1RIEA

Structure of a water soluble fragment of the rieske iron-sulfur protein of the bovine heart mitochondrial cytochrome bc1-complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
127
structure length
127
Chain Sequence
b'AMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIESKE IRON-SULFUR PROTEIN
publication title Structure of a water soluble fragment of the 'Rieske' iron-sulfur protein of the bovine heart mitochondrial cytochrome bc1 complex determined by MAD phasing at 1.5 A resolution.
pubmed doi rcsb
molecule tags Electron transport
total genus 33
structure length 127
sequence length 127
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1996-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1rieA00
1O7GA 2GBWA 3FOUA 4NBED 1KB9E 3L74E 2QJKC 2NVEA 1VF5D 3H1JE 1EG9A 3VCAA 1O7WA 4NBFD 4QDCA 4AIVA 2D2CD 1RFSA 2FYUE 2E74D 2QPZA 4P1CH 3CX5E 4NBBD 4NBHD 2XSHA 4NB8D 1O7MA 3H1IE 2YVJB 2NUMA 5KLIC 3N0QA 3VCPA 4H13D 1SQXE 2B24A 2XR8A 3VMGD 1O7HA 1SQVE 5BOKA 1SQBE 1NDOA 1L0NE 3EN1A 4HM8A 1SQQE 3L71E 1BE3E 5KLVE 2XSOA 3EQQA 4HM0A 3AZCA 2HMKA 1NU1E 2ZT9D 1NTZE 2E4QA 2BMRA 2QJYC 1VM9A 1P84E 2DE5D 4QDDA 4H44D 2HMMA 3GTEA 4HM4A 3CXHE 2BCCE 3GOBA 5CXMA 2BMQA 4HM3A 3BCCE 4PV1D 4NBAD 1UUWA 1UUVA 1ULIA 1VCKA 4QDFB 2YFLA 4HM6A 1RIEA 2JZAA 2NUKA 2Q3WA 2HMJA 1FQTA 2NVFA 4HM2A 4QURA 1EZVE 4QUQA 2YFJA 3L75E 3H1HE 2IBZE 3GZYA 5AEUA 3L72E 4U3FE 1NTME 2E4PA 5HL4A 2YIUC 2HMNA 5KKZC 3H1LE 3D89A 2E75D 3H1KE 3L73E 1PPJE 3VMHD 3CWBE 4HKVA 4P1BH 4HM7A 4NBDD 1ZRTE 3GCEA 4NB9D 2NWFA 4EMJB 2BMOA 1ULJA 4HJLA 4NBCD 2JO6A 3DQYA 2ZYLA 2GBXA 2FYNC 3GL0A 1G8JB 1Q90C 3VMID 3TGUE 2DE7D 3GL2A 4AAYB 1L0LE 3GB4A 2CKFA 4HM5A 1NTKE 4PD4E 1SQPE 2B1XA 2HMOA 3C0DA 4H0LD 2E76D 1KYOE 3L70E 2YFIA 1O7NA 2I7FA 4QCKA 1PP9E 3GTSA 1BCCE 1G8KB 2XRXA 1SJGA 4HM1A 2NVGA 1NYKA 1O7PA 4NBGD 2HMLA 4OGQD 5AEWA 4QDFA 3GKEA 3GZXA 1JM1A 1WQLA 4QUPA 2A06E 2QJPC 2DE6D
chains in the Genus database with same CATH superfamily
1O7GA 2GBWA 3FOUA 4NBED 1KB9E 3L74E 2QJKC 2NVEA 1VF5D 3H1JE 1EG9A 3VCAA 1O7WA 4NBFD 4QDCA 4AIVA 2D2CD 1RFSA 2FYUE 2E74D 2QPZA 4P1CH 3CX5E 4NBBD 4NBHD 2XSHA 4NB8D 1O7MA 3H1IE 2YVJB 2NUMA 5KLIC 3N0QA 3VCPA 4H13D 1SQXE 2B24A 2XR8A 3VMGD 1O7HA 1SQVE 5BOKA 1SQBE 1NDOA 1L0NE 3EN1A 4HM8A 1SQQE 3L71E 1BE3E 5KLVE 2XSOA 3EQQA 4HM0A 3AZCA 2HMKA 1NU1E 2ZT9D 1NTZE 2E4QA 2BMRA 2QJYC 1VM9A 1P84E 2DE5D 4QDDA 4H44D 2HMMA 3GTEA 4HM4A 3CXHE 2BCCE 3GOBA 5CXMA 2BMQA 4HM3A 3BCCE 4PV1D 4NBAD 1UUWA 1UUVA 1ULIA 1VCKA 4QDFB 2YFLA 4HM6A 1RIEA 2JZAA 2NUKA 2Q3WA 2HMJA 1FQTA 2NVFA 4HM2A 4QURA 1EZVE 4QUQA 2YFJA 3L75E 3H1HE 2IBZE 3GZYA 5AEUA 3L72E 4U3FE 1NTME 2E4PA 5HL4A 2YIUC 2HMNA 5KKZC 3H1LE 3D89A 2E75D 3H1KE 3L73E 1PPJE 3VMHD 3CWBE 4HKVA 4P1BH 4HM7A 4NBDD 1ZRTE 3GCEA 4NB9D 2NWFA 4EMJB 2BMOA 1ULJA 4HJLA 4NBCD 2JO6A 3DQYA 2ZYLA 2GBXA 2FYNC 3GL0A 1G8JB 1Q90C 3VMID 3TGUE 2DE7D 3GL2A 4AAYB 1L0LE 3GB4A 2CKFA 4HM5A 1NTKE 4PD4E 1SQPE 2B1XA 2HMOA 3C0DA 4H0LD 2E76D 1KYOE 3L70E 2YFIA 1O7NA 2I7FA 4QCKA 1PP9E 3GTSA 1BCCE 1G8KB 2XRXA 1SJGA 4HM1A 2NVGA 1NYKA 1O7PA 4NBGD 2HMLA 4OGQD 5AEWA 4QDFA 3GKEA 3GZXA 1JM1A 1WQLA 4QUPA 2A06E 2QJPC 2DE6D
chains in the Genus database with same CATH topology
1O7GA 2GBWA 3FOUA 4NBED 1KB9E 3L74E 2QJKC 2NVEA 1VF5D 3H1JE 1EG9A 3VCAA 1O7WA 4NBFD 4QDCA 4AIVA 2D2CD 1RFSA 2FYUE 2E74D 2QPZA 4P1CH 3CX5E 4NBBD 4NBHD 2XSHA 4NB8D 1O7MA 3H1IE 2YVJB 2NUMA 5KLIC 3N0QA 3VCPA 4H13D 1SQXE 2B24A 2XR8A 3VMGD 1O7HA 1SQVE 5BOKA 1SQBE 1NDOA 1L0NE 3EN1A 4HM8A 1SQQE 3L71E 1BE3E 5KLVE 2XSOA 3EQQA 4HM0A 3AZCA 2HMKA 1NU1E 2ZT9D 1NTZE 2E4QA 2BMRA 2QJYC 1VM9A 1P84E 2DE5D 4QDDA 4H44D 2HMMA 3GTEA 4HM4A 3CXHE 2BCCE 3GOBA 5CXMA 2BMQA 4HM3A 3BCCE 4PV1D 4NBAD 1UUWA 1UUVA 1ULIA 1VCKA 4QDFB 2YFLA 4HM6A 1RIEA 2JZAA 2NUKA 2Q3WA 2HMJA 1FQTA 2NVFA 4HM2A 4QURA 1EZVE 4QUQA 2YFJA 3L75E 3H1HE 2IBZE 3GZYA 5AEUA 3L72E 4U3FE 1NTME 2E4PA 5HL4A 2YIUC 2HMNA 5KKZC 3H1LE 3D89A 2E75D 3H1KE 3L73E 1PPJE 3VMHD 3CWBE 4HKVA 4P1BH 4HM7A 4NBDD 1ZRTE 3GCEA 4NB9D 2NWFA 4EMJB 2BMOA 1ULJA 4HJLA 4NBCD 2JO6A 3DQYA 2ZYLA 2GBXA 2FYNC 3GL0A 1G8JB 1Q90C 3VMID 3TGUE 2DE7D 3GL2A 4AAYB 1L0LE 3GB4A 2CKFA 4HM5A 1NTKE 4PD4E 1SQPE 2B1XA 2HMOA 3C0DA 4H0LD 2E76D 1KYOE 3L70E 2YFIA 1O7NA 2I7FA 4QCKA 1PP9E 3GTSA 1BCCE 1G8KB 2XRXA 1SJGA 4HM1A 2NVGA 1NYKA 1O7PA 4NBGD 2HMLA 4OGQD 5AEWA 4QDFA 3GKEA 3GZXA 1JM1A 1WQLA 4QUPA 2A06E 2QJPC 2DE6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7G A;  2GBW A;  3FOU A;  4NBE D;  1KB9 E;  3L74 E;  2QJK C;  2NVE A;  1VF5 D;  3H1J E;  1EG9 A;  3VCA A;  1O7W A;  4NBF D;  4QDC A;  4AIV A;  2D2C D;  1RFS A;  2FYU E;  2E74 D;  2QPZ A;  4P1C H;  3CX5 E;  4NBB D;  4NBH D;  2XSH A;  4NB8 D;  1O7M A;  3H1I E;  2YVJ B;  2NUM A;  5KLI C;  3N0Q A;  3VCP A;  4H13 D;  1SQX E;  2B24 A;  2XR8 A;  3VMG D;  1O7H A;  1SQV E;  5BOK A;  1SQB E;  1NDO A;  1L0N E;  3EN1 A;  4HM8 A;  1SQQ E;  3L71 E;  1BE3 E;  5KLV E;  2XSO A;  3EQQ A;  4HM0 A;  3AZC A;  2HMK A;  1NU1 E;  2ZT9 D;  1NTZ E;  2E4Q A;  2BMR A;  2QJY C;  1VM9 A;  1P84 E;  2DE5 D;  4QDD A;  4H44 D;  2HMM A;  3GTE A;  4HM4 A;  3CXH E;  2BCC E;  3GOB A;  5CXM A;  2BMQ A;  4HM3 A;  3BCC E;  4PV1 D;  4NBA D;  1UUW A;  1UUV A;  1ULI A;  1VCK A;  4QDF B;  2YFL A;  4HM6 A;  1RIE A;  2JZA A;  2NUK A;  2Q3W A;  2HMJ A;  1FQT A;  2NVF A;  4HM2 A;  4QUR A;  1EZV E;  4QUQ A;  2YFJ A;  3L75 E;  3H1H E;  2IBZ E;  3GZY A;  5AEU A;  3L72 E;  4U3F E;  1NTM E;  2E4P A;  5HL4 A;  2YIU C;  2HMN A;  5KKZ C;  3H1L E;  3D89 A;  2E75 D;  3H1K E;  3L73 E;  1PPJ E;  3VMH D;  3CWB E;  4HKV A;  4P1B H;  4HM7 A;  4NBD D;  1ZRT E;  3GCE A;  4NB9 D;  2NWF A;  4EMJ B;  2BMO A;  1ULJ A;  4HJL A;  4NBC D;  2JO6 A;  3DQY A;  2ZYL A;  2GBX A;  2FYN C;  3GL0 A;  1G8J B;  1Q90 C;  3VMI D;  3TGU E;  2DE7 D;  3GL2 A;  4AAY B;  1L0L E;  3GB4 A;  2CKF A;  4HM5 A;  1NTK E;  4PD4 E;  1SQP E;  2B1X A;  2HMO A;  3C0D A;  4H0L D;  2E76 D;  1KYO E;  3L70 E;  2YFI A;  1O7N A;  2I7F A;  4QCK A;  1PP9 E;  3GTS A;  1BCC E;  1G8K B;  2XRX A;  1SJG A;  4HM1 A;  2NVG A;  1NYK A;  1O7P A;  4NBG D;  2HML A;  4OGQ D;  5AEW A;  4QDF A;  3GKE A;  3GZX A;  1JM1 A;  1WQL A;  4QUP A;  2A06 E;  2QJP C;  2DE6 D; 
#chains in the Genus database with same CATH topology
 1O7G A;  2GBW A;  3FOU A;  4NBE D;  1KB9 E;  3L74 E;  2QJK C;  2NVE A;  1VF5 D;  3H1J E;  1EG9 A;  3VCA A;  1O7W A;  4NBF D;  4QDC A;  4AIV A;  2D2C D;  1RFS A;  2FYU E;  2E74 D;  2QPZ A;  4P1C H;  3CX5 E;  4NBB D;  4NBH D;  2XSH A;  4NB8 D;  1O7M A;  3H1I E;  2YVJ B;  2NUM A;  5KLI C;  3N0Q A;  3VCP A;  4H13 D;  1SQX E;  2B24 A;  2XR8 A;  3VMG D;  1O7H A;  1SQV E;  5BOK A;  1SQB E;  1NDO A;  1L0N E;  3EN1 A;  4HM8 A;  1SQQ E;  3L71 E;  1BE3 E;  5KLV E;  2XSO A;  3EQQ A;  4HM0 A;  3AZC A;  2HMK A;  1NU1 E;  2ZT9 D;  1NTZ E;  2E4Q A;  2BMR A;  2QJY C;  1VM9 A;  1P84 E;  2DE5 D;  4QDD A;  4H44 D;  2HMM A;  3GTE A;  4HM4 A;  3CXH E;  2BCC E;  3GOB A;  5CXM A;  2BMQ A;  4HM3 A;  3BCC E;  4PV1 D;  4NBA D;  1UUW A;  1UUV A;  1ULI A;  1VCK A;  4QDF B;  2YFL A;  4HM6 A;  1RIE A;  2JZA A;  2NUK A;  2Q3W A;  2HMJ A;  1FQT A;  2NVF A;  4HM2 A;  4QUR A;  1EZV E;  4QUQ A;  2YFJ A;  3L75 E;  3H1H E;  2IBZ E;  3GZY A;  5AEU A;  3L72 E;  4U3F E;  1NTM E;  2E4P A;  5HL4 A;  2YIU C;  2HMN A;  5KKZ C;  3H1L E;  3D89 A;  2E75 D;  3H1K E;  3L73 E;  1PPJ E;  3VMH D;  3CWB E;  4HKV A;  4P1B H;  4HM7 A;  4NBD D;  1ZRT E;  3GCE A;  4NB9 D;  2NWF A;  4EMJ B;  2BMO A;  1ULJ A;  4HJL A;  4NBC D;  2JO6 A;  3DQY A;  2ZYL A;  2GBX A;  2FYN C;  3GL0 A;  1G8J B;  1Q90 C;  3VMI D;  3TGU E;  2DE7 D;  3GL2 A;  4AAY B;  1L0L E;  3GB4 A;  2CKF A;  4HM5 A;  1NTK E;  4PD4 E;  1SQP E;  2B1X A;  2HMO A;  3C0D A;  4H0L D;  2E76 D;  1KYO E;  3L70 E;  2YFI A;  1O7N A;  2I7F A;  4QCK A;  1PP9 E;  3GTS A;  1BCC E;  1G8K B;  2XRX A;  1SJG A;  4HM1 A;  2NVG A;  1NYK A;  1O7P A;  4NBG D;  2HML A;  4OGQ D;  5AEW A;  4QDF A;  3GKE A;  3GZX A;  1JM1 A;  1WQL A;  4QUP A;  2A06 E;  2QJP C;  2DE6 D; 
#chains in the Genus database with same CATH homology
 1O7G A;  2GBW A;  3FOU A;  4NBE D;  1KB9 E;  3L74 E;  2QJK C;  2NVE A;  1VF5 D;  3H1J E;  1EG9 A;  3VCA A;  1O7W A;  4NBF D;  4QDC A;  4AIV A;  2D2C D;  1RFS A;  2FYU E;  2E74 D;  2QPZ A;  4P1C H;  3CX5 E;  4NBB D;  4NBH D;  2XSH A;  4NB8 D;  1O7M A;  3H1I E;  2YVJ B;  2NUM A;  5KLI C;  3N0Q A;  3VCP A;  4H13 D;  1SQX E;  2B24 A;  2XR8 A;  3VMG D;  1O7H A;  1SQV E;  5BOK A;  1SQB E;  1NDO A;  1L0N E;  3EN1 A;  4HM8 A;  1SQQ E;  3L71 E;  1BE3 E;  5KLV E;  2XSO A;  3EQQ A;  4HM0 A;  3AZC A;  2HMK A;  1NU1 E;  2ZT9 D;  1NTZ E;  2E4Q A;  2BMR A;  2QJY C;  1VM9 A;  1P84 E;  2DE5 D;  4QDD A;  4H44 D;  2HMM A;  3GTE A;  4HM4 A;  3CXH E;  2BCC E;  3GOB A;  5CXM A;  2BMQ A;  4HM3 A;  3BCC E;  4PV1 D;  4NBA D;  1UUW A;  1UUV A;  1ULI A;  1VCK A;  4QDF B;  2YFL A;  4HM6 A;  1RIE A;  2JZA A;  2NUK A;  2Q3W A;  2HMJ A;  1FQT A;  2NVF A;  4HM2 A;  4QUR A;  1EZV E;  4QUQ A;  2YFJ A;  3L75 E;  3H1H E;  2IBZ E;  3GZY A;  5AEU A;  3L72 E;  4U3F E;  1NTM E;  2E4P A;  5HL4 A;  2YIU C;  2HMN A;  5KKZ C;  3H1L E;  3D89 A;  2E75 D;  3H1K E;  3L73 E;  1PPJ E;  3VMH D;  3CWB E;  4HKV A;  4P1B H;  4HM7 A;  4NBD D;  1ZRT E;  3GCE A;  4NB9 D;  2NWF A;  4EMJ B;  2BMO A;  1ULJ A;  4HJL A;  4NBC D;  2JO6 A;  3DQY A;  2ZYL A;  2GBX A;  2FYN C;  3GL0 A;  1G8J B;  1Q90 C;  3VMI D;  3TGU E;  2DE7 D;  3GL2 A;  4AAY B;  1L0L E;  3GB4 A;  2CKF A;  4HM5 A;  1NTK E;  4PD4 E;  1SQP E;  2B1X A;  2HMO A;  3C0D A;  4H0L D;  2E76 D;  1KYO E;  3L70 E;  2YFI A;  1O7N A;  2I7F A;  4QCK A;  1PP9 E;  3GTS A;  1BCC E;  1G8K B;  2XRX A;  1SJG A;  4HM1 A;  2NVG A;  1NYK A;  1O7P A;  4NBG D;  2HML A;  4OGQ D;  5AEW A;  4QDF A;  3GKE A;  3GZX A;  1JM1 A;  1WQL A;  4QUP A;  2A06 E;  2QJP C;  2DE6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...