1RIEA

Structure of a water soluble fragment of the rieske iron-sulfur protein of the bovine heart mitochondrial cytochrome bc1-complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
127
structure length
127
Chain Sequence
AMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIESKE IRON-SULFUR PROTEIN
publication title Structure of a water soluble fragment of the 'Rieske' iron-sulfur protein of the bovine heart mitochondrial cytochrome bc1 complex determined by MAD phasing at 1.5 A resolution.
pubmed doi rcsb
molecule tags Electron transport
total genus 33
structure length 127
sequence length 127
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1996-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1rieA00
3GCEA 4NB9D 2NVGA 3C0DA 3L73E 5BOKA 2E75D 1O7NA 1ULJA 2I7FA 2QJYC 3EN1A 1O7HA 1VM9A 3GB4A 2DE6D 4H44D 2CKFA 1ZRTE 3GKEA 2YIUC 3EQQA 4EMJB 4NBED 5CXMA 2QJKC 2HMNA 3L74E 4NBDD 1P84E 5AEUA 3BCCE 2E4QA 3GL2A 4QDFB 2ZYLA 2JZAA 4QUPA 3VMID 4AAYB 1SJGA 1KYOE 3GTSA 1RIEA 4HM1A 4HKVA 5KLIC 3VCPA 5HL4A 3FOUA 1NTZE 4NBHD 4QDDA 3D89A 2NVEA 3CXHE 3DQYA 4P1BH 4NBBD 2YFLA 2Q3WA 2HMKA 1JM1A 4H13D 4HM7A 2XRXA 4HM6A 1EZVE 1SQBE 1RFSA 2HMJA 2BCCE 4HJLA 2QPZA 3GZYA 4QUQA 4NBCD 3GOBA 2NWFA 2HMOA 2FYUE 3CWBE 3L72E 4H0LD 4HM0A 3L75E 3VMHD 2NUKA 1PPJE 2DE5D 2YFJA 2HMMA 5KLVE 4QDFA 2IBZE 1L0NE 4NBAD 1G8JB 1O7WA 1NTKE 2BMQA 3L70E 1G8KB 3H1IE 1VF5D 1FQTA 2E74D 4HM8A 3N0QA 1NYKA 2XSHA 3VCAA 2FYNC 2BMOA 3AZCA 3VMGD 2XSOA 1PP9E 2E4PA 1NU1E 2QJPC 2D2CD 3GZXA 2E76D 4HM4A 4HM2A 4AIVA 1VCKA 4NBGD 2HMLA 1UUWA 1WQLA 4HM5A 4U3FE 1O7PA 2GBWA 2B1XA 1SQPE 3H1LE 4PD4E 1O7GA 3GL0A 4OGQD 4QDCA 3CX5E 3H1KE 4P1CH 1BE3E 1O7MA 2GBXA 1EG9A 5AEWA 2YFIA 1NDOA 3H1HE 2ZT9D 4QCKA 2YVJB 1NTME 4QURA 2NUMA 2BMRA 4HM3A 1ULIA 1SQQE 1UUVA 4PV1D 3TGUE 1SQVE 3H1JE 1Q90C 1L0LE 2XR8A 5KKZC 4NBFD 2NVFA 1SQXE 3L71E 3GTEA 2DE7D 1BCCE 1KB9E 2B24A 2A06E 2JO6A 4NB8D
chains in the Genus database with same CATH superfamily
3GCEA 4NB9D 2NVGA 3C0DA 3L73E 5BOKA 2E75D 1O7NA 1ULJA 2I7FA 2QJYC 3EN1A 1O7HA 1VM9A 3GB4A 2DE6D 4H44D 2CKFA 1ZRTE 3GKEA 2YIUC 3EQQA 4EMJB 4NBED 5CXMA 2QJKC 2HMNA 3L74E 4NBDD 1P84E 5AEUA 3BCCE 2E4QA 3GL2A 4QDFB 2ZYLA 2JZAA 4QUPA 3VMID 4AAYB 1SJGA 1KYOE 3GTSA 1RIEA 4HM1A 4HKVA 5KLIC 3VCPA 5HL4A 3FOUA 1NTZE 4NBHD 4QDDA 3D89A 2NVEA 3CXHE 3DQYA 4P1BH 4NBBD 2YFLA 2Q3WA 2HMKA 1JM1A 4H13D 4HM7A 2XRXA 4HM6A 1EZVE 1SQBE 1RFSA 2HMJA 2BCCE 4HJLA 2QPZA 3GZYA 4QUQA 4NBCD 3GOBA 2NWFA 2HMOA 2FYUE 3CWBE 3L72E 4H0LD 4HM0A 3L75E 3VMHD 2NUKA 1PPJE 2DE5D 2YFJA 2HMMA 5KLVE 4QDFA 2IBZE 1L0NE 4NBAD 1G8JB 1O7WA 1NTKE 2BMQA 3L70E 1G8KB 3H1IE 1VF5D 1FQTA 2E74D 4HM8A 3N0QA 1NYKA 2XSHA 3VCAA 2FYNC 2BMOA 3AZCA 3VMGD 2XSOA 1PP9E 2E4PA 1NU1E 2QJPC 2D2CD 3GZXA 2E76D 4HM4A 4HM2A 4AIVA 1VCKA 4NBGD 2HMLA 1UUWA 1WQLA 4HM5A 4U3FE 1O7PA 2GBWA 2B1XA 1SQPE 3H1LE 4PD4E 1O7GA 3GL0A 4OGQD 4QDCA 3CX5E 3H1KE 4P1CH 1BE3E 1O7MA 2GBXA 1EG9A 5AEWA 2YFIA 1NDOA 3H1HE 2ZT9D 4QCKA 2YVJB 1NTME 4QURA 2NUMA 2BMRA 4HM3A 1ULIA 1SQQE 1UUVA 4PV1D 3TGUE 1SQVE 3H1JE 1Q90C 1L0LE 2XR8A 5KKZC 4NBFD 2NVFA 1SQXE 3L71E 3GTEA 2DE7D 1BCCE 1KB9E 2B24A 2A06E 2JO6A 4NB8D
chains in the Genus database with same CATH topology
3GCEA 4NB9D 2NVGA 3C0DA 3L73E 5BOKA 2E75D 1O7NA 1ULJA 2I7FA 2QJYC 3EN1A 1O7HA 1VM9A 3GB4A 2DE6D 4H44D 2CKFA 1ZRTE 3GKEA 2YIUC 3EQQA 4EMJB 4NBED 5CXMA 2QJKC 2HMNA 3L74E 4NBDD 1P84E 5AEUA 3BCCE 2E4QA 3GL2A 4QDFB 2ZYLA 2JZAA 4QUPA 3VMID 4AAYB 1SJGA 1KYOE 3GTSA 1RIEA 4HM1A 4HKVA 5KLIC 3VCPA 5HL4A 3FOUA 1NTZE 4NBHD 4QDDA 3D89A 2NVEA 3CXHE 3DQYA 4P1BH 4NBBD 2YFLA 2Q3WA 2HMKA 1JM1A 4H13D 4HM7A 2XRXA 4HM6A 1EZVE 1SQBE 1RFSA 2HMJA 2BCCE 4HJLA 2QPZA 3GZYA 4QUQA 4NBCD 3GOBA 2NWFA 2HMOA 2FYUE 3CWBE 3L72E 4H0LD 4HM0A 3L75E 3VMHD 2NUKA 1PPJE 2DE5D 2YFJA 2HMMA 5KLVE 4QDFA 2IBZE 1L0NE 4NBAD 1G8JB 1O7WA 1NTKE 2BMQA 3L70E 1G8KB 3H1IE 1VF5D 1FQTA 2E74D 4HM8A 3N0QA 1NYKA 2XSHA 3VCAA 2FYNC 2BMOA 3AZCA 3VMGD 2XSOA 1PP9E 2E4PA 1NU1E 2QJPC 2D2CD 3GZXA 2E76D 4HM4A 4HM2A 4AIVA 1VCKA 4NBGD 2HMLA 1UUWA 1WQLA 4HM5A 4U3FE 1O7PA 2GBWA 2B1XA 1SQPE 3H1LE 4PD4E 1O7GA 3GL0A 4OGQD 4QDCA 3CX5E 3H1KE 4P1CH 1BE3E 1O7MA 2GBXA 1EG9A 5AEWA 2YFIA 1NDOA 3H1HE 2ZT9D 4QCKA 2YVJB 1NTME 4QURA 2NUMA 2BMRA 4HM3A 1ULIA 1SQQE 1UUVA 4PV1D 3TGUE 1SQVE 3H1JE 1Q90C 1L0LE 2XR8A 5KKZC 4NBFD 2NVFA 1SQXE 3L71E 3GTEA 2DE7D 1BCCE 1KB9E 2B24A 2A06E 2JO6A 4NB8D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GCE A;  4NB9 D;  2NVG A;  3C0D A;  3L73 E;  5BOK A;  2E75 D;  1O7N A;  1ULJ A;  2I7F A;  2QJY C;  3EN1 A;  1O7H A;  1VM9 A;  3GB4 A;  2DE6 D;  4H44 D;  2CKF A;  1ZRT E;  3GKE A;  2YIU C;  3EQQ A;  4EMJ B;  4NBE D;  5CXM A;  2QJK C;  2HMN A;  3L74 E;  4NBD D;  1P84 E;  5AEU A;  3BCC E;  2E4Q A;  3GL2 A;  4QDF B;  2ZYL A;  2JZA A;  4QUP A;  3VMI D;  4AAY B;  1SJG A;  1KYO E;  3GTS A;  1RIE A;  4HM1 A;  4HKV A;  5KLI C;  3VCP A;  5HL4 A;  3FOU A;  1NTZ E;  4NBH D;  4QDD A;  3D89 A;  2NVE A;  3CXH E;  3DQY A;  4P1B H;  4NBB D;  2YFL A;  2Q3W A;  2HMK A;  1JM1 A;  4H13 D;  4HM7 A;  2XRX A;  4HM6 A;  1EZV E;  1SQB E;  1RFS A;  2HMJ A;  2BCC E;  4HJL A;  2QPZ A;  3GZY A;  4QUQ A;  4NBC D;  3GOB A;  2NWF A;  2HMO A;  2FYU E;  3CWB E;  3L72 E;  4H0L D;  4HM0 A;  3L75 E;  3VMH D;  2NUK A;  1PPJ E;  2DE5 D;  2YFJ A;  2HMM A;  5KLV E;  4QDF A;  2IBZ E;  1L0N E;  4NBA D;  1G8J B;  1O7W A;  1NTK E;  2BMQ A;  3L70 E;  1G8K B;  3H1I E;  1VF5 D;  1FQT A;  2E74 D;  4HM8 A;  3N0Q A;  1NYK A;  2XSH A;  3VCA A;  2FYN C;  2BMO A;  3AZC A;  3VMG D;  2XSO A;  1PP9 E;  2E4P A;  1NU1 E;  2QJP C;  2D2C D;  3GZX A;  2E76 D;  4HM4 A;  4HM2 A;  4AIV A;  1VCK A;  4NBG D;  2HML A;  1UUW A;  1WQL A;  4HM5 A;  4U3F E;  1O7P A;  2GBW A;  2B1X A;  1SQP E;  3H1L E;  4PD4 E;  1O7G A;  3GL0 A;  4OGQ D;  4QDC A;  3CX5 E;  3H1K E;  4P1C H;  1BE3 E;  1O7M A;  2GBX A;  1EG9 A;  5AEW A;  2YFI A;  1NDO A;  3H1H E;  2ZT9 D;  4QCK A;  2YVJ B;  1NTM E;  4QUR A;  2NUM A;  2BMR A;  4HM3 A;  1ULI A;  1SQQ E;  1UUV A;  4PV1 D;  3TGU E;  1SQV E;  3H1J E;  1Q90 C;  1L0L E;  2XR8 A;  5KKZ C;  4NBF D;  2NVF A;  1SQX E;  3L71 E;  3GTE A;  2DE7 D;  1BCC E;  1KB9 E;  2B24 A;  2A06 E;  2JO6 A;  4NB8 D; 
#chains in the Genus database with same CATH topology
 3GCE A;  4NB9 D;  2NVG A;  3C0D A;  3L73 E;  5BOK A;  2E75 D;  1O7N A;  1ULJ A;  2I7F A;  2QJY C;  3EN1 A;  1O7H A;  1VM9 A;  3GB4 A;  2DE6 D;  4H44 D;  2CKF A;  1ZRT E;  3GKE A;  2YIU C;  3EQQ A;  4EMJ B;  4NBE D;  5CXM A;  2QJK C;  2HMN A;  3L74 E;  4NBD D;  1P84 E;  5AEU A;  3BCC E;  2E4Q A;  3GL2 A;  4QDF B;  2ZYL A;  2JZA A;  4QUP A;  3VMI D;  4AAY B;  1SJG A;  1KYO E;  3GTS A;  1RIE A;  4HM1 A;  4HKV A;  5KLI C;  3VCP A;  5HL4 A;  3FOU A;  1NTZ E;  4NBH D;  4QDD A;  3D89 A;  2NVE A;  3CXH E;  3DQY A;  4P1B H;  4NBB D;  2YFL A;  2Q3W A;  2HMK A;  1JM1 A;  4H13 D;  4HM7 A;  2XRX A;  4HM6 A;  1EZV E;  1SQB E;  1RFS A;  2HMJ A;  2BCC E;  4HJL A;  2QPZ A;  3GZY A;  4QUQ A;  4NBC D;  3GOB A;  2NWF A;  2HMO A;  2FYU E;  3CWB E;  3L72 E;  4H0L D;  4HM0 A;  3L75 E;  3VMH D;  2NUK A;  1PPJ E;  2DE5 D;  2YFJ A;  2HMM A;  5KLV E;  4QDF A;  2IBZ E;  1L0N E;  4NBA D;  1G8J B;  1O7W A;  1NTK E;  2BMQ A;  3L70 E;  1G8K B;  3H1I E;  1VF5 D;  1FQT A;  2E74 D;  4HM8 A;  3N0Q A;  1NYK A;  2XSH A;  3VCA A;  2FYN C;  2BMO A;  3AZC A;  3VMG D;  2XSO A;  1PP9 E;  2E4P A;  1NU1 E;  2QJP C;  2D2C D;  3GZX A;  2E76 D;  4HM4 A;  4HM2 A;  4AIV A;  1VCK A;  4NBG D;  2HML A;  1UUW A;  1WQL A;  4HM5 A;  4U3F E;  1O7P A;  2GBW A;  2B1X A;  1SQP E;  3H1L E;  4PD4 E;  1O7G A;  3GL0 A;  4OGQ D;  4QDC A;  3CX5 E;  3H1K E;  4P1C H;  1BE3 E;  1O7M A;  2GBX A;  1EG9 A;  5AEW A;  2YFI A;  1NDO A;  3H1H E;  2ZT9 D;  4QCK A;  2YVJ B;  1NTM E;  4QUR A;  2NUM A;  2BMR A;  4HM3 A;  1ULI A;  1SQQ E;  1UUV A;  4PV1 D;  3TGU E;  1SQV E;  3H1J E;  1Q90 C;  1L0L E;  2XR8 A;  5KKZ C;  4NBF D;  2NVF A;  1SQX E;  3L71 E;  3GTE A;  2DE7 D;  1BCC E;  1KB9 E;  2B24 A;  2A06 E;  2JO6 A;  4NB8 D; 
#chains in the Genus database with same CATH homology
 3GCE A;  4NB9 D;  2NVG A;  3C0D A;  3L73 E;  5BOK A;  2E75 D;  1O7N A;  1ULJ A;  2I7F A;  2QJY C;  3EN1 A;  1O7H A;  1VM9 A;  3GB4 A;  2DE6 D;  4H44 D;  2CKF A;  1ZRT E;  3GKE A;  2YIU C;  3EQQ A;  4EMJ B;  4NBE D;  5CXM A;  2QJK C;  2HMN A;  3L74 E;  4NBD D;  1P84 E;  5AEU A;  3BCC E;  2E4Q A;  3GL2 A;  4QDF B;  2ZYL A;  2JZA A;  4QUP A;  3VMI D;  4AAY B;  1SJG A;  1KYO E;  3GTS A;  1RIE A;  4HM1 A;  4HKV A;  5KLI C;  3VCP A;  5HL4 A;  3FOU A;  1NTZ E;  4NBH D;  4QDD A;  3D89 A;  2NVE A;  3CXH E;  3DQY A;  4P1B H;  4NBB D;  2YFL A;  2Q3W A;  2HMK A;  1JM1 A;  4H13 D;  4HM7 A;  2XRX A;  4HM6 A;  1EZV E;  1SQB E;  1RFS A;  2HMJ A;  2BCC E;  4HJL A;  2QPZ A;  3GZY A;  4QUQ A;  4NBC D;  3GOB A;  2NWF A;  2HMO A;  2FYU E;  3CWB E;  3L72 E;  4H0L D;  4HM0 A;  3L75 E;  3VMH D;  2NUK A;  1PPJ E;  2DE5 D;  2YFJ A;  2HMM A;  5KLV E;  4QDF A;  2IBZ E;  1L0N E;  4NBA D;  1G8J B;  1O7W A;  1NTK E;  2BMQ A;  3L70 E;  1G8K B;  3H1I E;  1VF5 D;  1FQT A;  2E74 D;  4HM8 A;  3N0Q A;  1NYK A;  2XSH A;  3VCA A;  2FYN C;  2BMO A;  3AZC A;  3VMG D;  2XSO A;  1PP9 E;  2E4P A;  1NU1 E;  2QJP C;  2D2C D;  3GZX A;  2E76 D;  4HM4 A;  4HM2 A;  4AIV A;  1VCK A;  4NBG D;  2HML A;  1UUW A;  1WQL A;  4HM5 A;  4U3F E;  1O7P A;  2GBW A;  2B1X A;  1SQP E;  3H1L E;  4PD4 E;  1O7G A;  3GL0 A;  4OGQ D;  4QDC A;  3CX5 E;  3H1K E;  4P1C H;  1BE3 E;  1O7M A;  2GBX A;  1EG9 A;  5AEW A;  2YFI A;  1NDO A;  3H1H E;  2ZT9 D;  4QCK A;  2YVJ B;  1NTM E;  4QUR A;  2NUM A;  2BMR A;  4HM3 A;  1ULI A;  1SQQ E;  1UUV A;  4PV1 D;  3TGU E;  1SQV E;  3H1J E;  1Q90 C;  1L0L E;  2XR8 A;  5KKZ C;  4NBF D;  2NVF A;  1SQX E;  3L71 E;  3GTE A;  2DE7 D;  1BCC E;  1KB9 E;  2B24 A;  2A06 E;  2JO6 A;  4NB8 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...