1RIHH

Crystal structure of fab 14f7, a unique anti-tumor antibody specific for n-glycolyl gm3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
227
structure length
221
Chain Sequence
QVQLQQSGNELAKPGASMKMSCRASGYSFTSYWIHWLKQRPDQGLEWIGYIDPATAYTESNQKFKDKAILTADRSSNTAFMYLNSLTSEDSAVYYCARESPRLRRGIYYYAMDYWGQGTTVTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Molecular Interactions of a Unique Antitumor Antibody Specific for N-Glycolyl GM3.
pubmed doi rcsb
molecule tags Immune system
molecule keywords light chain of antibody 14F7
total genus 44
structure length 221
sequence length 227
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihH02
4V1DB 1BECA 2FH8A 1BFOA 4P4KA 4QXTB 2FX7H 4XNZB 4M48L 1KPVB 4G80B 3ULSA 4M93B 5A16A 4ZO8A 3WEXB 1ODAA 4DZBA 1KCVH 5I0ZA 3KLSA 3VXPB 1OD7A 4GMTH 3WMSA 2EDHA 1FDLL 1JF1B 3GK8L 1P53A 3PNWA 4G6JL 4MX7A 3X14B 2CUIA 3KPRB 1YYML 2CD0A 2W1NA 5FM4A 5C8JB 5GIRB 1KXVC 4RQQB 1I9JH 5INCB 4PRID 4OM1H 3H42H 1NJ9B 1OAQL 1KYOJ 1T7XA 5E6IA 2ZUSA 1QPPA 1I3GH 1P7KA 3U2SA 2X4RB 2YA2A 2IH3B 2CRZA 4P3DB 5C6TH 3O2WH 5HYJA 1MWAB 1FL5B 2WSKA 1G7PB 4OZHF 3SKOA 4PGEA 1N6QH 5GJSL 4F33B 5K59F 1NBYA 2HJKB 2GTWB 5IB4B 2IQAB 4K3EL 4LNRA 4ZQKB 2MHAA 3RPIB 5ISZD 2YN5A 1D6EA 5ICYA 1KJVA 1IC4H 1IQDB 2V9TA 1HKLH 4PV9B 3MXVH 4E5XA 2LAAA 3WUWA 1Q9LB 4MNGE 3HN3A 3MV9A 1F4AA 4Y4HB 1AE6H 3IRZA 1LQSR 4YGAB 1F42A 3BP7A 2VZOA 4HS3B 3GMRA 5CZVL 4FS0A 1CZ8L 2XA8H 1PKQB 4U3CA 3MCKB 2CR3A 3INUH 3ARUA 3RL1B 2IC2A 3OHXB 5HI5D 2VLJE 4GXVL 1OSPH 3GBLA 2P5WB 5F9JB 3VXRD 3MGOB 4UTBH 3IAQA 2X1WL 1B4JL 5GXBB 1HOCA 1WAAE 4N9GB 1FFPB 3C5SA 5EIIA 2XZAH 2O61A 3MLRH 4DAGH 3HZKB 4NRXA 4KTEH 2NY6D 2UZYB 1M6OB 3KPMA 2IAMB 3EYQC 1MLBB 2YKLH 3IDJB 3TYFA 1CD1B 1VKXA 5T1LB 2I26N 1Z3GH 1D5MA 1R3KA 2O93L 1BGXH 1QFOA 3E2HB 2YN3A 1K2DA 2ED9A 3BE1L 1YEKH 4PGCA 1H3GA 3KNBA 3U30C 5DJ6B 2BNRB 3VGGA 1U8HB 1S78C 4WHYG 4XAKD 4GAJH 3PUCA 3KVQA 5BVJB 1HQRA 5I19H 3SGDI 4ZD3L 3LS5H 3H6JA 2ZSVA 3QQ9D 1HH9A 1WBZA 1M6OA 2RJMA 3I2CH 3FOLB 2X9YA 4UI2A 3O2WL 1MRDL 4HWZA 1DN0A 5KAQF 4HIJB 4S1QL 3KLAB 3IF1A 1IQWH 5TE4H 2R2BA 4LAJH 2XKSA 4J3WA 1F11B 1QSFE 2CLRB 4JFFB 3B2UC 1GOHA 4RBPH 4G6FD 2YD7A 1BMGA 3LQZA 3UYRL 2ATPB 3ZKXC 5DJ6A 2VXSH 1NBZA 3E0GA 5B8CB 3GSNA 3TNMA 8CGTA 1D5XA 1MWAH 3AREB 4KK5D 5ACZB 4Z18A 4YDLC 2H32B 1IAMA 2AS5M 4U0RB 1IAKB 5EUKA 4J12A 3X12A 3MC0A 3TH2T 1I75A 1T2JA 3P77B 4UIKH 4YK4C 4BSWB 4QEGA 1FYTB 1YMMA 3HC4H 5DHYB 1GZQB 2E9IA 4PTTA 4TRPH 4DN3L 1IRAY 1X4ZA 4YHNB 2BRQA 5C08B 1XGUA 5JW3L 2R0WH 4NFBA 4Y4KC 2Z92A 4KMTH 5HHQB 1UEYA 1JHLH 1E4WH 5J12C 1MFDH 2CIIB 4PP1D 4DCQB 2GKIA 5A2KH 3QIBD 4N68A 4L8CA 2MCPL 4KK9C 1XH3A 4PJ9D 1EHNA 3BFOA 2HLAA 1NC4B 3EDEA 4MQ7A 4ZDHA 1BJ8A 3IDMB 5CKGA 2C3HA 3E3QE 4LPUA 3UTSD 5KVEL 2J8UF 1RAMA 3FHAA 2XTJE 4XVTL 3KAAA 1OGTA 5D1QA 5DT1L 4EDXA 4IRZH 5HDQH 4Y8AA 3FMGL 3P0VL 4F57L 4U3XA 5D93C 2DQDH 4NKMB 3DVGA 2XTJB 5HVHB 2GCYB 5D1ZD 4NZTH 3EYQD 4WW2F 2GI7A 2V7NA 2AQ2A 2ZUQB 5EZLA 2J88L 3G6JA 3WDJA 1J88A 1G7JA 2H3NA 2JCCF 3MJ8A 1RZ8A 4U05A 5EBWB 3NZHH 2ZCLL 1TTGA 1CG9A 2APFA 2Q3AA 3PP4H 3OKLB 2EEAA 5DRZB 3Q5YA 5KSBF 3QCVH 3L7EA 1IBGL 2XG5A 2NY3D 4EOWH 2Z31C 4XNMB 5JW5A 4JO4L 4CVZB 1X5ZA 3D6GA 4RBPK 4X4ZA 2D7TH 4HC1A 4YBQD 5DT1H 4OF7A 2H6PA 4YHIB 4BUHA 1M7XA 4ZPVB 1ONQB 1I7UA 5KVDL 4N5UA 2YPKB 5LG1A 3QIUD 5DJYA 1MCWM 5B39B 5CJXC 2R0ZL 1EJOH 4Y19E 1RZJH 3T09A 4G9FA 4XX1E 2EYRB 4OCMC 1CDHA 5IW1A 1KJ3L 1OTTD 1P7QA 5C0FA 5IMKB 5DDHA 5B21A 1F3DH 3ROLB 5J57B 1JPST 3BKCH 3CCHB 35C8L 3MLXL 5TJWK 4PJAF 3WUWG 2AJYL 4G9DA 5HI4C 4KI5E 1MCPL 5J9PA 3UPRA 1T3FB 3QA3B 4D3CH 4S11A 3V4UH 1IC4L 2BC4B 3IETB 3K8MA 3BIKA 3PWPB 5IMMB 2HJLA 5AZ2H 4LLVB 4PD4J 4BFBD 2ICCA 2IAMC 2W59A 1LHZA 2OMBA 1BZ9B 5DJ2B 5TDPA 4IMLB 3RZWA 1INQA 3P4MB 1FNLA 4EVNB 2E6JA 3I85A 1NCDH 1ZSDA 1P5UA 3FT4A 2QSCL 3IDIB 5B3JE 3VWJB 4P9ML 2ZZUT 2D31A 3GI9H 3PV6B 2CH8A 5DRWB 1GRWA 3BYYA 3GRWH 2F74B 2FYYB 2FX9H 4LSTH 3IDGB 5J13C 2JJTA 5J9PB 2DKSA 5D5MF 3OR6B 2YS4A 2IAND 5HGAA 2PW2A 3PJSB 1LO5B 4OGXH 1S5HA 2Q76A 3O6LL 1YDPB 3MRBA 3UPAA 5D7SH 1P69B 2YUXA 1VGKB 1AHWB 1XGYL 3BDYL 4G43A 1U3JA 1CFNA 2P42B 3CFCL 2XQYG 1TXKA 1YMHA 4U1LB 1MHCA 3IJYA 1G6RB 4XC1L 1S7WB 1YQ2A 1ZSDB 3A6BL 1E6JL 1GGTA 1RFDL 5AG8A 1YEKL 1DSFH 3ZDXE 5E6IC 3UBXA 4Z7UE 2VLLA 3VGAC 1EPFA 2GJZA 1IFHH 4U0QB 1K85A 4X6FB 2GK0A 5DQJA 3GEWB 3ZKMD 1ND0A 1NLDH 1JRHL 3TN0B 3HG1E 1MCHA 3HPLA 4E42B 2OTWA 4X6BA 5F1KC 1VEPA 1A3QA 2JCCA 5D2NE 3MRQA 1FV1A 3HR5A 3G6JE 2EDKA 3TV3H 4NM8H 4JFOB 1H15B 4P23A 3P0YH 1A6UL 1N0LA 1BOGA 1JHLL 3NAAH 5EC1B 4XMPH 3C8HA 1RUQH 1AJ7H 4OLYL 3SGKC 3VI4E 2CKBL 1U91B 1VFBA 1B2WH 1JFQL 4PRHB 3Q5OA 3OMZA 1QRND 1IZKA 3P73B 3VXMD 5E4IA 3VXRE 1RK0B 4QHUA 4MJIA 1VEMA 1V05A 1KCLA 3B2UD 4XI5D 4U6YA 2K7QA 3QPQD 3K46A 3LKRA 1IGJA 3LQAH 1Q1JL 3UYPA 5DEGA 2XTJC 4YFLF 2WBWB 1N8ZA 4XZUA 3NABH 3VH8B 1CGYA 2C3VB 4UT6H 2WANA 3VXOA 4NNYA 1SJEA 5BV7C 1S7RB 4K9EH 1JUFA 3CVHH 1GHFH 1AQKH 1IAIH 3K80A 5GJSH 3RAJH 1Z2KA 4R2GC 2EH8L 3M17B 5K9JL 1IAIL 2GFBA 3HC0A 4GRLB 4P4RB 1INDH 5DFWH 4RA0C 2YD9A 4MD0A 4JFZH 4L4VE 1NKOA 4EQ2A 2VZ1A 3N1PC 2FGWH 2QADB 3HPJB 5KVEH 1VPOH 3EYSL 4OCYL 4U6XB 2VDQL 3C2AH 1NGZB 1MUJB 2P5EA 4JRXB 1FSKB 3JV6B 1NGYA 5D2LB 1UXSA 2QQNH 4LVHC 2ZOKA 1I4FA 2Y25A 2VE6A 1T4KA 1FBIL 3BX7C 4RFEB 2BHUA 5EU5A 1Z6JT 2H1PH 3CPLA 3C09C 4QT5A 5CEYB 2VUYA 4KXZI 3ARBB 2V17H 5JUEL 3S35L 2A6JB 5IB1B 4RMQA 2V17L 3AC0A 3BIBX 3S35H 1CFVH 4XP9L 4S0TD 1NGXA 3FO2A 2YKLL 4XC1H 1EJ6A 1LEIB 1INEH 5J1SC 2CRYA 4HIEA 5J89A 3UTZB 5DFVC 1B4JH 4C56B 3SGJA 2JK5B 1HHJB 3BD5A 3P0GB 4NQCE 4XX1G 5GSVA 3PWUA 1F00I 1FZMA 5EBLB 3SPVA 3V6OA 4TSBL 3VE0B 3CSYA 4JRYE 3BGAA 1NANH 1AKJB 3MRHA 4FQLH 5GRJL 3F58H 4ZO9A 4LSTL 4PRAA 3MRRA 3VA2C 1WF5A 2VDKH 3V52L 1J05B 1WFTA 5B3NA 3MLWL 1WCBA 5JHDA 4B50A 4PYHA 5D6CA 1A9BB 1K5NA 4KI5F 5CGYC 3T1WA 2GJJA 2P8LB 1NFDA 4O58L 3ORJA 4QY8B 1LEIA 2DF3A 1DL7H 2HMIC 2YA0A 1U93A 1OF2B 2WW8A 3L3KA 4ZUUB 2EO9A 2JK5A 3BW9A 4WEBL 1I7RB 1TJGL 1MRCH 3RQ3A 2AI0H 1E27A 1ZHBA 3F7VB 4GAYB 4WI9A 2NCMA 1YJDL 4CUCA 2WWKT 1CD9B 4FFVD 4K23L 4WWKA 3LPFA 5DFTA 5MEQA 1C08B 3U2SB 4P5TA 3QFJA 3ARGA 4L3AA 3TBVB 1GC1L 2MQ0A 2VISA 1A1NA 1U2CA 2GYSA 3MRRB 3MZTA 3L3DB 4IDJH 1CWVA 2CRIA 2P5ED 1J05A 2AJVL 2NXYB 3FN9A 4WFED 4HAFA 4U1MA 5CEZL 1GGCL 1DBBH 2F15A 2UY7A 2YK1L 1T5WB 4LAQH 3EAKA 1ZKAA 3BMVA 2DLIA 1K8DB 3BO8A 2R2EA 2Q20A 1MIEL 4ZG1A 4YHML 3FQNA 1KPUB 4K7PX 3FZUC 4R7NB 4P48A 1Z9MA 3AXLA 3QUXB 1KPRB 3K4AA 1RK1B 4XH2A 4Q0XH 3JWNC 4JKMA 4GKOA 2AP2A 3ZYZA 3NFNA 1B9ZA 5I18H 3H3KA 4NWTL 3U1SH 4XTRD 4K23H 5HSFA 3C6LD 5GRUL 5BOPA 4M6NL 4OLEA 4U1MB 3T2OA 1I8KB 4XNUH 5T3XL 4X7SH 3RL1A 4B0MM 4GG6B 3FOMA 1SEBB 4PD4K 4IIQB 2YHGA 4GQPH 5FUZH 4G7VL 1BBJB 1V3JA 1WV7T 5D7JD 1KTKE 4K3EH 2HRPH 2ZUTA 5A2LH 3FB7B 3V5DB 2VC2H 3GMOA 1H3XA 2O61B 1ORSB 4JZJC 1YEHH 3DURB 4F7CA 1CFBA 4LEOA 1MHHB 1S7UB 1NCBL 3QUMA 4IHOA 3MFFA 5JIHA 2IAMA 3ARED 1DQQA 1MI5B 3IDJA 4RGND 3QCUH 5EUOB 2VDKL 4IS6A 4S10A 3V52H 5C0BD 4ENED 2PYFB 3MV8E 4M43L 3RDTA 3SDYL 1DUYA 2A9NL 1N6VA 3S36X 4IRJA 1T20A 4K94C 4QRUB 3DUHA 4N0YH 5ITFB 4QRTB 3STLA 5L0QC 4K7FA 1J8HE 1FL6A 2IG2L 1A1MA 1BQHB 3OKKA 4C56E 3LY6A 1ULVA 2APVA 3V5DA 4Z77A 1KOAA 2M2DA 2DD8L 4YHPB 4N0UA 3O3DA 1A4KB 2OSLB 1KXTB 3ESUF 3QDMA 1DLHA 3QUYA 5D7LA 3MRPB 4HIJA 4HCRH 1QTYT 3MA9H 4PJXA 5FYKL 4D0DB 3S5LA 1D6VH 3UZVB 4JFYB 1I1YA 2E9WA 5TQ2H 4F57H 4UOJA 43C9B 5MERB 1JNNL 2RAMA 3DROA 5BVPL 1LP9F 5J56B 2XXMB 1EJOL 5DHVB 3UTPD 2XWTA 25C8L 3RUGF 4D9RE 5IT2L 4QLRA 1P84J 3QUZD 2DKUA 3MBEA 2V5RA 1T04B 3ES6A 3UC0L 1QNZL 5IBUG 3U82B 5TFSH 5EN2A 5AAMA 4ZSOB 1H3TA 5F3BA 5T3ZD 2MFNA 1HI6A 3U4BH 4UQ2A 4HWEL 3VFPB 1FCGA 4OQ1A 3BJ91 3QWOA 1N7ML 2JB5L 1G7QA 1OOAA 3TPUA 3OKMA 4JFHD 1S7SB 1X5GA 3RIAF 3TLRA 1QBBA 3TIEA 5INDB 3OJDA 1SY6L 5JZ7D 1H3UA 4DCQA 1FBIH 3DBXA 4WGWB 2CXKA 1XH3B 4Y0GA 4X99B 5EWIL 2IJ0C 2FD6L 2YD6A 3MLTB 5FK9B 3SQOL 1IGIH 4LCIL 1F8TL 8FABB 2XN9A 4XNXL 1YC8A 5E5UB 4PRDA 4Y16D 5DC4B 3KJ6L 4HS8L 1HH6B 4C83A 1D5BB 2IBBA 1NMCC 1DL7L 3QNZA 4QRSA 2APTA 3DOSA 3B5HA 5E2JA 3TA3D 5JIIA 4V1DA 2A1WH 5IMLA 1MY7A 4GW5B 3G08A 2X9WA 1I9EA 3CU1A 4PGDA 3EYVB 3LMJL 1QRNE 1MREH 2A6KB 4WNQB 3UTSB 4F9PC 5I73B 1RUQL 3PWNB 3DRQA 3MRDB 1OAYH 3VGDA 4QWWC 1RZ7L 5DVNA 5JQ6L 3OXRB 3UTTB 3ZHLA 4KK9D 4I77L 1GGYA 3JZ7A 1UB5B 3HS0A 3F7PC 4C59B 3FB6B 3MRCA 2CJUL 4XBEL 3FKUS 3S9DB 3HE6A 3O4LD 4MX7B 4U7SA 3JVGA 5E6YA 4MB5A 2JJTC 1H8OA 4JY4A 3LIZH 4YE4H 1HH6A 2A6IB 1CIUA 5HHMD 4IEFB 4JM2D 5JW5B 1IFHL 2DIJA 5I1HH 4WIQA 4XMLH 5EFIB 1MY5A 4O02H 2YD3A 4P3DA 4CAGA 2QADD 4D8PA 4CJ1A 4LGSB 4BZ2H 4ZXBA 5E00A 3QUMH 3L9RA 2DQFA 4C58B 2Q7YA 4ODTL 2EYTA 4WCYL 3QEHB 5LBSH 1IM9D 3JV4A 3LKNA 3FB6A 4HJGB 2H8PB 4G6AC 3DO7B 3NN8A 1EO5A 1J8HB 3GBNH 3W81A 5DR5L 4HFUL 3H9HB 2VDRH 3C5JB 2F19H 1T1ZA 2FBJH 3FQRA 3PDOB 5C0BA 4MHHI 4HXAH 5CD3A 2OTUA 1HDMB 3NMEA 5F9OH 4NQXA 4HIIA 4LMQE 2DWEB 2FBOJ 3RWGB 5DJAA 5CFHA 2H41A 3GI9L 3H9SB 3KXFB 1EZVX 1PKQE 5IM7A 1QRNB 1W0VB 3RWIA 1KCUL 2C7UB 3B9EA 3NZHL 3BAEL 3V6FB 4M03A 5SWZD 3VFRA 3TIDB 5EWIH 4P9HL 3CAFA 1T89A 4P9HH 2N7BA 1B3JA 3MR9A 3NPSC 1S7TA 5DYOB 1JMXA 4UNUA 4DZ8A 2DQCL 3QDJD 4XP6H 2WV3A 3LSOA 4Z7OF 2XY1A 2P8MA 2IMNA 1MAMH 1FGNH 1G7IB 2C9AA 2SEBA 5BRZA 4PB0L 4D0BA 4NBYB 4LLQB 5BZDB 2D03L 5T1LA 2NY0D 4OF5A 5AG9A 4XBPA 5EO0B 5F88A 5D7IE 2V6HA 4PJEF 5I1LA 5KVGH 2BRRH 4KTEL 5HHPA 4HW6A 3SCMB 4NHCH 4YDIH 3RP1A 1NMBL 4ELKB 4OFVA 4GXVH 3C6LA 3SY0B 3EUUA 3F6IA 3MRFA 1AFVH 4X5LA 5LGJA 1JZ5A 3B5TA 5CEZH 3IXTA 3MLSL 4WFGD 5E6ZA 2YK1H 3QAZB 1IAIM 1QUNA 2P5EE 3DETD 3N06B 1UCBL 4DKEL 3BUYB 4WFEE 4NQCA 5I1CH 1F4YH 4JO4H 2BSRB 1UH3A 5KN5A 4X6FA 5DQJB 4DJMA 4P0DA 4NKDB 4IOIB 1GXEA 3I84A 4Y5YC 3ARFC 3X13B 1UM5L 4RIRB 1BLNB 3TEUA 5CINH 3O9WD 1T21A 3BP6B 3N1GC 4AH2A 3K81A 4M93C 5IW6B 3VI3F 4FRWA 4A6YA 2NY2C 1RIHH 5IK3A 3GSNB 2IWGA 3TNMB 3D5OF 3TZVB 3OG4B 4W81A 3W5MA 3Q48A 4NJ9L 5L2JA 3C87A 5FM8A 3KPPB 1DBMH 4J7RA 1LNUA 4ONHA 3QP3A 3HZVA 4MNQE 5L2KB 4M7KH 3WNPA 2PYED 2K9UA 3FHQA 3WJJA 3WEXA 4CVUA 1H5BA 3DUSA 5I66A 4CMMA 4LOUD 5IFHH 1XGUB 5ILTH 3GMNA 3BPOB 2WINA 3WFEL 1RUPH 4IDLA 5FO8B 1WIUA 4YPGA 1H5BC 1A2YA 4G7VH 4KJPC 4X6DA 3DSFH 4PGBA 3UROR 2H26B 4MAUL 4ZS6C 3H2WA 4C4KT 5C2BH 3QIWD 2J8OA 2A9MH 1OB1B 3BEWA 5MENB 1EZVY 1LK3H 1J1XL 1I7TA 4ZS6D 2QHLA 5HPMA 4XMPL 3NOIA 3R1GL 3T0WA 3R0NA 4BQ6A 1M71A 1BD2A 1CICA 1QOKA 1EFXB 1FO0A 5FYJE 2X70B 1JVKA 1NAMA 3LKPB 3SKOB 3K4DA 1MHEB 4MZ2A 3P0YL 4HUKB 2W07A 3PWVA 5EIVA 1AD9A 3PHSA 4ZAKC 3GJFH 5TE4L 2XZQH 3REWB 5CHNB 1SMAA 1NEUA 1RZ7H 4L8SB 2ADFH 2C4FT 1T1YA 3GKZA 3C5ZB 1YEJL 4I77H 1XF5B 5HGBA 1P84K 3O3UN 4HPOH 5BXFA 3CFJA 3MXVL 12E8L 4ZO7A 3MOQA 3DJ9A 2B1AL 5DQDH 4O2FA 1CICB 5CJ5A 1EFQA 1G6RL 3OPZL 5B3JF 4EIGB 3BPCA 4GW1A 3BEVB 1UEMA 4DWHA 3IDNA 3ZDYF 4ZNCD 1MHEA 2JELH 4BH8B 4I4WB 2XNAB 3IDYC 3DTXB 4JGUA 4O58H 2AV7B 3V8OA 3ZZ1A 4U1IA 3EYUL 5JR1L 4NT6B 4G9FD 2UYLB 4LCCB 4N9GA 5GGSA 4XPBH 2XTLA 1OAQH 5HHNA 3UTTD 2LVCA 3LEYH 3UZEA 2DN7A 2NXZD 4NPYB 2WK2A 4KRPB 5KVFH 2OK0L 4MB3A 4OCLC 1U58A 2UWEF 1K2DB 1N59A 1SYVA 1IL1A 4E9LA 4IMLA 4XXCA 4L9LC 3HTLX 3VFSB 5J12B 1KBGH 3TJHC 2ZNXA 2I60L 3MMEB 2RGSA 1YC7A 4U1IB 4NC1C 3SDDD 4LLAA 3JWOL 3P9MA 4PJAB 3RY6C 4WI8A 4DQOH 4Z7OE 5T1MA 3W9DA 4P2RE 1E6JH 3MCKA 3CFKB 4JPVL 2NX5E 3MBXH 4PJFA 2AK4A 1T5WA 5F9JA 3H9YA 2YZ1A 3T0ED 4AMKH 3ULVC 4JREB 3ELAT 4Y4FA 2R2EB 1FZJA 3FO9B 1CU4L 2Q1EA 3GNMH 1JGVL 2CJUH 2E7MA 3TYGH 3V9FA 1QLEH 4WY7H 1V7ML 1N0XL 4HUXB 1CD1A 4MJ2A 5E8OB 5KBNC 1JI2A 3BPLC 1OARL 1X3DA 1SMOA 3BYTA 3LHPH 4RWYH 2X4OA 3VG9C 1QVOA 4ZOCA 3WLBA 3VXQA 3OGCA 3F65A 4OI7A 3W0WA 3K2UH 5DHYA 4HMEA 3TN0A 2PO6D 5JA9A 1NANI 2Q3ZA 4PTTB 3CXHJ 2R29L 1QBAA 4ODVH 4MLSA 3VFMA 1RI8A 3THML 4PG9B 5MP6H 1UGNA 3HB3D 4UINL 2PF6A 2ICES 5EZIH 5KW9L 3ZHDA 1U8QB 4LLYA 1RVFH 3LS4L 1U95A 5F7LB 2QHRL 2DQTL 5ETUA 5H2BB 1RY7B 1MPAL 1ROWA 5T5FL 1QD0A 4I3RL 3HMXA 2V2WA 3TM6A 3VA6A 1X5KA 1QSEB 1IVLA 2M8XA 5F6HI 4ZTPL 4ZOEA 1CLZH 1NPUA 4HXBH 2H2SD 4RGNB 2MSPA 4L8SC 4HKZB 3KPLB 1OTTC 4LASH 4TOYH 4XP1H 2J1KA 3GJEB 4LCUA 5ELIA 4OIAA 1CXHA 1S7XB 2J6EL 1V3MA 1AO7D 4WI4A 1WTGT 4Z7QF 4N90D 4FXGA 3SKJH 4X5XB 3IDXL 3A6CL 3B4NA 1JNHB 3HG1A 4OZIF 3CXDH 2CLZB 2D7QA 1C7SA 4MD4A 3BSZH 2QHRH 1EAJA 1I1FB 4FTVA 2AEPH 4EI5A 4X7TA 2G5BB 5DWUL 1LVEA 4GRLA 2VYRE 1PG7W 3CFEA 4PGZA 3QG7L 1IBGH 3O4LB 1J86A 4OAWA 3E2HC 2XY2A 3TPKA 3ZO0A 2ZOLA 2GQHA 4HC1H 3VFUB 1N7MH 2JB5H 1TETH 3KPSB 4XBEH 5CP7B 5DVLA 4PJ8B 5IF0B 1CBVL 2DI8A 4JO1L 5JHDD 4GBXC 3KPNA 4RMRA 3OJMB 2GUOA 5FOBA 3MNVB 4LGPB 1KJ2B 2JF1A 3BI9X 5F7NC 5GGQH 3UTQA 3SJVE 1A6UH 1MRDH 4L4JA 3QG6A 4N8VB 4BFIA 4HPYL 4NQVA 4P2RA 1ACYH 4S0SD 2YEZB 3O4OB 4RISH 3GMLB 4DKFL 4XWGH 4UTAL 2W9DH 5CSZA 3NCYS 4XP5H 5FUZL 4GRWH 1I9JL 4PP2B 2M26A 2ITDB 5GIRA 5D1ZA 4FQJH 3GKWL 5T1KB 3T3PE 5F8RC 5DZOA 5L6YL 4Z0BH 3MACL 5I1JH 3MNWB 3O3BB 5ID0B 5BJTB 3QDHA 2VIRA 3UTSA 2IALB 5I1GL 4XPFH 1BEYL 1DBAH 5HHOD 2W38A 2H1PL 4HGWB 2A73A 1ZT1A 3NCEB 2A2QT 3T0AA 1KUMA 3TWCH 1NEZG 1J8KA 1UA6H 3BESR 3IDGA 1J7VR 3RJDA 2CR6A 1EBPA 1WSST 1NMAH 1RUPL 3WO4B 2YC1A 3K74B 1A7QL 4FHBD 1U8NA 1CVRA 1QLRB 4MA1C 5C0JB 1CFSA 3VCLA 1SVCP 4HEPG 2AXFA 1EGJH 1YMMD 1I85A 4NN7C 1MHPL 1XR8A 4LLUA 1MCRA 2DQUL 1JV5A 1IEAB 2R1YB 3T2NH 1CZ8H 4BYHA 4G5ZH 3RBSA 4WJ5B 5JXAL 3DMMC 1MAML 5D4QA 5DHVH 3EO9L 1DP0A 1LILA 4KQ3H 2AI0L 2N4IA 1N4XL 2PYEB 1FNHA 3LN4B 2JB6A 3OHXA 3M45A 2CDGB 3GGWB 3RVXC 3SJVB 3BN9C 2XOTA 3W82A 3MLVL 4HC1L 3LH2L 3KYNA 3IXAA 3LDBC 4UINH 5GGTA 5EIIB 1DE4B 3VU2A 1U8MA 4M5ZL 4N0FA 1BJ1H 4MVBC 1OTSC 2RFXB 5HI3C 1P1ZB 1TVBA 3RUGB 4NUGL 4GS7C 1UCBH 3V7MA 4Y2DA 1HSAB 1JCKA 1MCNA 2X41A 4PJGA 1WCQA 1MJUL 4RAVA 3QFJD 2IF7A 4YXKL 4MQXC 2AJUL 3TCXA 2OZ4H 1JTOA 3QUZC 5EBMA 3VFRB 1JPFA 3E6HA 3G5XA 4HKJA 4FQCL 1JZ2A 3WE6B 4P9MH 1RZKL 2X4TB 2J6EH 3B9KB 2VOTA 1D9KA 1S9KC 2YWYA 3ILPB 3KYOA 1C7TA 4Z0XA 2EC8A 3I02A 4YXHH 3DARA 1MHHA 3U0PB 3INUL 4PR5A 3ZYIA 5D96B 4AEHL 4LPXA 3SKMA 4LLQA 4QNPE 2FJHB 4P5TD 5I1GH 3H9SD 4KHTH 1KLGA 4G42B 1DSFL 2DI7A 3DGGB 3QUXD 1U42A 4AIZA 3BDXA 4X6BB 4RFNC 2VR9A 4RAVB 2JIXA 1JMZA 1FIEA 2KDGA 4OD1L 5DJDB 1HCVA 1OP5K 2WUBL 3SGJC 2EIDA 1HZHH 4YXLH 3RIFF 1VADA 2DM2A 3EOTH 5EBMB 5C3LD 4Z9KB 5ICZB 3T04D 4RDQG 5JXED 3ETBF 1S9WA 1C12A 1WLHA 1INDL 5LJYH 3PIQB 3VW3H 3UBXI 3UTOA 4R4BA 5CILH 3CGTA 3KYOB 1JYWA 4UNVA 2FJFA 4NWUH 2BVOB 4FQXC 3Q1SL 4I5BA 3V0VA 4LVEA 2NY1C 4QXTA 5GGQL 3SKUD 1ZGLA 2CDFA 1T4KB 1LEKA 3WSQH 1FO0L 4PJXB 4JFXB 1QACA 1FVDB 1KT2B 4LMQI 4YHNA 5F21B 1TVHB 3VXPA 3E1F1 3KYAA 1OAKH 2DBLH 1I1YB 4DEPC 4L5FH 4A6YL 4YFDB 5I75C 4RGOH 2H32H 2B2XL 5LBSL 5I8OL 5D7JC 1CU4H 3EYUH 3TZVA 3EIFA 3TJHD 4ORGB 4QHKI 1JGVH 4I0PD 4OCRH 1INEL 1DQDL 2VWEC 4N8PA 4NSKB 5IVOA 4ZFOL 2HT4D 2R4RL 5K9OB 4ONHB 2ZSWA 3MV7D 5E7BA 3P4OA 4IOSD 3W9EB 4JJ5B 4JPIA 4IOFD 4APQB 4FQJL 3A6CH 3QNYB 4HFWB 4WO4A 4EQ3A 4XCEB 2VQTA 3STBA 4Z0BL 4WI6A 3VJ6A 3WHXB 4OZ4B 3VMOA 4WHYH 1DCLA 3MV9E 4WV1C 2EXYD 1ZHLA 4YUEL 2DDQL 3FO0L 2VXTH 4JFZL 4PY7B 4HAGA 1KPVA 5I71C 32C2B 5DRNA 3S37L 4ODBD 1DBKL 1OF2A 1UH4A 4RAUA 3U0WH 2X7LA 4PRDB 2VL5A 4YC2B 3BD4A 4KMTL 4HJJL 2YRZA 2A38A 5CEYA 4LDEB 3W11C 5ACLA 5I6XC 5IESH 4X6DF 3U36A 3U6RA 1DBML 1OT2A 3G9VA 4U7MA 4XPBL 1Q9LA 5DD5H 3HRPA 3W9EA 5MHSE 3ARGB 5GSRB 4AQOA 5FYLE 3TBVA 1EAPA 4PLOB 3AU1B 3MCLL 4MNQA 2Y36H 1SJHB 1KB5H 3PWVB 4ISVB 3GMPA 3FFDA 5GJTH 4NP4H 3D69A 4U31A 5DK2B 3RZCD 4HQQH 4N8VG 3T2PA 3MUHL 1A1OA 3O9WB 4R97C 1NLBH 4QHLA 1OCWL 3PQYD 4WHTA 1DANT 5IFJA 1BQHG 3BO8B 3O6LH 1P4IH 4Y4KD 5BS0D 1AD0B 2ZJSL 5BMFH 3QXAA 2VABB 4YX2L 1UWEL 5D2NB 4MA3B 2E9BA 5D6CB 3MRKA 3DXAD 2I07A 4TTDC 4DVBB 2N7AA 3G6AB 5GSRA 2OJEA 3QCUL 4H8WH 2KKQA 3VXUE 1A7OH 3V0WL 3CX5J 3WDIA 3M1BB 1A6AA 3U4EA 3D2UA 1OTSD 5HI3D 4GAYA 2HTKC 1AH1A 4XNYH 2XWJA 2BXZA 3CMGA 3O6FA 3EDDA 4FXKB 4WWKB 2ZCHH 5FYKD 4D9QD 4P5TB 2P7TA 3ISWA 3BD3A 3ZKQD 5T5FH 1YPZA 2VL4A 3B83A 3OXSB 1WGOA 2C3XA 3BN9D 4R97B 4F37K 4JR9H 3RVXD 1ZA6A 2IBZX 2NTFA 5IV2A 4GT7A 4M6MH 3CVHB 1FFNA 4JEGB 4XP6L 4KJYA 3ULVF 1UXWA 2DMKA 4WI3A 1MVFA 4M1GH 3IFPB 2HYMA 3H9SA 1A14H 1G84A 1RHHB 4QCIA 3RDTD 1IM9A 3MLSH 1UJ3B 5E5MA 5JW4M 1I1AC 3UEZA 4MYWB 3BWAB 1ZVHA 1NC4D 4OSUL 2E8YA 2OQJA 3OF6D 2EICA 4M9PA 4OLXH 4ETYA 2UUDK 2BMKB 2UWEE 1GGCH 5KS9B 4LQFL 4PRPD 5T1MB 3W9DB 3ZT7A 1FL3A 3TYGL 2FEEL 2IPKA 2V2TB 2AXJA 1SBSH 3IJHB 2NY6C 3WFZA 2PTTB 4I3RH 1QSVA 4KGLA 4XCNB 1PDKA 1UKQA 1YY9C 4OF8A 4M5YH 3RGVC 1T5XB 2VITA 2LABA 4X6DE 2R0KL 5AZ2L 1SQ2N 2X4NA 5FGRA 3QHZL 2J6EA 4BSJA 1S7UA 3VXUB 4QRRE 4OD3H 4MJ5A 5IHZA 2JJSA 5CUSL 2FR4A 1IC1A 2W9EH 1XF3A 4UBDD 1ZXQA 3VWKD 1EIBA 1S5IL 3F7YA 1SJVA 2BNRD 1L0QA 2AKRB 1YYLL 2ESVB 5I1HL 4PLJC 1KCRL 1RUKH 4FP8L 3S37X 1A9EB 2H9GA 5T1LD 2GSGA 2HFGH 2VB5A 5JXAH 3ARDC 5ESVB 3W11D 2R2HA 5AAWA 3L3IA 1O7SA 5E8DH 2P48B 4K7FB 1IGFL 5F1NB 1M4KA 1AFVL 4XCNA 2GK2A 4PTUB 4H25A 3OF6A 4ZO6A 1LO2H 5E9DB 5KOVC 2EDLA 3LKRB 2R0WL 2ICWJ 3KPQA 2BVQB 5DR5H 2J2ZA 1MVUB 4GRMB 3WXVH 5C6PB 1F58L 1FN4B 3QCTH 5ETUB 4D0DA 2F53D 3SO3B 3KHQA 3ZT6A 4KFZC 4KHXL 2E7LA 3WL9A 2EXWC 4I2XE 1QSEA 1Q9WB 5HBBA 43C9A 4RMVA 1UM6H 3T0VA 2HFTA 1YYLH 5FCUL 5HTSA 4ZAKD 3WCYA 3WXWL 1KJ2H 1DVFC 2NXYD 2A6KA 5ITBL 4JFED 5F97E 1TCRA 4Z7QE 4MDJB 1I7UB 1CGSH 1WZMA 3FJTA 3PQYB 3MBEB 2YZ8A 4MJ6A 3V8CA 4EIZC 5C0EB 2W9DL 5J1TC 1AGDB 4WU7A 5I76A 1CLYH 3NFSL 4OZIE 4GRWB 5EN2B 2FSEA 3VD3A 5DJ0B 1GL4B 2HKFL 2W0FA 2Z93A 5IG7B 2C1OA 2Q87A 5IW1B 2EKJA 4LQFH 1H0DB 1HHGA 1YNLL 3TPUB 4M9OA 1ZWIA 2KL6A 2NW3A 3WLWD 4AM0B 3OJDB 4ZUVB 4HK0A 3FO2B 4S1SH 4HIXH 3S37H 4KKCD 3SE9L 5K9QG 4P59L 1BD2B 4JPWL 1OP3K 1PGRB 3PWPA 1I8LA 1X5YA 2XZCL 1TCRB 4G8EB 5HYQA 4UDUB 4WTXA 5FA3B 3GNML 3PQYA 1A7QH 2ED7A 4JJHA 4OKVA 4Y4HC 5FO9B 4AYFA 5E6IB 5J6HA 4LBEA 3VG0L 3MRGA 3RFZC 3SQOH 3CDYA 2VLMD 1JYNA 1A6WL 4WCYH 1UZ6E 5CBAA 5K9QI 3RNQA 4KAQH 1F3JB 2NZIA 3V0AC 3RZCC 1EMTH 2APBA 1G1YA 4NQVB 4P2RB 2OL3B 3KPSD 4ZTOH 1KEGH 2NY7L 2GHWB 1D5ZA 3CXHK 4JKLA 4LSVL 3BKCL 4AT6A 3OR6A 4K07A 1QBLH 2J5LB 5HGAB 2PW2B 1U93B 4P2OA 4RSVA 4ODSL 1F4WH 3AS3A 1RZKH 5BQ7B 3CFBB 3PE9A 4XWOC 1R0AH 1G7HB 5DURB 3BPNC 1QO3A 1R3JA 4YC2C 1AO7A 1A8JH 2AV1B 4JHZA 2HFGL 2BNRA 5HPOA 1E4XL 4ERSH 1MELA 2B5IB 3MJ9A 2YD4A 1A1NB 1QEWB 4LCCA 3WO4C 1TFHA 4X9FA 4ZUTA 3TO4A 1ZT1B 3BP4A 1NCBH 3DVIA 4HBQA 4LEXH 5DJ2A 4WW2B 1HINH 2EYTB 4OZGF 5F89A 3T1FA 4YWGH 4P2OB 3QRGL 4KPHL 2FWOB 4R0LC 1BZ7B 4XB7A 3CLFH 4XCFL 3GRWA 1AXIB 3PV6A 4OUUB 4MAYD 3DSFL 1F11A 4JFFD 5HHVH 4R7NA 2JCCB 4F80A 1ZMYA 4NRXB 4J3UA 1IKNC 4D0CA 1F6LL 2Z8WC 1MNUH 4GQ9L 3Q6FB 4ONGL 5F7YC 4EBQL 5MEPA 4CN4A 4JZNA 1RZIA 3C6LB 1JI1A 3SY0A 1FO0H 5K9KA 4CBPA 1KNOA 3BGFB 4AY0A 4WWID 5EUKB 4OZFA 1N0XH 3PL6B 3KNBB 1CL7L 3QI9A 1C1EH 3NTCH 5IQ7L 2A83B 4PJFB 3GSOB 1IEBB 2RHEA 3P73A 3ZLQC 4M4PA 4W68A 4MA1B 1YEHL 4FQHA 4W6YB 4XXDA 4DZ8B 5C08A 3GZKA 3BP5A 3VFTB 1OSPL 3NCCB 4Z5RB 4H1LA 2GIYA 1QFUL 1DBBL 2CIIA 1IGFH 3ULVL 4WEMB 4TNWK 1Q38A 5C0DA 1G0DA 4OLVL 4TUKL 1ND0B 4ZTPH 4V2BA 5EUOF 1EMTL 3QR2A 3S96A 2NMSA 3KG5A 1F90L 2ZCHL 3CZFA 4O2CA 4OD3L 1J1XH 3DLQR 4CW1A 3IU3B 5HHPB 5LCVL 5I1AB 3DVGB 2YA1A 5I18L 5FYKE 3AREC 3DGCR 1RZJL 1U92B 5M7QA 1DDHA 1XCQA 4M7LT 4OD2A 3IFNL 4LLWB 1OGAD 4MSWB 2BNUA 4Y4HD 3QXUA 1LD9B 2FATH 4FG6D 4YBLC 2J7LA 1UG9A 4OM1L 1H8SA 1U3HA 4QXGL 1NFDE 5I8CB 1B6UA 2PXYD 3MTRA 3MOBH 1N2RA 1FQ9C 1FYTE 4BQ8A 4Y5XC 5CCKH 4HQQL 3O45B 5ISZB 1C12B 1A5FL 2R15A 4HX1B 1A6ZA 4K7PY 5H94B 3ZKMC 1UKSA 1IGTB 5IIEA 4JY6B 1EDQA 1AC6A 4QRQA 5HYIA 4WUKH 4U6HA 1T04A 3RI5K 3CD4A 4YHOL 1DVFB 3QO1A 2GSIA 2IANE 3KXFD 4EUPA 2NNAB 2VDML 4FOMA 4KMQA 1RUMH 3CLEH 5C09D 1CIDA 1R3LB 3V4VH 4G5ZL 1VGEL 3HG1B 4U7KA 3NIDF 3RY4A 5A3IC 3P11H 1PAMA 5IMKA 1JPSL 3DV6A 4Z7UB 5AYQA 5M95B 5A1AA 2YUVA 3WJLA 1LK2B 3G6JB 1QA9B 3QSKB 4FQIL 4NQDB 5KSBB 3AB0C 3VRJB 4X99A 3TH4T 2MHAB 8FABA 4MD5A 4ZUUA 1TZHA 3CPLB 4YFLI 3A67L 5MENA 2ZUYA 1GOGA 1X5LA 1P4BL 2A6JA 1FORL 2BXYA 2IBZY 1UWEH 5A2JH 5F1SA 1C16B 1UB6B 2IADA 2ZJSH 2QR0B 1GC1H 1KJMA 4FP8H 4HZAA 1GGBH 3FN0L 1KTRL 3LOWA 3NCMA 2XQBH 4I0PB 4JM2B 5ACMA 1HHKB 4DGVH 1TETL 3L3OB 5I0DA 2CUMA 2FHBA 3T8XB 1YNKH 5HYSG 3QNXB 3CLFL 5AZEH 4N8CH 4GKNA 3BGMB 5AZEL 1QFPA 4JM4L 1PYWA 1VACA 5IVZA 4TUOA 1L6ZA 5DMKA 5JPNB 1HINL 3C5SB 3ROLA 3VXMB 5HI4D 3D0VA 3CCHA 1SYVB 1ACYL 2ZG1A 1T1WA 5TFSL 3VFSA 4ZXBD 5BJTA 3VXME 5GS1C 4ZUSA 4NO2A 1Q0XL 1VENA 2WUCH 4Q7DA 1JNJA 1KJMB 3DI2B 4EI6B 5GZOD 2WUCL 4JFEE 4JM2A 4P5MB 1Y18B 4PJEE 4K8RL 3MRNB 3QIUC 1YEIH 3B2VL 3GB7B 4LSSH 3T8XA 4X4XB 4ERSL 5C0AB 2C3GA 3HUJA 1FVEB 3FOMB 1FNAA 3V95A 3QFJB 1IGIL 4LCIH 4OZHE 5GS0C 2VISB 5GRVL 5KSBE 2P47B 3BE1H 1QLRA 3RL2B 3WNMA 4U6VL 4D3CL 5GGSB 4U1GC 2EXWD 2VXVL 5D2NA 3REVB 4NO3B 2ARWA 1JTTA 4JFOA 3HA0A 4L4VD 2ZKHL 4R0LB 2LU7A 3OB0K 1TPXB 2DLGA 3QI9D 3HMWL 5GS0D 3MRBB 3U7YH 2AJSL 3FRPA 4PJDA 1A0QH 2EIZA 3L5IA 2AEQL 3DMMB 1VFBB 1CE6A 3QEQA 4PJXF 4CNIA 4X8JB 5B8CA 3H0TB 3GI8H 2EEBA 2Y5TB 2QQNL 5ISZE 4CKVX 2R23B 4K71B 1BVKB 2RCSL 3QPQC 1VEOA 1U8MB 2NXZC 3N1QC 4J4PD 4LASL 4PJ7A 3L3JB 4TOYL 4UMGA 5L88H 3EDKA 1ZVYA 2PCPA 4MJID 2D9CA 3SDAA 3FQWB 2E6QA 4HMDA 4GG6A 5EULV 4N5ED 3P40A 2VKXA 5C0CE 3RU8H 4NQCD 4WI2A 3TZVC 2WWMD 3HPLB 4E42A 4OGAD 1G7LB 4C4KO 5ENWA 2A1WL 3OJVC 1FC2D 3W2DL 5ADOH 1A6TA 2DIBA 2NPLX 2EIZB 2Y07L 4JM4H 4KRNA 1Q72H 2D4FA 4OUOA 3IVKA 1W72A 2NY0B 4L4VA 4TSCL 2WUBH 2K3TA 5JOFB 2FCBA 4ZSOE 4IS6B 1I3VA 2E9JA 5CCKL 1Q9OB 5F72S 5E5RB 4U6XA 3HAEH 1KCUH 4FQXA 4KXZH 4MA8H 2FEDD 3ARGC 4JRXA 4HLZH 1JNLL 4Y4FC 2AEWA 3SDAB 5CWSA 4XPTH 1KCKA 1UM4H 1S3KL 1DQLH 4NQTA 4P5KA 4QRTA 3STLB 1M1SA 1KLGB 5HGDB 4RIRA 2GCYA 2CDEB 4NO0A 5T1DH 3OKKB 2R56H 1NAKH 5LGHH 5C6WH 5C9JA 3QFDB 2HMID 4MQTB 4LQ1A 4Y8DC 2A74B 3VRIA 2UV3A 4I48A 2OK0H 3R8BB 3VH8A 1Q9KB 3C6SA 3IJSB 5JOFA 2Z8SA 2XN9B 1NSNL 3BN3B 2V2WB 4JFYA 3P4NB 1LNUB 4FQ1H 4HCRA 5JUEH 1QSFA 2DWDB 5FDYA 4FABL 4TVPL 5L6YH 3AVEA 1OM3H 2R2HB 3QI9C 4E0RB 1V7NL 1YJDC 2AJZB 5F70A 3QWRD 3GSVA 3V7AE 4KTYA 1A7RH 4X4YB 4NO0B 4LCWD 3ULVH 4WUKL 2UY6A 2HH0L 2Z31A 3O11A 4IMKA 4X8XA 1BAFH 1WT5A 3QG6B 3JV5A 4N8VA 4O9HL 1QSFD 3AY4A 1A2YB 3P9WB 2HWZH 4ZQKA 2OR8A 4ODXB 4WGVB 5ID1A 3V6ZA 4CVXB 5FYJL 4TTDD 4Y2DC 3BAEH 5FCSH 1IQDA 4OZHB 1LP9E 5IOPB 4LAQL 2BFVH 3EHBD 1ZHBB 4HWNA 5HGGS 3HFMH 4NO5A 2DWDA 4YIQA 4PG2C 3LQMA 4W4OC 3UPRB 1QFHA 1E4KC 4KZEH 2VZ3A 5CD5D 3BH9B 4HMCA 1GJIA 3WHXA 1ADQL 1PKQA 1NCAH 3QHFL 1RSFA 4PJ9B 2CUHA 5CINL 3QG7H 4PJCE 5M94B 4ODSH 4JREC 4JFQB 1P7KB 1OWWA 2Y36L 1GIGH 3E6FA 3JV4B 3Q5TA 15C8L 1T2XA 5BRZE 4G6JH 4YXLL 2D31B 4HIHB 1KTDB 4LARH 4Y5YB 5CMAA 2NY5H 4KGJA 4R3SB 5C0JA 3AMLA 4WUUB 3HZKA 4BFIB 1UC6A 4NNXA 1FYTD 1OAZL 1PFCA 1XR8B 4LLUB 4AM0A 3MLZL 4E41D 5EC2A 1IM3A 2ZWLT 5B8CC 3PJSA 4M7LL 4JDVA 3WFDL 5C0NC 2BNQB 3BW9B 3NCFB 1R24B 2CXGA 3G5ZB 1A4JB 1MH5B 3IDNB 1REIA 2EXYC 3QRFM 2VXQH 4I4WA 4NHUB 2HT2D 4W70A 5T1KA 3BT2L 5D8JL 1AR1D 2JB6B 4YR6A 4R26L 1OGAA 5IHUH 3SJVA 4GLRI 4QHLB 4C54A 4Y4HA 4WHTB 3VFGH 5IGXL 1ZLWH 4UIMB 3L3DA 1DQML 3UZQA 5MEOB 1MCBA 1W0WA 3U9UA 3X11A 2VDMH 4KKLC 3OTTA 3WN5B 4UV7H 1UZ8B 5D1ZC 1A3RH 3KLAA 4JB9H 5HVGB 4PV8B 5E94B 4S2SB 3OSKA 5DEZA 1P4IL 4U6VH 1ZHNB 3VFWB 3L6FB 3CUPB 1EVTC 4JAMA 5CIPB 4BM7A 2VAJA 3DIFB 4NHUA 2Z35A 2XZCH 3DSNA 3HE7C 1JPFB 3E6HB 1G7MA 5T3ZE 1R5WB 4QRUA 1RULL 2QJDA 3K2UL 4BQBA 4J3SA 3MO1A 4PJ9C 2O5XH 3TGXA 2DI9A 2GJ6D 4JRYB 4GBXA 3TO4B 5E2UH 4KJPD 3X12B 3O6FD 5TGBA 4LL9A 4FFZH 2W92A 3QH3A 3CVHL 5DMGC 5BOZG 1Y6KR 2MJWA 4FG6C 3NCYP 4XHJC 1XF4A 2GY5A 4AIZB 1DE4A 4JGJA 2IH1A 1MFDL 1G7IA 3OKEB 4HJ0D 3NFSH 4L8CB 1AR1C 2HA1A 4Q6IC 2FB4H 3PWLA 5GRUH 2HT2C 1G6VK 5C07B 2NY7H 3P11L 1U8KB 4HJ0C 4NNYB 3QQ4B 2C1PB 3SHSA 5JW4R 2AEPL 1V7NH 1NC2B 3B9AA 5I1LB 1L7TL 3FONB 2BVTA 3OKNA 4I5BB 1TZGH 4TUKH 3V0VB 3CDGB 5I16B 1A6PA 1CR9L 1ZGLB 1CDYA 2GT9B 5I1CL 2VXVH 4Z7WF 1T83A 2N56A 1Q94B 2CRMA 5DMJB 5AUMB 4P99A 3GO1H 2Y7QA 3HNTH 4PUBH 4Z77B 4X80L 3GMNB 1F58H 4DUVA 2E8ZA 5EZLB 1A4KA 3K4ZA 4X9GA 5I2IA 2P5EB 1HE7A 4LVNC 5CSBA 3C60B 3UYRH 4H8WL 3X3GL 4BSWA 4LHQB 1XF3B 5JQ6H 4NM4L 2VZUA 4NKDA 1R3IH 5FYLH 3F7YB 3MJ8B 3H3BC 3O3AB 2A9NH 5K33A 3SCMC 3LB6D 2R56L 1HQ4A 1RMFL 4PJIA 3HLAA 1LO0H 3DGGA 4PJBF 2ENYA 4M7ZB 3L7EB 3QCVL 3FT3A 4PJ5E 5LQBH 4EOWL 1GC1C 2BSTB 5FYJH 4LPVA 1RV6X 3DROB 1JF1A 3S35X 1QLEL 1VFOA 2DIAA 5DHVA 4MQ7B 4ZD3H 3EYVA 1CDUA 1M71B 4FMKA 2BX5A 4AMKL 4WRLA 3QDGA 3TFKC 2O26U 3AM8A 3KPPA 3GJEA 3HZYA 2QBWA 4YJZL 5GHWL 5ITBH 2F5BL 2VERN 4OI9A 2A77L 2X4RA 3CH1B 4WENB 3MRHB 4TQEL 4OV5B 4NZTL 4UQ2B 1MWAA 4OLVH 5DWUH 2FIKA 1T83C 3MUJA 1KJ3H 2WIIB 1MCPH 3CSBA 3TBWA 4QXUL 1MI5E 3QIWB 4BFEA 4DEPB 4ZODA 2HJKA 3MZGB 4MCYB 1QFUH 2OTPA 5TDNA 1RD6A 1V3KA 1D6EB 4YQXL 5ICYB 4NCC1 5I71B 4POUB 3FL7A 4OFDA 5BVPH 1A7OL 1OP9A 3KHOA 5C0EA 3LD8B 3F7VA 4JQIH 1DUZB 1S9VB 4OTXL 4U1SB 4Z76A 4YHLL 4YNYB 3OKOA 3PWPD 2IEPA 4KRMB 4FQPA 1SM3L 4XNQB 1NAKL 4JKKA 1VSCA 2W0FB 4UT7H 5CLWA 5DS8B 1CDJA 1JL8A 5E08H 4X6CF 1T1ZB 2V9QA 3ZSTA 5FYJU 2DQGL 1A6WH 1ORQA 1TPXC 3FQUA 4ZAKA 4YEFA 4LFHD 2P4AB 1WAAA 3LN5B 3P3YA 5TE6H 5E2VH 1MFEH 5EZOL 1B0GA 1U3YA 5CHNA 3BXNA 2VR4A 3H3PL 1SY6H 4H20H 3U7AA 1FAKT 3Q3GB 1AHWA 5D7IA 2P49B 2R1XA 1XGPB 5J0BA 3OAZK 2HT3D 3RI5F 1WBXB 3ZE2E 1RK1A 5I6XB 3OKOB 5EFIA 3ZTJG 2B5IC 1C16A 3F62A 1ZLSL 4B7IA 1D9KD 5EA0L 3TYFB 2W91A 1ZLSH 1WBYA 4YHYC 4GKSA 1MEXL 2MTPA 3OXSA 4EUPG 2NY3B 4MCZA 3ZE1F 5TDPB 3F6LA 2X4SB 3CC5A 1CXKA 1OPGL 3O6MH 3QNXA 3ZDXF 5C71A 4HJGA 1F97A 1HNGA 4I13B 3QIWC 5ECJE 3GSRB 3LKSA 3B6SA 4WO4D 3FT4B 4M3JA 3D25B 3JUZA 1H3PL 3HUJF 4HUNB 3I6GA 4UNTA 1SEQL 1XMWA 2NY4B 2BOCB 5T3XH 3TA3C 4R96B 5EU6E 1A3RL 2JJUA 1A14L 4ELKA 3QUML 3K0WA 3T65B 4ZUSB 4JQVC 1C5BH 3IF1B 2HVKA 3S7GA 1C5BL 3IFLL 4JZOB 1OTUC 4WO4C 2BOBB 1FFQA 3GKWH 15C8H 2WQ8A 4YDKH 4UT9H 5J1AB 3GGWA 1FG2B 3QUYC 2EZ0C 2Z8RA 4Q9RL 3WFCH 3LKQB 5BRZD 3PL6D 4RA3A 1PVHA 3P9MB 2VXTL 4LRIC 1FLRL 4Z7WB 4OUUA 4PRHD 3LSOB 4RFOL 4M43H 1R0AL 3RWHA 2BOCA 4JKPL 4YFEA 3FRUA 3MCG1 4M7LH 3ABZA 4ZNEA 4J1UB 4WFFE 5E2WL 4Y2DB 5FKPA 1LDPL 3KR3L 3MOAH 4HZLB 1MQKH 1ZLVH 2DYPB 1RFDH 5B38B 1JUFB 1PX4A 4L3EB 3QT2A 3MLZH 4HG4J 4PJHB 2J4WL 1IM9B 3HC3H 2XN9E 4UB0L 5DMIL 4F7MA 3RX7A 5HI5C 4BK4A 1MNUL 3SDCD 1IARB 4KUZL 5IP4A 3ALPA 5ESQA 1M05B 3G6DL 3JTSA 3OX8A 4KUCF 2AJXL 3VWKB 4CMMB 3PHOA 1OAXH 2EKSB 3LPGA 1D9KB 4U0RC 5EU4A 1DQJA 5D7JB 4L5FL 3K2MC 4J2XA 3O41B 2IGFL 1F6FB 3UO1H 4X6DB 1KC5L 3JWDC 4KH2A 3DYOA 4G80A 4J1UA 1CCZA 3KPTA 4NN6B 4HPOL 1RK0A 3EOAA 3EDFA 1JK8B 5DURD 4BH7A 5E2WH 2NQCA 3S96B 2FATL 5DD6B 2X4PA 5K93A 4KQ4H 5HGHA 1IAOA 1B6DA 5MI0B 1UFUA 2B4CL 3BHBB 3PNWB 1LO2L 5CILL 2YOCA 4DGIL 3U0WL 2JCCE 1MJJA 5L2JB 3OKLA 2HLFD 1DANU 2DKMA 3PWUB 4PJ8C 2HKHL 3DVFA 1SY6A 3HC0B 5J6GA 2AXGB 1KEML 4MXWH 5EOCJ 5IF0A 1K4CA 2AK4D 5DVOA 4NQSA 1CL7I 1G0XA 2EC9U 4JFPA 3IFLH 5FOBB 2KBGA 4PRAB 4RGNE 1WISA 3C2SA 5IG7A 3Q0HA 5AEAA 3TF7C 3UTTA 5L2KE 1XF5A 1XGRA 1WIPA 3EFFA 4YPGB 1EHAA 1UXSB 5HGHB 4HUVB 3GSNH 2DMBA 5GS0H 4OCRL 5CSZB 1AGCA 3BKYH 1NCAL 4I8DA 4ZXBC 4OGXL 2BJML 4ORGA 4U49A 2EDBA 2O5ZH 1FVCB 3PP3K 4NSKA 3GSWA 5FB8B 4M7ZC 4QF1B 4EI5B 4ELMA 2GSIB 4EUPB 1E6OL 4G6MH 1T03L 4P4KC 2FBJL 1MEXH 3L3HB 3T0EE 4ODWB 1YNLH 4POZC 3N0PB 2QQQA 4X6EA 1UM4L 5GGRB 1DQTA 5SV4A 3TNNB 4NM4H 4HK3J 2QSVA 5CJQL 3KPSA 5CP7A 5FHBH 5KAQG 2P8PB 2VSCA 3B43A 3HNTL 4XI5C 2X1QA 4ODUA 3MBXL 2FEEI 3PWJA 5JDSB 4D9RD 5DD5L 1U58B 4DW2H 1EK3A 4OV6F 4U1KB 1DQMH 5BW7A 3MLYH 3KPMB 5FCUH 1IT9L 4ZUVA 2H2PC 3GMLA 5JW4N 1J1OL 2FB4L 1XZ0B 2X1XR 2IADB 5T33L 3T2NL 3ARGD 3MACH 1D5IL 1S9YA 3RU8L 4PBWD 2VAAB 3UPCA 1FPTH 3ARFD 3GMPB 1TMCB 4G7YL 2P45B 4X7CC 2QQKH 2B4CH 5ID0A 3L7FA 4JHAH 3B2VH 2ITCB 3CSGA 3L5WB 2IPUG 5KVGL 2E27H 5C07D 2BERA 4OFIA 3RNQB 3LEXA 4KWUA 3BVNB 1J0IA 3FCTB 2JTDA 1K6QL 1MI5D 1BFSA 2R1WB 1WQVT 2PO6A 5J06A 1PEZA 5ESAB 3Q2CA 2A9ML 4OQTH 1AP2A 2JJWA 4XB8A 1PQZB 2BDNH 2NY0C 3QIBB 4N0YL 3G6DH 1AO7E 1FFOA 1QO3B 5GPRA 3CZJA 5FA4B 5FGCE 2Q8AH 4I0PC 1FVEA 3OPZH 1XAUA 1T20B 1OGAB 4N0CC 1FGVH 3W0WB 4P23B 3DYMA 2P24A 4N1EA 3L5WA 1KIPB 1JP5A 1YUHA 4QXWA 1BOGB 1CDIA 3ET9F 1KENH 4Z7VE 4FZEH 2DJSA 3FCTA 4JDTH 43CAA 3D85A 3MGTA 1K3IA 4BQ9A 4NO3A 3U0PA 3LN4A 3WYRA 5F7UA 1PZ5B 5HHME 1FFNB 4PRHA 4W6WB 4KV5F 3G9AB 2X10A 4OCSL 2ED8A 3DRTA 1GOFA 4ETQB 2N1KA 4CGTA 5LWYL 4GRWF 2FO4A 1B90A 4L8BB 1YY8A 3H3PH 4H20L 2D7NA 4FFYL 1LDSA 1LEGA 4I9WE 2AGJL 4HKZA 2C3VA 3VXOB 4Q97A 2WIMA 3QDJA 1OT1A 5E0QA 1MJ8L 2IPKB 2V2TA 4U1GB 2VSDA 4YDLB 3T0EB 5FFLA 4JFXA 1W72L 2WMPA 3D87B 3DYPA 3SO3C 1UCTA 3MROA 4A6YH 4HGKC 1AGBA 5INDA 4OM0H 5DLML 3CFEB 2FO4B 2VE6B 3DBXB 1DLHB 4LDLB 2Z0BA 2H26A 4FQIH 1OWRM 3SDDB 5DMGD 1WFNA 5EU7E 4G42A 3BPLB 4UV4L 4KTDH 1T2QL 3JSSA 2X9XA 3QWRA 2NR6C 5TQ2L 3H8NA 2ICEB 3RWJA 3QPXH 3UAJC 2CKBA 1KC5H 4P57B 1F02I 4JN2B 2W60A 4GXUN 1JGEA 2VC2L 2YMXL 4XPGH 3SQBA 4YX2H 3T0EA 4M7JL 5EZIL 4G8GE 2EZ0D 4HD9A 4WO4B 5DJXA 2BVPB 2MNUA 3QXDA 3D39A 1BHGA 1HILB 2Q8AL 1BVLB 3QRGH 4ONFL 3TVMD 2WBJD 3D3VA 2HH0H 2CQVA 3NACH 4G9FB 1LD9A 1R6VA 4GMSL 3RVUC 4OQTL 4HLZG 4M5YL 1XIWB 4LNVA 4P46B 1ZLUH 4G3YH 3GSQA 4OGZA 1X4XA 4OZGB 3TVMC 3F12B 4TN9A 5IR1A 4JRXD 4OAWB 5L88L 1RIUH 1U41A 3M8OL 4WY7L 1BJ1J 1FNEA 5DI8A 4XMKH 3P2TA 3VI3E 1CXFA 5E00B 2CK2A 2A73B 3HZYB 4LLMB 4XBGA 5ABDE 4QRSB 1NGQH 2VWEE 5C0RL 3BKJH 1C5CH 3MRIA 1BVLA 3DV4A 4PP1C 2VLJA 4M1GL 4PS4L 2DDQH 2LU4A 3BQUA 4XCCH 2QEJA 3RKDC 4NUGH 2EYSB 4V1DD 3TBSA 3K8KA 5T5NG 1ZLWK 1M7IB 1DBAL 3J8F7 3QXAB 3R0MA 5T3XD 1GPOL 4Z7UA 4GMSH 3ZMRA 3RWCA 1I8MB 2X2YA 3VFNB 3IDYB 4PJBA 3GSQB 3OAZH 1GZPB 3GBML 2NY5L 3HE6B 2WBJB 1NUDA 4NIKB 3QJFB 1EERB 4DVBA 4HDIA 5IFAH 2DQTH 4DW2L 1OLLA 5GGRY 1ADQA 4UDUA 5CJOH 3L5XH 3KDMB 3VFVB 3M1BA 9CGTA 1GGIH 4MMZC 4U1SA 3EYSH 4OCYH 4U1LA 4OZIA 1ZT4A 4LBEB 4XNYL 1AXTL 1IGCL 1JHTA 2AK4E 3E6FB 3H9SE 3FT2B 4NC1E 1KN2L 1KF9B 2FX8L 2AJUH 3IXAB 3S4SG 5D5MB 1F3JA 1SBBA 3RGVD 3TBSB 4HGWA 4WUUE 4MXQC 1IC7L 4KROB 3SGEI 1DQLL 2CSPA 4LPYA 1IC7H 5HYSB 5IB5B 1D5ZB 2C26A 1NDGA 4ZUWA 2P5WE 4KJYB 1CXLA 4HUMB 5E99L 4XVUD 1J8HA 5E03A 3VDCA 4LCCC 1VACB 4O2EB 3MYJB 4PJGB 1CD8A 1OAXL 3GO1L 3T0EC 5FYJD 5GZNC 1LE5B 3DECA 1ORSA 4NKOB 4NGHL 4YAQB 4PJ8D 5F3HA 1JYVA 2HLFC 5IKCB 2ENSA 1EVUA 3DMMA 1BEYH 3JTTA 1WAAF 3UTPE 2AJSH 1RJLB 2VLKB 1E28A 1CTNA 4QRPD 1AR2A 4PJCA 4UIMA 2OQJB 5CS7A 3LPWA 1LDPH 3KR3H 3MOAL 1JZ4A 2C7UA 3ARRA 2BVUA 1QNZH 4TVPD 3CMOL 4HUUB 5F1IA 3WXVL 2W65A 5JXEA 1T66C 5KN5B 1MCKA 1FL3B 4Y1AA 3OGCB 2UZXB 1NDGB 4YHKL 3T1FB 3W0WD 5F9DC 3AFLA 2FWOA 3HNVL 1BQUA 5JIPA 1FJ1A 4LKXB 2YRLA 3RL2A 1ZHNA 2HAZA 3L6FA 4JAMB 3ZE1E 5DQ9B 1HHIB 4C57C 1PG7L 1ZA6B 5BRZB 1D5IH 2XZQL 3CFDA 4CN1A 4ELMF 3BZFB 1FHGA 5DK0A 2QSTA 1J0KA 1QBLL 3IKCB 4Z95L 5ICZA 4Q9RH 1ZHKA 1F3DJ 3T65A 4KK8C 5EO0A 1KENL 5IQ7H 3D9AL 2EH7L 1IT9H 3MXWH 2J5LC 5DZNA 5KZCB 4G8IA 3HZVB 3UTTE 5L2KA 1CE6B 4MD0B 4X8JA 1Q0YL 2CDFB 2VDNH 1G9NC 2X42A 5LAXA 5IEHB 4M5ZH 1XGYH 1XF2A 2AGJH 4PJFF 1YNKL 1QBMH 3S88H 4NBZB 2JELL 1JJUA 4PY8I 3ARFB 4Z0XB 4KJWD 4ENEC 1LWRA 2ADJA 3HC3L 4JPWH 2ZOKB 1QR4A 2VZTA 1H9VA 1BVZA 3LRSA 5IQ9B 3PWLB 5LQBL 4GRMA 5DJ8A 2G9HA 2EC9T 1YN7A 4UT7L 3IKKA 4NJAH 3G04B 3RWFA 5ENWB 1AGFB 1NCDL 4KC3B 5DJDA 4JLRA 3RZCA 5IK3B 3NH7H 3PQYE 4D2NA 1W72B 1MIML 4C56A 1ZTXL 5C8JA 1RJYA 2G75A 3DUUA 4DGYH 1U2HA 2ESVA 3GSNL 4K55A 4Y4KB 3MRMA 1ZHLB 3VXRB 4F9LA 2YD1A 1ZVSA 5H37G 1L7TH 2VDLL 1ED3B 1UWXH 5E2TH 3R4DA 32C2A 3T4AA 3LRSB 3PGFH 5IQ9A 2FHFA 3HI5L 4LIQH 3OGOE 5DUPL 4N0UE 2BHZA 4FQ1L 2OI9B 4U1NA 5TE7L 1U3ZA 3RWFB 2APWA 4PGEB 5IOPA 4PRBA 2ZKHH 4WTWA 5F1OB 5CZKA 1JGDA 4NO5B 5IB4A 3MJ9L 1O5DT 4D9QE 3ARPA 3KYMA 2F8XC 2HFFB 1QFWH 5CEXB 5FUCE 1H3PH 1S8DA 1RJYB 2G75B 1CN4A 1LMKA 4E41B 3DUUB 1XGTB 1I7TB 5D1XC 3WL9B 5FA3A 3NIFF 1DVFD 4KRLB 4XWGL 1K8IB 3K8LA 3AAZA 4JFQA 4OI8A 5DF0A 1A7PH 1YEDB 4K8RD 2AJZA 3GJFA 5I73C 4NWUL 2B0SH 2UYLA 4XCEA 4ZXBB 1CF8H 1OW0A 5CP3A 4OB5L 2WP3T 1AXTH 1IGCH 4HFUH 5KSVB 2AJXH 1FIGH 4Q74A 4M02A 2DQFB 2FX8H 4MA7L 5J11B 4PPTA 1KG0B 2P5WA 5EC2B 1MCWW 3MGOA 1ZT7B 4OIIL 4PIRF 4OIIH 1FG9C 4WU5A 1CR9H 5SX4I 1A4JA 1U3HC 3GSWB 4KUCD 4ZYKB 5DRXB 1UVQA 5FB8A 4PRNB 3TA3B 5BXFB 2AV1A 3BMWA 3QDGE 1HDMA 4N9OB 4ZOBA 3RX8A 3S3PA 2Q8BL 1PG7X 3MLUH 3OB0H 5C6TL 1R3KB 2MQCA 4Y5XB 3AU1A 2YRPA 4WTZG 3K7UA 4XCYA 4OKVB 3CFKA 5CJ8A 2XFXB 4OTXH 1LO0L 3SBWA 1YEEL 1A1OB 1TJHL 3E8UH 4BZ1H 3GIZH 3QDMD 2HN7A 2KZ1B 4UQ3B 4O51B 1UXWB 2VXQL 4OLZH 1NBQA 3BZ4A 4UAOB 2ZUUA 2QKIA 4F7EB 1P6FA 4OCNC 1AD0A 2FL5A 1NCWH 5EU3A 3JVGC 2VABA 5CMAB 1YN6B 3D18B 2OL3L 2OX5A 1NCNA 1T89C 4GMTL 5D1XD 3LEYL 1MJ8H 2E3VA 4ONGH 5IVXA 2F9BT 4X9BA 4Y2DD 3IYLW 5HD8C 5GGTL 5JR1H 2O5YL 4I18A 1VGEH 4GG6F 2EE3A 4XXCC 3GMRB 1CXIA 35C8H 2DQIH 2UWEB 5KS9E 4HT1H 4TSAH 3PL6A 2DM3A 1DUYB 2X4SA 3CC5B 2QV2A 2VXSL 1Q72L 3QH3B 4P2OC 5ITFA 3L7FB 1MWAL 3LKSB 1CFQA 3SE9H 1F13A 2QKIB 3A0OA 3I6GB 1T1XB 5LWYH 1A7BA 1HYSC 1PSKH 5E7FA 3E3QC 2X4NB 4PG9A 3S34L 1N5YH 5D70H 3TBYA 4F58H 5JHLL 1XCTA 3ZKNC 1AI1L 5D6DA 3LD8C 5F89B 1MF2L 1NGWA 4HH9A 3O81A 3IS0X 4JKPH 2HVKB 3OJ2C 3K3QA 4B5EA 4PJEA 1U8LB 1EEUA 2FLBT 1PG7H 3C60C 1RU9H 5E95B 4PGCB 5DD0H 3KWWB 4AH2B 5CEZD 2VZSA 3BWAA 4TSAL 2KPNA 3LZFL 4MB4A 4R4NC 3MA7B 4PBVC 1BVKA 1ITBB 1CTOA 3NIGE 1CGWA 4NKIL 3O9WC 5I2IB 5TGBB 4FABH 3IAGC 1O7VA 4QTHA 1HIMH 1Q0YH 2VDNL 5EZJB 5JO5A 4LARL 5DC9B 5F9WC 3IDXH 4HH9B 4HWZB 4QOKB 5TDOB 3D39E 1H5BB 1AHWC 3WS6C 4M6ML 2Z4QB 1LP9B 3VFTA 4KVCH 3EYFB 2EO1A 3UDWA 1K3ZA 2ID5A 5FDWA 3DETC 7FABH 4QGTA 2VLME 1U95B 4PJIF 3ZSSA 4OKDA 2ATKA 5C07A 4YUEH 4JFDB 3B8SA 1OB1A 1J0JA 3WFCL 4G8FA 4YHZH 4MDJA 4XC3H 3RVTC 5MENE 5IIEB 5EA0H 3I75A 3WIIH 3N9GH 5CWSB 4J4PC 3F7RA 4Y1AD 1H3VA 3PXJA 3S5LG 3W0WE 5GHWH 1XIWD 4GAJL 1MCLA 2H6PB 4YHIA 1HIML 4HF5L 2L7JA 4YGVA 4BH7B 2Z4QA 1OP5H 3R06B 4M62H 4QRPA 2MCG1 3QFJE 1WVZA 2WBJC 5SWSB 5SX5H 3T3MF 4OF0A 1NH6A 2DM4A 3ARDA 4CN6A 2EYRA 4OB5H 5T1KD 1C5DA 3IDUA 1O0VA 2G2RA 2BCKA 2XPGA 4FQ2L 3N50A 2G5BA 2ICEA 5JIKA 2AXGA 1RJCA 2CKBB 3I6LD 3MRGB 3O4LA 5CZXC 5DGQA 3VXNA 5CAYB 3P0VH 4E0RA 1NUFA 3TO2B 3HUJE 4KROC 4HJJH 2WLYA 2PW1A 4G6ML 1T03H 1TQCB 1P4LA 4U6HB 3OBAA 3D39B 3EFFB 3L3OA 3NIGF 5F7WC 1DVFA 2BY3A 4L8DA 5DUML 5LCVH 5E8EA 4N1CA 3MNVA 5IVZB 4Y16A 3WFDH 4GAFB 3PGDA 1U8NB 2E7LC 5JPNA 2BSSB 4XMLL 5T33H 1CLZL 1SHMA 5DO2D 1T0MB 4QF1A 5EB9A 3S97C 1KB5B 2A77H 1XGPA 4ZTOL 5E9DD 4HGMA 1WBXA 3GFUA 4NQXB 5EH1A 3MRJA 5EOCL 3GMMB 5TDNB 1LO5A 4NPYA 4W4OA 1FNEB 5DI8B 6FABL 3KLHC 5IMOB 5KG9B 2VLKE 1NAML 4G8EA 4NKIH 5HYQB 1Y18A 1GIGL 1PJ9A 3CFCH 1KLFA 1N59B 2HRLA 3D2UB 1WFOA 3MNWA 3O3BA 1EXUB 4P2QD 4X4XA 3WN5C 2XWJB 1OSZA 3HAEA 2ESVD 1FH5H 1UB6A 3G5YA 4YZFE 5H8DA 1MCSA 4OCXL 3F5WB 2QR0A 4NGHH 1CL7H 4R8WL 1MCIA 4BZYA 1KIQB 1MREL 5I17B 1R5IB 4PLKC 2NX5A 2Z31D 4F7TA 3WLWC 1LE9B 2R8SL 4CVWA 4HKBB 4JFDD 2R8SH 4Q9QL 3VFNA 4FQQB 1TVBB 3RUGA 2X4QB 3AROA 4L3ED 4OF6A 1I1AB 1WJ3A 1KN2H 1RZIB 3V5KA 3C60D 2O5XL 5IJVB 4XBPB 5D70L 3EDJA 2OTWB 1QLFA 2BFVL 4JZOA 3CK0H 3LKOB 3KDMA 4Y19A 1UYWL 3MBED 1QFWL 2OR9H 4YH6A 2BDNL 3HAEB 3V6OC 1FAIL 3QXWA 4WEBH 4XTRC 4NNPL 4LPWA 4MWFB 4AL8H 5HYFA 5I17A 4JN1H 2R23A 4MA7H 4NFDA 5MEOA 3EO9H 4KQ3L 3ULVD 4YDVB 4PREB 2D0HA 4TPRH 5FGSA 3RWHB 3SE3C 2PCPB 5D96C 5FHAH 4KDVA 1FORH 1QVOB 4N90E 1V8HA 4AEHH 5I75B 2BY2A 2FJHA 4YDJA 4JVUA 3X13A 5LVEA 1VHPA 3B6SB 1UJTA 2B20A 1YEGH 3KYNB 3SE4A 4OLXL 1ZTXH 3EKCA 3VDBA 5FYLD 1YDPA 2VITB 2OJZH 2DLTA 3CU7A 4DGYL 4KJWC 1RIVH 3HHRB 4WDIA 1MLCB 4O2CB 5I74B 5C7XH 1F4WL 4ONOA 1BWWA 1JPTL 4F7MB 5FYKU 3QDGD 4R2GB 4GG8A 3RTQB 4HSQA 1ZK9A 2OR7A 5SX5K 3PV7A 3W39A 1AQKL 3MUZ1 4LKCA 2FJFB 1HSBA 1NEZA 3HE7B 4PLJD 2DQHH 4X7EC 4LLWA 4JO1H 2F5AL 1MCQA 2EECA 5HGDA 3UO1L 4LHUD 4NOFA 3LRHA 4GQ9H 1OQXA 3DRTB 3VXUD 4IRSD 3I02B 3BOVA 2DTMH 4RNRA 4XCFH 1UKTA 5ADOL 1EO7A 4DKFH 4UTAH 2IPUK 4PJHE 2YUZA 3O3EB 1P9MC 5C0AD 3QXVA 1CYGA 4Q2ZA 4P23D 3BPOC 4QXGH 3ZKND 5GGVY 1FZOB 3FTGA 3WV0A 4GRLC 2NXZB 5I1AA 1U8JA 4OCXH 4QHNA 1T80A 4RGNC 1N5YL 1ES0B 4P2OD 2CIKA 1U92A 4NYLB 4WV1B 3FO1B 2IQ9L 3RDTC 2Z31B 1FZMB 4OD1H 5EBLA 2K7PA 5GZND 3CSYB 2AEQH 3EOTL 3LQAL 4MXVE 4PY7A 5GGUB 3B8YA 3KPNB 4ZS7H 3SOBH 1LO3H 4DGVL 2B7DT 2G9HB 3ZDZE 4QRRA 1LO4H 1YN7B 4L8SA 5E08L 1TVHA 3QZWA 3P9LB 1JK8A 1F4YL 1SJEB 1W72H 1CE1H 3QHTC 2DQGH 1YMME 1MFBH 3B9VA 4MXQD 4ACPA 1DBJH 5D7KE 2MKLC 4GBXD 4JN2A 2ORBH 1NFDB 2ZG2A 3CX5K 2XKNA 3O45A 3PGFL 4GLRH 3BHBA 5C0RH 3L3HA 4M4RA 5JTWA 1IJ9A 4HLJA 3TT3H 5GS1A 3ULUL 3IJSA 1KIRA 1DLFL 3BZEA 4MNQB 4U1JA 4PBXA 2HTKD 1RIUL 1DEEB 4EN3A 4KZDH 3VXRA 1PEWA 4HIXL 3JV6A 4RGMB 1BP3B 2DLEA 5IROC 5J6HB 3EO1B 2IQ9H 5GGUA 4K8RH 1KYOK 2VQ1A 3SDXA 4JFPB 1FNGB 4NT6A 3PP3H 3QO0B 4I3SH 3SE8H 4F3FB 3D39D 2F8OA 4P46A 4MDIA 2CLVB 3BUTA 2GW5A 3D0VB 1FZKB 5F6HJ 5IVXF 2OL3A 2OM5A 2UUDH 3VGAB 5KSBA 3L5XL 1NGXB 2E7HA 5L8KB 3VXSE 1TENA 3NACL 1K8DA 4AG4L 3UTZA 5FF6B 5BQ7A 2OR9L 3G5ZA 4M7JH 3PDGA 3VD4A 3G6JF 2VAAA 5MEND 1A6AB 1F4HA 4P9HC 3TVMA 5DMYA 3MRIB 5EUOE 4A2MA 3BDBA 3MPCA 1A5FH 3B5GA 1F5WA 5EU7C 4LVOB 2KZWA 1N4XH 5FECB 3JWDH 2YPLE 3T77A 2MPAH 1YEDA 5TF1L 5ANMA 4ODWA 2DBLL 4K3JH 3SDXB 1JYXA 1T7WA 3F58L 1EAPB 4LVHB 1QEWA 1RMFH 1P2CB 1XT5A 1Q8MA 3WIIL 4ZUTB 1SJHA 4H5SB 4HWBA 3KJ4C 2EH7H 1EEZB 2O5YH 4IRJD 1KFAL 2DQJH 3C8KA 1E6OH 3WS3A 2DQEL 1I8KA 3FQUB 1C5CL 4UV4H 4ZFFB 2J8UA 5CBEA 1KG0A 5EORL 4JM2F 2BJMH 2X6MA 3OKDA 3VGFA 3IFPA 4WHCA 3Q6GL 5DLMH 3GSXA 3V6OE 3VFWA 4N0RA 1ZGLP 3T3ME 4L9LA 4PLNC 1YEGL 1TJHH 4JANB 4BZ1L 3LQAC 1JHTB 1G7MB 2Y9RT 3SDAD 1JWUA 1QYGH 4U4BA 4DKDC 4Y5XA 4AK1A 4TVSa 4OZGE 1MH5A 4YK4B 1RURL 2F58H 3GIVB 4NRZA 4X6CB 3C09B 1J1OH 2VLRA 1BJMA 1U0QA 3CIQA 4ZS7L 3EBAA 1IEBA 1F2XK 3IFOA 1A1MB 4RISL 1JPGB 1LE5A 2AEIT 1W8OA 3O3DB 4I0CC 4U6TA 1IKNA 3QHZH 1Q0XH 4PJIE 3WN5A 3VXUA 3WFBH 5D7LD 5D2LE 5J3HD 5KTEH 5LGHL 3HZMB 1NUGA 2DAVA 3G5VB 4HHAA 5F7EH 1Q9OA 4I1NB 5F7EL 3QQ4A 2C1PA 1WZ1L 5JORB 3SKNA 4NN6C 2HT3C 1OCWH 2W65B 4R8WH 3WIHA 5DVMA 3I50L 1YYMH 1SEBA 1FP5A 1MCOH 2I5YL 2ESVE 4JCLA 1UA6L 4XGZA 2CDEA 4TSCH 1U6AH 2VLRE 3OR7B 4NZRH 4PJ7B 5DXWA 4MAYB 3FB5B 2OS7A 3MV9D 3MROB 3DURA 1GAFL 1P5VA 1JF6A 2DQHL 4LRIA 3U30B 5IFAL 1MCEA 4U1HB 3U7YL 1BIHA 1T0PB 4OFYA 1PZ5A 3IKCA 3BKML 3CFIC 1MFBL 4DQOL 4FTVE 3S4SB 5I15L 5SWSE 2J4WH 4UIKL 4UBDC 1CICC 3KPOA 4JQXC 5CD5C 3N9GL 1T0NB 3RNKA 2R2BB 4NKQB 2BY1A 5HYEA 1U8IB 3B3IA 5JORA 1SVZA 3LQZB 1KCSH 4AENA 2IANA 3NZ8A 1T22B 4FXLA 4Z7VA 3RWDA 2W60B 3VFOA 4IRJB 4XPHH 3ZT5A 1FPTL 3MLTA 3OX8B 4OFKA 4EDWH 4OCSH 4JE4B 4KZDL 2FH6A 3PHOB 2P44B 4KROD 3SN6N 4YHYB 3QQ3B 1D7FA 2JE8A 2V5TA 4UT9L 3SGKA 3V5HB 1PBYA 2ZSWB 4ODXA 3MYZA 3CH1A 2NW2A 4JN1L 1R3LA 3V6ZB 4CVXA 3MRPA 3PWNA 4OV5A 4HS6A 4GSDL 2F53A 4JO3L 2RR3A 3UTQB 1HHGB 1NDMA 2M1KA 5IEKB 2OCFD 3H7LA 1FFRA 4H88H 4J4PA 3F7QA 1MVUA 3SOBL 3VXSA 5I1KH 1MJJB 4MD5B 4K3GA 3NCJL 3OAYK 5I1KL 3ROOA 4L29B 1ETZB 1I8IA 2F5AH 1P7QD 1QSFB 5BCAA 1QQDB 1CF8L 2KUTA 2BSTA 4K9EC 3BRFA 5I8EB 1ED3A 3GRWL 3I3BA 2XQYK 1Y6NR 3MJ7B 3TBTB 5C09B 2LFGA 3RVTD 2FJGA 2OYPA 4CDHA 4HIHA 1X5HA 3VFPA 3SDXF 5DSCA 4ZFZB 4Y5YA 4I0PA 4XP1L 2WWKO 1HHKA 4JVPA 3QQNA 4F2MA 3RWCB 4O00A 3OKMB 4WI7A 2Q7YB 1TQBB 4HUVA 2D0FA 3LKNB 2CPCA 2FGZA 3TN0C 5I30H 2VN4A 3T4YA 3DO7A 3NN8B 2HKFH 1FRGL 3ZL4L 5CEXA 1HZHL 3PDDA 4HDIB 2BNQA 1CFSB 2DLHA 5DRZA 3ME0A 4P46D 1Z9OA 5H35B 1CGSL 5DJZA 4TPRL 4MA3A 1AO7B 4C83B 4F15B 2X09A 5HJ3B 4OCWL 3H9ZA 4YIQB 1T1WB 2I07B 1OGAE 5D71H 4OBSA 3A6BH 1KACB 4LF3A 3MLXH 2I9LA 4JCMA 1G7PA 3T0BA 1YPZF 4MNHB 1QRNA 3OQ3B 4ZPVA 5F7MC 5KSVA 3BP4B 4ORZC 1BM3L 4DKEH 3UYOD 4WW2A 1NCWL 3VGHA 2LU3A 4MGXA 3QAZC 3GSRA 2VO5A 2LTQB 5CBAB 1UADC 2ADIB 1T7ZA 2R39A 3DX7A 3MYJA 5EU6A 4YBLB 1OVZA 1HHHB 3QIUB 4ZYKA 3UMTA 1UACL 4QRRD 2XV6B 4K71C 5AD0B 3H7BB 4ZAKB 4PJBB 3KXFE 2FRGP 2Q6WA 2MPAL 1N5AA 3ULUD 5FHAL 4Y2OA 4LF3B 3HFML 2Y6SD 3BIKB 5CZXD 4BKLB 1KNOB 2AERT 4I18C 5CJXA 2WLZA 1G9ML 2V7HA 4H0IA 1KCRH 3LH2H 4APQC 5ALCL 2R1XB 1L6XA 4RZCB 4PUBL 4YBHA 3SCMA 5IB2B 4UQ3A 3G5YB 4JG1L 3W2DH 4TULL 5FO7A 3B9KA 2X05A 4TULH 3VWJA 5CKAA 1R5IA 2R4SL 4IJ3C 1JE6A 1W0WB 1LE9A 5CJQH 5IBTH 3BUYA 4H1LG 4QTIH 2OTUB 5ADPL 1MLBA 4I3GA 2F53E 1VB9A 3KXFA 4KHXH 4FQLL 5GRJH 5F3HB 4YAQA 2Z35B 4FZ8H 2YPVL 1KB9K 4ZFOB 1NMAL 3WUZA 3VXTA 4LPCA 2NY1B 1U8PA 5LXGH 5MEPB 2V5SA 3NH7L 4HV8B 4Q6IA 3TT3L 1T7YA 1XF2B 1KIPA 1YUHB 5FO7B 2D3VA 2DQEH 1DLFH 5L8LB 1UQSB 2EKSA 3AM8C 1DQJB 4LSPL 1NL0L 43CAB 2XICA 4I2XA 6FABH 1HH9B 3X3FH 2Y06L 2DB8A 1DBJL 5KSAB 2GSGB 1NUNB 1TZGL 1U3HD 3L3IB 5BZDA 2CK0L 5IBTL 4UOW1 3TESA 4NZJA 5I66B 4EXKA 1HQ4B 3RBGA 4QTIL 3T2QA 1KB9J 3BP5B 4MA8L 1U8OB 1JZ3A 4CDGC 4ETQA 4XNZC 5F93C 3UDWC 3C9NA 1CDGA 1J18A 2H2PD 3CFDB 3O6ML 1II4E 1OPGH 1S9XA 2HTLC 5DUMH 1CVSC 1B88A 5D1XA 4HWBH 3RPKA 2GJ6B 2YMXH 4XPGL 2RIKA 1ERNA 2AK1L 4NC0B 1IGTA 4HBCH 4K8RC 2QADC 1VFUA 5HYJE 4HBCL 2W0KA 3FONA 3S34H 5DUBB 4UT6L 1ZVSB 4YHZL 2L0DA 4X5WB 3MLWH 3SEPA 4JPIB 1N64L 3RAJL 1EGJL 5SWZA 3HR6A 5BV7L 1FO0B 5IJKC 4KU1A 4QHUB 5JPMA 4K94H 3LS5L 5BV7B 4D94A 3IU4H 2ZP0T 1MFEL 3QIWA 3EJYC 3H42L 3C60A 1AGDA 4WU7B 4YDKL 5IJKA 3ALXA 2QLVB 5IW6A 4MSWA 3TH3T 2AW2A 1A7RL 5KANI 2HFFA 5JA8B 4JFDA 3EOAB 1TZHB 1S78D 4JB9L 2X7LB 4G8FB 2IPTH 4BZ2L 5JOPE 1N2RB 4J3XA 3WD5L 3FTGB 1ZWIB 5TE7H 2NZ9C 4PJBE 1JGEB 1J0HA 4X5WA 5ERWB 2BNQD 1TZIA 1LO4L 4F9PA 3FFCB 1EHLH 4LIQE 2G60H 2CGRH 2YPVH 3R06A 4H26B 1X5AA 4XC3L 3QXDB 2NY6B 1OP3H 4NZUL 4OFPA