1RI3A

Structure and mechanism of mrna cap (guanine n-7) methyltransferase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
252
structure length
252
Chain Sequence
SKTINIRNANNFIKACLIRLYTKRGDSVLDLGCGKGGDLLKYERAGIGEYYGVDIAEVSINDARVRARNMKRRFKVFFRAQDSYGRHMDLGKEFDVISSQFSFHYAFSTSESLDIAQRNIARHLRPGGYFIMTVPSRDVILERYKQGRMSNDFYKIELEKMEDVPMESVREYRFTLLDSVNNCIEYFVDFTRMVDGFKRLGLSLVERKGFIDFYEDEGRRNPELSKKMGLGCLTREESEVVGIYEVVVFRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of mRNA cap (Guanine-n7) methyltransferase
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transferase
molecule keywords mRNA CAPPING ENZYME
total genus 81
structure length 252
sequence length 252
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2003-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03291 Pox_MCEL mRNA capping enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1ri3A00
2G72A 3HM2A 2VDWA 3FPJA 3FYDA 4E2WA 4E33A 2H1RA 1WY7A 3CJQA 2PSSA 4DM3A 3HNRA 4PWYA 2YTZA 2NXCA 3P9IA 4QQKA 2ONYA 9MHTA 1QAOA 4PYOA 2EJUA 4V0RA 2AVDA 2C7QA 1JQEA 2OZVA 4A6DA 1ZQ9A 1QANA 1KPHA 1KXZA 1XXLA 1RI4A 3BWBA 3ORHA 5ICCA 3NWBA 1WG8A 5KVAA 4PYMA 4F85A 2HMYB 3AWIA 3GU3A 3LGAA 4EQZA 3VSEA 3BKXA 2GPYA 4ER3A 5KQSA 1X19A 2C7PA 3DR5A 4X1OA 1NW8A 3KPUA 4GQBA 3K0BA 4ISCA 1RJFA 2AOVA 2HWKA 1EJ0A 3BUSA 5EVJA 5GWXA 2Y1XA 3I9FA 2ORED 2YUIA 1TPYA 3ME5A 3OCJA 5FWDA 2B2CA 2ERCA 4RTSA 2BM8A 5E1DA 4CXMA 2AOUA 3OZTA 1FP1D 1M0EA 1VPTA 2O07A 3GO4A 2QE6A 3NJRA 4PIMA 3GNLA 5DSTA 5HIJA 5BW5A 3NVKI 2LD4A 4YUXA 2PGXA 5HOQA 2YXDA 1FBNA 1XVAA 2HR1A 3OFJA 4MQ4A 4C06A 3GJYA 4XUCA 1SUSA 3T0IA 4RVGA 3R6TA 3FPFA 2OO3A 5EZQA 3EVEA 4RTOA 3I5UA 3KQPA 4R8SA 5EEGA 5HZMA 1IY9A 4PYLA 1O9HA 5K0CA 3Q87B 4RVDA 5E8RA 3KHKA 4LECA 4KWCA 3EVFA 4KDCA 1YFLA 2DPMA 1DUSA 3KQYA 4PYKA 2ZZMA 3M6WA 3EGIA 3HCAA 3SSOA 1P1CA 1QAMA 2PT9A 1XDSA 4EVIA 4QTUB 3HCCA 1O9GA 3SGLA 1M6EX 1F38A 2PXCA 4X41A 4XUEA 1VQ1A 5DM0A 2ZULA 2YQZA 4RTQA 1T43A 1HNNA 3HP7A 3FYCA 3P9NA 3P97A 4MTLA 5FQOA 2IH5A 4FSXA 3UWPA 5FULA 3CBGA 2Z6AA 3B5IA 5U4XA 2JJQA 3A7EA 5HEKA 3OU6A 1RI5A 1G38A 2NXNA 4P7JA 4RYLA 2PBFA 3AXSA 1RJEA 3M6VA 3A25A 3R24A 4HRAA 4AZTA 5KQRA 5CCXA 4YUWA 1SQGA 3KPWA 3LCCA 3TKYA 3G89A 4C05A 2PWYA 3I53A 1XCLA 2OYRA 4GF5A 2PX2A 2IBSA 1VIDA 5EEHA 2AOWA 3MCZA 1N7IA 1NKVA 2AN5A 2HNKA 2BR5A 3FRHA 3HVHA 3B3FA 1L3CA 3FZGA 1EG2A 5EIWA 4V0QA 2XYRA 4KVZA 4RTKA 5E1OA 3SR4A 2P8JA 4HGZA 5E9JA 5H02A 2P35A 4E2XA 2Z6UA 1D2GA 1VP3A 4DZRA 2B9EA 2HTEA 4FR0A 4DA4A 4XCXA 5BW4A 4RTRA 3KR2A 1RI3A 1YZ3A 2UYOA 4YUYA 5C9ZA 5IKMA 2PVCA 4QDKA 5DT2A 2AOTA 3CGGA 2IGTA 1JG3A 2IH4A 3OU7A 3NDIA 2CMGA 3G5TA 5F2KA 5EMLA 5FQNA 3THRA 4QPPA 3G2OA 5ICGA 2IDJA 2YXEA 3ID6C 4QTTB 2JHAA 3HA3A 1JTEA 5FA8A 3PLAE 3K6RA 5KS2A 5DWQA 2EG5A 3FUXA 3HVJA 1X1BA 4QDJA 2XVMA 3FPHA 3SSNA 2VS1A 3R9XB 4YMGA 2FRXA 4QVGA 1NV9A 2AVNA 2BZGA 3G2PA 3PS9A 3EVGA 3LCUA 1P1BA 1ZG3A 1RJGA 2NXJA 3P8ZA 1WXWA 4Z2YA 4RWZA 3KR0A 3DLIA 4P7GA 4AZVA 4P58A 2C7RA 4M7RA 3VC1A 3LECA 3FRIA 5LQJA 2NP7A 3CKKA 3DUWA 4PINA 1H1DA 2NNWB 3OZSA 1NBIA 4KDRA 1AQIA 1UWVA 3B3JA 3EEYA 3HCDA 3O4FA 4M37A 3BWCA 3UJ6A 3KQVA 3G8AA 5K03A 5EOVA 3P2EA 5KYGA 5CVVA 4FGZA 3ER9A 1EQAA 4YV1A 2ESRA 4EK9A 3PVCA 2AOUB 3ELYA 2V74B 3DXYA 4R6XA 3DH0A 3GDHA 4Y30A 5LQAA 3M70A 3MCTA 3UJCA 3GRUA 4BP1A 3WSTA 5E1BA 3UJ8A 3O7WA 4ER6A 3EVZA 1RI2A 5CVEA 3EVBA 3TR6A 3B89A 2Z6QA 1N2XA 4DCGA 1TW3A 3GIWA 5EG5A 1I9GA 5K8VA 1VBFA 4Y2HA 4KW7A 5K0NA 2G8NA 4RVHA 2QRVB 4BLVA 3OE4A 5EKUA 2GH1A 1YB2A 3BGDA 3X0DA 4YV0A 5CM2Z 5LQUA 3AXTA 5FUBA 2QM3A 1R6AA 1JQDA 2AOXA 4IV8A 2BM9A 5ERGB 4E32A 3ELWA 3PTAA 3FTCA 4YMHA 3REOA 1VL5A 2P3LA 5FA5A 1YUBA 4KIGA 4C04A 4DKJA 1I1NA 2EJTA 3EVDA 3E7PA 3AY0A 2FYTA 1AQJA 3DULA 3DMHA 3JWIA 3TM4A 3KQWA 2G1PA 5MHTA 2JH8A 4U7PB 2GS9A 1BHJA 2P40A 4E30A 1JSZA 3P2IA 4HH4A 4OBXA 2AN4A 4A6EA 1NW5A 3ELDA 3M4XA 1JSXA 2FHPA 2ADMA 4F84A 4R8RA 1NT2A 2XVAA 4POOA 2P3QA 4IKPA 3UJ9A 3G7UA 1RI1A 3ERCA 3O31A 4F86A 3LL7A 2NXEA 1WZNA 3EPPA 3KR1A 4CTJA 3E05A 4NECA 3I64A 2ZFUA 1BOOA 1JTFA 4AZSA 4P7FA 3G5LA 2R3SA 3CCFA 5K09A 1G8SA 4MIKA 3NWEA 4CKBA 5DTQA 1KYZA 1QZZA 3FUWA 2EFJA 4PYJA 2FK7A 3C0KA 3KQMA 1JQ3A 2P7IA 3M6UA 4GOOD 5FADA 4QQNA 2YX1A 5DTRA 2PWPA 1R8YA 2XBMA 3NMUF 3A27A 5GINE 2ZBRA 8MHTA 1NBHA 1G6Q1 4PYQA 4ER5A 2C7OA 4OQDA 3MERA 5K0BA 5B1SA 1ORHA 2OB2A 1XDUA 5EPEA 3LDFA 1Y8CA 2P3OA 3TFWA 2JHPA 3F4KA 3T7RA 2FK8A 5DX0A 5FHQA 5LQKA 4OA8A 4PCAA 3EMBA 3G2MA 1L3IA 1YF3A 1NV8A 2ZIFA 3GRVA 2ZBPA 3GRZA 1IM8A 3KPVA 4KIFA 3U81A 4LG1A 1M6YA 3SXJA 3ELUA 3DMFA 4M36A 3UFBA 1UFKA 3PX2A 2ONZA 2IIPA 4R6WA 3EEOA 2ZZNA 3FTEA 2H11A 1NW3A 2O57A 2WA1A 1SUIA 4RSRA 5E8JA 1X1DA 2QY6A 5GM2A 3TMAA 4GEKA 3DP7A 4RTLA 3LCVB 3UZUA 1PRYA 2UYCA 4IWNA 1X1CA 5HFJA 3S68A 3TRKA 2AOTB 3MTIA 3UJDA 1EIZA 5DRYA 4JXJA 5FTWA 2UYQA 5T6BA 4E31A 2AZTA 3THSA 5G02A 4CKCA 4HGYA 1D2HA 3P9KA 3TM5A 2CMHA 2OXTA 4RTJA 2I7CA 4PGHA 4X60A 3IYLW 5DPMA 1N7JA 5E2AA 3DTNA 1VLMA 3KR9A 2GAFA 1NW6A 3EVCA 3G8BA 3R3HA 2PX4A 4CKEA 5CCBA 3QV2A 1L9KA 2CKDA 5DTMA 3GGDA 4PYIA 1U2ZA 5EKXA 2PV0A 3NW9A 1XCJA 2PLWA 2IDKA 3GXOA 5GOZA 5ICEA 3KQQA 5EC8A 4DMGA 1ZGAA 5EZSA 1AF7A 4PONA 3DXXA 3KPYA 1Z3CA 3HA5A 5D1HA 4C4AA 3V8VA 3P71T 4QPNA 1XJ5A 2XYQA 1EAMA 4ZTBA 3EMDA 3KU1A 2ZW9A 3DLCA 3HVKA 3OFKA 4OA5A 5FHRA 1P91A 3TPZA 3PB3A 5LQNA 1P39A 4R05A 2Q41A 2ZCJA 3UJAA 3UA3A 1DL5A 3QOXA 2NP6A 3BT7A 1JR4A 3G88A 1KIAA 2HV9A 3FTFA 2G71A 2G70A 3Q7EA 5M5BA 1L1EA 4BLUA 1KPIA 1RJDA 2O05A 3CJTA 2PXXA 2ZZKA 3L8DA 5K0GA 4OX9Y 2IPXA 2NYUA 3EGVA 3QOWA 4GOND 1KYWA 4YUZA 3FUTA 4XUDA 3GRRA 4FP9A 3P2KA 2IP2A 4FZVA 2IFTA 1BKYA 2JHCA 3LHDA 4C03A 5GM1A 2VZ9A 4UOEA 1XDZA 5LQCA 5LQRA 4KRGA 5DLYA 5EQJB 5BXYA 3GCZA 5K0FA 5IH3A 2ZVJA 2GLUA 5DXJA 5CD1A 4U7TB 4AZWA 1FP2A 5DM2A 2FCAA 2YXLA 3GWZA 1NE2A 1VP9A 5EHGA 3C6KA 3KPJA 3SM3A 4G56A 4QVKA 3MQ2A 4GOMD 1L3BA 4OBWA 5T67A 5HIIA 3FUVA 2GB4A 2CWWA 5DM1A 2BH2A 1X1AA 3EGEA 1Q0TA 3CVOA 4E70A 3SX0A 2PX5A 3IHTA 3MAGA 2ZSUA 5DX8A 2WA2A 1IXKA 3NVMB 4RVFA 2DULA 3ANXA 2Y1WA 4BP3A 3CJRA 2O06A 1BC5A 3HTXA 1G60A 2VDUE 2F8LA 3IEIA 1KHHA 3C3PA 2PXAA 2I9KA 4GOLD 3HCEA 2P1DA 4AX8A 3KQTA 1ORIA 4BLWA 2YVLA 2ZBQA 4EKIA 3NTVA 5C0OE 2CL5A 3RIEA 4ATNA 3V97A 5K0JA 4CTKA 1AV6A 4RV9A 1JG2A 1B42A 4GC5A 4RX1A 4LWOA 3OE5A 3PT9A 4ER0A 2I62A 4DCMA 2QRVA 1EJ6A 1UIRA 4YV2A 4K6MA 5DSXA 1HMYA 2P7HA 3UJ7A 1XTPA 2WK1A 3HCFA 2E5WA 3VYWA 3LBFA 4HG2A 3EVAA 4BY9E 5K0LA 5FWAA 4PGGA 4GC9A 2B25A 2PX8A 3TLJA 3KKZA 1JG1A 2V7EA 4MHTA 4PIPA 1QYRA 4RTMA 5CVUA 3AJDA 5GIOE 4MWZA 4PCLA 2ZLBA 2BR4A 3BZBA 1Q0SA 3LDGA 1WXXA 2JH9A 5BP7A 5E9WA 3CC8A 3RODA 5F2NA 2P41A 5HILA 2ZIGA 2K4MA 2BR3A 1INLA 5EHIA 1R00A 2ZTHA 4RTPA 4X63A 2OB1A 3T7SA 2O0LA 3KQSA 2UYHA 2EX4A 2A14A 3DMGA 2PT6A 3TQSA 3A4TA 1DCTA 5EMKA 1NW7A 1SKMA 3SSMA 2FPOA 5DRTA 5E2BA 1SQFA 4O29A 4HTFB 5CIYA 3B3GA 4WVLA 3VC2A 2JG3A 1KR5A 3NDJA 5K01A 3OZRA 4E2YA 1MJFA 4L7VA 3OU2A 1JG4A 5HIKA 1VE3A 4FT4A 3UJBA 2OY0A 4B17A 2OPBA 2ZIEA 2H00A 3H2BA 3PFHA 5ICFA 3T7TA 3FUUA 3BWMA 3R0QA 4M38A 3HA7A 3M33A 5CVDA 4LWPA 4C07A 2PJDA 4EMSA 5LR6A 3GRYA 4AUKA 1I4WA 1SVUA 3FPGA 1R18A 1QAQA 3A7DA 1G55A 5CUQA 3JWHA 3MTEA 3HEMA 5EGSA 2OBFA 2ZWVA 4FT2A 1KP9A 2XYVA 5D1NA 3LBYA 3TOSA 3JWGA 4HTFA 3DOUA 4ER7A 1PJZA 4RTNA 3HCBA 3LX6A 2I6GA 4HSGA 3A26A 1TW2A 5JR3A 3E23A 3BGVA 2AN3A 4OQEA 4FSDA 1FPQA 3LDUA 3ER8A 4CWAA 4DF3A 4GBED 2UZ4A 4PNEA 5K05A 2OKCA 2GA9A 1MHTA 5P8WA 1F3LA 5C1IA 2AS0A 3G2QA 2AR0A 4IV0A 3PFGA 1O54A 3D2LA 5EMJA 5GIPE 4H0NA 2VDVE 1ZKDA 5E1MA 10MHA 3IV6A 3RW9A 3PX3A 3B7PA 5F2OA 1ZGJA 2YR0A 3KQOA 2B3TA 5LSAA 5EMMA 2PY6A 7MHTA 5DX1A 3LPMA 2KW5A 3JWJA 5DXAA 3LKZA 1FJXA 1V39A 4P7KA 5E9QA 5HIMA 3C6MA 3SVZA 3SMQA 3HVIA 5GP1A 1WS6A 4WXHA 2IBTA 3BXOA 1R8XA 3OPNA 2R6ZA 3I58A 4DQ0A 3LKDA 3MGGA 1SG9A 2ZWAA 4YUVA 4E2ZA 1KPGA 3M6XA 1D2CA 3FTDA 2B78A 4PYNA 2PKWA 3BWYA 4HC4A 1ZHFA 3TKAA 1R74A 3BGIA 4C08A 3C3YA 4GUAA 3E8SA 1YFJA 2QYOA 3FPEA 3MB5A 4X61A 5JUWA 3BKWA 5DM4A 5K0EA 4EKGA 3UA4A 2VP3A 3LSTA 4FS8A 3MHTA 5CVJA 5EIFA 5FCDA 2IH2A 1G8AA 5T64A 3UBTA 3P9CA 1OR8A 3DXZA 1YZHA 2N47A
chains in the Genus database with same CATH superfamily
4UVHA 1KVQA 1QV6A 4OAOA 4PZAA 2FSVC 4D0RA 5C1PA 4YQYA 4E2WA 2BISA 3JRNA 2J7PD 2JLQA 3NH9A 2VLIA 2YVQA 3B1KA 4RDIA 4YDSA 2CDNA 5DGHA 3X1ZA 1ZAYA 1N3LA 3Q5DA 5LA6A 1K6MA 1TKBA 4OB7A 3EY9A 4K88A 4PZUA 1Y98A 5CT6A 1S3SA 2H51A 5AR1A 3BMCA 3EIFA 4WZ6A 4DA8A 5JHHB 2JGDA 3BWBA 5KU1A 5GJBA 2KBFA 4DEVA 3RFVA 2XE4A 3JAMA 5JSZB 3G3EA 3HEAA 5BSKA 2CLMB 5FFFA 1S9DA 4V3BA 1X19A 5CH5A 4ALNA 1XZIA 3DR5A 4MKZA 3CV3A 1T6YA 5AXCA 1VXOA 1N7HA 3GLUA 1TM2A 3BM5A 5DLEA 4AY2A 2GDJA 5IDWA 1TA4A 3EBOA 3I9FA 3UIEA 3SAJA 1P0PA 4HVAA 1NR5A 1KGDA 4R9SA 1U2SA 5KYVA 4N6OA 2BM8A 1JJBA 4HN2A 1CT9A 4MW5A 5T3YA 3V4PB 5IU6A 4CLOB 1FP1D 2XOEA 2XNDD 5LA6B 1TTHA 1XGKA 3UM9A 1N0WA 3ISTA 5TMDA 4F8EA 3LDHA 3FWHA 4M54A 1ZRNA 2YXDA 3C7KA 5T57A 5TQ0A 3WLJA 4K1XA 3N2NA 3QEAZ 1Q21A 2Q1UA 2E0IA 4MDYA 4E5VA 1M6NA 1ZMBA 3LF2A 2G08A 3IODA 3NKFA 4Q3DA 3WMGA 1EIWA 2VK8A 4ID3A 2L42A 1P7CA 3GGCA 4EA6A 1JLHA 4WBNF 2B7CA 4QDUA 2CLCX 2FH5B 1L8OA 5HRAA 3WL3A 5JPCA 1T3SA 4OL0A 2P9GA 4TZKA 1CC1S 2DPXA 4IOLA 1V96A 3LVRE 1A9RA 1TZMA 3DV9A 3OPYA 3S1AB 1E3WA 3ZCUA 3KHTA 1VHLA 1YA4A 4QQFA 4EARA 3I2IA 3JVVA 1JB9A 1JLLA 4L0MA 3ET4A 3ZDEA 1Y4SA 4X41A 4RTQA 5JMWA 3ZE2B 1GPBA 1UXOA 3GFVA 3P9NA 4ZEWA 4E5NA 3MTAA 3FSEA 2GZRA 4QOHA 2EIHA 1T4BA 2NO7A 1LVHA 3PDJA 4BWYA 3AVVA 2XCUA 4S0ZA 1XOIA 1KK3A 2DLNA 2WWFA 4LRXA 4D97A 3KLOA 2HIAA 2Q5IA 1CJTC 4BLRA 1M3SA 5K3AA 3RRJA 3EX7C 4JVNA 1RKBA 4MW2A 3MMXA 3B60A 1YO6A 4HLQB 2GPSA 4C2UA 3TR5A 1XL1A 4JQSA 4KG7A 2PCJA 4B75A 1NUUA 3T35A 3H2SA 3SHOA 4G0WA 2ZB2A 3PQ4A 1J0CA 3IEVA 4GR4A 3DEHA 2GZ1A 3OPXA 5LOVB 3QVOA 2P8JA 3ZDDA 4N5HX 5FXMA 1CWUA 1LLUA 3WJ2A 2XRFA 2JW5A 1W0JD 3KL2A 3WV4A 2UYOA 2QGNA 2X4LA 4KQCA 4PAQA 1P1JA 1TM4E 3RSLA 4P82A 3DCNA 4Z9XA 1LLQA 1P4GA 3CGGA 3QYPA 2VPPA 2HK7A 4FTWA 5T5QA 3S4YA 1RWWA 1EBBA 3TZBA 4BKUA 5FQNA 3PNBA 1O96A 1L4FA 3SQNA 5DMHA 2B7BA 2IHUA 3AMVA 2NTNA 4X8LA 5DYGA 4HQRA 4IJ6A 1IY0A 3LVQE 1I4DD 1AO3A 3SHWA 1MX1A 3NAZA 3RTAA 3LPLA 3BHJA 1BDHA 4XLTA 2WG0A 3O8DA 5DNWA 4ML3A 1XKTA 5IK2A 3FZQA 5ARDA 1JJIA 1RABA 4GMDA 1XMPA 3GB9A 3VU0A 3KR0A 3ZU3A 2REOA 1MQ9A 1EEHA 3IHKA 3G2LA 4KQHA 2HIMA 3SYLA 5JATA 3NH6A 5LD2C 1E77A 4HFRA 5JY1A 1A2OA 3RFUA 1ISSA 2Z2ZA 5DF1A 1DQRA 3H99A 4DWOA 1YU9A 1DRVA 3EEYA 3F5QA 3IOEA 4NVRA 4URHA 2BEUB 5CFRA 5JO0A 1TB4A 5D5HA 3KE9A 3AIIA 4DSOA 3IR6A 1SY7A 2PANA 3BWVA 4KPFC 5LDHA 1VSQA 1NT4A 3AUYA 4I2VA 2NYAA 3ZTYA 3NVDA 1VLQA 4HN9A 2WWWA 3A6LA 3DH0A 3NHSA 3AR4A 1LF5A 4ACBA 4XVUA 5BNIA 3AHCA 3GBSA 4WOJA 3WSTA 4DUGD 3QLEA 4ER6A 1D1QA 2B0CA 3F90A 3I1YA 4PX5A 3Q1LA 2A0KA 4AECA 4B8WA 1TQ8A 4V03A 3FYTA 2QM8A 4PSDA 3L7MA 4OK5A 1P1IA 4KKVA 4CHGA 2ZPAA 1E3SA 2OLJA 3DAHA 1E8DA 3N74A 2AK2A 4HR7A 1ZHHA 4JYMA 1L1QA 1XK6A 5D00A 2I2DA 5EUBA 4ZAWA 1CUDA 1HT3A 2XRYA 3WHLA 3X0DA 3HVRA 1MAAA 2ZBEA 2ZRJA 4IV8A 4OAQA 4NATA 2GWHA 5FBKA 1L8LA 1Z0ZA 4MCIA 1ZW6A 3F7MA 4NL4H 4MINA 5J4KA 3G8DA 4M8IA 4NYIR 2EJTA 1PV1A 4RFSA 2Y2UA 1JX6A 2Z9BA 1ZLYA 3MFYA 4MP8A 1QZTA 1TCBA 2W2LD 4A8JB 1X7WB 2LPMA 4JUDX 3TQQA 4JXXA 1RJ9B 3GI1A 3OUZA 4IX9A 4MUBA 3PRYA 4ZRDA 3UKOA 1ESNA 2C20A 3KTOA 2G7ZA 3I23A 2EJWA 2PWBA 3ROFA 1SPXA 3B1FA 4CHTA 3ELDA 1XQYA 3ENKA 2XB6A 3GROA 1N8KA 2RAUA 3BRCA 5JSHA 1JFTA 4DAEA 3TRIA 2WIJA 4IH9A 1SC9A 4LQLA 4NZ9A 1Y9ZA 1Z13A 4R5HA 4JFAA 3QBVA 4MR8A 2WUEA 4R7TA 5AKXA 3IUJA 2VZ8A 4ZT7A 4JJFA 2GPNA 3KR1A 3MJHA 1DWUA 3MIIA 3RKRA 5CBPB 3GEBA 2WC1A 1G1MA 1D1TA 2R1ZA 1BOOA 2GARA 3I64A 4MUIA 4N82A 4QXAA 5DYNA 4IIHA 4CIWA 1I2ZA 4CKBA 2WE7A 3O8LA 3PNVA 5DTQA 5WRFA 1AHNA 2UYGA 3E27A 3OIGA 1XNGA 1D6MA 4HD8A 4PYJA 3MJ4A 1EB9A 3WK8A 3IV9A 3VJKA 1Q6YA 3NALA 3ZZTA 3VQTA 3CLHA 1A9YA 4QLAA 1U7UA 5F3WB 1DIAA 4BGEA 4QAJA 2Q1YA 3GNSA 3L4KA 2V3WA 4EW6A 3PWKA 1A9QA 1GQFA 1V8ZA 1XRJA 2W43A 4JC0A 4UPVA 4QM7A 3GMSA 5C37A 2YS6A 5DDIP 1EJBA 2QRJA 2YRXA 4IMRA 5LMZA 1D0IA 2ZDQA 3G13A 3MRSA 1KYVA 1TF7A 4O0LA 3R8XA 2A59A 4W9RA 4B80A 2WNIA 1IEVA 2YHIB 4K9LA 5FO0A 5I4KA 3NPMA 3ZYZA 1KL7A 4CTNA 1M1UA 2R11A 5FAXA 1WUTA 3U81A 3NUZA 1P0FA 3N6RA 3DEJA 2VA8A 4Q1FA 4AWAA 4HADA 1AGRA 3JQFC 2FPSA 3DMFA 2OGSA 3FOBA 4NV1A 1Y1LA 3K70C 4M36A 5KZMB 4EBBA 1VHJA 4R6WA 2WUGA 2WA1A 1PSZA 1I3CA 3IBFA 1SUIA 2P78A 3ML1A 2VXBA 3VR5D 5LYJF 2QTAA 3ROEA 3ZGLA 5HPYB 5JNTA 5AVUA 1KTIA 2FPGB 4B0OA 2XWQA 4OYLA 4D45A 5EIXA 1I7NA 5DRYA 3AVYA 4O1IA 5T4BA 1C0EA 1JAIA 2CGEA 5DCLA 2QSYA 5EP4A 2NUBA 1N0HA 1SKAA 3QXCA 1OE0A 1R4MB 3R41A 4YC7A 3VV2A 3THWB 3S8YA 1ZP6A 2HCTA 1QGUB 1Z22A 4QRIA 1TGVA 4Q6BA 4GI7A 5G4KB 2QGZA 2NZXA 3GL9A 3EVCA 4J6FA 2H54A 3V1UA 1IBKB 4YWHA 5CT4A 5HK9A 3Q0IA 5T6MA 1V9LA 4GOXA 4HGRA 1EVIA 2HQOA 3OPYI 2OL4A 1GD1O 4RM2A 4Q7JB 4MUKA 3JTEA 2W2LA 4Q7KA 4JI3B 2NAFA 3A2LA 4LY3A 3H83A 1Y4ZA 1F60A 3ZHQA 1Z38A 4GKBA 1VJ0A 1Z36A 3FN4A 1BS1A 2FSPA 1GA6A 1A72A 4NICA 1SBNE 1C2TA 3HA2A 3TPZA 3ZXUB 4LE2A 2W2KB 4BQOA 1P2VA 3OZEA 5KNDD 1LY1A 1MV5A 2NP6A 4X6YA 2CF6A 5JAOA 1UMDA 4UBJA 1BXGB 2KHZA 1WL8A 2D2XA 3USCS 2FB9A 1N1EA 1RJDA 4Q1EA 2WIBA 5TPWB 1GNTA 3F6BX 4J76A 3RRZA 4DVGA 5AOCA 1KYWA 2B35A 3UJHA 3WYCA 4KZPA 3ZWBA 4FP9A 1KI8A 1SR8A 2XCRB 2IFTA 1F6WA 2V5AA 3HUEA 5CK4A 5JSZA 2BHNA 2FWBA 2VPWA 3ANSA 4KRGA 5BXYA 5EQJB 3GCZA 4FFLA 1CPYA 9LDBA 1DWOA 2VF2A 1T3HA 4E15A 1J24A 1QH0A 1H0RA 3CKMA 4JBIA 3CF2A 4Z54A 3PENA 3U44A 3BE6A 1KBQA 4EG1A 4GOMD 4AN0A 4LK2A 3JZDA 4FNGA 4H16A 3VX3A 1PUJA 2FPLA 2ET6A 5TVKA 1E79A 4E70A 1PIWA 1JKXA 2PX5A 4H59A 4REQB 4MQ6A 4OSOA 2QUJA 3B1JA 2AX4A 4YB8A 1RRPA 1SC4A 4UE6A 4DC0A 2F43B 4IDBA 2WYUA 3EISA 4GPD1 4KLAA 1E2HA 3GZTB 3WGVA 4I2NA 1DHRA 3C3PA 1CQPA 1EA7A 2Q62A 4DKXA 3JATB 1PEYA 4Z9AA 4MUJA 3H1AA 1E4OA 3GJZA 2PGNA 3OOEA 2F67A 5FNVA 5C46F 5ALQA 3S2FA 5F9FA 4IFTA 2FEKA 1GL3A 3EF1A 4ND3A 2DETA 1EFTA 2GN8A 1U2QA 4RFVA 3VTFA 1ABFA 3B48A 5AH0A 2ZKLA 4NEHB 1NMEA 1NX9A 4ZO6A 1E1KA 3TJRA 4M86A 3X2FA 4QXMA 3GLGB 1N5LA 1X1EA 3L0YA 4M0PA 2FUG1 2NT3A 1P9LA 4X6UA 1CYEA 3LY8A 1YB4A 4RKFA 2VDWB 4ZCSA 2KLBA 1FK8A 4IJQA 2EC5A 1VTKA 5CA1B 2VUHB 4G81A 3RUDA 2ZRGA 3WB2A 3FETA 2PL9A 1XMOB 1UAAA 1FNBA 1H6AA 1RWQA 2ZQYA 1DCFA 2V7QA 4B82A 4ZICA 1X0XA 3MJVA 2HIGA 4MI1A 4MYSA 4CKYA 4O3MA 4Z4IA 1XMVA 3VUEA 3H3XA 3QHQA 4DBLE 3FGNA 2C1EA 3A32A 4EBFA 5AW8A 5EJ8A 4A03A 1H85A 1T9BA 2QX8A 4D96A 4ZYZA 3WNCA 5EJ7A 1TF5A 4O4LA 1ZNZA 4ZANA 4UASA 4YONB 4PS0A 1YDGA 2JLWA 4DQDA 1CY4A 4HXYA 1HNXB 1XLTA 2ZJFA 1I5OA 2Z9CA 1VB3A 3GUYA 1G7TA 2IHJA 2FKAA 3OX1A 4DV6B 1E0JA 4NZPA 1N3IA 1QZXA 2EX4A 4UHDA 1LNQA 2RHOA 3TQSA 1E1RA 1HV8A 3K30A 2QG4A 3MXOA 1TMKA 1W94A 3LOQA 1ZJ6A 3N0WA 4HDRB 1DC6A 4JHXA 4LV8B 5EIBC 1SQFA 2A9QA 3VYRB 5JXIA 2F55A 1KO4A 2V9PA 5IUKC 2I03A 2II6A 4TMFA 5JNUA 1YXMA 3CLVA 3E1SA 3OZRA 3QY0A 4NJEA 4TTTS 2BJHA 2DR2A 1LZLA 4Z4FA 1HYHA 1PL8A 4J75A 5LB4A 1Y3IA 1RBYA 4M38A 3N3BC 5KSYA 1I5RA 1LJUA 4K6KA 3MT0A 4CT5A 3C74A 4LYGA 3ABRB 3N86A 4MW7A 2JGJA 1TUEA 4YAGA 2IITA 2QXYA 3AR5A 3L1HA 2CVQA 4IMJB 3VC7A 5FBZA 1VRVA 4ZDKA 1FP4B 1DG3A 4IXWA 5CUQA 5AM2A 7AT1A 1T5BA 2CT8A 3ASZA 4FT2A 2ID9A 2ILVA 5D1NA 3DVAA 4NU0A 4UBNA 4ZZ2A 2X3UA 4NHOA 1OXVA 5G3YA 1N7GA 1CRWG 1T0HB 3DOUA 3L4SO 5HF9A 3TAXA 4CMJA 3PXBA 2QMHA 4WXYB 5HKLA 3LX6A 5K7SA 5HF6A 4D79A 1T0PA 3UKJA 1BW9A 3KTDA 1D2RA 2CLFB 1E2UA 1F2TA 1MOPA 2H7CA 1XA4A 2QUAA 2EATA 3O0DA 4IM7A 3T7EA 3HBLA 2K7FA 4RPJA 2BEUA 4D9KA 2AR7A 5AMXA 2V3CC 4CCAA 4FJ2A 1HSOA 2NUAA 4WJKB 2AR0A 1JWLA 3A1DA 1Z0AA 2R2GA 4HB2A 3OTOB 2BTEA 1E1NA 1OLSB 4XGNA 1MA3A 3RFFA 4BPRA 1RBZA 3ST7A 3DWEX 4WXRA 2Z4SA 2W37A 3NV9A 3WHKA 2W2XA 1B6GA 4COOA 4ETMA 4ZO9A 4H15A 2BGIA 1NFRA 4INZA 1TEHA 3CA8A 3LPMA 4L75A 3EOZA 2M2IA 2RHGB 3LKZA 4MQ5A 2AB0A 4OPMA 4W82A 3H42B 4Q4CA 4UPEA 3R40A 3CF0A 2YWBA 4YBZA 4D8TA 3HK2A 3T5GA 2EKDA 4D3ZA 4PR0A 3WRVA 5L6MB 3OPNA 4WINA 1R5JA 2IS2A 2CNWA 3OMXA 5TMEA 5AM3A 4LRSB 3LLCA 4JYPA 3X43A 1D2CA 3A28A 1HA3A 1RYNA 1RXYA 4X97A 4C4PA 1JILA 2CLKB 4FMDF 1LI7A 5A6SA 2AEJA 2AYZA 3C3YA 1T1SA 2QU7A 4L5CA 4C08A 2XCLA 4HRYA 1HM5A 3ZWWA 4H6WA 5DM4A 4TLCA 3UA4A 3RBVA 3HJBA 3A06A 4TOIA 3AFMA 3U60B 3V2HA 1G8AA 5CXXA 2ZJ5A 2VQ6A 5AI9A 4BMCA 1EQ2A 1T4GA 1XVTA 2G72A 2JCYA 3MGBA 4M76B 2GEFA 2VIIA 4JP5A 1CQIA 4MRSA 3R9KA 5TS3A 3UNXA 5MGBA 1Z4LA 2J3KA 5I5GA 1T3TA 2NOAA 2GXUA 1WQ3A 2YV1A 4PWYA 2FAXA 2QTNA 3A9RA 4A5SA 1KWGA 1P2BA 4ZOLA 5LA6F 2AVDA 4KWHA 4OD0A 4X9XA 2WY2D 1JQEA 2AR9A 5KAPA 2JLAA 1M8JA 4JL5A 5SZIA 1JH8A 4P33A 2O1XA 3CH6A 3H11B 3O92A 1BS2A 1IEWA 2BLLA 2QZSA 3FLEA 1ZS9A 2CDBA 4LKRA 4RVOA 5G0TA 5LXTF 5AM5A 3VSEA 3DBRA 4DSAA 6LDHA 4C14A 3U9SA 2VJYA 1NA5A 4OKNA 3F46A 2AOVA 2OO5A 3BJEA 4UUAA 1IBMB 2CVZA 3W1WA 2G67A 3ZHRA 1BX0A 2F8TA 5ECGC 1P7WA 4GXRA 2ZI7A 1E60A 4J07A 5AJHA 5K8TA 4TTAA 4TMZA 4DV5B 5K3BA 4Y6GB 3K73O 1SU7A 3TQFA 1MENA 2Q3MA 3CX7A 3VR6D 3W9BA 3TFQA 5C4IA 1L5OA 2J08A 2IOFA 3R3ZA 4KRFA 1XVAA 2Y6VA 4R1TA 3OFJA 4KZKA 1RE1A 5JVDB 1HXHA 3T5DA 3HJHA 3L3BA 4QTYA 4TLEA 3VKUA 5LC1A 3S2IA 4JOBA 1KDOA 1U1DA 5CXSA 4YMLA 4DR1B 4IFIA 4JODA 4W99A 2C07A 2H2GA 5MF6A 3D43A 2XCOA 4I50A 4O4HF 5B1DA 3U19A 4MCAA 1P61B 2ZRNA 2QX7A 3L8FA 4YAWA 3U7QA 4PHFA 1SJ9A 3O47A 2RCYA 3AVOA 3U09A 2G1JA 1XWWA 2VHTA 5D3ZA 5AW5A 3AF4A 2P1ZA 5ALNA 3RANA 1QO9A 1MIOA 4QZVA 1JDBB 1T9GS 1P62B 2XADA 4H4CA 5CPFA 5FBQB 2X2PA 2ZRAA 1DRUA 1H94A 5ALOA 1XALA 4W8GA 5AW2A 3BCRA 3QTBA 5D3MA 5J2TB 1CDOA 2PZKA 4MJ7A 3FOWA 4UPDA 1H2AS 3C87A 1SEVA 2NXNA 3NI2A 4URWR 5FORA 4JVMA 1VRWA 5BQOA 1I7DA 4GXTA 2HA7A 4LZWA 2BOVA 1AUPA 2D59A 2PWYA 4NOKA 3KT3A 2WFLA 4BLTA 4IOKA 1NKVA 3E53A 4HN4B 5E0KB 4G5SA 3VR0A 2ZYRA 1L3CA 4RA9A 1YNSA 3T1NA 3MLBA 4GWKA 1D03A 4PQFA 2I3AA 2YHSA 1NXTA 3ENWA 5AJVB 1CQJA 3AI1A 1X1QA 2A9OA 1UC8A 2H2HA 4FQ5A 4DA4A 1FMCA 1YZ3A 4JN6B 4ZI7B 2TSYB 2HK6A 6REQB 4YJ3A 4PIVA 3WTCA 4EHJA 1Z6QA 3ZCQA 2ZT8A 1EXDA 1IZ0A 1HE1C 1Y4UA 2ANBA 2C3OA 4DNPA 3OH8A 1J9EA 2O3TA 3AM3A 1I94B 2QGFA 1P4JA 2YDYA 4I3HA 1PFKA 1MGPA 5FX2A 4HF7A 5JG7A 3AKYA 5KQGA 3Q15C 3RC9A 4JDPA 4C0JA 3WO0A 1YVPA 3R9XB 1L7EA 2F3UA 1EWYA 1GRNA 5DCYA 3T06B 2B4TO 1SOWA 5E6SA 2LCQA 1RC0A 3GAZA 1JFLA 3DL0A 3H7AA 3PWSA 3KWMA 4A0FA 3BWDD 3P8ZA 1I14A 2AI3A 1ULSA 3DLIA 4NY1A 4RWZA 1AXGA 3C7CB 1NOJA 2BHRA 1DOAA 2CXTA 3EB9A 3N7UA 1OAKA 1C3LA 3NVAA 1WSBA 3RI3A 2JANA 1NP7A 5E95A 2AEEA 1BFUA 3TSYA 5JHGB 1NBIA 4GMFA 1AQIA 1WEKA 1JEJA 1QIHA 2C5FA 2OO7A 3L8ZA 4ITUA 2W6IA 5DLPA 4QJ4A 3AY7A 4LSWA 4G1VA 2QTBA 4WMLA 5KYGA 4MW0A 2AA3A 4FGZA 2Y1EA 2ODWA 1SCAA 1UMDB 1ZU4A 3KEGA 4P38A 1YK1A 4CLOA 4Z3KA 3MVEA 3TL6A 1ZJ4A 4ZGWA 2VT7A 3O7WA 2OWEA 1TU3A 2FX5A 3PSHA 3RSSA 1N2XA 2F9MA 2W6QA 2EP5A 3IEUA 5J5VA 2XNDA 1O94C 3QELB 4FMPA 4INPA 4NSNA 1J9GA 5K0NA 2FQWA 2Y4OA 3C8ZA 1LFAA 2PCLA 4BRSA 5LQUA 1U8FO 4ZQIA 1Z0FA 3MTGA 1XCBA 4WA8A 1Q77A 4XX0A 2H16A 2PWAA 3Q3JB 4X7MA 1MZPA 3BORA 1M34A 1HEYA 4M8SA 3EQ2A 1DQSA 4RF3A 2FMXA 5JCXA 1U0BB 5IZ4A 3NHRA 5CM8B 6GPBA 3LTNC 1CZHA 1RRFA 4MLCA 3CIOA 3E15A 4C04A 5IZCC 1I1NA 1USKA 3W3AD 1V41E 1WHTA 2HA4A 2NYVA 2J85A 4C6HA 2QX6A 4MW6A 1VKOA 2DHRA 1Q7RA 2IPLA 2WUDA 3ETLA 4TTVA 4EKNB 4RZ2A 1NW5A 2E37A 2R1TA 4N8EA 2PRKA 2G5PA 4FVTA 1OI4A 4Q3EA 1S4MA 1OKKD 3TW6A 4PAGA 3K35A 1GZVA 1GUBA 1YCGA 5NULA 2DU8A 3C5CA 5AKJA 2XJ9A 4BNFA 1CY8A 4LHXA 1WCV1 5BURA 3CUVA 2XZTA 3RVPA 3TIXB 1ZN2A 1C2YA 1QIIA 2YNMC 1YRQA 3IQEA 3WICA 1RP1A 2F1RA 3CRMA 3LUKA 2O1EA 4BAGA 3IPXA 1JJAA 2XF2A 4NR0A 3WLAA 2EF1A 3ZV5A 1P19A 1P0QA 4U8GA 1VL8A 4BEWA 3FUWA 1LRLA 3H4IA 2FK7A 2WMDA 4UZSA 2CHFA 5REQA 2DWCA 1TVKA 3TAUA 5JZMA 3WGZA 3BCSA 2C2KA 4N0QA 1YZGA 4YJFB 2O8EA 1H22A 4UVGA 3KO8A 3PC8C 3EY4A 4UNQA 1CUGA 3L6EA 1DARA 3K5HA 5SZJA 3W79A 4P3KA 5K6AA 4G9BA 1NBMD 3SZLA 4NXNB 3U7JA 1RYHA 4WW0A 1IYZA 3GRVA 2ZBPA 4U9IS 4ZAZA 3KELA 1E63A 1WETA 1CR6A 1UPUA 3KKPA 2I4IA 3RHFA 1IU9A 4CCYA 4OP3A 1N5KA 1X1DA 2WMOB 3JXEA 2ACVA 1V4VA 5GM2A 3ZU4A 2IYWA 4RTLA 1E2DA 4AQDA 3S2YA 1BGVA 3PXAA 3OP1A 4P31A 3QG1A 3ZWAA 1UOQA 3NGXA 3Q8XB 1E5VA 1QHYA 1QIMA 3CEJA 3ITDA 1A7UA 2AZTA 4GIBA 4G86A 3REQA 3RTEA 4R0NA 3ETHA 1K8ZB 4ZVKA 1Y5LA 2G1UA 5CNMA 1KK1A 2JHFA 2WVGA 3EZGA 3TF5A 4R9UC 3K71B 1VIAA 1KJQA 2BC9A 1O4VA 2J8ZA 1USIA 1V16A 2RGCA 2ST1A 2VOEA 3OJFA 2LIPA 4GZ6A 4PGHA 3ZY5A 1GLVA 3KR9A 4B7CA 3IAHA 3O2SB 4B32A 2WJHA 4FD2A 3RROA 4QYWA 1ZXBA 5KOJB 2IEZA 1JFRA 3IVRA 4G5FA 2X0IA 3EPRA 3IPLA 4I1OA 1H8HA 2DFDA 2CXSA 2JAOA 2XR1A 1ID8A 3WLFA 1OKKA 2Q2WA 2Z8YA 4KRYA 4XYMA 4G4GA 5FR1A 2XYPA 4R3WA 4CJXA 1O5TA 3GYBA 3U4CA 1H2WA 2IHKA 3ZCSA 1TC2A 1YE5A 2IT1A 5H81A 3VPFA 4BNKA 1WE2A 1BGWA 3NTXA 1AMOA 2DFTA 1B73A 4L8WB 4IH1A 4BJ3A 2YIJA 3U4QB 1RZ3A 4WY2A 1DT5A 4B6EA 3H2ZA 2B8JA 1EX9A 4IVRA 2G0AA 3ZIAD 1H93A 4UHBA 1X1SA 2JPDA 4DMKA 2F4VB 5ALDA 3JSAA 3PE4A 1E0KA 3C8HA 3MCAA 4TYMA 1CETA 3W77A 5L7YA 3LLMA 1L1RA 3SC2B 3V1KA 5K5EA 1XI2A 1V1RB 2DPLA 1BKYA 4M8NE 3GUHA 5CNJA 1WXQA 4UOEA 1X15A 5LQRA 2IZ0A 3CLSC 5EJAA 1OLXA 4B7ZA 3UANA 5BOVA 3IHLA 1FP2A 1OBFO 3VSBA 2FLWA 1HLFA 3W05A 3DMPA 1M72A 1NE2A 2I2WA 1A88A 2VPYA 3LX5A 3OE7A 3OZBA 2FCRA 2GBLA 2JFBA 2ISSD 2OC9A 4JDUA 621PA 5JAZA 5J58A 1D0VA 1SVWA 1ENOA 4X7RA 5HTKA 4IBOA 1IC6A 2O0JA 1WD5A 4MQFB 4AW9A 2J3DA 4ZK2A 3A9UA 1S3GA 2IKSA 5DX8A 3S2SA 5KU7A 1EDDA 4F4DA 1YBFA 2QD1A 2VI5A 3K1YA 5FF9A 3ANXA 1OY1A 2A4MA 5IANA 1PG5A 2GJ9A 4CV3A 3VHXA 3O26A 3F7NA 1UANA 2Q6TA 1U2DC 4ISBA 1M2WA 1HT0A 1Y5RA 5AKHA 2X76A 1I7LA 5BVGB 5IC4A 1C9NA 3GPIA 3DYIA 2YVLA 1GCAA 4N03A 1XELA 3ZS8A 2FKNA 2PNFA 2C58A 3H84A 1JDJA 4C20A 4E7PA 5K0JA 4MVCA 4UBIA 1UZAA 4X20B 4KNVA 4YAFA 4B3MB 4ARSA 1OGYA 2VYQA 1ZC3A 4ZAVA 1JRLA 3PT9A 2RCNA 4JGIA 5DGDA 2WVAA 2G40A 4LJ8A 3EAFA 4NEQA 3TTWA 1ZY2A 3KEQA 4K6MA 5FL7A 1Z35A 2J3MA 3NBXX 1II0A 1SUAA 4UNRA 4JH0A 3HCFA 2PR2A 3KTFA 4BY9E 2NUTA 2PMEA 3IILA 2YRWA 1NI4B 3MB8A 4BNGA 5FBLB 4JZYA 4J1QA 3LIPA 1PJ8A 4FLMA 2D5LA 3LYLA 3W2TA 1O8CA 2ZLBA 3TDNA 4LOAA 5JJ5A 4UMDA 2JH9A 2EZ9A 3B9BA 3CR7A 5E9WA 4EY6A 1OBCA 3OLVA 5FO1A 5HILA 1L5SA 4A1FA 3O1IC 4HUQA 2D5CA 3JD3A 1T6ZA 1N0VC 4RTPA 4E09A 3TQRA 4BVFA 5BYAA 4LXYA 1NJGA 2XT6A 2JLRA 2Z43A 3L0CA 4ZQGA 3G0BA 4WD3A 2XCIA 4ZI7A 4YRIA 4B3HA 1GAJA 1EU1A 1V6CA 2AXPA 5E2BA 5LWQA 3OZ7A 1ZWKA 3KVNA 4HDMB 2SKEA 4Z6KA 4NMXB 2XB8A 1KR5A 3CUTA 3K53A 1DLJA 3FY4A 3I2GA 3RAJA 2QRPA 5AD1A 4G0NA 4L7VA 4N5LA 3FCEA 3SFTA 5H3CA 3UATA 2OY0A 4B6PA 2BFMA 3PFHA 1LTQA 4Z9BA 5JH7A 4D9CA 2QENA 5A6VA 4NU5A 1X13A 4MUHA 1UXIA 1Y37A 3CCBA 4BB5A 1O77A 4KEAA 3MYRA 4E2ZA 5A4AA 5DNCA 4MKRA 2VTBA 4L8FA 4HDSA 3E9ZA 3ZIUA 2JGMA 2DB3A 2QT1A 1N5JA 3KBBA 1G16A 4NAVA 4CEHB 3S70A 3IAEA 2JK1A 1LWOA 1DQZA 1ONBA 1S8NA 2MIIA 3QXJA 1HQYE 1J8MF 1KK0A 2CY0A 4Y1RB 4YDRA 1A97A 4HSGA 1XZBA 1XZGA 1Y5IA 2R7MA 3H1TA 4QJBA 4AO8A 1J2YA 2J4FA 2AJCA 1H1TA 1N5MA 3FYUC 3KUKA 4KQ9A 5ALSA 3TCKA 2XMPA 3TOCA 4F6CA 4D0NA 1FYEA 2LKCA 2PJUA 2QR3A 3HCPA 2VZ0A 3S8MA 2FN3A 4Q66C 2W71A 1O54A 1E6LA 4PLTA 3OCCA 4B7XA 1SWVA 1A2QA 3Q6NA 1CY2A 1OFUX 2ZGVA 1WF3A 4MIOA 4TSRA 3EXHA 5HDQA 3AEUB 1E5XA 5KYWB 1JV2B 4ZXFA 3KAKA 3TZKA 3D81A 3TLMA 2NZ8A 4P0QB 1TMOA 2IJGX 1W49A 1PFWA 2N1MA 1FSZA 2DPHA 1LBIA 2B34A 3E84A 1NRJB 3FNIA 3KLBA 1PCXA 3OM1A 1M0SA 4FYVA 3B82A 4IP0A 4EJFA 3SYNA 5AJXA 4DUYB 1X77A 2GXSA 2RJNA 2O8NA 5ECDA 1QKIA 2B83A 3AHGA 2A9RA 3GYGA 3H2JA 1C0LA 1P3Y1 3EFHA 3WMRA 3KOWA 3NNDA 1Y1KE 4GP9A 2DBYA 3HSYA 4GZ5A 4TROA 1KPGA 2B20A 4GGOA 3T7IA 2QE7D 1EVZA 1JU3A 1R74A 3WLHA 2IXGA 1SRQA 3EIOA 3IDAA 4IIJB 3MB5A 3ZY3A 5JUWA 4D81A 2D0PB 1FTGA 2BBWA 1Z25A 1RRVA 2P9TA 3SEFA 2X9GA 4Q3OA 3UMMA 2AW5A 1FDRA 3D3QA 5FWYB 3K9FC 2W0SA 2IH2A 4BRWA 4BGDA 3AETA 1EFAA 1XXHB 3GU3A 4RGVA 2CNDA 1KF0A 3HM2A 4KO8A 1I7PA 3RSOA 1UADA 4MV1A 3JVEA 1P6XA 2AFVA 1EFPB 121PA 2JKVA 1V37A 1VKHA 3MT7A 3U3XA 1GVHA 4QQKA 5BYKA 1R8SA 3O95A 3JVUA 1DQNA 4A6DA 1ZU5A 3HRHA 5ICCA 1J23A 2C2HA 3Q2OA 5TQJA 3HN6A 4ONEA 3ZWDA 1P72A 2B8EA 2VPXA 2VTKA 1GKLA 3Q9NA 2A5GA 2D5AA 2QXTA 3C14C 4YS6A 2QRMA 2VYVA 4F4UA 2RBGA 1QOPB 3MGKA 4P84A 2WWIA 3AIMA 3DA8A 4G26A 1XEXB 1YAHA 3KB6A 4DSUA 2D54A 3SU8A 1GQOA 4ND6A 5ESXA 1SIUA 5FOXA 1GV1A 1N5DA 5GWXA 3H3FA 4U7JA 4YRSA 2R751 2X2FA 2ERCA 4DA6A 1JDVA 3QI2A 3QFCA 2GDZA 4CU5A 2CVPA 4CXMA 1UAYA 4RF5A 3BMQA 3GO4A 1WUYA 4D4MA 4WKPA 4GE3A 3MOGA 4YXFA 1JP7A 1S89A 1Z6PA 1HORA 2LD4A 2QDXA 4G8JA 4MVJF 5A7HA 4QXQA 5JFTA 1GGHA 1OCEA 1T3GA 1Z2EA 2GM9A 3ASYA 4Y9DA 3HHEA 5I7HA 1FLVA 1FQOA 4INAA 1P74A 2OO3A 4NYMQ 4OI2A 5EZQA 5AVSA 1SHKA 1YZLA 3KUXA 3TG8A 4YCNA 2YJ5A 3E0QA 3H2GA 1FSFA 1N0IA 3KJHA 3KZMA 3QK7A 5LBIA 5A4JA 1GZ3A 2Q3DA 3JRXA 3PPWA 5KCMA 2YOFA 1V11B 4FHEA 5JQWA 4BVLA 4O5OA 2V65A 3K8QA 3FNBA 4QUHA 4ZO8A 3BQ9A 3TECE 2C2ZA 3GFBA 4KVAA 5TEVA 3HCCA 2Q3CA 5ADUS 1L1FA 4UOZA 4G8CA 1L4YA 3AB7A 1UC4B 3O3MB 2O2SA 4FFNA 3LLSA 1OGIA 2P62A 4KMSA 2BLNA 3B3AA 3P9SA 3QKSB 3ON5A 2HF9A 3AONB 2DAPA 5K51A 3WYAA 1QF7A 5LXTA 4V0ME 3JR7A 4JSYA 5L3QA 1ITZA 5DHFA 3PI6A 5EUMA 2W22A 4WFJA 1TA0A 1KA9H 4P8RA 1CZRA 4QD3A 3AKZA 3ZWNA 1EFUA 1E1QA 3O84A 3RC1A 2G9UA 3O90A 4HDNB 4ZOLF 2EBWA 2P65A 4EITA 2ZT6A 3K0SA 2HNKA 2BJWA 4C7JA 3MCVA 5SICE 3QEBZ 5F21A 2GTHA 4FEGA 4GMHA 4LHZA 4C89A 1NGSA 3O21A 1J70A 2C94A 2P35A 1M83A 5H02A 2I91A 3HQ4O 1VE7A 4PHTA 4OHXA 4C01A 3NTUA 2WM9B 1BKSB 1G3IA 2OAP1 4W4TA 3KFVA 1RI3A 4KQFA 5E7JA 4D4JA 4RTRA 2B36A 5I9BA 2WJAA 4LVOA 3KKNA 1ICEA 1NHGA 3O4JA 4UM7A 2DSNA 1AHPA 4LZLA 3REQB 1YOBA 3RF7A 1E0SA 1M66A 1DEHA 1LK5A 1NQWA 5AWFC 4YCBA 1L5KA 1KU0A 4U0JA 3CF4A 4E46A 2UDPA 1KQPA 3JD0A 1X1BA 1V9SA 4RZUA 1R27A 3IL2A 2PBZA 5CIWA 4DJTA 1MFPA 1QWSA 5ALPA 5FBWB 7REQA 1GAWA 1XTVA 1LNZA 1CUJA 3DBOB 3QYJA 2XQKA 3SC4A 5B53A 1KAEA 2OV1A 1IN8A 2QZ9A 4HB3A 5A5VA 3EAQA 5ER9A 4XR9A 4CF5A 2YYYA 3RVMA 1ZR2A 1VGQA 3LECA 1C9JA 4TXNA 3VC1A 4E6EA 4URZR 4OEHA 4CIBA 2QRLA 3HBAA 2ZTVA 4L0QA 2OCKA 1TYAE 3DB2A 2IVZA 4MR7B 3E3AA 3SFZA 3TOVA 3UJ6A 5JVDA 4F6RA 4B4WA 3G68A 5AVTA 4M1TA 3ZW9A 3MMNA 4MUEA 2RAPA 5IW8A 3WSVA 1VOTA 1KZ1A 4MDHA 3IPAA 2X4GA 1CTQA 3M70A 1Y5MA 3N59A 2AE1A 3HL0A 3A6KA 1AC5A 1JT9A 3ZOZA 4AICA 4BNDB 3C5VA 1MIHA 1H2FA 2N1BA 1ID1A 5F2EA 2JLZA 4BLOA 1VC2A 1NNI1 3M1AA 3H6HA 3VHRA 5FOWA 2YFQA 1JDBC 2HF2A 1YQQA 3W8EA 5EJ5A 2HZ7A 2P5SA 5HKBA 1RIIA 4JYCA 4E4TA 2DBRA 3HYTA 1AUOA 1RQLA 4DSTA 1DX9A 3QYAA 4YMIA 1NHWA 3IKTA 1IIBA 1Z7BA 1IUKA 1BJTA 1E8NA 2QIOA 1A5AB 2FSFA 3BTSA 4KX5A 5DMXA 3WGTA 1IXRC 2KX7A 2OP0A 2RI6A 3OKCA 4HZUB 2I29A 3WYGA 1VA4A 3DDCA 3RS0A 4KIGA 4TTSA 3IAS1 1TTQB 3I9KA 3SKYA 4YR7A 4LOIA 3BFKA 2MCFA 1PEKE 1YZKA 2BGJA 3TM4A 4DNQA 4DV1B 3CZ5A 5DI3A 3E9MA 4W5OA 4MGHA 1TUBA 2A86A 3EK2A 1M7GA 1KO5A 4TVSA 2JEYA 4HJXA 3L05A 4MULA 3B2NA 2AX3A 1TLFA 3CH4B 3W9SA 2WI8A 4HGOA 3T9FA 4R8RA 5L51A 1SBIA 3DAPA 4C76A 4KQWA 4ENRA 2XVAA 2OSVA 3GJ7A 4GE0A 3ZXSA 3LZDA 1CNMA 3QEMA 4LFCB 1K86A 4A27A 1I4TD 4QXOA 2BUAA 1SOMA 2NSLA 2QN9A 3HC7A 2H85A 4OY3A 1FIUA 4L4RA 1EHIA 3A9CA 5JSFA 4K05A 1H2RS 2VAWA 1UWLA 4JROA 4U7GA 5J1SB 3R3WA 5JWRA 1UBMS 1NLFA 3AKCA 1YVDA 4TGLA 1FJHA 2EFJA 3A4LA 4X1KA 4YQEA 1FXWA 3JQ6A 3N76A 3RIGA 2QVGA 5BT9A 3THYB 1E6KA 2WJGA 3ZLVA 4LJLA 1N2ZA 3WYBA 4FC6A 2B69A 1YTLA 2I7DA 5K0BA 2O5EA 4MS3B 2WM3A 5DISB 3OEHA 3GNTA 3LO5A 3JATA 2VRNA 1RQ2A 2H06A 4Y0AA 5BV0A 3RTCA 1GPKA 3QF7A 3UN1A 1VDZA 4BWGA 2XNKA 1LC0A 4IGFA 5H5JA 4R3UC 1XD2A 1P29A 1CUHA 2OCPA 5AI6A 1NL3A 2EWMA 1M6YA 1IQRA 3EVNA 2FZ4A 1AURA 2NQ8A 2JK0A 2XT0A 1OREA 2Y0EA 4AG6A 5EIEA 3GLGA 2NVBA 3IDSA 3JQAD 4UARA 3GVIA 2H11A 3JZAA 4WK4B 2QT9A 3REFA 3UT6A 5IS2A 2GKGA 2Z1NA 5AI5A 1W8DA 1Z8DA 3O8NA 3M5DA 3LYHA 1R12A 3G5UA 5HFJA 3TRKA 3KD2A 2RC5A 3LC1O 4QYMA 3MTIA 3GFRA 1E3EA 3ADDA 1W2HA 4D3DA 5G02A 4CR8A 1YCHA 4N7MA 3PHIA 3Q1KA 4OG2A 4HAWA 3V4SA 4YYEA 1G7RA 1PHPA 3KWFA 4X60A 2KI5A 1JJ7A 1BX1A 5FOQA 4I4TB 2GAFA 4GHWA 1HZZA 2AYYA 4V24A 4IDGA 4YR9A 3A8TA 5JOQA 1U04A 1DQPA 4W1RA 4K9QA 1S96A 2VR1A 3LWBA 3VA7A 3ZHZA 2AL7A 3D3KA 5GOZA 2IDKA 1KDTA 5BQFA 4NWIA 2D8AA 1AF7A 3WYNA 3DXXA 4TRNA 2GESA 2RJOA 4KQXA 5PNTA 2XRMA 4A91A 4F60A 3N2YA 4G36A 4YRJA 4F2GA 2XH8A 1EK0A 2ZJ1A 1UBFA 4N4AA 4EPWA 4OA5A 2QSZA 1AIPA 2VG8A 3HFJA 1JXAA 4F04A 2WD8A 3PXEA 1UBEA 5AXBA 1GV0A 3WLRA 4QUKA 1PE0A 2BFPA 3B1WA 4DOMA 2ZI5A 1YUMA 3U7IA 4R2XA 3OC0A 2P4QA 2FEWB 1L1EA 1TO2E 4L85A 4YMSA 4BV8A 4DMHA 5M5BA 1SBZA 3WQSB 3SHVA 1P3DA 1KDPA 4JJ7A 3WP0A 4EG8A 1NBME 4G5HA 1L4LA 3MWJA 4N47A 1HF3A 1DMRA 3HBMA 2B5OA 4Z0PA 3CVXA 4RD2A 1IQUA 3OTIA 4A4DA 5LKAA 3LCMA 2X5OA 1IUOA 4UQPA 4WNAA 4TV8A 1T8UA 4EB6B 4ZHSA 2PS0A 4OP2A 3IP8A 3HXLA 4U7TB 1U7PA 1WABA 1PAUA 1P9NA 3TINA 3A10A 1KFJB 4QVKA 3AJRA 3ZXYA 2NU6A 3P7MA 1BE0A 2O23A 3BMQB 3K5WA 1J5XA 1GDHA 1KFKB 1Q14A 1K89A 2CZCA 3QJGA 4DCPA 3PL5A 4Q4JB 5IXJA 1JYEA 4YUAA 1IAQA 1XQ9A 1USVA 4C6TA 1J2RA 5C5EA 4PFJA 2WA2A 1JQ5A 2R7LA 3AFNA 1W2WB 3MS7A 4IXDA 5BO5A 4XYGA 1HDCA 3DAOA 2EYQA 3DEFA 3A04A 3FNEA 3GN1A 4H0CA 1GOTA 2XT9A 2BSXA 2GHIA 4OQYA 2G04A 2XY4A 4A8HA 2G9NA 4EUHA 4IEEA 3HL4A 2ZYHA 3B9QA 4N54A 4AS2A 4DCCA 1H05A 6NULA 1AV6A 1B4DA 1GA4A 1QG0A 2HO5A 4PFQA 4W6QA 1PJAA 1YBHA 2OV8A 1K98A 2Q5EA 3IAXA 4LWOA 5TB5A 3RS3A 3SQOA 4CKXA 5BY2A 1MOSA 4MWTA 3V4ZA 4ER0A 3LSYA 1ABBA 5J4LA 2JIRA 3VOSA 4HAUA 1F0NA 4YV2A 4JEMA 4ZHQA 2JLSA 4OOEA 2YYZA 3BH7A 2WJ4A 3VYSB 3L6DA 1ZOLA 1T0BA 1LI5A 4QHYA 1QH9A 2PWZA 4ND5A 3Q9UA 4XM2A 3EVAA 1JNXX 2Q7OE 3ZU6A 4EJSB 4MDEA 2JNWA 4ZKDA 1WF6A 4AMGA 2ZEJA 2VJLA 3HYLA 1IEXA 3PF8A 4TT8A 4U02A 1S0UA 2C2YA 3GJSA 3S2EA 3TJZA 3AJDA 3EZXA 4AWBA 1HSZA 3TXAA 4LQCA 3L7JA 1I6WA 4YP0A 3H11A 3UC9A 4MW1A 1VMEA 1AS3A 1TZJA 2WPDA 4OFXA 4WCDA 4J0HA 4MOWA 5I01A 1V4BA 1OD6A 2E6UX 1FDSA 5UKDA 1I10A 1TLTA 3N8IA 1LD3A 3RU9A 3M1LA 4FFWA 4ZAFA 1MNQA 3AV3A 2PT6A 4HGQA 1G8FA 2C54A 3PHBE 4RH1A 1QR2A 2HNBA 5F9MA 3SSMA 3T1OA 4BN0A 4LC9A 1B26A 1T4CB 3CU5A 1NBWB 1L4NA 2VK1A 3RVNA 2OESA 1QQ7A 5C3MA 3GVCA 3TSCA 2Y99A 2CHVA 8LDHA 2DFVA 3ZLBA 1VE3A 3TQTA 3T0FA 1YCFA 3FUUA 1GFSA 3E9EA 4L3OA 3MCUA 1CZLA 5CD9A 3GRYA 3HPRA 4DLYA 3CIFA 2PKXA 2MSWA 3FSGD 4AUKA 4H9GA 5I48A 1JIUA 2C9YA 2JEOA 1FVFA 4Q05A 2POQX 3LT4A 1KAQA 3MTEA 2KJQA 4FZRA 3QWBA 3RLIA 4NPCA 2J45A 4ALLA 2VJAA 3V8PA 1N6RA 3JWGA 2CSXA 1D2EA 1AUXA 2EFEB 3O75A 3H5LA 4OMFG 5BSHA 3LUHA 2WU1A 5SYAA 3H5WA 3DKVA 4EA7A 1EVJA 1HDOA 4MIYA 1KS9A 1TE2A 4R41A 2PFKA 1TW2A 4G1MB 3K0FB 5JS2A 4OQEA 3J81k 2O48X 1GL7A 5BN5B 2IUYA 3ZEIA 1XNQB 2FR8C 2CYAA 3BA1A 2PUJA 4BLPA 1BJKA 1GPMA 4EGJA 4XZ3A 4Y6QA 5BWMA 5AW4A 1WMBA 1OVGA 3PJRA 1CF4A 5J63A 1N2OA 2CB9A 3TCNA 4OUDA 4H0NA 4TS1A 4EI9A 1LWNA 3V8EA 4DRZA 3AL2A 3H87A 1TPZA 3K9NA 1H2ZA 1L6IA 5C1BA 2I65A 1G3UA 4Q4HB 4EHHA 4M22A 5BOSB 2WBLC 1MH1A 3LC0A 5FTLA 1GCUA 1KSJA 3OJEA 1V3VA 4O8ZA 4W1QA 4X3CA 1X7ZB 2R6R1 4X5OA 3MTDA 4BKPA 4XD7D 1VCIA 4YAKA 4OCZA 3T3HA 3C6QA 4D43A 1JKFA 3HVIA 1T24A 3EDMA 3BXOA 2R6ZA 2GBFA 4JB3A 5IHPA 4L95C 4UW9A 1JTVA 3WDSA 2FEMA 3R8FA 1YHYA 3ELBA 2B78A 3J7TA 1CP2A 1NSTA 1T5OA 1EDOA 1P5ZB 2ZK7A 3CXRA 4IVPA 3EUWA 1P2GA 3FOAA 4INOA 3I72A 3ZTWA 1NBEA 1NF9A 1A9OA 2O5CA 1WXIA 2RGAA 4RCVA 5IC6A 2IELA 1T8TA 1T2FA 1JR6A 5KDOA 1XPOA 3QP9A 4O4HB 4YCJA 5L6LB 3FMVA 2Z1MA 3A6EA 3GGPA 1HLPA 4P3YA 4CM3A 4RHXA 1E1CB 1KMCA 3P9CA 4PC1A 4OX9B 3K2QA 1EGQA 2N47A 4IIJF 1Y1SA 3FPJA 3FYDA 2EZ4A 3DTVB 1JKMA 3CJQA 3DEAA 3DDUA 5TQ2B 3T99A 2WT8A 3JQAB 4NZYA 2JLYA 3HNRA 1AKEA 3E61A 9MHTA 2GVNA 4GMKA 4BGVA 4Z1OA 5KYNA 3JVDA 4F3CA 3VU8A 4NG4A 2G5GX 1R4ZA 5K3CA 4RAQA 2QRGA 3W7AA 2Z56A 2FW7A 3ZLJA 1MT3A 1XTKA 2P8SA 3NAMA 3AV0B 2V54A 4EHLA 5CG2A 1JQLB 3VR4A 1C50A 1G63A 5I7SA 1SD2A 5J43A 1ISMA 1E7YA 4LF5B 1BWPA 1SOUA 2XDYA 1SCBA 1ZGCA 3VTZA 1PJTA 1WW3A 1XRRA 2WRZA 4NJMA 3DTVA 3G02A 2OZKA 1Z6AA 2QDKA 1VIMA 3CB2A 4X8MA 2P9FA 4TTIA 2ZCUA 4RSHA 2O4CA 3E48A 3RU2A 2QA5A 4UUQA 3HUFA 1FRVA 4PZDA 4YX9A 4HOYA 3DQQA 2BDUA 2FV8A 5T7BA 1QSGA 4BNJA 4ZMBA 3IC5A 5H4HA 3P9ZA 4M0LA 2PUDA 2ZU0C 2ZIWB 2OZLB 3NOQA 2REQA 4RTOA 4TUYA 1Y1PA 2XZDA 1IY9A 1T5DX 1ZEJA 2C31A 5HE9A 2PZMA 1IHPA 5E6SB 2BKUA 3MM4A 3RU3A 4BBAA 1ZMRA 2HA5A 3LBHA 3DEIA 3DOCA 3QRWA 4XDGA 2J0SA 5EJIA 4AKIA 1XDSA 1V5FA 1P2DA 1U4SA 2HAEA 2YFKA 4MKGA 3RAPR 1OAOA 3TAHA 4R2WA 1OFGA 2QTZA 3JYNA 2EJVA 2QQ5A 4NPAA 2SHKA 1M2NA 3FYCA 2PH7A 2WLTA 1E1DA 2CJWA 3CN7A 3U4HA 1GEGA 1U2TA 2Z5FA 1C9YA 2DH6A 2BY4A 2WD9A 3FPAA 4F9GA 1G38A 1N92A 4NYJR 4RYLA 1DKMA 3EC7A 1SUEA 4MS3A 5D01A 2GYVA 4AZTA 5J4YA 4JI7B 3IEMA 2H0RA 1PZFA 1UJCA 4XDYA 4JLOA 4H3SA 3NBYC 1K63A 5CYOA 4XE5A 3ZCVA 4BWFB 4GF5A 2YINC 4IVNA 1X9IA 2I0FA 1X92A 5ARCA 1A5TA 2AOWA 1IQ0A 1HYGA 1OFIA 1JJVA 1VFPA 2D4HA 3L7NA 4JT8A 3ONFA 4OJNA 1NWHA 4BNWA 5B36A 4M49A 3I0MA 2X8JA 4A2WA 1EG2A 1PK8A 4OHWA 4EUEA 4M9XA 3U48A 1VKJA 3C3XA 5KWVA 4FYKA 1EK2A 5E9JA 1WUKS 4QPZA 2WU4A 3EPKA 1FFHA 1L4GA 5LQSA 4EQ6A 7ADHA 4WWHA 4DZRA 1G5HA 1ZVJA 1OYWA 2WKRA 3LWZA 3NC1C 2EIXA 4XWGA 1JLSA 1MCZA 3SBEA 1KYQA 5JNVA 2XLCA 1A77A 1CUAA 1BQ3A 5TXGA 2OOKA 3E9NA 2M6LA 2LRHA 2CMGA 3D7SA 4G24A 2FSSA 3ZK7A 4QNNA 2QPOA 4ZA2A 2V7WA 4GSLA 1W52X 5EMLA 4F3KA 4N76A 1W87A 4DCOA 3F47A 4FXOA 2AG5A 1NVGA 5CLLA 1GR1A 3EGDB 3MMSA 3O4RA 4XJVA 3L02A 1WSDA 3DE5X 4QDJA 3HVJA 4CLRB 1FXUA 2XVMA 3ITNA 4F9EA 1PLLA 4IDEA 2HBQA 4L4SA 1HEUA 2VQSA 4UUBA 1ZLXA 1KRHA 5EWJA 1B1CA 2J3EA 1VKRA 3SJAA 3NRBA 4NH0A 4AY5A 4Q3KA 3LXUX 2BGMA 1SCQA 3OAAA 1FQWA 4LSGA 1U3UA 1T2EA 1ZCAA 2XZPA 1NRWA 1A82A 4AFNA 3DT9A 1AQUA 4M7RA 2LGJA 3DTYA 4WLOA 2GKOA 3SX4A 4ZWNA 3VZBA 4B8ZA 1AA6A 1BDIA 2IEBA 4RLHA 5HMMA 3KOZA 2HEIA 1A4UA 4C7OB 1HQDA 4GO1A 1WR8A 2NNWB 2Y1OA 4JY7A 1F2TB 1XMJA 3ETDA 4A9AA 4GMXA 1YFZA 1NP3A 5AVKA 3AUFA 1BE6A 3FNQA 2GO7A 4HEJA 1ISFA 3NIWA 4YV1A 2W2TA 4BN5A 4ZIRA 5JZBA 1A5ZA 3DM5A 1WHSA 1RMYA 3JS5A 2X0FA 1ZVVA 4EELA 2EWVA 1SD1A 1QK4A 1UQUA 3A9SA 3CZCA 1I24A 3PPIA 3HH8A 1JHYA 4PLZA 1JHMA 2R8OA 1PJBA 4O2AA 4TRJA 4BDTA 1I9GA 4YAUA 2G06A 2J31A 2HD4A 4JOSA 5B30A 2Y0CA 4EO7A 2VNHA 2C8JA 3H1FA 1TCCA 2AOXA 3LPNA 4E32A 3ET5A 4RKEA 4X7BA 2P67A 4KV9A 4R69A 2P6UA 1SO8A 2E3JA 2YW2A 2Z1DA 2KPOA 1EEXB 1FY2A 1YUBA 4G09A 4QATA 4LZPA 4BS9A 2C78A 5C80A 2FYTA 3I9V1 2DG2A 3CTPA 2B37A 3QYFA 1ILWA 3EZNA 3QZUA 4LE0A 1P7YA 3FOFC 3L01A 4CFZA 1QG2A 2Q29A 3U6BA 4G65A 2OV4A 1ETHA 3WX0A 4OJYA 4FXPA 1UBLS 1Z0KA 2OENG 4X00A 1CK4A 1SKYE 3L6BA 4ZVRA 1U6IA 3C43A 1KE1A 1SU4A 3THOA 3RYHA 1WIWA 2LE0A 2D5IA 4DREA 1LZKA 1T15A 4ZI7F 3T5AA 1XCPA 1GCIA 5F35A 3UJ9A 3U9TA 3ERCA 3FCUB 1GXSA 2ZI4A 3DO5A 3LL7A 4NI5A 1R0WA 4NFSA 1MB9A 4EY4A 3GPLA 1U4OA 1HGXA 4GQIA 3ZI7A 1URPA 4DIMA 2Q2VA 2MU1A 3H0KA 3MJTA 3ZK9A 2AMLA 5JSQA 2CSUA 3JQDA 4H7DA 3ZDBA 2F8SA 3EZFA 2GNAA 3QLUA 2ATIA 2P5UA 2QR2A 4ZTUB 1OWMA 4E5YA 1NMQA 2Q1TA 1F0YA 3FB1A 5F9HA 1FUIA 1UK7A 2C88A 5A9TA 4DT1A 4B34A 5ICSA 5KNCH 1Z74A 2I1QA 2X1VA 4KBYA 2GK4A 3LP5A 3USES 5JLJA 2JGRA 1N2SA 1BNCA 1LW6E 2GKSA 5K8CA 3FWZA 5IJ0B 1PI3A 3D2BA 3DHNA 4DHEA 4FS3A 1YIOA 3PLRA 3DZIA 3VNRA 1RHQA 2ZB3A 2BFWA 4YCSA 4I7EA 4CQLB 1MVNA 2Q0QA 3I6MA 2I78A 5FHQA 4DCNA 5IAEA 3H2KA 4PCAA 2QW1A 3SHTA 4EO4A 4AMBA 3MUNA 5FLKA 5KTOA 1EQUA 4S05A 2GD6A 2PUBA 3K1ZA 2PQMA 4NMWA 2IHBA 2YUTA 3DLAA 4C0SA 3GP5A 1TTPB 2Z9DA 1XZNA 2NU8B 2OTCA 3C3KA 1WOMA 3FDXA 3GDOA 2QTWB 3NJ8A 4FI3F 4XXHA 4PX9A 1N33B 1EHYA 1X1RA 2GZ2A 3TMAA 4BB9A 3U7QB 1L5WA 2QAJA 2VDJA 1XPJA 1X1CA 2I9PA 2VT6A 1IJBA 3SDSA 1PEDA 5TIIA 4JXJA 3L7IA 4K0KB 3EOBI 1PR0A 4MQFA 1S2LA 1C7FA 2C9MA 2IE8A 2H17A 4WPGA 4IOMA 3K3PA 2M1XA 2O8FA 2WKQA 5IDVA 5AHWA 1K8RA 3CS3A 5DPMA 2UUPA 5IN5A 4J4TA 1PK7A 5THQA 2QJWA 3W5CA 1OFVA 1QFZA 4K6CA 1XN4A 3RFCA 1EUCA 4AP5A 1IPFA 4LEIA 3PDWA 1TJ4A 1X86B 5TT1A 1QYIA 4JP2A 2XQVA 2WHEA 3BRWA 4IHJA 1J2EA 3HJGA 3KS9A 3PEUA 2PV0A 1DKUA 1XCJA 2PLWA 1ZXXA 3NW9A 2CVOA 1Q3TA 3N7TA 3E9YA 3MS2A 4M1OA 4URYR 1L5VA 3DKKA 3VOAA 3E18A 3IBGA 4KQMA 5B2EA 1VPVA 1XA3A 1XZKA 4YRFA 4N7BA 5C8DA 4EJMA 3G7NA 2IBMA 3V8VA 1B93A 1KWKA 4YRBA 4HYYA 4MLPA 4N0PA 1UL1X 1WXFA 3X3HA 1CUZA 1GT6A 2C2XA 2YFYA 2RIRA 4OH1A 1ESCA 2OXCA 1P39A 2UXCB 3JASB 1HLGA 3GXBA 4QG3A 1XKLA 3CLUC 2ZJ7A 3QOXA 4MTCA 4B35A 4AMZA 2OM6A 4DPKA 2ZSBA 4OUDB 1E92A 2KYRA 1C30B 2HV9A 2PV7A 2VYNA 2WU0A 4DC9A 1JSLA 1I6KA 1SU6A 5K0GA 2JATA 2NYUA 4MQLA 3VI4B 1BQ4A 4C4SA 2ZCVA 3MAAC 4BZPA 1DV2A 4NE9A 4HI0E 2PQ2A 2KQUA 5DTJA 2NQTA 2VZ9A 4UTXA 4YRLA 3SZOA 5KYTA 1GTSA 1YBVA 3PEYA 3IDQA 2O3JA 3QX8A 4FN5A 4OXIA 4TT3A 3RUHA 5KQLA 2ZVJA 1R64A 1Z4QA 3K31A 3HMKA 1K4YA 3IR7A 3O4HA 5CTAA 5DLDA 1QVVA 2FCAA 1GNSA 1OFUA 2OMEA 3KT6A 3QVGA 1F14A 3JASA 2YWRA 4Z86A 5KYXB 2ZREA 3D4PA 4G56A 3WWCA 4NYMR 4NIMA 2FPGA 2X5JO 2IS4A 2CLLB 5DHQA 1HURA 4AZ3A 3K6SB 2VRBA 2PLFA 1C7JA 3K9GA 2VC2B 4D57A 1J09A 1FQJA 2PRYA 3JAKB 4G5XA 4FWBA 4JIMA 3SNKA 2QL5A 3LHSA 4GOKA 4OHUA 1DKNA 4IUYA 3ZV4A 4CZ2A 1MLDA 1Q5PA 2DWUA 4P80A 4PO3X 3C2QA 2OXIA 2XA2A 1PGPA 1V47A 2C4TA 2IOFK 4HZUA 2F8LA 2VDUE 4RA9B 5IJ9B 5CK5A 1Q0ZA 2I9KA 2ATCA 1NOIA 3KYIB 1RWMA 1RVV1 3KQTA 4OJMX 1JSRA 4YJGA 3N2GB 3TLCA 2PKQO 4EEKA 2ZB7A 4RF2A 1WBDA 1EXMA 2B2NA 4I1RA 1L8XA 2P30A 3KTAA 3OUTA 1W9MA 2PD4A 2OBNA 3JU3A 3QE0A 1AX9A 1JMKC 3NPAA 4RX1A 1MRNA 4WL0A 1XCOA 5CP8A 1OJLA 3AFGA 5DHUA 3T7AA 3AZPA 1CEYA 1Q17A 2O2CA 1PTJC 3NOOA 3QELA 4EVSA 1F48A 2NZVG 1AN0A 1SWWA 2QP4A 5I9SA 4PBSA 2C9ZA 3DHYA 3KLMX 1GPWB 3JQ9C 5TV2A 3UY4A 4ASUD 1V5EA 1DAKA 3I62A 1XLUA 2PS9A 1GSOA 1H5QA 3A3PA 3BJRA 1M2HA 3F7TA 1DWQA 4PGGA 3QVSA 4MROA 5E7IA 1Q7GA 2V7EA 3ZDXB 1Z8HA 2GZ3A 2R25B 4DPLA 1NAIA 2C9BA 3N8KA 3HM9A 3QEOA 1PNTA 3LL4A 2YL2A 3NWPA 1E62A 2BR4A 1N2EA 5F52A 4AUNA 3MCWA 1Y6FA 4IZIA 5BP7A 3N28A 2AMFA 3EXAA 2GNPA 1ZNWA 2ORVA 4RHFA 1DBWA 2BR3A 3K92A 3Q4GA 3UAGA 2IPNA 2V1UA 3H17A 6ADHA 4HB4A 2HEGA 2NN3C 4N6GA 2AMVA 3KBOA 3T3MB 3KQSA 3O9MA 4UDYX 2A14A 3K94A 1ISPA 4BV3A 1EDEA 4J3FA 1YK0A 3ECSA 3PYLA 4LX8A 3DHEA 4GX0A 2IHVA 1I3LA 4YWJA 3W8NA 5IYZA 1KZ9A 4DV3B 1H2BA 1B8PA 2IGBA 3QFFA 2R8XA 4OQQA 1VCMA 3FZYA 3E3MA 1NW4A 4WK0B 1IH8A 4BP1A 4ACAA 2D74A 4JYZA 1U8XX 3CX6A 3H86A 3GT7A 3P0EA 3BFPA 3ISVA 3T9AA 2W2VA 3MELA 4LYAA 3KD3A 1GDTA 5EKSA 1WUHS 1FE8A 3GH3A 1LJ8A 1WSWA 5J9FA 1Y7TA 2OAEA 4AD8A 4DLPA 1TIPA 3CINA 3LBYA 5A1JA 2QAGB 3VOBA 1H23A 3V8NA 4RD0A 3TD2A 3GBPA 1SM4A 1AKNA 2B82A 3O8BA 1QFYA 4P4SA 3HR8A 2PUWA 3QF4B 4JI2B 4YO7A 5JR3A 3BGVA 4I1PA 3TGLA 4PPYA 5ECYA 3RC8A 4V0NA 1T5IA 3I1IA 3L0SA 1L7MA 3B7GA 1ISIA 3E5RA 4EPRA 2I8LA 2QTTA 3Q8WA 2H08A 4P4LA 5FFNA 4GWGA 2H8KA 3KVOA 4BFLA 4ARIA 3QVKA 3OD1A 3KYJB 3T7SA 4LAFA 3IUYA 1GTRA 4NESA 1PBNA 4GBJA 1KJNA 1Z4IA 2H0QA 3ONNA 1Q95A 3G82C 1UK9A 3G5MA 3HYSA 2QTLA 4QYIA 5ITZB 3ZQKA 2Q07A 5I9MA 1ZK1A 4Z5XA 3G79A 5I9NA 1CY6A 3JWJA 1Z47A 3OETA 1YKFA 4B87A 5IMBA 2NO0A 3T5PA 5K6RA 3C6MA 1YS1X 5I4BA 3KB1A 3UG6A 3CG0A 2XBUA 1G66A 1ZYUA 1MBZA 3E2PA 1GGVA 5ESDA 4K9KA 5IULC 3FWKA 2CLDX 4LNAA 1R88A 2Y4NA 3ZNOA 4Q4DA 4XJSA 4E4RA 3HU3A 1P8JA 3PT5A 3FCOA 2CHUA 1OLSA 4EJ0A 4LFAB 1AVTA 5F3DA 2G1KA 3NC0C 3VHLB 2XIQA 2IYZA 2IYXA 4OGLA 4EKGA 4FS8A 5TMBA 3KSAC 1IOZA 4OMDA 4AF7A 5CVJA 1XTBA 2QSJA 5CH8A 2QORA 3TQCA 3WYFA 5JCJD 2P9EA 4BJ5A 5KX5B 3B51X 3PZBA 5EN4A 4QJ5A 3EEQA 2WPDD 4YRQA 4C9BA 4CIVA 1FRQA 4Q1BA 3QNUA 5KDLA 2WWHA 3AEYA 3LYUA 4B4UA 2C61A 1XU7A 1H2HA 1TF2A 3BTOA 2C7QA 4OREX 5KNDA 3AR6A 4DBVO 4XD2A 3NWBA 1YZYA 2FMIA 2NQ2C 2DWOA 3N70A 3QKUA 4GG1A 4V2UA 3SLGA 3SXUB 4QGHA 1YDWA 5M7EA 1Z0DA 3B6MA 2OCBA 3KFLA 5FP0A 4OGKA 3VPAA 3IMGA 3MILA 1EJ0A 2IYQA 4FNOA 4JLJA 5A71A 1DXOA 1KERA 1FFDA 1YNOA 2YUIA 3BDVA 1CRLA 1ZUNB 3CLRC 5E3JA 4ARZA 2FQQA 3DOIA 1DX6A 3GAAA 4JQYA 3W5SA 2D2EA 2QG6A 2YZMA 3E9CA 5EYPB 2HFKA 5DZSA 3IP3A 3PGKA 2J87A 1Z0UA 3BOSA 4C1NA 4C22A 5JJBA 3ROTA 3T0IA 1XCGB 2YWGA 1DAIA 4J4BA 4PSAA 4WESA 3K1TA 3QUTA 3WV5A 1A04A 3B9RA 1G20E 1M2EA 2XUQA 3HKEB 2IEDA 4W5WA 5ERXA 3GW8A 3NWJA 3NJ4A 3KHKA 3KB8A 3RPEA 1PKXA 2EZ8A 3BL8A 4IKEA 4B33A 4P32A 1MJ5A 2QQGA 2FPRA 3M6WA 3HHPA 3I6ZA 3RS4A 1I13A 5FOTA 3KALA 3PDCA 3QMPA 1KJYA 1Z17A 4C2BA 3GEDA 3PC8A 2AKAB 4HWRA 2VAPA 3IURA 4LJ6A 4XDHA 5DTEA 4WFQA 3WGLA 3ESYA 4TVKA 1RT9A 3GAFA 3HKBA 3N8DA 3CX4A 4J2OA 5DM0A 1WB9A 4JR1A 1Z5PA 1S1CA 1R6UA 2HRZA 4LKOA 2FP4A 4IIXA 3P97A 1QVZA 2WMNB 4RJJA 2E9SA 3DNMA 2ATEA 3B5IA 2R79A 2I67A 4DR3B 2O2XA 4P7JA 5FLXA 1TQ2A 3RT1A 4BYMA 2FZLA 1MZVA 3TPFA 5B1YA 1BD3A 1IRXA 2YC2C 1F4LA 4LVUA 4CQLA 2A0YA 1XCLA 5ELXA 3G9UA 3OP4A 2Y0DA 1Y1QA 5EEHA 3ISJA 2B4QA 1KNXA 4XQCA 3HVHA 3KUUA 1JEQA 3OWOA 4BFTA 4PQYA 1GCGA 4EUKA 1VSUA 2CJYA 1HX7A 5EIWA 2H1SA 4R8LA 4RTKA 3ZD8A 4TM8A 4EPVA 2Y66A 4MVJI 1PYGA 4MR9B 1HOXA 5I6DA 3THYA 3LW7A 4L4XA 4DE5A 2I3BA 2OGUA 3JQRA 1Z88A 4RZ3A 1QGYA 2P6MA 5TPZA 2IV2X 3VYUB 3WFIA 3KJZA 4C4XA 5EQTA 1JDTA 3L04A 2ZYSA 1XMXA 3PQEA 4W5JA 4DVJA 2NUPA 3MS4A 1Q1EA 1B0PA 1PUIA 1XZLA 2WFLB 4L6IA 2G82A 1VGRA 5CFLA 4X65B 2R6FA 2DFKB 3WJ7A 2O8FB 1QDUA 1GUZA 1W96A 1D7AA 1G6OA 1QH1A 2WTAA 3I12A 1TRHA 4DY6A 2WUFA 4EFMA 4NG5A 1PT8A 2BZGA 3FA2A 2OD9A 3JAWB 3V33A 1XL0A 5EIHA 1N3YA 3R7FA 1RJGA 5KYXA 5D6NA 3T7KA 5HNKA 2JI4A 4IIEA 3WYDA 5BOSA 2DBQA 3PCXA 5JD4A 2EOAA 4PHHA 1F9AA 2PQ0A 3D4OA 4GICA 5JAHA 1W2GA 1ZUD1 1C1HA 2WKWA 4R54A 2VJPA 1BA2A 4TV9F 3TNJA 4FEAA 4IKOA 5KVSA 3V4RA 1FXWF 1JL3A 4CMBA 5J4HA 3I32A 1FOEB 4WX2B 3E2IA 5HBRA 2FZCA 4GU5A 4M37A 4AXXA 2ZSHA 4ARAA 4DJFC 1DKQA 3C1TA 2FLKA 4XI9A 4CTOA 3LVFO 4EECA 3C5EA 5EOVA 5K03A 3U5ZB 1W581 3TOXA 1TEZA 2GK6A 3KCNA 3WRXC 2EHDA 3L0PA 3OG9A 3QHPA 4LXUA 4AJIA 3R5SA 3B85A 3CKYA 1I2AA 4CF6A 5HM8A 4YT8A 3UJ8A 3D02A 1QB8A 3CMMA 1WKCA 1E66A 1SVOA 3GEGA 5TE9A 3TVDA 5H3HA 4NOLA 3TR6A 3WOVA 3DBVO 3GIWA 2R0QC 3GLIB 1GL9B 1GG8A 1I4EB 2ZJBA 1JDSA 2BM1A 2VATA 4C6RA 4X84A 4RSMA 5MFZA 4OQFA 5JAQA 2NPFA 3CZQA 3FIUA 2E89A 4QNRA 1F8UA 1WZIA 5FUBA 5CG1A 4K9OA 3UYKA 1KEKA 2MJLA 1DSSG 3TNFA 5AVOA 1ESDA 2X15A 3DKRA 4MA5A 3TBHA 4WZAB 1US8A 5FA5A