C2JB 4MROA 4DNFA 1R0ZA 1ODJA 3T7CA 3W6NA 3R24A 3KYIB 3OF2A 1D2MA 4B45A 1JLKA 1FUKA 4D9HA 5CVTA 1ISIA 5DGHA 1MNQA 3GJRA 3H5NA 2MSDB 2EW8A 1UZLA 3I2YX 3U4CA 2ILVA 2JIMA 4OXIA 1U4SA 4D56A 3DWEX 2I29A 4EFDA 1QJCA 2UKDA 3PSAA 4FR5A 3NM6B 4H4CA 3S2UA 4PAQA 1M54A 4TYNA 3T0FA 3DEJA 3WRYC 3HVJA 2V6FA 1PRYA 4QJ5A 2VAMA 4RZ3A 3QRWA 3O21A 2OB2A 1NQTA 1NBAA 3AB7A 3KJZA 4GYWA 3ADBA 1C2YA 4JN6B 1T6BY 4KHZA 5T67A 2ZTLA 4R8LA 4TKUB 2HLNA 1WBJB 5FADA 5J9FA 2G9NA 1ZEMA 4DKJA 1CKEA 3H3XA 5I7OA 1WNFA 2R65A 5CPFA 2QR5A 4DR3B 4BQSA 5HQTA 4D80A 5K3AA 4D25A 4PZ9A 1YA8A 2HHLA 1B42A 3LWZA 5KOHB 1TKBA 3L7BA 2Q2QA 4PPFA 3L43A 3RU7A 4BN0A 4F72A 4MVJF 2PKQP 2F6RA 2J6BA 3JWHA 1TM4E 4IDFA 4O25A 4RK5A 4N3BA 2WJ4A 1WUKS 4RK7A 4DIUA 5HKOA 2FW9A 1I13A 5G1NA 1NR1A 3WQHA 4GIBA 1TOAA 2I65A 2QPTA 1FUEA 3EF1A 1KP2A 4BO1A 4X91A 2AN4A 3C8HA 3CU5A 2XADA 1FP2A 1V5EA 4J7XA 2BSQA 4OBEA 3KFVA 2C57A 1NJ5A 3GH3A 3OTIA 4IQ4A 3NLLA 1KY3A 4B74A 2YHUA 1NL3A 3H1AA 5BSVA 4A2QA 5EZYA 3T9CA 3GT4A 1PLJA 2NUAA 4QNMA 5IMSA 2DPMA 3SI7A 3ER9A 3EBPA 3D8UA 4FI3F 2QAGB 1PR3A 3CZPA 4L27A 3ZI7A 2EHDA 4YREA 1P0PA 4INZA 1LRJA 2XW6A 3P94A 3V6MA 4ARIA 3KZMA 5ECGC 4YP6A 3ZWQA 4FJ2A 2HAEA 3GPBA 4QXQA 4G8JA 3GZNA 3UAWA 4MWTA 2W42A 4ZVKA 2A84A 4AKEA 4X7PA 2LE0A 4DCVA 2ZWVA 2V3CC 2QTFA 3SHOA 5DK4A 1A76A 3UKJA 3ANXA 4BXOA 2G9QA 1T0BA 3WDKA 4NOJA 1SCBA 1CDZA 3ZE1B 1YVDA 1RRMA 1S1CA 2QD4A 4KAJA 2QAIA 4R9NA 4N47A 4YECA 1OILA 1QVWA 3RT9A 3B1KA 4KMOA 3GH1A 4CLXA 1R0BA 4YQYA 3U6BA 4RTRA 3P9KA 2C9ZA 2ERYA 2C3MA 1UDWA 3T4PA 3GVXA 3NTQA 1KYZA 3E2PA 3PK0A 1JJFA 3UAVA 3W06A 4C2BA 4EELA 2C7OA 1GQSA 3BQNB 3QXSA 5DHUA 5JBQA 3A6JA 3T3NA 2FOLA 2Q3HA 1LKZA 4KR3A 1IHOA 4L85A 1RE0A 2AW3A 2OO5A 2PBZA 4M38A 4U7DA 4B6GA 3GAFA 1QP8A 2WNHA 2H8GA 3KOWA 1ZD9A 3KQUA 5TT1A 2I62A 4KJXA 3KLNA 5IULC 4QE3A 1KDYA 4OBBA 1L0BA 2ZAIA 4JC5A 4C2UA 1V2HE 1KI4A 3GJSA 2FR0A 4KI0A 3AINA 3P7MA 4OI2A 4OQXA 3E82A 5CX1A 1JG6A 2WRZA 2YIJA 1YS6A 1J49A 3F3KA 5IJ0B 5IT9A 1YR3A 3D3EA 4F5YA 3J80A 1FZQA 1NP7A 1JILA 1DXHA 3HWWA 1R6AA 3N6RA 4GZLA 4B6OA 5B12A 5HOQA 1ODLA 1W7AA 1J7KA 1XZNA 3GFRA 3VR5A 4JCOA 3NKFA 2I78A 1E92A 4YUZA 1I1OA 4MEAA 3DP7A 2WM9B 2XNKA 1WMFA 3AR6A 4UUPA 3ZGVA 1Z7GA 3GVHA 4GC9A 2QN1A 2OYRA 3SLGA 5AOAA 5MF6A 3AKZA 3MFYA 2AQKA 3HE3A 4BGUA 1E1MA 2IJGX 1Z2NX 4NF2A 4P32A 5AFSA 5TQJA 1VA4A 4M53A 3UMYA 4D8VA 4QXOA 4IXWA 4NECA 3I1YA 4PGAA 3T7RA 4Z1MD 5EHNA 3F6YA 4E5DA 1QANA 4DQKA 1MVNA 1Z0SA 3NTOA 4ZRNA 4EENA 1UAGA 3LY9A 4NHOA 2G1PA 1WSDA 2CLHB 2ZIGA 4MS4A 4PYRA 1T2UA 4CU5A 3V4PB 2UZIR 4RZXA 2MYUA 3NVDA 3O5AA 1W5EA 2QPAA 2OGUA 2H1LA 4IW3B 4NPAA 1NM5C 1P29A 1U0OC 1U7XA 4LYGA 1JU4A 2X0NA 3K6SB 2PMBA 1S9HA 5KREA 3CX8A 4HXGA 1RQPA 2HQSA 4WCVA 1VLZA 5IM4F 1LDMA 3B13B 2I76A 3T06B 1VSBA 2R8RA 4ZREA 1DOAA 1Z0JA 3AV0B 4HLNA 1T1GA 1O94C 2UUOA 3JRNA 1W5BA 3AI2A 3Q88A 2GF9A 2O2CA 2CXHA 2G0TA 2J41A 2OT3B 4GC5A 4LVUA 3ZXSA 5AW7A 1U7PA 1UJNA 2WSSA 4PGHA 4H7DA 5CR9A 2A0YA 3RFUA 2GESA 1GAEO 2N9UA 1G8MA 2P9TA 2PX6A 2Y99A 3EF0A 3O0TA 5JAMA 5LD2C 1G20E 1HETA 2FMUA 3DDUA 3KWLA 3IHWA 4JLDA 1F3OA 1BWRA 3OQ6A 1ZH6A 4P83A 5HHTA 1U7TA 4B6SA 4O1IA 2CMHA 4JVLA 2DFDA 1Y89A 3NP7A 4PBSA 4DA4A 2ZJ0A 1SFRA 4BO6A 4BWFB 8ABPA 2NU9B 1E1RD 2C9CA 2E7ZA 2OC9A 2VHXA 2DQYA 3B52X 3T5CA 2WIGA 3OLQA 4F4DA 1G8KA 2QMUA 3DXXA 4QTUB 1IC6A 3IMKA 3HUFA 1C30A 3BMCB 1XLUA 3T9FA 1XQWA 1FRNA 3B82A 2OV6A 4OI1A 2IIPA 3L04A 4FDTA 3IUMA 2V7GA 2ZS8A 1EFVB 3JWGA 1BAPA 1XDWA 2B4TO 3CMCO 3TOCA 2VDLB 4E0BA 4ZMRA 2ZU6A 1JAYA 4AQDA 4PYLA 1C4KA 1M34A 1SIBE 3T61A