1RI3A

Structure and mechanism of mrna cap (guanine n-7) methyltransferase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
252
structure length
252
Chain Sequence
SKTINIRNANNFIKACLIRLYTKRGDSVLDLGCGKGGDLLKYERAGIGEYYGVDIAEVSINDARVRARNMKRRFKVFFRAQDSYGRHMDLGKEFDVISSQFSFHYAFSTSESLDIAQRNIARHLRPGGYFIMTVPSRDVILERYKQGRMSNDFYKIELEKMEDVPMESVREYRFTLLDSVNNCIEYFVDFTRMVDGFKRLGLSLVERKGFIDFYEDEGRRNPELSKKMGLGCLTREESEVVGIYEVVVFRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of mRNA cap (Guanine-n7) methyltransferase
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transferase
molecule keywords mRNA CAPPING ENZYME
total genus 81
structure length 252
sequence length 252
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2003-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03291 Pox_MCEL mRNA capping enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ri3A00
4HTFA 4WVLA 5JR3A 3SSOA 3FRIA 5DX1A 1WXXA 2NNWB 4OQDA 3HA3A 1JG4A 2G72A 5DSXA 3E8SA 3MGGA 4YV2A 1QYRA 2XYRA 1VP3A 4HC4A 2CMGA 3PT9A 5KVAA 2FK8A 2P7IA 3B3FA 3CJQA 1X1DA 3DOUA 3EVAA 3UA3A 1NW3A 4E30A 2PKWA 2JHCA 3CCFA 4IV0A 4X41A 1L9KA 1JQEA 3KR1A 4PYNA 5BXYA 2FRXA 5HILA 5F2OA 2IH5A 4ER5A 1NW6A 3G7UA 4PIMA 4OX9Y 1IXKA 2YVLA 3C3YA 4DM3A 4GF5A 5EIFA 1FPQA 3DULA 3P2IA 3KPJA 4KIGA 5CVDA 4PNEA 5B1SA 5LQCA 1MHTA 2R3SA 4GUAA 3KQMA 3LBYA 4CXMA 2PT9A 1XCJA 4PINA 3EMDA 2ONZA 1INLA 3AWIA 1Q0SA 4QPPA 3MTEA 5EMLA 3UA4A 5DXAA 4ATNA 5JUWA 4C06A 3OU6A 2XBMA 4OA8A 1XCLA 4F84A 1FP1D 2PT6A 5HFJA 2NXJA 4DMGA 3R9XB 1D2HA 5EGSA 2HMYB 2ZW9A 5FA5A 1YZHA 4FP9A 5DTMA 4PYJA 2I62A 3QV2A 3AXSA 3FUTA 1AQJA 2YXEA 4F86A 3OZRA 3UJCA 3OFJA 2Y1WA 2IP2A 3RW9A 4FSXA 5GWXA 3THSA 3SSMA 3EVFA 2PX4A 5EZQA 2FPOA 1G60A 3GGDA 4E2YA 2DPMA 2WA2A 3B7PA 3NDIA 3NWEA 3KR9A 5E8RA 3LGAA 2PXAA 4C03A 1NW7A 2YQZA 3HTXA 4QVKA 4POOA 2O0LA 2PX5A 2R6ZA 2F8LA 2ZBRA 2ZTHA 5K0JA 1D2CA 1N2XA 2AOUB 2G71A 4KWCA 5DT2A 5EEGA 1P1CA 3VC1A 4KVZA 3M4XA 5H02A 1ZKDA 2BH2A 2O07A 3TMAA 5C1IA 3HCDA 3A7DA 3EVGA 5LQJA 2NXEA 5FUBA 4DCGA 1AF7A 2I6GA 4MTLA 4EQZA 4H0NA 4XUCA 2V7EA 2VDVE 3ELUA 3TKYA 2XYVA 3NVMB 4KIFA 3OU2A 2C7PA 3HCCA 2A14A 2QRVB 2CMHA 4Y2HA 3HNRA 1AV6A 3I53A 4M7RA 3ELWA 4RVHA 3LSTA 2WK1A 1KR5A 3SXJA 3C6KA 3ELYA 3FTEA 1SUSA 3FPGA 1DUSA 2ERCA 4A6DA 2ONYA 5FA8A 1P1BA 2FK7A 2PWPA 3OPNA 5LQUA 5M5BA 3GDHA 5FULA 3B3GA 4RVGA 4CTJA 5LQKA 2UYOA 4PGHA 5T64A 2ORED 5K0GA 1TW3A 1NW5A 5E1DA 3PLAE 5D1HA 1HNNA 4QVGA 2BZGA 1WXWA 1RJGA 1X1CA 2G70A 3UZUA 4E2WA 2ADMA 3CKKA 3FUVA 5EG5A 4DKJA 2PWYA 3UJ6A 4E32A 3T7SA 3KQTA 1DCTA 1RI3A 5E1BA 5FWAA 3P9CA 3BWYA 4OQEA 3LCVB 5LQRA 2P41A 5DM4A 3MHTA 4C4AA 1G6Q1 5K0EA 1VL5A 5KQSA 5DTRA 2JHPA 2IH4A 1O9GA 1KPHA 4PYKA 4GC5A 2ZIFA 3WSTA 3LHDA 1QZZA 3DP7A 3NDJA 4KDRA 4RTPA 1JSXA 1NV8A 1VPTA 5EOVA 3T0IA 1JQ3A 3TLJA 4X1OA 4UOEA 4C04A 2IDKA 1JG3A 3KPWA 3KQSA 3MERA 3DLIA 3FUWA 4RWZA 5F2KA 3FTCA 4EKGA 7MHTA 1ORIA 4RSRA 5CCBA 1SG9A 3L8DA 4YMHA 2VP3A 3DH0A 1YFJA 2GLUA 2GB4A 2PSSA 3DXYA 2BR5A 3TOSA 3TKAA 4LECA 4BLWA 3PS9A 4GQBA 3AJDA 2YR0A 2UYQA 2V74B 3KPUA 4IKPA 5KYGA 3ER9A 1BC5A 5CVUA 3B3JA 3HVKA 1ZG3A 5DM0A 3G89A 3M6VA 2OO3A 4MQ4A 5KQRA 4P7KA 1EJ0A 2EFJA 2HNKA 3SSNA 2O57A 4MWZA 3TPZA 3CBGA 4RTOA 3E23A 5FHRA 3K0BA 3TM4A 1NKVA 1UFKA 2PLWA 5GP1A 1TPYA 1T43A 2QRVA 5LQNA 1L1EA 5K0BA 2JH9A 1M6YA 2CWWA 3EGIA 4NECA 3EMBA 4X63A 4XUDA 3NMUF 2GH1A 3KPVA 1X19A 3ID6C 1ORHA 3P9NA 5K01A 3BWMA 3G2OA 1YFLA 4RTLA 2AVNA 1SVUA 3R3HA 2JG3A 3OE4A 2P40A 3JWGA 5IH3A 2QM3A 4PWYA 4XUEA 2PX2A 3FUXA 1KPGA 3FZGA 2HWKA 5EPEA 4V0RA 3AXTA 3THRA 1YUBA 3DR5A 3FRHA 3A26A 4O29A 5GIOE 3PVCA 3ELDA 3SGLA 1RI4A 3FYCA 1AQIA 1SQFA 3UJ8A 3LKZA 2ZIGA 4P7FA 3B5IA 5EC8A 2YTZA 5DRYA 5GIPE 4M37A 2IIPA 5FADA 4RTMA 3EGVA 4MIKA 3MAGA 4P7JA 2IFTA 4PYMA 4DQ0A 2ZWVA 2P3QA 5D1NA 4F85A 4HSGA 3Q87B 4PONA 1VE3A 4R8SA 1WZNA 3A7EA 4YV1A 3BKWA 3OFKA 4PCAA 5E9JA 1QAMA 3LL7A 4G56A 5EEHA 4A6EA 2XYQA 4QDJA 5K0NA 3GRVA 3X0DA 1RJDA 3M6UA 1Z3CA 4GOOD 2AOVA 5T6BA 4BLUA 5DLYA 2AOTA 5EQJB 4E2ZA 1ZQ9A 4QQNA 5CVEA 3PB3A 3GCZA 2VDWA 4QTTB 2GS9A 2QYOA 3E05A 3E7PA 1F38A 2JHAA 3B89A 4GOND 4PIPA 5E2BA 5HEKA 3KQOA 1MJFA 4YMGA 5BW4A 2HR1A 5DPMA 3PX3A 3OU7A 1B42A 2ZZKA 4GEKA 4OBWA 2IBSA 5GOZA 2BM8A 2PJDA 4QQKA 2ZBPA 3CVOA 4P7GA 1KPIA 3HCBA 4HH4A 1RI2A 4Y30A 3SR4A 3O4FA 4QTUB 3P2EA 4EK9A 3I58A 3MB5A 3LKDA 4ER3A 3NVKI 3TFWA 3MCTA 5GM2A 2HV9A 5DRTA 2C7RA 2IDJA 3EVDA 1XDSA 2VS1A 1VLMA 3CJTA 3MTIA 3G2PA 5EVJA 4R05A 4CWAA 2JH8A 3A27A 3NJRA 3F4KA 3OZSA 5LSAA 4RTRA 2H11A 1WY7A 3G5LA 4C07A 2EX4A 5E1OA 3C0KA 4GC9A 3KQPA 3ANXA 1FJXA 3FTDA 3LDUA 1ZGJA 3M6XA 3PFHA 3EPPA 4FT4A 5FTWA 4Z2YA 4ER6A 1N7JA 4RTNA 1NBIA 3OCJA 1RJEA 3LDFA 3TM5A 1M0EA 2VZ9A 4DZRA 1Y8CA 4RTJA 2B9EA 4P58A 8MHTA 1OR8A 3C6MA 4EKIA 2ZFUA 2ZCJA 4U7TB 4U7PB 4HGYA 3LCCA 4R8RA 3OE5A 3SMQA 1JSZA 3KPYA 4ISCA 2Q41A 5E9QA 1RI5A 1G38A 1P39A 4PYIA 1M6EX 3UJ9A 3EEYA 2PGXA 5DWQA 5CIYA 1NBHA 3BT7A 2H00A 1G55A 4E33A 1SUIA 2NP6A 3UWPA 2Z6QA 4IV8A 5K03A 3TRKA 3CC8A 5DSTA 3CJRA 3EVEA 3ORHA 4FT2A 5DM1A 4AZTA 4DA4A 4LWPA 4C08A 4RX1A 4WXHA 2P8JA 3VSEA 4RTKA 5ICCA 3K6RA 5EZSA 3AY0A 4MHTA 2AOWA 3DMHA 1BKYA 3DUWA 2ZZNA 3QOWA 4M38A 2BR3A 2O05A 3KQQA 2GPYA 4X60A 4PYLA 3HCAA 1KHHA 1R8YA 4M36A 1R8XA 5C9ZA 4EMSA 5EHGA 5K05A 1L3CA 2NYUA 3I64A 3GIWA 1VQ1A 3HCFA 3NWBA 4PYOA 4ZTBA 3SVZA 1YF3A 5EIWA 4RTSA 5GM1A 2IH2A 3KR0A 4LG1A 2O06A 3UJAA 5DX0A 3GRUA 1WG8A 4CKCA 1IM8A 1VIDA 5LQAA 2ZWAA 5K8VA 4CTKA 3DTNA 5U4XA 3R24A 5CVJA 3LDGA 5F2NA 2GA9A 5DX8A 1QAQA 2AS0A 4QPNA 3P2KA 2N47A 5ICGA 1YZ3A 4CKEA 5K0LA 3P8ZA 2IBTA 3BGVA 1SKMA 3HA7A 3HM2A 2B3TA 4HTFB 4R6XA 5ERGB 2XVAA 5E9WA 3HVIA 3GRYA 3G2MA 2GAFA 1KYZA 2JJQA 5E1MA 3T7TA 2NP7A 3PFGA 2PBFA 3UBTA 3S68A 1JG1A 4RTQA 2HTEA 1F3LA 2AOXA 2OPBA 4V0QA 2P7HA 5CM2Z 3T7RA 1JR4A 3LX6A 4HRAA 2OXTA 2AOTB 2BR4A 3GWZA 3VC2A 5K0CA 1EJ6A 4AUKA 4GBED 4BLVA 1EQAA 2Z6AA 2CL5A 3BWBA 4OBXA 2YXDA 3IEIA 5DXJA 5FQOA 5P8WA 1PJZA 2UYHA 1D2GA 1N7IA 2AVDA 2PXXA 5ICEA 3TQSA 3D2LA 3KKZA 2UYCA 2B78A 3KQVA 2OY0A 2YUIA 3V97A 2YXLA 1KP9A 3HVJA 3RIEA 1FBNA 2EG5A 3FYDA 4BP3A 1EG2A 2BM9A 3JWJA 5HIIA 4DF3A 4E31A 5GINE 1X1AA 3TR6A 1HMYA 3P9IA 3KQWA 5FCDA 3V8VA 1O9HA 2AN3A 2I9KA 1V39A 3PX2A 1XVAA 2ESRA 3HCEA 2ZVJA 3BWCA 4QDKA 2ZLBA 3NW9A 2ZZMA 3FPEA 3H2BA 3R6TA 1O54A 3G8AA 3KHKA 5FWDA 1I4WA 3VYWA 2FCAA 1XTPA 3ME5A 4E70A 1RJFA 3FTFA 3EVCA 1KXZA 3NTVA 3GRRA 2K4MA 3DLCA 1XDZA 2PVCA 3M70A 2PY6A 3P97A 1JTEA 2ZBQA 2IGTA 4KW7A 4L7VA 1DL5A 1BOOA 1EAMA 3BZBA 3EGEA 3FUUA 3G8BA 2NXCA 5E8JA 5FHQA 4PYQA 4YUVA 3C3PA 1P91A 4FS8A 4YUWA 4BP1A 4YUXA 3HEMA 4RVDA 5HIJA 1KYWA 5HIKA 3M33A 1R74A 1XXLA 2P3OA 3O31A 3A4TA 4FSDA 3SX0A 3OZTA 4ER0A 5EMJA 3KR2A 3A25A 3UJDA 3BGDA 3GO4A 5E2AA 5HZMA 1X1BA 3IYLW 2ZULA 5HOQA 3LBFA 2Z6UA 5G02A 3R0QA 4E2XA 3HA5A 3I5UA 3UFBA 2AN5A 4X61A 3HVHA 3CGGA 5IKMA 5HIMA 1G8SA 4PCLA 2DULA 3Q7EA 5MHTA 4OA5A 3G5TA 1SQGA 2I7CA 4ER7A 2C7OA 4EVIA 3SM3A 2E5WA 3FPHA 4RYLA 4AZVA 2WA1A 3GNLA 5BP7A 4CKBA 1NW8A 1NV9A 3JWHA 4R6WA 2NXNA 1IY9A 1TW2A 2AOUA 2B2CA 2PV0A 3LCUA 2FYTA 4AX8A 4C05A 1U2ZA 2B25A 3ERCA 1JTFA 2EJUA 1UIRA 1NT2A 5DTQA 1G8AA 1PRYA 4JXJA 3M6WA 1EIZA 3BXOA 1Q0TA 2G1PA 1FP2A 4DCMA 4GOMD 4HG2A 2OKCA 3FPJA 4KDCA 5BW5A 4AZWA 1JG2A 3GRZA 1R6AA 1I9GA 2AR0A 10MHA 3QOXA 2OB1A 3DXXA 4KRGA 1VBFA 3BUSA 1UWVA 3HP7A 4RVFA 5CD1A 3P9KA 5K0FA 5EMMA 1ZHFA 4YUYA 2FHPA 4HGZA 1I1NA 2OB2A 2KW5A 2LD4A 3FPFA 1YB2A 3JWIA 1BHJA 5KS2A 3MQ2A 3GU3A 4YV0A 3EVBA 5EHIA 5EKUA 2OBFA 1XDUA 9MHTA 2ZIEA 2CKDA 3EEOA 4PGGA 3I9FA 2QY6A 5EMKA 3DXZA 2EJTA 4IWNA 2UZ4A 1RI1A 4K6MA 3G88A 3REOA 5LR6A 4FR0A 4FGZA 3RODA 3MCZA 5ICFA 3ER8A 4B17A 1NE2A 2OZVA 3DMFA 1R18A 3G2QA 3O7WA 4BY9E 1VP9A 2YX1A 3DMGA 2P1DA 2QE6A 3IHTA 2P3LA 3KU1A 5DM2A 5T67A 2XVMA 2VDUE 4AZSA 3LECA 3PTAA 3LPMA 3P71T 2IPXA 5FQNA 1KIAA 1L3IA 1QAOA 2G8NA 5EKXA 4FZVA 1ZGAA 3GXOA 3U81A 2P35A 5C0OE 1WS6A 2Y1XA 4RV9A 2AN4A 4XCXA 5CVVA 2PXCA 1JQDA 1R00A 3IV6A 2PX8A 3KQYA 4LWOA 2ZSUA 5CCXA 1L3BA 5K09A 3GJYA 1H1DA 3BGIA 4GOLD 3UJBA 2OYRA 3EVZA 5CUQA 2H1RA 4YUZA 2C7QA 3BKXA 1QANA 1XJ5A 3UJ7A 2AZTA
chains in the Genus database with same CATH superfamily
3TLBA 1VGRA 4YV7A 2WP0A 3PWTA 3AR2A 2Y0CA 4LWQA 3RTAA 3H5TA 5H3CA 3W2EA 1BHQ1 3SZRA 2GYWA 4X97A 5D8DA 3B2QA 1KR2A 1W4RA 4K6OA 4Q1BA 3T0FA 4INJA 5KYTA 3HGMA 3RK1A 5LYJB 3GQBA 1SU6A 2ODEA 5EJ8A 2W2MA 5PNTA 4RH1A 1GN8A 4KXVA 5EIHA 2Z83A 5LQSA 1DQNA 4RPLA 1E59A 1E99A 2XOKA 5CJ2A 4PYNA 1ZMRA 3LHSA 5M04A 3T61A 1LEHA 2HBRA 1RYBA 4NMMA 2O6HA 4FWBA 2OAQ1 5B1EA 5CBPB 1FFXA 1GLNA 1FXWF 1LJUA 4K8RB 5HM8A 4YVFA 4A5OA 4JI0B 4C2TA 3HKBA 3DMPA 3KPJA 1DAHA 3NNDA 3NUGA 4K9NA 3KOZA 2H4WA 5JH7F 2FX3A 1NBEA 4FOSA 1BJRE 1XTTA 4KITB 3DZFA 3NC0C 3TDMA 1KI6B 3TAHA 1D07A 4JJ4A 1IRIA 1PUXA 5CFOA 3HY4A 4UNPA 1ZAYA 3R9XB 4R0NA 3N8HA 5HX7A 2V03A 3G1UA 1IWBB 5AXAA 2Q5LA 2YINC 2O3SA 3QW2A 4KXXA 1P9RA 2D54A 4ZRDA 1G8KA 3ZHRA 1XEWY 3AXSA 1FFYA 1R0KA 1ZNZA 2W7TA 2ZRCA 4TROA 2JAPA 3V8EA 1HZJA 2FZLA 2NTNA 3EOAI 1U8EA 2XZLA 1N5LA 4KQHA 1NGSA 5BSVA 2NSJA 1G18A 2RD2A 2HFJA 5E8RA 1VKJA 5LZ5A 3PIRA 1AKMA 4IQ8A 1NW7A 2VDWB 3LLVA 1V3TA 4POOA 5IKEA 5EXTA 5IWAB 1RWXA 5I45A 4OUKX 4A0RA 5K0JA 2B7LA 1T4MA 3U49A 1N2XA 2AEEA 2WJWA 1EUDB 3V1TC 3VC1A 1KWGA 1P1CA 1RBZA 4FQ5A 4U3JB 3TLGB 1JLHA 1GGMA 3O03A 3PTLA 3QU4A 1BWSA 2Z9BA 4FEGA 4BX2A 3K6SB 2W2PA 4JXKA 3FPKA 1P7CA 2J9FB 4C6HA 2DPGA 4C4PA 2H4FA 3NPAA 2X1MA 2G0NA 2XODA 2F2TA 4HYEA 4BFXA 3NQ41 1CDDA 3EXG1 3C6ZA 2Q1XA 3OJFA 4LSZA 2QENA 5ALIA 5T3UA 5JCOC 3RAEC 2JD2A 2J30A 1PR3A 4LQLA 1L5NA 2YV4A 1PIWA 1ZI6A 2W6ZA 4ISBA 4Y2HA 5BN3A 4XWWA 5IAJA 1DINA 4M1KA 2FF5A 2WYIA 4CMEA 4RVHA 3DVAA 5CA1F 2RGEA 1XN1A 1C30A 2AG6A 2QXTA 3MUOA 5J5VA 1E3EA 1X7GA 1HH4A 3VR4A 2PR7A 4YFYA 1JG7A 1L5FA 1CBUA 2E6KA 2XQGA 3A28A 5AP9A 3TJMA 5LQUA 5DMXA 2Q99A 4YXWD 5BYJA 3GP5A 1P4RA 2QE7A 4RVGA 1KMQA 3DC2A 4PGHA 2FVXA 3V6MA 1V6SA 4X7MA 5D1HA 3AF1A 1D1TA 4J3NA 4ZTZB 4BWFB 2VP0A 1KU6A 2YMPA 5IDYA 2G70A 2H16A 2XNDA 5BV7A 3WLKX 1T0HB 4YT2A 2JLWA 4XVCA 2QPAA 3QUAA 1SBHA 3CF2A 4J3FA 3FYTA 3K9FC 2HU7A 1XNJA 1NP3A 1U7OA 5KQSA 2C2YA 3EPJA 5BN5A 2OXEA 1G5RA 3GOQA 2FR1A 4RHUA 2PT5A 3PXCX 1QE5A 1CRLA 2EERA 2RGUA 3G9XA 2BEKA 2V9CA 1QTNA 2GZ3A 2QP9X 1V11B 4REQA 4UHJA 4ND2A 1OIVA 1FDRA 1QC5A 4PBSA 4HNQA 1RYNA 5ILQA 1Z25A 3HPQA 2H8GA 5EGNA 3H5AA 3MBIA 4YGYA 1L5QA 3ZJVA 2HTFA 5KI6A 1FNCA 2E89A 2WFLB 5EYPB 4FR2A 1L7OA 5C1DA 2PBZA 4LE1A 3PQ7A 5ALUA 3ZCVA 4HNUA 4PF1A 4TTVA 2E2WA 1SXHA 2LV8A 4R2KA 2FPIB 4K8OA 2Z0MA 1XZMA 1RQXA 1ZWKA 5IJZA 5JXJA 3WZLA 4ZI7A 3CVUA 3Q3HA 4RGBA 4EYEA 4FB5A 4H3HB 3F0TA 2H2HA 4ZICA 1NAHA 3KV3O 1C9MA 1EXMA 3RSZA 5JISA 1SBYA 2RAPA 4Z9AA 4C2UA 2XMZA 3F6EX 4ZAFA 5FLEX 3NB0A 4DJJA 5K01A 2C2OA 4B3MB 1N6NA 2FPPB 3H2JA 1QGYA 4UAGA 4RTLA 1DXQA 1QOPB 2W6ID 4AW9A 3H5VA 4PWYA 3QE0A 1KPGA 3KT8A 4C21A 4QDUA 4YWJA 2BFFA 2Q21A 3DR5A 2J3JA 4XGNA 3D9QX 1QIKA 5J2TA 1CEXA 5AM2A 3AETA 4Q12A 4B2PA 1L6IA 3K9LA 1TI7A 3DOOA 4DRXB 3INRA 5GIPE 2GD6A 3KJZA 3PT5A 3W3AA 5TE9A 3PFIA 5DI3B 2CJPA 2PS3A 2ZKLA 4ZEVA 4ZFNA 5AKLA 1JV2B 1KDPA 1NLFA 4DQ0A 3KE9A 3S7ZA 3Q7TA 4OU5A 4RELA 3BGWA 4UTXA 3AK4A 4LXYA 5K6AA 5M29A 2PE5A 2R6R1 3ESBA 4MW6A 4JI7B 2QU8A 3FMFA 3ZY6A 1TCBA 4XEHA 1JBKA 4XSVA 1M6VA 4X5OA 3PUZA 1M2HA 3OLZA 1G21A 1BU5A 1N5OX 3GRVA 1D2MA 4JVOA 3SY8A 1ZM2A 3VDQA 2CF6A 4B6GA 2PFGA 2YKGA 1GG5A 1XVVA 3CLTD 2O8EA 2NZYA 3R0ZA 3SEAA 4TTJA 5FA6A 4PIPA 5JYEA 1Y82A 3V34A 5DPMA 3UHJA 3JVEA 3PX3A 4CQMA 3OBIA 3ZHTA 4XFJA 1U8FO 4JLWA 1R0ZA 1XT6A 2GZAA 3WGYA 1NULA 1HDCA 1P8JA 1T5OA 4DLBA 3QW4B 4EBFA 3GLGA 1KEUA 3BXFA 3ISTA 3PHJA 3U7EB 4ZT2A 4CM5A 2NU8A 2WOJA 3TVDA 1RZUA 1UAAA 3GRFA 4EJSA 5DRTA 4UTOA 1XDSA 1V1MB 1B0ZA 1F0YA 3PZRA 4P93A 3RV3A 5IJ9B 3HJGA 5J47A 1RIIA 2WT8A 3PL5A 5CYFA 2B36A 3AIIA 5CAEA 2B7CA 3D3WA 4N3NA 2XF8A 3ANXA 2CWDA 4FE7A 4M0CA 2B4TO 2ZVPX 3BDVA 2R84A 1Z2AA 2OBYA 3JAWA 5TY0A 4ZVNA 3RUPA 1D4FA 3O8DA 4S12A 2JGLA 4R8VA 3WKCA 2HDNB 2JC3A 3EIUA 4WI1A 1LPBB 3WQQA 1GGKA 1Y8AA 4B9AA 5CEJA 4AKGA 3BAZA 3MPOA 4MKIA 4RC9A 4UPVA 4NDZA 2BI8A 3DAPA 4RDXA 3B9RA 1XYYA 4ZO8A 4B44A 1L6RA 4KLZA 5LP1A 5A9RA 4DV2B 1LWNA 3ZNQA 2G1JA 2VRNA 3OIWA 1M6EX 3OHSX 3ACCA 4IDDA 4KXLA 4P4GA 1P4HA 3I2GA 1J9EA 1GAJA 1MV5A 1QPBA 3KTDA 5DF1A 3PXEA 2IYWA 1PT9A 3NTXA 1TRHA 3WOVA 3VYSB 3IAEA 2F00A 2NO7A 4IUDS 5DBFA 3KWJA 3PV0A 1QH8A 2XMBA 4WY8A 3THOA 3U7RA 4NOMA 1ULSA 3AWDA 5DYGA 4FGWA 3IT3A 3KYDB 4DMHA 1GKIA 1XV5A 2HY7A 1T15A 4WXHA 1NVTA 3E9DA 3ENKA 1HDOA 3OUTA 1UQUA 1MZPA 3D7KA 3L06A 4CV3A 4JKOA 2OFFA 5B4UA 2AKEA 3KAQA 4ZQGA 3ITEA 4V2IA 4P4NA 1G20A 1CUXA 3N05A 4NBLA 421PA 1I7QB 1NIPA 3FFBA 1CQPA 2IYUA 4O59O 1TZMA 1GAQA 3ZKWB 3ASYA 1E94E 3RIYA 5C5IA 1BFKA 1NE7A 1VBNA 1W85A 1AV7A 3TG8A 1H6BA 1KAEA 1Z0IA 1XZJA 3GFGA 1SVWA 1MU0A 1NJ8A 4XYEA 1N25A 3L7KA 3LYAA 1YHZA 2JATA 3OJWA 4G6ZA 4MUAA 4A36A 2PMCA 4FX5A 2YWEA 2VP6A 1GN9A 1XLWA 3CLSD 3P5SA 4UBIA 1U3FA 3ROZA 3P9RA 3WICA 2PGOA 4NV3A 4EAAA 3DKRA 4ND3A 3TB4A 3TLAA 4KE9A 5BUQA 3LDGA 5IP5A 3LOUA 2AEFA 3HU5A 3K4QA 3NBXX 4GYWA 4KH1A 2GPWA 3N2KB 5AKJA 4YY3B 3HM2A 3QV1A 1RRFA 5ERGB 3PVSA 3NVAA 2XWPA 3ET4A 2PQ6A 4M99A 2ZI5A 1GV1A 2VCHA 4S1TA 1R10A 4UDNA 1A97A 2XT9A 1GNTA 2G4VA 1GGVA 1XMOB 1UH5A 3T3NA 1MX3A 3RKRA 1MPTA 2QI9C 3N2EA 1Z6YA 3I1IA 5LP6F 1SEVA 4IIGA 3EGWA 2I7TA 4HRAA 1H4SA 1E9FA 1SQ0A 1L9XA 4S1WA 4DCVA 2YNMA 3BREA 5B7NA 4FE3A 5ENDA 3G2HA 1I2ZA 2HMWA 1QDEA 3D6HA 3T9EA 3Q88A 1H42A 5KTKA 3JD4A 4X1YA 2PZGA 1B6RA 1F4LA 3IHKA 1M0EA 1E1CB 2I6QA 2CL6X 3R5FA 1CUUA 1O58A 2I7VA 3HFJA 3N6RA 3TQSA 1OWOA 2HI0A 4B34A 3MT0A 4Y6PA 4F21A 4Z4QA 4WA7A 4MQEA 4N6OA 1SUBA 1Z88A 3HGTA 4HS9A 1KP9A 2QWXA 1SBIA 3HVJA 1FBNA 4D9KA 2DERA 4DF3A 4CMCA 4RZIA 1FPMA 1E1LA 4NFHA 2QIOA 2IUSA 4D56A 1XAJA 2AN3A 1V48A 1QYXA 1R4NA 4ZI5A 3W79A 1YK1A 1MP0A 5C1BA 1XDBA 2AX4A 4ZDJA 1QB7A 1VRCA 3G8AA 4B3BA 1H6CA 3WDMA 1ESMA 3UT5A 1XTPA 1H8HA 1OT5A 1FFCA 3EG5A 3D8SA 2R86A 1WM1A 1CHDA 1P73A 2Z9DA 3P97A 4L7VA 1RLOA 3DT9A 2FLWA 2IYZA 2EJCA 2N9UA 1PEKE 5AOBA 3WK5A 1K89A 3M3PA 4AJOA 1P1KA 1P91A 3C3PA 5JBIA 4KYVA 3P5BA 4JCCA 1BJKA 3RUFA 4EO4A 2RGXA 2ZROA 3AVOA 1IFXA 4Y2PA 3ZS9A 4WW0A 2A5DA 4G2NA 5KSOA 1Q6YA 3FPAA 2D2VA 3S5UA 4EW6A 1YK0A 3SNHA 1Q12A 2VDKB 1C9NA 1ZOIA 1PJAA 2AC2A 4M60A 3GMSA 4HMOA 2L19A 2P9CA 1V8BA 2ZUSA 2DBYA 4G5QA 4R3WA 2OV8A 1T9ZA 2HXGA 3IPLA 3TBKA 3T4UA 5IKMA 3KLNA 1BW9B 1YDHA 1YR2A 3DNFA 4ZVPA 2C7OA 4PG6A 5DYWA 3TINA 3FIJA 4ZJZA 1MDFA 1E6MA 4ZVKA 1DKOA 2CEAA 4TYYA 4BLTA 5GQSA 2Q50A 1QRSA 1GZ3A 5ANRB 4MWEA 3DUFA 1NVFA 4CKBA 1NF2A 3IXMA 5JNLA 2JLUA 3AQIA 4AX8A 2AOUA 1MXFA 1LX6A 3DEYX 4UE2A 3T5CA 1GZ5A 5AIBA 1Y6GA 1P81A 2BMVA 3DEZA 4RLFA 4TKUB 4XSHA 2J9FA 3NXKA 4NPAA 2R6AA 3BXOA 1P2FA 4QT4A 4GOMD 3AFGA 4TMWA 3A1SA 4JS0A 1SCQA 3RK0A 4L9AA 1EUDA 1V47A 3GGGA 1CUGA 1UXJA 3DVSX 4JLDA 1Y5LA 2XDAA 4GI5A 1U5CA 2NN3C 2CLHB 2ZRHA 3IOBA 3LMKA 3QPVA 2P5UA 2XD9A 4EQ6A 1PT8A 4URVR 2ZAYA 4ND7A 3AHEA 3FDXA 2GM3A 2H2FA 3KUUA 4OMDA 2P2YA 4PZDA 4KDEA 1EX7A 2G82A 5LLTA 2VPWA 2ACKA 1JXMA 3FSGD 3HWRA 3NIDB 3Q7RA 5KTYA 2GCGA 3OE7D 1G8FA 2P3SA 2EKQA 4L50A 4A0QA 4CHTA 3DWFA 3EIWA 5I7SA 1WHSB 2DBZA 3JQ6A 4Y9RA 5EKDA 1I7SB 2JGAA 5TR9A 3T7IA 1MB9A 3CXRA 3OVMA 2E21A 1H2FA 4GZ3A 4NCIA 2Q7OE 4BUCA 4IUYA 4P0TA 3OA2A 2ZDHA 4KGZA 4II3A 3FNEA 4EMBA 2O2CA 3SZUA 3A6ZA 1WDKA 2BY4A 1FTYA 1M8GA 2XDWA 2FPLA 1HURA 3PQ3A 4C4OA 3AV3A 4YMSA 3ZHQA 3X2FA 1X80B 1W4ZA 4WUVA 1TEXA 2X1HA 2CVOA 1P18A 2XIQA 1H2WA 3W1WA 3KT3A 4HDCA 1YR9A 2VTKA 4X7BA 5EKXA 2P35A 5C0OE 4EA6A 3AHCA 3GI1A 1RWPA 1GLGA 2QSJA 2VC2B 1HF3A 3C7KA 4XCXA 1KE1A 3S2GA 4Q4LA 3IT2A 3RTBA 4AJ4A 2JLXA 2ZSUA 5JMWA 2BM1A 1DFIA 4RY9A 2AFRA 3JCZA 3IGFA 2C7BA 4I6JA 2G9UA 4GR4A 4DRXA 3TD2A 4FGKA 4GUDA 3IQEA 4QBKA 4AF7A 2ZJ7A 5J43A 2Z5GA 5KNCH 1ODIA 1UWKA 2G07A 4FMDF 4ZPXA 1DELA 4LN1A 4U7DA 3WYAA 3GZTB 1RRGA 2UYYA 3ZDBA 1XVUA 2J9GA 1SZCA 4L73A 4W8HA 1SVOA 1WEKA 5MN5A 3H1BA 1FUEA 3F46A 1NW3A 4R8MA 3EIOA 3JRXA 4TLLB 1ZXXA 3EULA 4IV0A 4EHFA 3TDKA 1YV9A 3ZUPA 1ZUHA 2WUDA 1VL2A 3FNRA 3ABOB 2QORA 1EZZA 3O3MB 1XZDA 1PZGA 3EPRA 3ZWKA 4CEJB 4N18A 1U2RA 3N0XA 3L4SO 5K4AA 4UEQA 2SICE 1A9QA 1TD9A 2HRBA 2JLBA 3U4GA 1UWCA 1AN9A 2GFIA 2NX2A 4PX2A 2IV3A 5AW5A 5ITZA 4H6VA 4K1XA 1JIUA 1Y3CE 2DMRA 3HZHA 4XTCS 3QIVA 5DXAA 3WE7A 4ATNA 4C06A 4OA8A 3N70A 4Q66C 5JWHA 4LAFA 2MSLA 4KEAA 2HMVA 2W6OA 1HOXA 3D7RA 4QUHA 4ZC1A 3B3AA 5KTOA 3RFTA 3L6EA 3UGQA 3DMTA 5CLGA 1D8AA 1T1EA 2D2XA 2FE1A 1IDOA 3FUTA 5ECYA 1QM5A 3KBOA 4N3GA 1HYGA 4R41A 2P0AA 5BR1A 4IJMA 3OFJA 1GZSA 3JTEA 2GTHA 3M1YA 5FLYA 3TQTA 4B2IA 2Z3VA 3THSA 1EXVA 1OW3B 1UAGA 2DPMA 1WIWA 2FFHA 3Q3IA 3RYFB 1ZJYA 4RMHA 4C03A 1M3SA 1W0JA 3AUYA 1W9HA 1X14A 3FH0A 2DR0A 3MYRA 2ZTHA 2VKQA 4E7PA 8LDHA 4C7OA 1O95D 1A7KA 1ADGA 3AR4A 1E5QA 3CEAA 1SQ5A 1W1WA 4R1QA 2A7QA 5FOVA 3M4XA 4ESEA 4BQEA 4YBRA 1Q3HA 3KDSE 1PGOA 4D8VA 2GEFA 2MMCA 4AS1A 2YWHA 4IQGA 1V41E 5DHFA 4DJAA 4LTMA 3D6JA 3ZWNA 5HM6A 4L5JA 2G0AA 2YWFA 1EA5A 5EKTA 3WP1B 2QLLA 2DWQA 4GW3A 3OEHD 4RXUA 4UJ5A 4WNIA 2CMHA 1KI9A 3CF6R 1MB4A 2SBTA 2DHDA 3MMPA 2ZVDA 1J0CA 2O2HA 3LSTA 2WK1A 4S2UA 3OEHA 1G3UA 2DFPA 3FCUB 3PC8C 1QLWA 2RIRA 2R7NA 3LP6A 2ALJA 1Y89A 5FNVA 3AEQB 3OPNA 3VR5D 7REQB 1P1HA 5FULA 3IIMA 3OIUA 4ALJA 4Y2UA 4UTNA 3NDPA 3COZA 4URUR 5G0TA 1CZUA 2VP2A 2VG8A 4GKAA 3QF4B 5I7EA 4BNFA 4OP3A 3PGA1 1DCTA 3KEMA 2PYIA 1XN4A 4C0KA 1BE6A 3PXGA 3EZ2A 4HEQA 3LCVB 3MA0A 1SFRA 5TS2A 4C4AA 1YR6A 3HDTA 1FYXA 2NSDA 4IZHA 3WS7A 2C9ZA 1O9GA 2GARA 1ZXBA 2GLXA 2QMHA 5B3KA 4JKIA 5GTDA 5K0ZA 4TOIA 2WAXA 1ULUA 3ANLA 2R7MA 4KNWA 4TMKA 1ZOLA 1AKEA 1GPAA 1RIFA 1TK9A 1ORIA 1A9RA 1RQPA 1Z7BA 2W2KB 3LUHA 2W43A 3QX9A 3GJ5A 1SG9A 4L3WA 3DH0A 1UT5A 3IIEA 3EW7A 3F97A 4GMHA 4YAEA 3IA2A 2HSWA 2Z2XA 1EK1A 3SG0A 3T99A 2GBPA 2YS7A 1GVHA 3TW0A 4ENSA 2PN1A 4Z1MD 3DWIA 2AH5A 3WLJA 3Q15C 1ZWLA 4FOLA 1J1IA 1GYQA 3CH6A 4IKPA 2PL3A 4JL8A 4M98A 3FHLA 1SNYA 4ZOCA 1ZG3A 3NZEA 4XRGA 3KHTA 4UD2A 2ZJBA 5K6RA 3O74A 2XADA 4FTWA 4KSBA 4Q9JA 1SHZA 2EFJA 1EFRA 1ZUIA 4X20A 1GAWA 1L4BA 3B6IA 4TUYA 4BN0A 4DY4A 5CDUA 4IR7A 4KR2A 3CBGA 5FBVB 2HLDD 4L72A 2G83A 3BJMA 3DZJA 3RS5A 1R8SA 1UPCA 2RK4A 3TRFA 2CWWA 3WOHA 2RKWA 1CIVA 5T4EA 1KK2A 3G7SA 3IMGA 1D7AA 1CWUA 2I2CA 2XAUA 4G1BA 4ARVA 5LP6A 4L22A 1II0A 3BWMA 3ZWMA 1NJGA 2WNSA 1THTA 1AZWA 3D1LA 5EJEA 3GAAA 3BH6A 1Z4OA 1P72A 2NU7A 2HK6A 4OP2A 4ADSG 1P6QA 3W5AA 4F7DA 3PVCA 3UGJA 2NV0A 2ZE7A 1E92A 3HNPA 4AJNA 1DVRA 2XOKD 4JP5A 1R3DA 2C95A 2W6JA 4JSTA 3ZE1B 5L6MB 1K75A 2WJZB 2YTZA 5ED0A 2DECA 1COWA 2H2IA 1E3JA 1FDVA 1VMIA 1CT9A 3H4MA 3WLMA 4LRWA 1E6KA 2O3JA 3UW1A 4HSGA 5F64A 5IUJC 1AK9A 1BAPA 1WABA 1OJ7A 1POWA 5JSUA 2KE5A 3AFNA 4B8WA 2V6BA 5A62A 3OZVA 2B3DA 4FZRA 4IMJB 4LV5B 1G9TA 1LFAA 1NWCA 1RJDA 2PIAA 3QPCA 4XDHA 4E21A 4Z4EA 3ZE6A 3E3OA 4O33A 4B7UA 1E1RA 2J3HA 1IPEA 1YVEI 4KVFA 5CNMA 3RUIA 4CQJA 1D7OA 2AFHB 4Z0PA 1DZ3A 1Q0UA 3KZCA 1T9AA 3PGXA 5DIZA 3DAGA 4OYLA 2JHAA 4KO8A 5IN4A 4TWZA 1ISJA 3C3CA 3ZCSA 5E0KB 5AD1A 2WSSD 3MXTA 4HXEB 4WCFA 5FUMA 1M0TA 5HPYB 3OTOB 3A36A 2ZEJA 3V4RA 2C7GA 1B42A 1CZLA 3FCYA 2UXBB 3L02A 1DPFA 2PSJA 2WHQA 4IRXA 4EITA 5WRFA 2BEUA 1FDUA 3FPSA 3QU2A 5IDXA 2ZRDA 1TU4A 3EFEA 4YN3A 4W63A 4KLAA 1FFHA 2XGJA 4OXRA 5E7QA 2MMGA 3FLAA 1YR3A 2X9GA 3CGWA 1LPOA 2X41A 1R0SA 2PJUA 2BJVA 1XF9A 2VS1A 4L8YA 4RADA 3EX7C 5EWMB 1YGYA 2OHHA 1QHEA 3C7AA 1G7SA 3OZSA 1W5FA 3U1VA 2ZM5A 2ILVA 1HE2A 1VMDA 1NVBA 3EVNA 4NZYA 4ZCQA 1JQBA 4K9MA 2RAUA 3OY2A 3IQFA 1NBMD 3LDFA 3B8EA 3CF0A 1GU0A 1KJJA 2UXCB 2JIMA 1DIBA 1DNPA 3FLMA 2IWRA 5IC6A 1F17A 1I94B 2W6QA 2A33A 4RKFA 4ZZ2A 4EHAA 1DQPA 1FTQA 4ZC8A 5F7XA 4Q02A 3OZGA 4U7PB 1UFQA 4R8RA 5EHQA 1M5UA 1M34E 3OE5A 5JD4A 1K6XA 3I01M 4BO7A 3S2EA 4Y0AA 1BXZA 2Y0PA 1ODSA 3AVQA 5BOSA 5LUAA 4AUEA 4C0JA 4IKOA 4CDMA 4ESOA 3QU5A 1FJHA 1G7TA 1NBHA 5BT9A 2OSBA 3KBBA 3S3TA 3SR3A 1G55A 5KJFA 4HZUA 3LX4A 1BRMA 4EL5A 1ZHOA 5FWYB 2MYNA 4DUGD 4ZGWA 4H1UA 2ZIUB 4RJKA 4D79A 1W73A 4B6SA 2JFHA 4YHBA 3BIWA 1QHNA 3VU9A 4LWPA 4OSEA 1UT8A 4YCCA 2P9QA 3ZC3A 5JG7A 3PKIA 4D81A 3N5KA 2C92A 1Q3KA 3AY0A 2VRCD 4MVYA 7YASA 5K0SA 2IS4A 3HZZA 2OVBA 2P69A 2FPMA 2VVTA 1PZFA 2JBAB 3OOWA 2OLEA 2VT3A 3GFTA 4ERNA 3S27A 1AKRA 3CIFA 4CR8A 3O8OA 2O2DA 1NDQA 1R8YA 4XTRA 4Y1EA 4B33A 1R8XA 1VG1A 2GAJA 1ADJA 1GPMA 2XUJA 3L41A 5GONB 4C5AA 3P2YA 2ZYDA 3IC5A 4YQFA 2A35A 1S3GA 4ES6A 4A2PA 1ZIXA 1T9CA 4M4SA 2RGCA 1KBZA 1VRWA 5KYWB 2QMEA 2YICA 2X0RA 4HWSA 4NJMB 1JFTA 5JT1A 4R1SA 1Y80A 4J6FA 3QFFA 5A3SA 1PNVA 1LCIA 3DTVB 5U4XA 1UDXA 3R24A 3TZHA 5JD5A 3U7GA 2O8FB 3VKGA 1J39A 1QAQA 2ZWMA 3UYLA 4DFDA 3DONA 3M6AA 4PG5A 2HSZA 5HQJA 3BD9A 1EDBA 2B3TA 5IJXA 1CQXA 2O2JA 3LXRA 3KLBA 3HB9A 1P1FA 5LYJF 3NT5A 5IS2A 3K7EA 2JVIA 4F3RA 1KS9A 3HM9A 4QXOA 2RARA 3TX2A 1FFSA 3SF8A 1BS2A 2NYAA 4DCJA 1G6HA 4E07A 1LPPA 1VSBA 5B5SA 2PBFA 3HS3A 3GAFA 4PZ0A 4LYEA 1PUJA 2H1OA 4YRNA 5KNDD 5DH9A 2NZ8A 3TW6A 4V1CI 1X74A 4RPHA 4GE0A 3RVQA 4FNGA 1VJTA 4TUYF 1KVUA 2BR4A 1D5WA 1UOOA 1MGPA 1W88B 5BQOA 4WN3A 4FJ0A 2LGJA 2VYFA 4UJ3A 1I3MA 2CL5A 3SWWA 2HMTA 2C54A 1NJ1A 3LAWA 2WUFA 2WWVD 1YQQA 3AR7A 3V4VB 4DIKA 1NU8A 1CF2O 2P4EA 4L15A 3VKHA 2QSYA 3FGZA 5KQGA 1OAAA 4C2BA 4TLDA 4BP3A 1XKQA 4PYRA 3RSGA 5LDDC 4OOEA 5GINE 6REQA 3V32A 1KI8A 4CCAA 3WSVA 2NWQA 4MJ3A 4LXHA 1J33A 4IHKA 4RHTA 1A0OA 4MO9A 1LNSA 5B4VA 3U16A 2QZZA 5EE9A 2I99A 4B3XA 1K5DA 2VNJA 5CVTA 4WSOA 2W4MA 4BEBA 1L4KA 1I4WA 3G9UA 4RD3A 3IR7A 1ODCA 3V4PB 2BHLA 3WZ2A 4MAMA 4ALIA 1Z15A 4H0FA 1KXZA 3UVEA 2A0FA 2O7QA 1XDZA 3F9IA 3HABA 4P81A 1RXIA 3BE6A 2VQEB 3G8BA 5JXGA 1XNGA 4YCJA 5JFOA 1KH1A 1WOYA 4HAOA 1LPAB 4BRZA 2WD7A 3CURA 3WI7A 5JSHA 3DHEA 1R4NB 2CVFA 1UDBA 2G06A 2WT9A 3B1ZA 3HP4A 2FAXA 4GPEA 2P62A 1XPUA 3OFVA 2XE6A 3NH9A 1Z0JA 1OJLA 1S4QA 3OZTA 3FMPB 1EA7A 4XWGA 3SKXA 4CCYB 5A6VA 5EJ5A 4AKHA 4FOTA 5FFMA 1YBMA 3L3BA 3FOWA 3PVZA 2O1WA 4M46A 5J4HA 1YHNA 3I28A 4RF3A 1XRNA 3H5WA 3ROQA 3GL9A 3LBFA 3MT9A 4DNPA 1ONSA 3TTVA 1JIQA 2GCPA 3RC8A 4PG8A 3R0QA 1ULZA 2IHBA 4QNRA 2HPVA 4WKOA 1JILA 3D5QA 3OI7A 2YV1A 4WAUA 5FPKA 5IXSA 1FJ2A 2Q5QA 1YAJA 1RAIA 2ZYGA 3AEYA 2DULA 3EUFA 4ZOBA 3U17A 4IGIA 2IEDA 3CCBA 4GICA 1LV7A 1PD1A 2JZOA 4RVSA 2PKQO 5JYBA 1NUSA 4URFA 4OU4A 1XK7A 3VZBA 5HDQA 1XVTA 1Z6ZA 3QVXA 1T8YA 4KK3A 2NXNA 1IY9A 2W6MA 1QCYA 3JY6A 3QENA 4LOKA 5JANA 2FOXA 3D7NA 3VNSA 4YCMA 4D9CA 2BUBA 1BMFD 1V96A 2XRFA 5CLQA 4AWAA 5JS2A 1QHHB 1CUJA 1FLDA 4LMAA 4FVTA 3PD7A 1DKNA 3DNMA 1B16A 1U0RA 5FWXA 4TTIA 3V3TA 2O9JA 1UJ2A 1W4AA 1MAWA 2RFLA 5GGXA 4IS2A 3F47A 1MENA 3BXZA 4HT3B 2FHPA 3HFGA 1I1NA 1MMFB 1WPGA 2WJ6A 3MCUA 2R6GA 3MLEA 3T4PA 2WYWA 5DFAA 4V3CA 1PEYA 2GNPA 3G85A 1XZCA 2QX4A 3E70C 3GLHA 1R12A 3OT4A 4R81A 3ZHUA 1VFPA 1ZSVA 3GU3A 3C70A 5D85A 1OV6A 2YV2A 4LNAA 1W1UA 5DXFA 2DF8A 1PFYA 2OCLA 1A5TA 3K9BA 5H3LA 4RMJA 2JIRA 3EEOA 3SX4A 3VU9B 2FG5A 2FPRA 1CE8A 5BSHA 2GK7A 3PIIA 4HYQA 5IUNC 1RI1A 4NFLA 4Q1AA 4KREA 2VA9A 1LH0A 2R6FA 1C7RA 3U9LA 3IDFA 5LQCA 1J6UA 3I1JA 4D8UA 5C1PA 3G2QA 3S7TA 3DMGA 1M2VA 1BDMA 1T24A 2V7TA 1N0IA 3C3KA 5DM2A 4CM4A 4LYFA 1SCJA 2IOFA 4MUEA 4N0MA 4CNBA 3PRKE 3KETA 1YFJA 2WTAA 4HATA 3ZBPA 2RI1A 1KDOA 2EBWA 4DZTA 3JQCA 1OC4A 1ID1A 5JVDB 2L82A 4YROA 1L4MA 1WUJS 4DMMA 5IFKA 1Z68A 4LSMA 5JWRA 3ICOA 3OM9A 4F1KA 1MRSA 2ECKA 2ENWA 3LK7A 4OKNA 4CN9A 3D81A 4AJEA 4V38A 3W4IA 1GR1A 4P8RA 1BA2A 2OQVA 2XMDA 3GBVA 4HNGA 2LDXA 4LHWA 2O8DA 2C8KA 4XA8A 1S01A 2CBZA 4IL5A 2H7VA 4HRYA 4NZZA 3VR5H 5CFLA 1GZ7A 2JK0A 1CG6A 2Q3BA 4PLFA 2GI4A 4Z9YA 4A2CA 3W77A 3X2SA 1AUQA 2WMYA 1SWVA 1JJIA 1FVOA 1KTVA 2H1VA 3HRKA 4LXQA 3GGJA 1NNSA 4XQEA 5IK2D 1X6VA 3IAS6 4QM7A 4N8SA 1MO4A 4HDSA 2BI7A 4GM1A 1NI4B 2W6PA 2BOVA 2XVXA 3MXOA 4FGJA 1HDXA 1YULA 2UUAB 3KFLA 2OORC 2J0SA 3C43A 3Q11A 1U81A 2YWJA 3H9UA 3BIJA 3N9IA 5F1OA 4AWBA 3K70B 1SU8A 4DXAA 4RJIA 2ZBGA 3HN6A 2FPXA 3HN7A 1NVAA 2AKYA 2VYND 4R2JA 4X41A 3ZZ1A 1HG1A 1U9CA 5JARA 2J7PD 2PO5A 4B46A 2A9VA 3S1LA 5IT0A 2BGNA 4C1BA 2GETA 2EAUA 4WA8A 2O8CA 4WCFB 3OZDA 2J8ZA 1QO0D 1CFZA 3CYFA 1P0IA 3KSAC 5CVDA 4ZHSA 3JQRA 4OGGA 1SWWA 1Q1BA 1TM3E 2AR7A 2VBFA 2FLVA 3A4IA 4QIHA 5EIBD 1QUFA 2PVSA 3BRWA 2O0HA 3FYUA 5C31A 5CCDA 3SZ3A 4F3CA 3N28A 4EL0A 2O2SA 4G1CA 4LGYA 2BFMA 1ESDA 3OEWA 2OLJA 3SXUA 4F84A 4DMGA 1W0CA 3HG7A 1NFFA 2WWIA 3ZK7A 4BVLA 1RS0A 2CXTA 2OR3A 3QV2A 3QVJA 4HDRA 4IMIB 3SC2B 2GEUA 2QJTA 2XLCA 4O3MA 2GM5A 4Q47A 2YW9A 1IAVA 4MR8A 4MUHA 2JF0A 1G21B 5AYVA 3SSMA 3UCEA 2Q0SA 2QRPA 4KXQA 5LD2B 2RHCA 3NWEA 2YJ3A 5H4GA 2E5FA 1L7DA 1LDYA 1C30B 1MAHA 1JBEA 3T5GA 1DOAA 3MINB 4QVKA 4DYVA 2O0LA 1BXRA 2AXPA 3KVOA 5CNJA 2PRKA 4DQUA 4GL2A 2Q29A 2H7XA 4ZCRA 1PV2A 3T4XA 1RXVA 2Q1TA 1EFPB 3TRJA 2E4AA 1JHQA 3JZFA 3LKBA 3CX4A 3VTAA 3HUUA 4ECEA 2I1QA 4UDYX 2FZEA 1QGUB 3V8RA 2A4MA 2BBWA 1VB3A 2H1FA 3TQHA 3UC5A 2OA0A 3WKAA 5A3JA 2ZDGA 3RJMA 5AVYA 2ONJA 3TKYA 1NNEA 1DC6A 1EVEA 1AKNA 2VATA 1OTYA 2CN1A 2NACA 2VBGA 2AK2A 2JS7A 3L7CA 4TXHA 5EQFA 2QRVB 5JJLA 1XQ9A 2IYEA 3LVRE 1B6TA 1RAFA 3KXKA 3P0JA 4A8JB 2WW8A 4I6GA 3C16C 3F8SA 3I2KA 5TSDA 3VTZA 3W3AH 2QRLA 2IITA 4BJ5A 3N75A 2C4KA 4GNRA 2YN4A 3RPEA 4LJYA 5DV9A 5CDFA 4A6DA 5CDGA 2UYGA 4QBTA 3STXA 2NADA 3R3ZA 2CLKB 3K70D 1RWNA 2YS6A 4LS3A 4ZI7B 2F8MA 3V2UA 2DFDA 1TM5E 2I5PO 4TXMA 4OK6A 5KYYA 4RVUA 1L4GA 2JGNA 3H3FA 3KOMA 3PHCA 1NW5A 1RHJA 2A3NA 2VF8A 4QVGA 1E69A 2JIBA 2YXNA 2ZIZA 3FKJA 3IRUA 4Y6GB 4B7CA 4BTLA 4NYIQ 5A0FA 3FUVA 4AICA 1WOMA 4HDNA 1JDTA 4ZVUA 2PMBA 1QYIA 3AY7A 3V42A 5FWAA 5E1BA 3VUEA 1UJ5A 2F9FA 1P6UA 4WQMA 3MT8A 2DH5A 3OOEA 2HDHA 4NJEA 4TL6A 1P61B 5DM4A 2RGNC 2JFBA 2JBAA 3G82C 3GAZA 4DILA 3V48A 2H4JA 5DTRA 2G63A 4DCOA 5JAZA 4OK3A 1PTJC 4UTRA 4N6NA 4E5UA 1K8ZB 1SOVA 3E8MA 3AI3A 3MRXA 1DEOA 4R2LA 5IVKA 1KGSA 2MSWA 2DFTA 1TUIA 4EYOA 4F5EA 1VSQA 1UXKA 2IY7A 1JGTA 3LCJA 4EKGA 1W34A 2H4YA 2W2XA 2YFKA 2IJGX 3OE1A 4OM7A 1LKZA 2OMEA 3L04A 5ALZA 4YMVA 2VTBA 3THYB 3ZJUA 2PL5A 2GHIA 1R7RA 4N0DA 4WT7A 2H1IA 4WZAE 2JW5A 3MBOA 3QX8A 4LECA 1LU9A 4QUAA 4G26A 3VR2A 1I1OA 4HAZA 4FQ8A 3O4RA 3LD9A 3D6FA 4F3YA 3WGLA 1CR1A 4X6XA 5LB4A 3RB8A 4ZAWA 1DEHA 3V8MA 1RPAA 2FXIA 2QTTA 3W6ZA 1QVRA 5DLQC 3IOYA 2HK9A 1WNTA 3FFWA 3FWPA 2P9TA 2YMLA 2F3SA 4MUFA 4HH1A 1I2AA 3G2IA 4WESA 1IOVA 5TT0A 5NLLA 5I5GA 2W8BA 4F8YA 3DHWC 3HDHA 4DLXA 5LMUB 3RC1A 4GWGA 2PG3A 3OQIB 1YBVA 5HZGA 2PK3A 3BMCA 3RU7A 2IHJA 1XKTA 4EA9A 4YRFA 3BULA 3TBHA 4BC1A 1E6WA 2O19A 5ILGA 1ZU5A 2C4NA 4QEZA 3FRHA 2K7ZA 4DLSA 1FDSA 1W6UA 1VA4A 2H31A 1Z7EA 2W58A 4GIBA 4TS9A 4K9KA 1ORTA 1W2WB 4X91A 3UJ8A 4CMGA 5IRCD 1VKZA 3U7HB 1V7CA 1GDHA 2VQ3A 3GNQA 2DT5A 2HMSA 2VJLA 3N53A 3GGPA 3A1FA 3E9YA 3TIVA 2GAOA 3D3NA 1GXSB 2G04A 3CN7A 4WLNA 1PJCA 4C0BA 5ALYA 3UGTA 4HXYA 2O0KA 2P79A 4JX8A 1QHGA 4BP8A 4OX9B 1TXGA 1VYTA 3Q8XB 1KMMA 1U0NA 3BKWA 1GXSA 1ABFA 1T6ZA 3PDWA 3SI7A 3V1UA 1DS6A 1V7ZA 1NTRA 1QAMA 3LL7A 1JH9A 1LBHA 4LX0A 2XYQA 2VP4A 2WV7A 1JX6A 4HWPA 4HRXA 4M1SA 4G9EA 1DO8A 1V1RB 3OQMA 4GI2A 5DNWA 4BEVA 3GLIB 4HEA1 2FEPA 3B20A 1O95C 4JAVC 1RXEA 1Z4IA 3QUSA 4L1KA 2WJPA 3PB3A 3H1TA 4B3FX 5JVDF 4TRRA 2ADFA 3B6JA 3A6FA 1QO9A 3SICE 1E77A 1T4CB 2FPSA 4KG7A 4JLAA 2VJCA 1XZIA 2F67A 4X9XA 2IOYA 1OYOA 2NSLA 2YIDA 1DIAA 3OU7A 1JZTA 5LFAA 3LBAA 1MJGM 4MGEA 1BXGA 2BM8A 4N4AA 2PL9A 5LCXA 4KHZA 2QNRA 5ELLA 1REQB 2ISCA 2NPIA 4DG9A 1BEZA 1Y34E 3MB5A 1U9JA 1IHYA 5IJWA 3AHGA 1R27A 1QYDA 4MW7A 5KTNA 5HRAA 3H4TA 5ECDA 5C8YF 4MHSA 4FYWA 1CS0B 1KH3A 1NNLA 3NGLA 4ARBA 1G4AE 4LKOA 4RY8A 4TYMA 1RMYA 5MGBA 3NT2A 4FFBB 3CWZA 3JQGA 3TAXA 3AG6A 4R2IA 2YFQA 2ZU6A 3WRWA 5CFZA 5CITA 5JJ5A 3I6MA 1Q1GA 5A5GA 2NUAA 4PQRA 5T8KC 1RM5A 2G36A 2JAXA 2ANCA 1IJFA 4CG1A 1W2HA 4FMBB 1A9ZA 2PDAA 4MUMA 3ZHSA 5M7EA 2GD2A 4HLQB 4GKJB 4PSUA 2GRUA 2BFBB 2J5RA 4HGYA 1YTUA 2F62A 3HUDA 3G02A 4LC0A 2YYZA 1Y5RA 3DYVA 4N7JA 4NXMB 2ZTSA 1SKUA 3RU2A 2BJWA 3KXLA 4ZT6A 3STWA 1RI5A 1W8IA 4PAQA 4EZIA 3R1IA 2R1TB 5HKAA 1CW2B 2YQ4A 1VKHA 2A1IA 2K2WA 4FUQA 3BMOB 2WZDA 2VCYA 3AV0B 1UDCA 3NC4A 4OGKA 1QLJA 5IYZB 1SUIA 3GV0A 1ZN8A 2FCRA 4CEHB 3TLYA 1DAKA 2VQ6A 1RTTA 3D54D 3IV9A 1JMVA 1RXSA 4YRLA 2WI8A 2B5VA 3VZPA 4CGYA 2WF5A 5HK9A 1P2UA 1SM4A 1C3LA 5JCZA 1S8FA 1C80A 1Z17A 3KHUA 3MQFA 3PR2B 2BGMA 4Z3DA 4F1WA 1TZ2A 2EHJA 3I6QA 1U2DC 3L4BA 1M1NB 4A6XA 1IMOA 1Y48E 1KJZA 2X0NA 4JLOA 1FY2A 2RJOA 3FROA 1FSFA 2HJ9A 4G0XA 2BR3A 4LA4A 1SN7A 1G66A 1PE0A 3D6MA 4MYSA 4PYLA 3SHVA 1SCKA 1F1JA 1YWGO 1IONA 1AUXA 1IH8A 1AGYA 1OIWA 1PSWA 2A6PA 3EC1A 4WK6A 1GRCA 4ZTBA 4IYRA 2BV3A 1E79A 2P9ZA 1HNXB 3TUJC 3HKCA 4EQ6B 1NLYA 1OBVA 1WMDA 1S1MA 5HXAA 4NV1A 2XEXA 3IPCA 2QN3A 5IF3A 2YHUA 4LOHA 4B09A 2BBSA 2FP4A 4D3FA 2NQ2C 1VMAA 4OJKA 5LQAA 1VM6A 5I3ZA 4BNJA 3M89A 2EC5A 2G1KA 4EI9A 1AHNA 4B6EA 4LW8A 5A4KA 1XRMA 4V02A 1MABB 3OLYA 1ULAA 1VDMA 4O2AB 2PGDA 4QGSA 5HFNA 1Z83A 1XMXA 2OZLA 1MG5A 2AG5A 2Q1YA 2FFAA 2HZBA 3UN1A 3ZJ5A 1DIRA 1BXRB 1Y4ZA 7ADHA 1USIA 4MVJI 2WIDA 5JCXA 2NQTA 2WABA 2AG0A 3EXIB 3PYLA 4NBSA 2EL7A 2NPFA 4QLBA 2VXBA 5F9HA 4QM6A 4B35A 3IE2A 2OCPA 5JSKA 2Z2YA 1PS0A 1QWSA 4JQCA 5T57A 1R66A 5EFZA 4EUNA 1AIPA 4HVTA 5I7RA 2RKBA 4Y2TA 3OFNA 3VU8A 1GZDA 1IOZA 3GP8A 4QO8A 4W9MC 4Q9DA 4UCFA 5HDBB 2O1EA 1N5KA 1BYIA 5K0CA 4ALKA 4CEIB 1C0IA 4RDCA 2EQBA 5CYGA 4CZ2A 3RYCA 2Q8NA 1J06A 1SQ6A 2WWGA 3KZKA 1U28A 1WP9A 1P5ZB 4J1SA 1P74A 2G09A 3DBIA 4MVJH 3I5YA 3BX1A 3RVMA 2F43B 2EYQA 2JD0A 5ARDA 2B78A 4KMOA 5AKZA 2R1VA 4AVYA 1BZYA 1DFHA 1HYHA 5D2CA 4WUTA 3H7AA 5HUQA 2IUYA 3R4VA 4FD3A 3FWZA 1VE7A 3JWJA 3L6RA 3GA0A 3JQ7A 3JQPA 1IJKA 3TUZC 1ES9A 1P4SA 3HI4A 4TL8A 4GXNA 3EAQA 1K5GA 1XX6A 2ZIWB 3OCXA 2GCIA 4UKDA 1RXWA 2V7VA 1KC1A 2ZZMA 5BQFA 3FXAA 1D3AA 2IPNA 4X66B 3ZD7A 3UB2A 2C5EA 1H2YA 1ZM4A 4WADA 3VR6A 5KYYB 3DOIA 1T9BA 1R9MA 2ZJAA 3GRRA 3EMKA 1RHMA 4HB0A 1QZ3A 2ZBQA 1L7VC 4Q15A 2PJZA 4B85A 1O95A 1UBMS 2RSLA 5K0TA 5CTAA 1JHYA 1OZ0A 3BORA 4LJRA 5ENVA 2W2TA 4MQEB 5F4ZA 4Q82A 1ZK2A 2XUAA 4XJTA 1E0AA 3TEFA 4A9AA 2P3OA 3FTNA 2W48A 3A4TA 2WOOA 4BMNA 5HW0A 1EHIA 4WVFA 3FKSA 1EIWA 2WF7A 1SXGA 3UAYA 4CMKA 5JAHA 2RE8A 2V1XA 1CUAA 1Q5PA 1GUBA 4MIOA 1W5SA 1F6BA 2NUPA 3E2IA 3NYIA 3PPWA 4F9FA 1ZSNA 2P2NA 4MK4A 4NZPA 2KX7A 1T2VA 3KZ1E 4JFAA 2J33A 5HIMA 2YC4C 2VHQA 2ZYTX 4PCLA 5DHQA 1KE2A 1XNRB 2N42A 3G8DA 1M2VB 3E0XA 4YMTA 1EXNA 1AD2A 1T5IA 3DW1X 3HO8A 2IW3A 3SM3A 4LY6A 2J46A 1R4MB 2WJVA 4X8OA 1BD4A 1SCNE 4Z2AA 2CK3D 3HADA 1NW8A 1Z2OX 4G85A 4WKGA 2MCFA 3DCNA 5KSZA 2HCBA 3ETJA 3I09A 4PG4A 2ZVQX 1Z2NX 1U2ZA 1IZ8A 2OUIA 3I32A 1EBFA 1ZBDA 4TMXA 3FBTA 3E1SA 1D2RA 5AOCA 1PQWA 2OGZA 3N07A 4NFSA 2EP8A 2GM4A 1GSHA 3GOHA 2O54A 2QJWA 3L4JA 4DN6A 5IBRA 1FFBA 1JIIA 1ZNYA 1KI4A 2MSDB 4HB3A 4X45A 5ITWA 4MP6A 5AVZA 3KSDO 1CJTC 3EFOB 1Z56C 3LCRA 3LFUA 1UBEA 4R84A 3UMRA 4ASUA 5K6AC 3RIMA 1ISMA 3A3OA 1AUVA 4M9RA 1V8PA 3QA9A 1ECBA 1ZH6A 2KW5A 5E6UA 2IW1A 1ZRMA 4MV3A 1BHJA 1Z6PA 4OB8A 4ZJUA 1EK6A 3EH2A 1EUZA 1T2UA 3SOPA 1SCBA 2VXCA 2Y2VA 2ZYAA 5JPDA 1WJGA 4WX2B 4S0XA 1KYVA 3O0TA 3PC2A 2O0JA 4R1PA 5C81A 1VG0B 1RABA 4TV9F 3RVKA 1KETA 3NO4A 4P5EA 3OHMA 2O8CB 3TSCA 5CHYA 4PR0A 3W5VA 4JEIA 4B81A 5I5EA 1A69A 3FLEA 3JYQA 3R3UA 5FD8A 3FE2A 3C8MA 3F49S 2ATCA 1PX0A 1DHTA 1ZCBA 3LBHA 1OD6A 3ZXYA 3CRZA 5SYAA 4JB0A 1ONBA 5IJ0B 1IN7A 1JEAA 2H51A 3PKJA 4MAAA 3K16A 4NPHA 1XI2A 2R4TA 4UQLA 2L17A 1U02A 4Z7QB 2JANA 4N3AA 2ZYSA 5EIOA 4IYJA 4MARA 3JQ9C 1C3VA 2GVDC 5L3ZA 4JLVA 3O3NB 4CG3A 1LRLA 2V98A 2VNAA 3K6JA 4H4EA 4HUJA 1E6CA 4JASB 4LK2A 3L0PA 5SY6A 4D9NA 5I51A 4NOJA 1E0DA 4PWZA 1PWXA 2BD0A 1RADA 3BDIA 5FAKA 4WVLA 1AZSC 1ID8A 4GMGA 1WXXA 1Z7YA 2CD9A 1N3IA 1X9IA 1BROA 1QNLA 1V35A 2LNDA 2YZMA 4AK9A 2NU8B 5AKEA 4BWGA 1KA9H 1HNZB 2KBEA 2PS0A 2ZB4A 3DW3X 4WBSA 5IULC 5I7VA 4JN6B 4JB8A 2ZUUA 3R0JA 2FK8A 4OYRA 4PANA 2XE8A 3UA3A 4NJMA 4QBIA 2AXNA 2ZXFA 4W5JA 2XWBF 3VNBA 1JQEA 1ZD9A 5IEBA 1U04A 4XFDA 3SCZA 4BPBA 1HOTA 1CE8B 1LC3A 3AW9A 3B7GA 3KNZA 2IUFA 3L84A 4LYYA 1SQSA 1E2BA 1R0XA 1VHWA 3ILYA 5DTJA 3C7TA 2XECA 1E2UA 4DIMA 1TZJA 1UBSB 5EL0A 5FLXA 1TCUA 4BO4A 5HS4A 1YB5A 3CEHA 2ZT6A 2FPUA 2QM7A 5CGZA 4E4YA 1C7FA 3OJOA 5CT4A 2AJBA 2ZJ1A 3QOYA 3QA3E 3KG2A 1H4TA 4U1RA 4GVPA 4RD4A 5KJCA 5EJIA 3TG2A 2FVYA 3NBZC 1LI4A 2GPBA 3BB1A 5I9LA 3QVGB 5KOYA 4RPKA 4K6FA 1BX0A 3RC7A 4AJPA 4FFVA 3UB3A 4RVNA 4EHIA 1GNRA 1CXZA 1AGNA 1Z0ZA 1G60A 2NZ2A 2BFAA 1ZNQO 4D0NA 1UZNA 3WIDA 3PQ2A 5KZMB 2ATIA 2I6FA 2Q1UA 1XF1A 1ZW1A 8GPBA 3L8YA 4W99A 3ZWWA 1XL0A 4J1NA 4G5YA 4P3PA 1MT3A 3W8RA 3WL4A 2GTPA 3MJFA 4F9TA 2H5IA 3I9V1 1NM5A 3HQ4O 4LZAA 3RSHA 4B3HA 3ZH2A 4PN3A 1J8VA 1NYTA 4XYBA 4AP9A 1N0VC 1NOJA 1IAQA 2CK3A 4QXQA 1S3SA 3A37A 1YRBA 5FUBA 5C5CA 1XIVA 3K5IA 1AF7A 4UREA 1X7DA 2I6GA 4FU0A 4EQZA 3F73A 1L5HB 2VHXA 1LF0A 3HFSA 3PRHA 3S2ZA 1L8OA 5BWMA 4HY3A 4KUEA 4X1KA 3ZWQA 4I1YA 1NM5C 3W6UA 3FR8A 3HNRA 1V8ZA 4F92B 1AV6A 1T91A 2FPIA 1QRTA 4HL6A 4L5BA 2VZLA 4J3JA 2RHWA 3NG1A 2RGRA 1PNRA 3E15A 4PZPA 1IN1A 1CQIA 1J00A 3FMOB 1RQGA 2F55A 2CDRA 2OHVA 3PR1A 1KKUA 3SM9A 4JXZA 3MGKA 2XZOA 5TDHA 1DMRA 1U8XX 1JG6A 1JVBA 1GPBA 1WW8A 1J9GA 1GFSA 3ADKA 2NOAA 3B3GA 3CU5A 5SY4A 5T64A 1K3UB 3KDAA 1TW3A 3ASVA 4YO8A 1KSHA 3IJRA 3O0DA 2AMVA 4ZRMA 5AXCA 4B48A 1P2BA 4FINA 4E2WA 1PFUA 1VLLA 2FWBA 3IUQA 4O8ZA 2YMMA 4JEUA 5HF5A 2QR5A 1PT6A 2HLDA 5BN5B 5KWEA 3IDAA 2ID7A 3RVBA 4QWMA 1X70A 3EWIA 4W5OA 5JZBA 2VN8A 5IZ4A 1QVVA 1DJLA 1MO5A 3E9NA 4TN1A 1WZUA 3JQBC 3NC1C 4MYRA 3DP7A 1C8KA 2G1PA 4DPMA 4LZPA 2OQIA 4HKTA 1RWWA 2JIDA 3CSSA 1EFTA 4INAA 5I4CA 3MERA 2V55B 4RWZA 1KEWA 2ATXA 4BU1A 1RRVA 3P0HA 1OBHA 4DREA 4DMCA 1FXSA 2E7ZA 1HEUA 3W7AA 4NBRA 5BV8A 3U56A 5EESA 2J9ZB 3AB8A 1LV8A 4YJGA 4FYVA 3AJDA 4R83A 4E4TA 4HPWA 1EDEA 1OF1A 1A98A 4HJRA 1OGIA 3RANA 4LRTB 2I3DA 4RXTA 1E1MA 3VKFA 4H59A 3BQ9A 4MQ4A 1FA9A 4NFYA 2R87A 2A5FA 1GTZA 3H2KA 2ZS9A 3CRVA 2P1RA 4J2TA 2ID9A 4B6OA 3BJRA 4M89A 3SVTA 5DDIP 4DR3B 5AKXA 5GMOA 4MA4A 3BC1A 1UFKA 4M86A 2RCYA 3I5MA 2P9GA 3V5NA 4OY3A 1UPXA 2IEYA 1J9ZA 1W59A 4UNQA 2I6TA 3GPCA 1XC7A 2ZS8A 3QUBA 1N32B 2EZ4A 3OE4A 5IH3A 3P4YA 4GVXA 4GWLA 2QM3A 4P5DA 4U3JA 2JJYA 3LTEA 4DHEA 4LVCA 1M2KA 4PZEA 1NG9A 1T1RA 3A3PA 4MRSA 5HKLA 4BLSA 5JC1A 5K3EA 3FYCA 4WE3A 3QK7A 1N2CE 3AL3A 1ZVQA 4QRIA 2IPMA 4YRRA 3INYA 1E5TA 4CMBA 5IZCA 1E5LA 3VPXA 4W1SA 4J0CA 3GLGB 2Q9CA 2YWGA 3EGVA 4JBIA 3LX5A 1V8FA 5LBUA 4AY3A 4C7VA 4U9IS 2Z5FA 2JARA 3GR6A 4H35A 1DKMA 4YC7A 5EIEA 2J85A 1N92A 4ZT7A 1YRLA 3I1FA 1Q44A 3C5VA 2HIMA 3D3EA 5BWCA 5G2OA 1ETUA 1FRFS 1MR3F 4LEIA 3T7EA 1SCDA 1D2EA 1VJCA 4KCGA 4QDJA 1WSWA 3GZNB 3A8TA 4KODA 2AJLI 1LC0A 4RFSA 5EE5B 3X0DA 1OAOA 2AOVA 2J5XA 5G1NA 4BLUA 3FGOA 1WKBA 1JDNA 4QQNA 4E2ZA 1ZR4A 2EV9A 2JAQA 2JLQA 1L5MA 4Q24A 1Z0FA 2XWSA 1Y37A 4R2HA 4YMGA 4NY1A 3QQPA 1MJFA 3BS4A 821PA 2HF8A 2P11A 3ED1A 4EF5A 3WLOA 2Y9MB 2CV0A 2JGRA 1NXPA 1QBGA 2AUMA 2TMYA 3LV8A 1X2BA 2HO5A 5BUCA 1T5TA 3G2NA 2XE4A 5EE0A 2NU6B 1HDZA 4MMZB 4BMOB 2B6NA 1O5IA 4UHEA 1F2TA 3I2FA 1UK9A 3SOZA 4TUYB 1X7ZB 1JQJC 1E8DA 1YRAA 4S1VA 5LYJA 3RYIA 2C7RA 2GRAA 2WWRA 4Q9KA 3OOHA 1PFQA 2I1VB 4CTNA 2Y71A 4K46A 2R85A 4Z7NB 2EX4A 1I6KA 3CX3A 1LDMA 3IDZA 4GC9A 1ISHA 3T3GA 4EGFA 5IKOA 5REQA 1B8OA 4ACAA 2GKSA 1H93A 2X7JA 4KE7A 1J90A 2OXFA 1OZAA 2P1ZA 2QTRA 3AKDA 3LNTA 3P2OA 5DEIA 3RWBA 5JO0A 1VL1A 2P4HX 1IN5A 1B3RA 3CF4A 4LYJA 2VZ9A 1ZC3A 1Y8CA 3ZVLA 1NA5A 4M1OA 1Z4KA 4KJXA 1VECA 1UDWA 3AKEA 3UAZA 4ZZIA 5HUHA 2XNJA 2HCRA 5CRIA 2CYCA 4TLAA 4ZJYA 4D3SA 1TA4A 2Y3IA 5T5QA 3SMQA 1P77A 2QQ5A 1TJPB 3A31A 4FFLA 3NASA 1Z4LA 1N2ZA 3FNHA 1UWLA 3CNEA 3VPGA 1Y6ZA 3UJ9A 3FN4A 4JC5A 3EA5A 1JSCA 4O4HB 1H85A 2JKZA 4DTIA 3W2TA 4HGOA 1CUEA 4R8LA 1NVMB 4IDQA 3FKQA 1E9DA 2I1WA 3UWPA 2QR2A 4AIIA 2QMOA 4PLWA 4BVFA 1CD5A 1OPXA 4PZYA 3VR6H 4DLVA 1BMFA 3PG5A 4AZ3A 4B80A 3QELA 1ADCA 5BR7A 4DA4A 3O4GA 4K28A 4E2FA 3ZQJA 2OK8A 4E13A 3ESRA 2C03A 5AQ1A 2WU4A 4Q3AA 4BB5A 2E55A 4XARA 1I32A 3NRJA 1N57A 1GL7A 2J87A 2GJSA 2PIDA 2WHPB 2YWCA 2VHYA 4UU8A 4X71A 5ALKA 3CONA 2J5KA 1BOFA 3NFRA 1GYRA 4G0NA 4OJTA 5LNK6 2DUNA 3BSSA 4Z4CA 3MCWA 1JEEA 5EHGA 4U5QA 4FN4A 3B6EA 2WWXA 3SNKA 2P2DA 1DRKA 3C3XA 1VG9B 3HKDA 3MCVA 1HL3A 1NTOA 2OE2A 4PTZA 3SYKA 5GM1A 3CX6A 3OC0A 2JAUA 4HNAB 3WK9A 2IH2A 3LLUA 3EGCA 5EIXA 2JJ1D 4EX7A 5B37A 4I5GA 1CUZA 2OCDA 4FONA 3RFCA 4TKMA 4DT1A 2PBLA 5T7BA 4JNKA 4EBBA 4I7EA 4MIYA 1IN8A 2ES4A 2IE0A 1J0AA 3K30A 3ZJ4A 2FWRA 2Z98A 1L5GB 1UUFA 4DIEA 5LXTF 1KAHA 2FZVA 3HXLA 5H70A 3R9KA 3TW8B 3ZBUA 5J4YA 2AS0A 4HH0A 1VHTA 4G9GA 3HKDB 4UM5A 5HQ3A 1N3LA 2ATEA 5KYVA 1DRJA 3IOMA 3ZDYB 1B8NA 5L45A 3KDPA 4LC9A 2NU6A 3THYA 1C5KA 1T0JB 1ULTA 3LJKA 4BYGA 3MMXA 4CKZA 3QYPA 4OXIA 5AVVA 1UC9A 1C3EA 5C3UA 1R3UA 1Y7TA 1QR6A 1F0NA 3G0DA 1DHRA 3VR1A 3F2IA 1E60A 1YT5A 1XHLA 2ZYHA 4NYIR 1XL1A 3IUEA 4JUIA 1KS2A 4MRAA 1NW4A 5TQJA 1CUIA 2PMFA 3R8CA 4UBNA 3PLNA 3HXQA 4PR3A 1QIHA 3CR7A 3PDUA 3K4PA 1OX5A 4BLVA 1HSOA 2R2AA 4PQEA 1HSZA 3BWBA 1RM0A 2KMLA 4NJEB 4RZ2A 2W2KA 1XAGA 3LA6A 2AVDA 2PXXA 3CLTC 1T0BA 3AUTA 3LYLA 5DHTA 5LB2A 1Z18A 3T3IA 1RM3A 3IEVA 1PK8A 4HV4A 3WLLA 5ITVA 1F9EA 4ZREA 1QRAA 1II9A 1Y4UA 2XNSA 3UKDA 4EFMA 3GWGA 5LZ4A 4J6EA 4GKVA 3HYNA 3OM8A 1Z4NA 1Q77A 1IE3A 3GW8A 4KXMA 4XR9A 4CE6A 1F60A 1I2BA 3C85A 4RK6A 2WYOA 4XE5A 3QXHA 5KTMA 1BGVA 1UMDA 3BWCA 5K7SA 1KY2A 3H6HA 1X1QA 4WLUA 4UUNA 3VYWA 1TJ5A 3OJLA 3DDUA 1I3OA 1FQOA 1VYHA 4TTRA 3ZGZA 4TYNA 4B4OA 3M70A 3A1VA 5CBPA 1RKBA 1T9GR 4KQMA 1JIJA 2IGTA 3BZBA 1PFWA 1Y6QA 1ZD5A 5L40A 3TFQA 1XCPA 4IINA 1H0RA 3IT0A 1LNQA 3HEMA 1I7LA 4M3NA 2IIQA 4EKEA 3HBAA 3V7NA 4AJLA 2PYZA 2Q9AA 1XA0A 1GPLA 1QUEA 1WVGA 1NVEA 1TE2A 1TM4E 2PPVA 3RRXA 3RYHA 3BGDA 4W6QA 1E2QA 1T6NA 2C9YA 4FFBA 5F9MA 4OHZA 4G1UC 3E7FA 3MAAC 4XSGA 2HT1A 4TQGA 2DPYA 2N3ZA 1X39A 4HO1X 4WNAB 3JTMA 3O1JC 1ECGA 1PT5A 4FKZA 4MW1A 4RCYA 1U3WA 1Y0BA 4UHKA 1WPQA 4U7WA 3WBFA 2I4RA 1SU4A 1G8SA 4ZALA 2C83A 4MVJA 1FTSA 2WYUA 5HF8A 4A10A 1W76A 3IQZA 3HI6A 3DL0A 1WTAA 5E4FA 4J75A 1H69A 4BB0A 1HZZA 3PNYA 2XB2A 3FPHA 2CCKA 5GGYA 5ITSA 1FU7A 2PH5A 5CLIA 4BFVA 1N0UA 4G97A 3GMDA 5IASA 1N0HA 2XAAA 4EFLA 2B25A 1SY7A 2I22A 3GLIA 4FYJA 5LC1A 4LF4B 1H2EA 5DNYB 1BNCA 3CRNA 1Q0TA 1U8YA 2BLNA 2E9SA 3QXXA 5FO0A 4MW4A 3K09C 2XUOA 1VDZA 3FDZB 3NTQA 3RQSA 5C4IA 5LJLA 1XD8A 2BDTA 1GU1A 1Z8DA 1DDIA 2PFSA 4O6VA 2PLNA 3L18A 3HP7A 4REMA 1K63A 1Q84A 2VJDA 4PZLA 5E0OA 2YH2A 1O97D 1AKVA 3B2NA 3BMQA 4G0OA 2CLSA 4O4JB 4V0ME 3PQ8A 4QFMA 2C9OA 4C6TA 4GKKB 3EVBA 4ZQHA 2OAEA 3HR4A 5TLSA 4A73A 1T34A 3C74A 2ZBVA 2FU5C 2IEAA 2MYTA 2NSHA 4GBJA 2ZIEA 4JA2A 3W8FA 4BNVA 1DDOA 2IZ6A 1JH8A 4PGGA 3I9KA 4EYQA 2JFFA 1AQUA 2UZ4A 4B3IA 5IN5A 3TCNA 5TQ0B 3FB4A 3AFOA 1RJWA 3HL0A 3Q72A 1E1CA 2PSHA 1VP9A 5GV8A 4HK4A 3VZCA 4I1IA 1TGYA 3M3HA 1T3ZA 3O94A 1A04A 3GARA 4AZSA 1ZL2A 5H59A 1PNTA 2VH2A 1GTJ1 1S2IA 1USUA 4F5YA 1QP4A 4UBJA 2N0SA 5KSPA 4HAXA 3ZDQA 4D3ZA 1YVRA 3GXOA 3K9WA 3MMZA 4KQ9A 4XIFA 4EGQA 3VR3D 4X84A 5FOQA 1JEDA 4IMPA 4DLKA 2ZTLA 3OOJA 4JBWA 4HYTA 4BNZA 1TYEB 4WXYB 5F21A 3EWNA 4GOLD 1J42A 3VR3A 1ZM9A 2QZ4A 3WHIA 4KBFA 5DNEA 1QYCA 2PAAA 4Y6OA 1C50A 3TEJA 2DTDA 1IMJA 2NPOA 3B70A 3C3DA 4M87A 3L05A 1UM8A 4TTQA 3W9BA 4DSZA 2X5NA 4AJJA 3ZYZA 3PP8A 1YFZA 1WNFA 4B4KA 4GOKA 4BEJA 5TB5A 3FRIA 4QE3A 2AB0A 4M8KA 1V5FA 1P7PA 1DV2A 3V00A 1YFKA 2AG1A 5A9TA 3UT5B 2F48A 3F3SA 3GCXA 3MGGA 3PJGA 4KQEA 5INTA 2A94A 1NYLA 5IKPA 1U8TA 3R23A 4LX8A 3K92A 1IHDA 3PT9A 3B38A 4YASA 3RASA 4AF8A 3RWOA 5B58T 2VHZA 3LI2A 4E5VA 3QEMA 3I9V6 4FNOA 2C9BA 1A5ZA 1G2QA 1ZJ6A 2JHCA 1BDJA 2VOJA 3T3PB 3OIDA 2VUSA 3GLHB 3PL1A 3TSAA 4MOWA 1YDEA 2DFNA 2OC9A 3VJKA 3WGHA 4C7KA 4QOGA 4OX9Y 3R3XA 2VYNA 1IXKA 3E27A 4CQMD 1W0JD 4PNEA 4J43A 5FTKA 4I2NA 1OTXA 1EX6A 4MUKA 1YL7A 3SIRA 1OXBB 3LE8A 3EMDA 4X92A 3H3XA 2DUWA 3AWIA 3ONWA 1TO2E 4DV7B 1KIFA 2Y0DA 4JP3A 2L69A 2XBMA 3QWFA 5IK2A 5AVKA 3ON5A 4G5HA 3QXSA 4FGLA 2GWHA 4RGQA 3VPDA 3NH6A 1NI3A 2ZIXA 5MFZA 2PD3A 4H7KA 5B53A 2C97A 3KKEA 1M54A 1XCGB 2I62A 3SZMA 4LYGA 2JAOA 1ACLA 1KO5A 1XTSA 4DMLA 3WIOA 3ZY3A 4WEQA 3EY4A 3HC7A 2VK8A 5DGIA 3RW9A 2BKVA 1N6KA 3OIGA 1G19A 2JNWA 2ARKA 4D3YA 3K9CA 5JXIA 1SIOA 4IRMA 1Q6ZA 4IH1A 1NC1A 3ASUA 3H5RA 5ALPA 4L5AA 3E1GA 3ZVRA 1BFDA 3DUFB 4HLUC 4TWAA 4BAUA 3NONA 2KLBA 2AOUB 2G71A 4J0EA 1V9LA 4Q0MA 4ZT3A 1ZKDA 2WD7B 3QWAA 5AESA 3WQHA 4WFKA 5LMNB 2IHNA 3GLQA 2MIIA 2D7CA 4IJQA 5SY9A 2R7AA 3NAMA 1CQJA 4PPGA 1IXZA 4RO0A 4M8NE 5FV4A 1M1UA 3GFVA 4H16A 2JCSA 4MV5A 3GIDA 5GZ6A 2B4AA 2Y0EA 5A05A 1HNWB 4NOLA 3LIIA 5JFTA 1AK2A 5FUQA 3I6YA 4XX0A 3GA7A 5AW4A 3ISJA 4RKEA 2UZAA 4AFNA 1T35A 5F5XA 1OWNA 4DNFA 4BNXA 4TV8F 4PLHA 3KKQA 3U37A 4LOJA 2QL7A 3A2KA 3PQFA 1X7XB 5HOEA 3HJNA 1QCZA 1M1ZA 2M1ZA 4BUJA 3HZRA 3Q3JB 4J2OA 5AW6A 3T15A 5K8UA 3RH0A 1UFRA 1SVMA 6REQB 3Q1LA 4ENRA 3EOZA 3D8BA 4L4YA 1EZ1A 1X1CA 1NG1A 3HJUA 3QVVA 4L4XA 3KJQA 1DE0A 4LDNA 2NLOA 2JEOA 4F3KA 3ILXA 2B2XA 3UJ6A 1GKKA 2A5YB 4UEOA 4TTPA 1X1RA 2X5JO 1FRNA 2C8VA 2FUEA 2QD2A 1KJ9A 4QJ4A 3QHQA 4W4TA 1XJQA 2VH5R 4DG5A 1SURA 1YF3A 2A8YA 2QL6A 4HNTA 3WSTA 1TF5A 1QZZA 1EH5A 3LHDA 1PF7E 1EYZA 4QU9A 3WIVA 2ZI3A 5I7FA 4RE5A 7MHTA 1XLUA 2DVMA 5EUBA 5KB3A 3TTSA 5G53C 1WY5A 3DT8A 1T6YA 2ZT7A 1E4VA 3GLKA 2BFPA 4YUVA 5C8YA 2DFLA 1GAXA 3BFXA 4BKMA 1EFVB 4IPTA 3PS9A 1B73A 3FWYA 4YJFA 5F33A 1AHPA 1X92A 3EZ7A 1NN3A 1VPVA 1ZN9A 3GB9A 5K8JB 2V74B 4AXXA 5KYGA 1S1CA 13PKA 1ZDMA 4QU0A 3I73A 3CLHA 1EJ0A 4WLFA 2B1JA 4UZEA 2V0NA 3E48A 3CLRD 3F9RA 2O57A 4BVKA 1LPNA 2Y6UA 1OI7A 1LDBA 3QFCA 3QVLA 3AH8A 3OX2A 3TM4A 2PLWA 1JRLA 2AI3A 2D13A 3GEHA 4PBRA 3KOUA 4RPGA 4CL3A 4X63A 5F78A 2J07A 3SHFA 1DG1G 1MOQA 4YACA 2AVNA 4C14A 2VZ0A 1ZI8A 3EASA 4TT8A 2NVBA 2AD5A 1H2ZA 2JRCA 2R6JA 5E4YA 3CLRC 4PE5B 3ZQ4A 4CFZA 2IHTA 2PZEA 2AQHA 2WFLA 4KXUA 3H1FA 4BMYA