1RIHH

Crystal structure of fab 14f7, a unique anti-tumor antibody specific for n-glycolyl gm3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
227
structure length
221
Chain Sequence
b'QVQLQQSGNELAKPGASMKMSCRASGYSFTSYWIHWLKQRPDQGLEWIGYIDPATAYTESNQKFKDKAILTADRSSNTAFMYLNSLTSEDSAVYYCARESPRLRRGIYYYAMDYWGQGTTVTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords light chain of antibody 14F7
publication title Structure and Molecular Interactions of a Unique Antitumor Antibody Specific for N-Glycolyl GM3.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 221
sequence length 227
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihH02
2P1YA 2FYYA 2YD9A 4ODUB 4ZFFA 5DSCA 1CR9L 4YGVA 5FYLE 1D5BB 5B3NA 4I2XE 3QXAA 5GGSY 5F44A 4WHDA 1A1OA 4Z7VE 1IM9D 3HUJE 2AEWA 3OJDA 4LKXA 4CVXA 3KG5A 1KENH 4LSPL 2KQNA 1FCGA 4OGYH 5SWSE 4U49A 5DD1L 1WUNT 4IS6A 25C8H 4LCWA 1U8OA 4HXAL 3EIFA 5E8DL 4R4FH 1OTSD 1Z9LA 5E2WL 4Z5RA 2D7MA 1MI5A 1MAML 3QRFM 2V17H 1OLLA 4JHAH 2CIKB 3U4BH 1QLEH 1DQDH 5I8EA 3I6KA 5JHDD 3L3OA 3T77A 2PO6A 1BGXH 4EIZC 1DEEA 1LDPH 4UUJB 1ONQB 5IMLA 4ZYKB 5M94B 3OXSB 1WBYB 3H3BC 5EBLA 1G0XA 4MDJB 1DANT 2P8MB 3KPSA 3O4OB 3PWUA 4UOJA 3M17B 1IGMH 3GSVB 1J8HD 2C7UB 2XN9B 5E2VH 2EDHA 4NCDA 1UGNA 1WT5C 3UJJH 4QHNB 1UCBH 3ESUF 4OLYH 1AGCA 1AC0A 4W6XB 5DJ8B 1N64L 2X89D 4FTVE 3PDOB 1NQBA 5EU5A 5EIIB 3VWJA 4KZDL 1JUFA 3CCHB 2OYPA 1K3ZA 4ODWA 2VLRD 4PJ5E 3OBAA 2E8YA 1T1XA 2XYCA 5INDA 5JPNB 1VKXA 1AHWA 3DROB 4PG9B 5IBTL 1DSFH 2CRZA 3WL9B 4CUCA 3L5WB 4KHXH 5HGBB 4JRXE 3QT2A 3FB7B 1N3NB 1K4CA 3MRQA 5I0ZA 3OG4B 2VLME 3HG1D 2EDNA 5T1DH 4YH6A 4QHLB 3L3JB 4EUPG 3HZKA 1JNNH 3MRNA 5HVHB 4OKDA 1LEIA 35C8H 4LEOB 3W2DL 3VDCA 4XPHH 1OPGL 3X14B 3IDGB 4YHNB 1EJ6A 4KI5E 4M7JH 3VD3A 4OD2A 4JLRB 4N8CL 1N6VA 1FNSL 2BHYA 3IXAA 4NGHL 2D4FA 5CINH 3T0WA 3AFLA 1IAII 2XY2A 5I2IB 1B90A 2DQHL 4Y2DA 4J3XA 4YDJA 5MENE 5D2LF 3F5WA 1YY8A 3QDHA 4NQEB 4Q2ZA 5AZEL 2R1XA 1IAMA 2RCSH 1FN4B 2A9NL 1I1RA 4URTB 1HI6A 2CDGB 3CLEH 5DI8B 5D7IA 2PW2B 2YUXA 1CL7L 1RUQL 3RRQA 1Z0NA 1JNHB 3I6GA 3S4SG 3KYOA 5BQ7A 4RA0C 3O45A 4PJFE 3GRWH 1V8HA 3P73B 2DQCL 3BISA 2AJ3B 3WE6B 1VDGA 4WFGD 2DI9A 5IBUB 3C2SA 2BNRB 1IEBA 3DO3A 3NN8B 2XQYG 3P30H 2XRAH 1UZ8A 4Y19E 3SGKC 1VGKB 3DVNA 3BZFB 3STZB 3Q0HA 1MCJA 3NABH 5C07A 1QSFB 4M48H 2A2QT 2UYLB 1IGJB 1KJ2H 4MXVF 3DUSB 3HMXA 5TE7H 2F53A 4HPOL 3GMOA 1E4XL 4UNVA 1TFHA 4HV8A 1J7VR 5IB5B 1S9YB 1VACB 1OP3K 5MP6H 1U3HC 5J6HA 2EDRA 4KWUA 3RUGF 1U8HA 2Z8RA 5EOTB 1X4ZA 5D96C 1YN6B 3I2CL 4PJDE 4NQSA 3S7GA 2X4UA 4KPHL 1MPAH 3H42H 1F4YH 3MRIB 4EN3C 4BZ2L 4UT9H 1DN2A 1KJ2B 3S96A 3VRIA 5DJ2A 1EO7A 5I8KH 3L3HA 1ES0A 3LKPA 1ORQB 4MQ7A 3STLA 4HEPG 2IBBA 2ZCKH 2ZP0T 4ZFOA 1U3HD 3CVHL 4I77H 1F8TH 3FB6A 3MNWA 4OJFH 2DKSA 2WINA 5HDQH 2V7NB 4PJBA 4LVNC 4Z7QF 3D39D 3FB8B 2NLJA 3RTQB 4DAGL 4EN3D 4PJIA 4F57L 3WS3A 5ECJE 4XMKL 5KVEH 3QAZC 1Q1JH 4NN6C 3FL7A 4PJAA 3BOVA 1WLHA 3GHBL 1OAXH 4UIKL 5DJZA 1BMGA 1UB6B 4PP2A 3O3EB 4GG8B 5ID0B 3WHXA 1J05A 5FOBA 1P7HL 1J18A 4E0RB 4GMTL 3Q6GH 1JMZA 5FGRA 4JZJA 5GIRA 3C6SA 4F7EB 4ZTPH 5J0BA 5D6CA 4XCNB 1FL5B 1KN4L 5C0AA 1QSEA 4WFFD 4DCQB 4O51B 1JGVH 4MA3A 3ELAT 2EE9A 5HPOA 1K2DA 1WF5A 2P5WB 2XKNB 3GJEB 3H9YA 4OFPA 2QQNL 1QLRA 4JPVL 3PQYD 2C3VA 4JO3H 1U92B 1NEZB 4XP4H 2G9HB 3EDJA 1JZ4A 4Q9RL 3VFMB 1KB5L 2VIRB 3RIFK 1HINL 4LOUC 5I16B 1FYTA 3MQIA 2Z9TA 5CLTA 3UTPD 1BBJB 4PRHB 1DBBL 1X9QA 4H8WL 5HVWA 5DVLA 1HCFX 2BVPB 3G04A 3U4AA 3BAEL 1NUFA 5I76B 3VE0B 3BIAX 4EJ1C 5D1ZB 4IOIA 3DV6A 3U9PL 4GKOA 4HQQH 5J56B 2B5IB 5KG9A 1F58L 2P49B 4LOUD 3RWCA 4YXKH 3T08A 4JFPB 1FO0H 2VDKL 1A14H 4OCSH 2YBRB 4OLUH 3TWCH 3FMGH 1V05A 2NZIA 3QDMB 2E7LC 1HKLH 3BZ4B 1YEDB 2XFXA 5DEGB 5EU7E 1JF6A 4I2XA 2R0ZH 1AXSB 4X4ZA 4Z7VA 3HUJA 4HUUA 1CFTB 4PGCA 1S3KL 4OZHE 3S35X 5EB9A 3P0YH 4DJMA 5GS2D 4POYA 1S7SA 3IU4H 2GAZA 5SWSA 3KYMA 1EJOH 1TJGL 1CN4A 7FABH 1MCRA 3MREB 2RR3A 3VXSE 4U6HA 5DMKA 4LMQE 3B5GA 1NCDL 2VWEE 1EZVY 4ZUTB 4BUGA 4KKLC 3ZSTA 2IG2L 1QRNE 2A0LC 1MCDA 4RX4A 2W07A 4HWZB 1T1YB 1WCBB 3K74B 1A6WH 1K5NB 2FECL 4G6JL 4YHKH 1ADQA 4XPTH 2A73B 4KY1H 1FFPA 3U46A 5TDNB 5CSBA 4XNUH 4FQJH 4GMSH 1SBSL 4DVRL 2IPUK 2R29L 5FV1L 3RNQA 1RZJC 3QJHB 3OR6B 1G7QA 1CTNA 4KKLD 3T0AA 1G9NL 4WGWB 1JNLH 2A0LD 5F3HA 2WIIA 4B50A 1ZA6B 1P4BH 2PXYC 1EXUB 1JZ8A 3IU3B 5F9AC 3JZ7A 4FTVA 1DFBH 1G6RA 2ZJSL 3DXAE 4G6MH 4H0HB 4TULH 5GRYA 2VDOL 1PD6A 1J0YA 1ZHLB 3N9GH 3EYFA 3DX9B 3L3KB 4CDHA 4CKVX 4PJ5A 2I9TB 3L5XH 5L7XH 4F58L 1BF8A 4QLRA 3TVMC 1CXFA 4LRIC 1MRDH 5EU6D 5B8CA 2AI0H 4LEXL 1WISA 5IF0A 4JRXA 3SGDI 2CDEA 2EE2A 3BT2H 2PXYD 2NY0C 5IW1B 5INCB 2ADFL 1XCQA 3MCLH 2ENYA 4F7CA 4Q9CA 4LSQL 3HRZA 3BGAA 2BJMH 3DHMA 3FAWA 4PR5A 4EI5C 5E9DB 2IF7A 3MLUH 5IEHB 4X80L 1OSZA 3TVMD 2I07B 1NGPH 1A4JB 2F74A 3MRRB 3VGGA 1BZ9A 3BPLB 2IH1A 2VLJB 4F8TA 4MWFA 2H1PL 2NY0D 4UQ3B 1WAAF 3MLSL 4PRAB 2YXFA 4NO2B 4NQDE 5MENA 3MOAH 2JJWA 4EI5D 3HE6C 4HLZH 3TNMA 4P2QE 3BGFC 4GW5A 4KTEL 3SDCA 4L29A 4N0RA 1Z9MA 1RU9H 2Z92B 2E3VA 1HDMA 5JNYA 3TZVA 5D1QC 4UQ2A 3RU8L 4TUJA 2DD8L 3LD8B 3RKPA 2MCG1 3WUWA 4AIOA 2DQGH 3EOAA 4PJFA 3QWQB 5ICZB 4QRPD 4BSWA 4L4TD 5CSZA 4I3RL 2VH5H 3HE6D 3CLFH 3TYFB 3PWNB 5DMYA 2NY7L 4Z8FL 3B2VH 3FRPG 3HNTL 3MMEB 4NZDA 2YD7A 4F7PA 2JE8A 2QQLL 2FHCA 2C4XA 3G5ZA 4Y19A 5EORH 5D1QD 1JK8B 2OX5A 3GIZL 4HUXA 1J12A 4X6EA 2XXCB 3O6KL 1YNLH 2VYRE 4JPKH 4KK5C 2H6PB 3KJ6H 4NKMB 1FNLA 3QPXL 4MNQD 2EC9T 4LAQH 5FGBA 1RK1A 1YEGH 4YK4B 1C1EL 1FFOB 2DS4A 4HHAB 3LKNA 4Y4HB 3OKKA 2D9QB 1J5OL 1I3VA 1C12B 1YEKL 4L8SC 5JO5B 4HXBH 1RPQA 4F8QA 1LNUB 3PV6B 1D5MB 4PJDA 4KK5D 2YWYA 1K8IA 2KKQA 3LKSA 1OQXA 1P7QB 3ARQA 3PWJB 5A1AA 1PZUB 1MIEL 1FVEB 2R69H 5FO7A 4MJ5B 4NM4H 3V8OA 1A6UH 3VXME 3S37X 3BP7A 5T1MA 2B4CL 1R5VA 4APQB 3IDJB 2AJVH 3W82A 3TCLB 1BECA 4H25A 5FF6A 5EZJB 3KPQA 3PL6C 4XC1H 2XWTB 5HYJB 2EIZA 5HYFA 5HGDB 5J1TC 2Q86A 2OZ4L 3B5TA 3MBEB 2ZSVB 1ACYL 3T2PA 3CFKA 3VGAB 1Y18A 4PD4J 1S7QA 3E3QE 3MV8D 2J8UB 2YD4A 4KGLA 4R7DB 2Z35A 3S88H 2NXYB 2VXVL 4R96B 4G80B 3O9WB 3QIUC 1IGCH 1G9ML 4PLNC 3H9ZA 1MVUB 3PL6D 2P7TB 3H3PL 3OG6B 4X6CF 5K9OB 1IC4L 3OKMB 4LHQB 3OKOB 1K4DB 2R4RL 1OTUC 5DHYB 4ZO7A 1GOHA 3EOYG 5J3HC 5ALBL 5DYOA 3ARGC 5IQ9A 2D7PA 4LBEB 3A6CL 3T4AA 4JM4H 4K7PX 4KMLB 4UV4H 1I1CA 3DX6A 3QIUD 1T5WA 5LBSH 4PREA 3UJTH 1T20A 2BXZA 3OZ9L 5CD3B 4I0CC 4G5ZL 5DMIH 5MI0C 5HYSB 4GQPH 1OTUD 5DD5H 3AB0C 3O3AB 2Y23A 4NUJB 3QNYA 4N5UA 5J3HD 2SEBA 3DOSA 4WNQA 3BIBX 1Q72L 3OX8B 2BK8A 3ARGD 4PTUB 4NWTH 2Q1EA 1B9ZA 4GFTB 1I3GL 1UJTA 3IXTA 2HFFA 3I3DA 4PS4H 4P3CH 1FGNL 3RVVC 4HWEL 5I66A 2ORBL 5DD6A 2P5EE 3GJFK 4LP5A 2R4SL 1MRCH 2VR4A 5IFHH 5IKCA 3QRGL 5DHVA 1QFWL 2A9ML 1K3IA 5H35B 5C92A 4GG6B 1YQVL 5D93C 4PJ7F 4M1GL 3VJ6A 5C0GB 3LHPL 4AEFA 2F5AL 4S10A 4I5BA 3WMSA 5GHWH 3RY6C 1D5IH 4HS3A 1T7XA 3IDNA 2NY5L 3RVVD 1GAFL 2FX9H 3TESA 2NR6C 3FZUC 3GI8H 3LN4B 2FX7H 4OZHA 1G7JA 1HXYB 4M5ZH 3P9WB 4PUBH 2Y7QB 4OT1H 2R2EB 4QHUA 1CDBA 2CJUL 1MOEA 1L7TH 5T33H 4PJGF 1FGVL 4NPYA 3VXSA 4YDIH 3O3UN 4YDLB 5J11B 1CK0H 3P4LA 5CEYA 1TZGH 2FH6A 3R1GH 1QRNA 3V4UH 4DUXA 2NR6D 4WI5A 3FZUD 5DTFA 5E08H 1I8IA 5EFIB 2VABA 2V2XA 5ENWB 4MCZA 4P23B 1Q9WB 1U8LB 4NZRH 4FP8L 1IQDA 3S35L 3ZDYF 3OF6D 3WXVL 2YZ8A 3S34L 4ORGA 1IC1A 3HB3D 5FFLA 4UDUB 3P40A 4X98B 4M93C 2CGRL 1SY6L 4YX2H 2RB8A 2DF3A 4V1DE 4OZGE 1SJHA 5F89A 3SY0B 3HNSH 2E6JA 1CWVA 4MAYA 4K9EC 3DXAA 1TVHB 4AENA 2IPKB 4G7VH 1A6PA 1PY4A 1KLGA 1YY9C 4U1KB 2X4NA 4WEMB 1ND0A 3TT1H 3BEWA 4U6VH 5DQJA 4D8PA 2YPKA 3QI9C 3TV3H 4XCFH 5D7LB 1KTRL 1II4E 4ZUVA 3LMJL 1QO3A 1X5XA 4XX1G 4GAGL 3WFEH 2W9LA 1YY9D 3WXWL 3LEYL 3BE1L 3MRHA 4YHLL 2OR9H 2ICCA 3P0VL 3FFCE 2HJLA 4K2UH 1PQZA 4P5MB 2DDQH 3UC0L 3QI9D 1QPPA 2GSIB 3FJTA 4WFEE 3VXNB 5BS0B 3QNZB 5KSAC 4QTHB 3BGMB 1GPOL 1T6WA 1WBXA 1CFQB 5BRZE 1MRFL 3DGGA 5DWUL 2H2PC 5JW4M 3G9VA 1N2RB 2F8XC 1S7VA 3U82B 4XP6L 1SMOA 4NQDA 3RWFB 3ZTJG 3TA3A 2Q76B 3E0GA 3L3IA 4RNRB 4G7YL 5A2FA 5J06A 2A6DB 4P2QA 3BQUB 4S11A 1T2XA 2JB6B 4X83A 4GKSA 3BZEA 1UKQA 2FSEB 5KSAD 2DAVA 5DRXB 4XXCC 2F5BH 2HKHH 1NAKH 4AG4L 2H2PD 1IC7H 4FXKA 3LS5H 4JHWL 5IHUH 2YUZA 5H2BA 4DKFH 5DJCA 4N90E 4QOKE 1YPZE 1Q0XH 1R5WA 3QDGA 5J4MA 4P46C 4ETYA 2GJJA 4E42B 1EFXD 4PV8A 2CXKA 3K2UH 2J6EH 5D8JL 4XH2A 4Y16B 4F37F 4XPAH 2R8SH 1SVCP 4MJ2A 3FOLB 3FAXA 4XC3L 5IVXF 3IJSA 1T04B 1X5LA 5T3ZL 2VAJA 2BVYA 3UO1H 3IVKB 4Z77A 3OGCA 4C83B 1CICA 2F19L 3VFUB 4M6MH 1ZLSL 4NQCD 1LP9F 2VDRL 1GIGL 4P46D 3O4LE 1ACZA 1YEJL 3U7YL 3KPNB 5KSUA 3HHRB 3KWWA 4I0PA 5IV2A 1CLZH 1NDGB 4IRSA 5GSRB 3WFCL 3EOTH 3GMNB 4GKNB 3MRLA 2ZG3A 3QQ4A 1KCUH 4FZEH 4R4NC 2DWEB 4LLUA 43CAB 2E9WA 4BKLB 3L1OL 3P9LA 5JIPA 5DT1H 4TRPL 4ENEC 3QHFL 1YEEL 4LLMB 3RX8A 2XICA 3EO9H 2AEQH 4WV1C 5EIQA 1TQCC 1LDSA 5EUOF 2VXUH 4NO0A 4PYHA 4XMLH 4K94L 1RURH 1RIHH 3O6MH 4KVNL 2BY2A 2ARWA 2YRPA 2HVKB 2DOCA 4R8WL 1OAUL 2UWEB 1JL8A 5J1AB 1TJIH 2ZSWB 3L5IA 5GGVY 4O2FB 4ZS7L 5AAMA 4NNYA 2XTJC 3VXMA 5KVGL 4YC2B 3EFDL 5B39G 4R4ND 1AE6H 1N0XL 4PRPD 4PGJA 4N8VA 1FL3A 5F72S 5AYQA 3WO4B 4ENED 1PFCA 1I1FB 1I9JL 4F15C 3S98A 5JOPE 2V9QA 4OCYH 4P5TB 1I4FB 1DANU 3IT8D 1WZMA 1IAIH 5EO0A 1A3RL 3FFDA 4RZCB 4LCIH 3OQ3B 2OTPA 5I17B 5D70L 2PYFB 2XTJD 1J1PH 3V5KB 5CZVH 3ZTNL 5DVNA 1NGXB 4X8JB 3S37L 2X9WA 5F88A 1WTLA 1CDUA 3K8MA 1S5IH 3UBXA 2ATPB 2X70A 4NKIH 2YKLL 5JHLH 4ZFZB 3LKOA 4MQXC 3V4PL 3EO1A 3HI6H 5HGHB 4Z76B 3HMWL 4RMQA 3VRJB 4G8GD 5DQ9B 3J8F7 3D69A 4JY6B 3EGSA 5TPWL 1OAKH 3V6OE 5IFAL 1CLYH 1A7RL 1RFDH 5I1AB 3QUMH 1KCSL 3UTOA 4HW6A 4ZDHA 3AU1A 4WIQA 1EAJA 1KFAL 4ZOCA 4UAOB 1YYLH 3Q3GB 4U1IA 1DE4B 4MQXD 5EN2A 2WAHA 4R3SA 4XP9L 4C56B 2UVEA 5CHNA 1JWMB 5GISL 4FFWC 1QUNA 4J1UA 5DA4A 2BVUA 3B2UC 1N6QL 2NY5C 1S7UB 3AM8A 3PXJA 1MCEA 5CD5C 3EFFB 2Y06H 1P1ZA 3F58L 1A6ZA 1UA6L 5FUCC 1KN2H 4K7PL 3QHZL 1CFVL 4L3EE 4JO2L 5J57B 1G6VK 4NQVA 1LO5A 4S0TD 3T3ME 4YGAB 1PAMA 4JHBA 4ZUUB 2X4TB 4WHTB 2FR4B 3U4EA 1I1AA 2P5EA 2QSCL 4ZFGL 5L0QC 4Z7WF 4Z7NE 2LTQC 5D1XC 4CVUA 4HK3J 2GY5A 4LHUD 4XNXH 4FFWD 1LEKB 2CH8A 1BPVA 3V6ZB 4J4PC 1KEGH 2BVOA 4KROB 4EVNB 1HIML 4Y5YA 5CD5D 3KPRB 4CJ1A 2HAZA 1TETH 4XVSL 4Y4FC 3IDUA 2BSED 4KDTA 4NSKA 3LEVL 3BUYA 3VXUB 5JMRA 2D7OA 3GSNB 2MHAB 3VDBA 5C0RL 2Z91A 3RWIB 2J5LC 3KXFD 4OQTA 5F3BA 2OL3L 5KTEL 1LWRA 1IZKA 1SM3H 4AYFA 5D1XD 5JUEH 5BMFH 3BRGC 5E99H 3ES6B 2O5XH 1B6UA 5BVPL 3RIAF 4J4PD 2W9DL 4FQHB 1UWXH 1YEHL 2OTWB 1G7IB 3TN0A 2ESVE 4Y1AE 4NUGH 4Y4FD 1KELH 5D2NB 1IEAA 5C2BL 3KNBB 5BV7C 5TGBA 4YLQT 4LPTA 4L9LC 1KTKE 1P53A 2FGWL 4TUKH 1JGEA 3QXAB 4YHIA 4LP4A 1A1OB 4WU5A 3FN3A 3OJDB 4CVXB 4R2GC 5E6IC 3MFGB 2VZ3A 5C0EA 4LARL 3EDDA 3ARBB 3ULUL 4YZFF 1W8OA 3ARDC 3D85A 1R0AL 1KENL 1RULL 4Z5RB 4H20L 4DGVL 1BJ1J 4JM2A 4OGYL 4HIXH 4V1DA 4F7TA 4OZGA 1JFQH 5I8EB 3I6KB 5IQ7L 2KH2B 1R3KB 4R4FL 4LLVA 4QRRE 4NJAH 3CH1A 4NT6B 5E6ID 2CO7B 5E2TH 1ZLUH 4K3EH 4U7SA 4NRYB 2BDNL 3ARDD 4NN7C 4Z7UB 3I84A 3PWUB 1NPUA 5FYJU 1UH3A 3KPPB 3LIZL 4JG0L 1BEYH 1W2KT 3CVHA 5AZ2H 3RDTB 5IVZB 1AGCB 1IGML 2CRYA 2YMXH 2DQIL 2KQMA 2OM5A 2EYSA 1NCTA 3HFML 3V4VL 4ONGH 1HZHH 5SWQB 3FFCA 3P2TA 3RWEB 4QRTA 2X1OA 4OLYL 4LLDB 4Z7OE 5I1HH 4L8BB 2D03H 3HZMA 2PUQT 5C2UB 5BRZA 4Y88A 2DL2A 1TDQA 1AHWB 1XF4B 1N26A 5EBWA 1AGDA 1LO2L 1IBGH 2AJXL 4KRPB 1U6AH 5SX4H 3JBG7 4DKDC 4HS6A 4I4WA 3WNOA 5C0IB 5T3XL 1DUYA 2X4SA 2ICWA 1LEIB 4HDIB 5J9PA 4HUVA 3UBXI 4DVBB 2FLRT 2DWDA 2G60L 4NRXA 2AKRA 3SE9H 1EVTC 3IDYC 2OP4L 1AO7B 2VN7A 1QTYT 1F2XK 1UM4L 4QOKA 2XY1A 1JRHH 1YPZA 3ZHLA 4YDJB 1CGXA 4M02A 4OCWL 2FWOA 4C54A 4ZD3H 1AGFB 1YY8B 4G9FE 2NY3B 1CD8A 3H8NA 2Z0BA 4WW2B 4O2EA 1M7XA 2YC1A 2H26A 1QVOB 1RUPL 1WFOA 4LPCA 4CMMA 3RWDB 4PTTA 2WMPA 3KYOB 3F6IA 3ARGA 1IKFH 3HMXH 3Q5OA 4S1QH 3MROA 3TH3T 4Q6IC 4KH2A 3O45B 3T0EB 1DDHA 4LLWA 3O4LA 4O02H 2VXSL 4GBXC 4NBYB 2NX5D 1S7XA 3N85L 2P8LB 2I25N 3C5JB 3OKEB 4FFVC 4XPBL 4Z9KB 1IEBB 3BFOA 3ZKSD 4OI7A 3DSFH 1MJUL 1OW0C 1FNAA 3O2DL 1HN1A 4OV5A 3UTSE 1IQWH 1IGIL 2H8PA 3BHBA 1WZ1H 1FFRA 1BFVL 1FZKA 4GBXD 3PDDA 4M9PA 4WHCA 4M61B 1X5FA 5FECA 1BD2D 3LN5B 3GMOB 4FFVD 4L3CA 4HKZB 4N1HB 4PRDB 1F90L 3SDDC 2PTUA 4JE4B 1S9XA 1CL7I 1ZANL 5I74B 3SHSA 4OD3H 1G9EA 1W0WB 4Z18A 4B7LA 1NMBH 3VH8A 2OI9B 1U8HB 2IBZY 1CXEA 3CFEA 5E7FA 3D2UD 4JDVA 4MA7H 5D72L 3ZDXE 4NQSB 2X4UB 5I1CH 5MP6L 5EO9A 2GIYA 1MCBA 5CP3A 1YC7A 2X4RA 4BK5A 3S96B 1RZKH 5DJ2B 2Y1VA 4E5XA 3BDXA 2X6MA 4E9LA 3SDDD 3LKPB 2YOCA 4MQ7B 2X42A 4D9LL 5EZLB 3FRUB 4ZFOB 2E7MA 2J88H 4EZMA 4Y5XB 2WINB 1W0VB 1BHGA 3MCKB 4V2BA 4NBZB 2NLJB 4I77L 2E9BA 1KG0A 1HWHB 1MHHA 1XIWB 4PJIB 3PGCA 3V6OA 1EEYA 4MHHI 3KLAA 3W0WD 1CGTA 2WUCH 4PJAB 4K55A 5DQDL 1AGEA 3AVEA 3H7BA 1JGUL 2B1HL 4ZUWB 3U0PB 3GSOA 1AY1H 3FQTB 2VZTA 4C59B 4ZODA 3WHXB 3P11L 4HFWB 3C6SB 3MV7E 1U8KB 3GK8L 1IAKB 3QSKB 1G7LB 1I85C 4U1GB 4FFYL 3MJ8B 4JQIH 2F54B 4RMSA 5JPMA 1JPSL 4JFDD 1TTUA 4Q58C 1CQKA 4J3TA 2W1NA 4L3EA 4UTBH 2R39A 4L9DA 1JGVL 2R0WL 4PY8I 4BH8A 5F9OH 4FQ2L 1GGIH 3V0AC 3MA9L 4HD9A 1QBAA 5F6IC 1T80A 3ZE0E 5JOFA 1BFTA 4RDQF 4EBQH 3D3VE 4NO5A 2OR8A 1MH5A 1TZIA 4JKPH 1K8DA 1UWEL 4LHUG 5K9KB 1ZXQA 1IKNA 2FJHA 4JFED 4HBQA 4IDJL 2G2RA 3C5SA 3UDWC 1PKOA 1FVCB 4TUOA 5FYLH 4DFHA 4OCMC 4OF5A 5KZCD 2DJSA 3OB0K 1SVZA 4KAQL 2ZNWA 5MHSD 2ICWI 3MNZB 1ZOXA 4QY8B 2BNQE 3FQNA 2WM0A 1A21A 1LK3L 5FB8A 5DJAA 4BSJA 2ESVA 4Y1AA 1KJMA 3MRKA 1BZ7B 4RGOL 3WIFA 5LAXA 4HQQL 4DFIA 3ETBF 4FMKA 5C0BE 1YNTA 1TQBB 3FOMA 3QEQE 5HHVL 4EIGB 4HPYH 4YXKL 2XFXB 1I3RA 1F6AB 4I2XB 2OMBA 3A67L 5DRNB 5T3ZE 3F65A 4HIIA 1F97A 2CO6B 1ADQH 4PGCB 4X6FB 3UZQA 1S7SB 3MACL 5IMMB 1PG7H 4RIRB 3KYMB 1JHLL 3S4SB 1NGYA 1CGVA 1KPUB 3ZE1F 3DARA 3MRPB 1GC1L 3HCVB 2R1WA 5DMKB 3N1QC 4LGSB 1G84A 3B9KB 2UV3A 5CCKL 3HR6A 5IROA 3LH2L 1KYOJ 5FM5M 5ACZA 4WGVB 1AFVL 4QRRA 4FA8A 4PJ9A 1G6RH 3NGBC 4YEFA 2AJUL 2E9IA 4XBEH 4JFHE 1A3QA 4JZNA 3DYOA 4N0UE 1E27A 4KKNA 3HNVL 3S3PA 5K33A 1LILA 3SDAC 4MJ6B 3ULVL 3NCFB 3RNQB 2KBGA 5C9KA 5MEPA 2QR0B 4GLRI 5FDWA 3ILQC 1JYWA 3S9DB 5TE4L 3U0TB 4QCIA 1EHNA 5DUMH 3REVA 4IMLB 2FHBA 1RUAL 4XNUL 5I1JL 5HDBE 4WU7A 5FKAA 3DUUB 4J3VA 4GH7B 1NFIB 4G3YH 4WFHD 4PJEF 3MLWH 3JWDC 4LCCA 2OZ4A 5KS9B 3QCTL 3RX5A 1I8KB 2OMNA 5HBBA 3U0WH 1TZHB 2NY2B 1H15B 4DEPC 4PJ5B 3SDAD 3ILQD 4E41D 2W0KA 5T3XD 1P2CA 3CXDL 1QFHA 2G5RA 2W60A 4ONFL 1MNUL 4QNPF 3SJVB 4IDLA 4M5YH 2CIIA 3WS6C 4O5LL 1XCQB 3QCVH 4LGRB 5C09E 4JFOB 2AI0L 1H0DA 3O3DA 1NLDL 3OR7A 1KPRB 2R2BB 1LO3H 2DM7A 4JQVA 2CDFA 4Z95L 1EO5A 3VFTB 3RBSA 4JDTL 3MLUL 1ZEAL 2CK2A 1N8ZA 3DRTA 4WI7A 1IMHC 4X6DF 3FB5A 5C3TA 5MEQB 4G8IB 2GJ6E 4ODVL 5MEOB 2D7TL 1RUKH 1UYWH 2V5MA 2LVCA 4G8FA 4G9FA 5AWNL 2H9GA 4GRLA 3SE8H 4MX7B 5CLWA 3PWPE 3S5LA 1P9MA 3OWEA 1HDMB 5JNYB 2Y07H 2CUHA 2PETA 2DBLL 2HLFC 2XV6B 4TUJB 1U93A 2PR4L 3CK0L 1GGCL 1TNMA 3WUWB 3EOAB 3WNPA 4AJ0A 5T1KA 3VA2C 4L3AA 3QJFA 3UTTB 1U8JA 2ZCLL 1J11A 5J6GA 3L7EA 5HHMD 1JWUA 3B3IA 3K7UA 1NKRA 5AG9A 4R4BA 3OKLA 4ODSL 1A2YB 2C1PA 3G5ZB 3UTSA 2VNCA 2HN7A 3GUTA 2HLFD 3MGAA 4D3CH 3L9RA 3WFBL 5GS1C 3IFLH 4YE4H 4X6EB 3MODL 3P9MA 5KW9L 4FHBD 2BNUB 5FM4A 5J13B 5ESVA 3Q5YA 3IFOA 2WBKA 4OLZL 3AS2A 3N1MC 1YNLL 4HJGA 4P4KB 2DYPB 1XH3A 3KJ6L 1EDQA 5FA3B 1I7UA 3I6LE 1AGBA 2EEAA 4PJDB 4UILH 4WWKB 4JN2A 5CEZL 1K8IB 2I9LB 2PF6A 4TSCL 3CMOL 3A6BH 2AJSH 4HXBL 4HF5L 5FO7B 4AMKL 5DRZA 3RL2B 1TJHH 4ZG1A 1BIHA 4F9LC 5T1MB 1S7WA 1XR9B 3ULUE 1RZGB 2J2ZA 3THML 2R69L 1IE5A 4NM4L 1IM9B 1SY6A 3FCTA 5FUOH 4HZLB 5FKPA 1NCNA 1JV5B 1NCWL 5EOCJ 2ZOKA 2DTMH 2Q86B 4XP5L 5E5MB 4TNWF 1KTDB 1OCWL 4J8RA 1QLFB 5IW6A 1LE9A 2UUDH 2XN9E 2VXTH 2I60H 3QUKA 1S7QB 5TF1L 3FQWA 4MXWH 3DX8A 2Z35B 5JHDB 1T1WB 4M7KL 3QDJD 4NBXB 3K1KC 3U2SA 1IILE 4HCRH 4L8CB 4DUVA 2FBOJ 3FO1A 3V6FA 2JTDA 5HXMA 1YMHB 4WRLA 2MJWA 1J10A 4EI6B 1EGJH 3CSYA 2AK4D 4HLJA 4XCEB 3B9DA 3MV7A 3RZCC 1NL0H 4OFYA 4RAHA 2WBJC 5DYOB 4WJ5A 5ID1B 1KULA 2HWZL 1J8HB 4X9FA 5TFSL 5IGXL 3MSPA 1OAYL 4GRWF 1PG7W 2FO4A 3SDYL 5FYKD 4PREB 5DJ6A 4PPTA 4RDQG 1FZOA 3OKDA 5E2UL 1A5FH 4FQXC 3RZCD 3SGJA 3D3VA 4KJYA 5ICYB 5DHVH 3FT2A 4NYLA 5LBSL 2WBJD 1EAPA 4OIAA 2SEBB 4WNQB 2NXZC 1ZLUK 2FGZA 2XZAH 1NFDF 3WJLC 4CW1B 1ZVHA 5TH2B 3I50L 3TC9A 5T3XE 3K4AA 2YXMA 4U1JA 4Z0BH 1OHQA 2I24N 4RQQB 5DUPH 1F2QA 3P4NB 3HI5H 5DD0H 1QP1A 2Y4SA 4X0KB 2Z31C 4NQEE 4FQXD 5DD6B 5I8CB 4QO1A 4GSDH 4OAWB 2BNQA 4OF6A 2A77L 2NXZD 3HR5A 5IKCB 2YRZA 3G6AA 4WDIB 3CJJA 3ARVA 3MV9E 4FZ8L 3KJ4B 5EO1A 4D9RD 3CNKA 5C0BA 4HS8H 3VJ6B 2XTLA 3QEQA 1KCRH 2AERT 3EYUH 4I5BB 4J3WA 5D2LB 5HI3C 2VB5A 2ZZUT 3X12B 1AR2A 3IDNB 2FLBT 5AUMB 2Z31D 4LU5L 5DLMH 4XNYH 2BNRE 4Q6YA 3SKJL 4OZHB 1G7JB 2GUOA 1WIOA 4WUUD 2JIXA 2FIKB 4QHUB 3ZL4H 2QTEA 2DLHA 3QIBA 2VLLB 4GT7A 3VXSB 3JTSA 5HI3D 4M9OA 1A02N 3O3BA 2Y9RT 2YUWA 4HSQA 4LLYA 4OT1L 5IG7A 1E4WL 1FFQA 2GCYA 3N06B 3CD4A 4N1CA 5HSFA 5L9DH 2V2XB 3V0VB 1QFWI 3SKOA 4MCZB 1HSBA 4M62L 4N0UA 2R56L 4WO4A 1K6QH 4ORGB 2B2XL 4JDZB 4LVHC 3LQAH 5KVMC 4DQOH 4K8RH 1ZHNB 4BJLA 1Y0LA 3ZKMC 5F89B 1FNGB 5I1IL 2EXWC 4X7SH 5IWLA 4P2OC 3PHQA 1DBKL 1KLGB 4P59H 2X4NB 4JFYA 2KL6A 1ZV5A 3BEWB 2WW8A 3KLDA 3D9AH 3SO3C 3WFZA 1JPTL 4G7VL 2YPKB 2ZOLA 2R23A 4P9HC 2QADC 4K3JL 2OSLA 5BO1H 3ZKMD 4ZUVB 1CGWA 4NKOA 3NAAH 2EXWD 4JY4B 5C6PB 1QO3B 2JLLA 2VC2H 2X05A 2K1MA 3KYKH 3W39A 2IGFH 4P2OD 5J1SC 4XCFL 4QYOB 2GI7A 5C09A 5LCVL 3MRHB 1WV7T 4XPGL 5E4IA 1X5KA 2HJLB 4PJXE 1U3HB 5CKAA 1IM3B 1N7MH 2QKIA 2F15A 5I19L 5D96B 1UM6H 2QADD 1X7QA 3WUZA 1WBXB 2W65A 2HVJB 2R0KH 4B0MM 5HTSA 1MFBL 5C0CD 1MCWM 2ADGA 4X5XA 2GJ6A 2XZQH 5GS0C 3TA3B 3GMLA 1MUJA 3VXPA 5HVGB 1HOCA 1U91B 4HZAA 4P48A 3BZEB 3DLQR 4HGMA 4GKSB 1MHCA 5D5ME 1MWAL 1MVFA 3PWPA 1F3RB 5K9JH 4LVNB 4OCRL 4FXGB 5CJQH 4FXKB 5KN5A 3ISWA 5IB3A 1DCLA 3BDYL 3BP5B 1A6AA 3B9AA 1LD9B 5H2BB 2QLVB 5GS0D 5I1GH 5DJDA 3DMMA 3QAZB 3C6LC 4OUOA 1R5WB 4NN6B 4BFGA 3LDBC 2EH7L 2IAMC 5IHUL 3ARPA 4PV8B 2EYTA 1XF5B 2CMRH 2D31B 5HYQB 4XH2B 2BSSA 2IQ9L 4OLVL 3KPMA 2E7CA 1CR9H 4OSUH 4YHYC 5CWSB 4Z77B 4WWID 1JP5A 2OL3A 5I1LA 1CICB 3LRSB 3ZE2F 1RK0A 2XWJB 3C6LD 2PN5A 4X9HA 1A9EB 3BWUC 3QDME 2IAMD 4LSPH 2B20A 4WUKH 4EDXB 5KSUB 5DD1H 1D5BA 4I0PB 5K59F 1MCIA 3GMRA 3DJ9A 3OAYK 3QG7L 1KIRA 4HXAH 5E8DH 3CMGA 2F8OA 5E2WH 4BQ9A 5BW7A 3P9LB 5DRWB 1VADA 3SDXF 5GS2H 1MAMH 5DURB 4CJ0A 4WEBL 3FHQA 2OQJB 1H3TA 4XCYB 2ZUWA 4NKQB 3L5JA 4NO0B 3RL1A 3SCMC 3UDWA 3V8CA 4I48B 3RGVC 4PYGA 2AEQL 3GB7B 3WN5C 4OTXL 3C5ZC 4UUJA 1ONQA 5IT2L 3F7YB 3QP3A 1KXQE 3OXSA 1WBYA 1RJZB 3ZO0A 4W70A 3LAFA 3SCMD 2DLGA 3BD4A 3M17A 3GSVA 2XN9A 3QULB 1N64H 1OWWA 4KUZL 1ZT1B 3M8OL 3RGVD 3W9EB 2G5BB 2VDQH 4QHNA 2KZWA 3C5ZD 4KZDH 3ALWA 3VXQB 1JGLL 3MV11 4EQ3A 5JW3L 5CUSL 4OKVB 4I18C 1J1PL 5ISZD 4QXGL 5IBTH 5EIIA 1I8LC 3ULVE 3LKOB 3CCHA 3EO1B 3FT4B 4BFBD 4PG9A 3Q6FA 3PNWA 5JHLL 1D5XA 3WL9A 1CYGA 4QXTA 2P24A 1JF1A 3W2DH 3FB7A 1N3NA 5M7QA 5B3JF 1OPGH 3GJFA 4UIMB 3AU1B 3L3JA 5I71C 4N8CH 1FNSH 4LEOA 4U1IB 5LGKA 1KTLB 4IIQC 4NGHH 3EYVB 4U6XA 3RP1A 1A4KA 1FDLL 3HE7C 4YHNA 3X14A 4R3SB 1AJ7L 5E9DE 3T3PF 3TPUA 8FABA 2DQHH 3PGFL 2DM4A 4GS7C 4JLRA 4WCYL 4LVOC 2GITB 4PY7B 2IAND 2XKUA 3NCEB 5GRZA 3ZTJH 3H9SD 5EU6B 5AZEH 5DJYB 2A9NH 1KGCD 2PXYB 1LO5B 5KSBE 1CL7H 4NQEA 3CC5B 4Z78B 1RUQH 3I9GL 1BFOB 1BP3B 3GSNL 3HE7D 5KJRL 3TH4T 1Z9SA 2CDGA 5DI8A 1WIPA 2PW2A 2AGJL 3M1BB 1BREA 3IF1B 2BY1A 2BVOB 2DQCH 3MV9A 3TVMB 3CZJA 3IDIA 1JNHA 1E4KA 3OHXB 1Q38A 4OM0L 3VFVB 1CXIA 3FO0L 5DZNA 5C0CE 4ZNCD 2XG4A 2AJ3A 3WE6A 2WIMA 2C3WA 3PDGA 2C4FU 2BNRA 1CCZA 2PKDA 1LE5A 3V6BR 1EUTA 4YUEL 4HPOH 3CXHK 2O5XL 2FH8A 1E4XH 3WLBB 2UYLA 3DUSA 3QO0B 2AXFB 4OBRA 3Q1SL 3HC4L 2VTFA 2VRAA 3O2DA 2ZUVA 4L4TB 2FJGB 5IB5A 1S9YA 3I2CH 4M6OL 4WU5B 2WANA 4KPHH 3FO2B 2HTLC 4BZ2H 4WEUD 5D1QB 5KBNC 1KV3A 1YN6A 5ETUA 4P49A 3CVHH 4MJID 4F7TB 2KPNA 1CXKA 3KHQA 3WFDL 1ORQA 2DLFL 4MNQB 5DUBA 3SQOL 2J1KA 4DAGH 1A0QL 2HTLD 4PJCF 1TXKA 3QHTC 4LPWA 5CEZE 4BA8A 4X9IA 1OT1A 2V7NA 4F57H 1HXMB 2PYED 4XMKH 3FB8A 3RTQA 9CGTA 1AI1L 2IH3B 2VL4A 3AAZB 1P6FA 3DTXA 3GHBH 4M1DL 4PRIE 2J8UE 4UIKH 4ZAKC 1YZZA 1A7QH 1Q8MA 2EYSB 1P5UA 2H45A 2BMKB 1FL6B 1KN4H 4PJXA 5ABDE 1UB6A 3O3EA 4GG8A 5ID0A 5DFWH 2AK1L 1M6OB 4CVWA 1FVDA 3NIDE 4F7EA 3AY4C 32C2B 3DECA 3WIIL 4DCQA 5EBWB 2QQNH 4JPVH 1AGDB 4ZAKD 4OZIF 1JN6A 3MV8B 4X6CB 2XKNA 4Y5VA 4Q9RH 4I4WB 3EDFA 1KB5H 5BJTB 4UT7L 1HINH 3VFSA 4RCAA 5J9PB 5D5MA 4HUVB 1DBBH 3DYMA 2DWDB 2Y6SD 2DMCA 4H8WH 4OLWL 2MMXA 2AKRB 5F7YC 2VIRA 3BAEH 4YAQB 1FCCA 5CJXA 4OUUB 3CPLB 1ZSDB 2BVPA 3U9PH 1YA5A 1YPZB 2HJKB 4H1LG 2UUDK 2VQTA 1F58H 1TTGA 1KB5B 4XAWL 2VDKH 5A2LH 1RIVL 4JFXA 1DUZA 3WNLA 5L2KD 3O6FC 2VSCA 2H26B 2ZUQC 4JFPA 4CMMB 4PTTB 3JV5A 5EIVA 3ARGB 2M26A 3MROB 1WK0A 3WDHA 5HHNA 5JXEC 1DDHB 1WJ3A 3QDMA 4X9GA 4LLWB 3O4LB 3QQ3B 1S3KH 3ARSA 1YEDA 3BZ4A 5DEGA 3KS0J 5JLZB 1TJGH 3BMWA 1CFTA 3O6FD 4HKBB 1PGRB 1DQQB 3CDCA 4OV5B 2H8PB 1NCDH 2CSPA 1HQ4A 2IG2H 3MREA 1MCCA 3W81A 5CP3H 2RGSA 5JXED 1FH5L 2NW3B 3TBTA 3VG0L 4G6JH 5C0JB 5FYJL 1NC2D 1P6AB 1S9XB 1T1YA 2A83B 5C6TL 4ALAL 4DVRH 1SBSH 4KFZC 4PJGB 1K5NA 2R29H 3RVUC 3VH8B 3CFEB 4F80A 1U58B 4M1CC 1G9NH 3TPKA 4FQCL 1L9MA 4OD3L 5D93B 3CZFB 1X5ZA 5GGTL 5EO9B 3OR6A 2ZJSH 2BERA 1RZFL 1H5BA 2GK0B 2VDOH 4E5XB 3U6RA 3ZDZE 2O5YH 2B39A 2DLIA 3IU3A 4F58H 1Z3GL 1NCCL 5HI4C 3RVUD 4LPVA 4PJHE 1A47A 1ZHLA 4M1CD 5DVOA 1ZGLA 3UZEA 3DX9A 1EX0A 4J6RL 3TO4C 1Z0MA 2ADFH 5D7LE 5D7JA 1EK3A 5IHLB 4H0IA 3SPVA 4LSQH 2EECA 2E6QA 2X44D 2VZUA 5IW1A 5INCA 4FQ1L 3VGEA 3JWOL 5HI4D 4X80H 3BKCL 1FFNA 2APBA 3MRJB 3QXWA 1DVFC 1J88A 5A40E 1UEMA 4BM7A 1BQHG 4ONHB 3HN3A 1IARB 5E9DA 3BXNB 3JVGC 2H1PH 3TO4D 5IEHA 2YA1A 3MLSH 1A4JA 3L3DB 2NY4C 1KBGL 5FDYA 1ZHKA 3ZMRA 4UQ3A 4PRAA 3BPOB 4KTEH 4DKEL 4NO2A 4JQIL 5KSBA 1DVFD 2N7BA 3V5HB 3CFDB 4U05A 2DD8H 1OP9A 1GXEA 4BQCA 1DBAL 5HVFB 1OB1B 1HWGB 2FD6L 2NY4D 4U4BA 4ZOBA 3ARFC 4FABL 1BJMA 4I3RH 4OZIE 3GM0A 2Q8AL 1UJ3C 4NZJA 2NY7H 4Z8FH 3C5SB 1RHFA 3HNTH 3ZT6A 5ICZA 3BRFA 3T8XB 2QQLH 5ESQA 3DURB 4AIZA 4HX1B 1HYRC 3WKNA 1NGQL 4TVPL 2XZCL 5I8OL 3GIZH 1V3KA 1F4XL 2VZOA 3O6KH 3FQNB 5ACMA 3ARFD 1I7TB 5FA4A 4L1DA 5FB8B 2ESVB 3QPXH 1NBQA 2ARJB 1XAUA 1BFSA 1NBYB 1C1EH 1YNTB 4NWUL 4OQ1A 1NJ9B 4GRMB 5LG1A 1MY5A 4XPFL 4HIEB 4QKXB 3MR9B 1I3RB 4O4YL 2D3VA 3UP1A 1MJ7L 1HHJB 4L4VD 5IVXB 3BKYL 4NZTL 3CFIC 4HHAA 2IQAB 1EFXB 1BAFH 4Y4HA 3BH8B 1C08B 1MIEH 1D9KC 1TTFA 3DYPA 1KIPA 3G6JF 3PV6A 1D5MA 2EKSB 5JTWA 2V5YA 1LP9B 1NMCC 1NGYB 4LNVA 1QYGL 1A9BA 1P7QA 2B4CH 1FVEA 1H3VA 4MJ5A 1HKFA 1UXSB 5ACZB 3JUYA 2VO5A 4P46B 2EDXA 4PJ9B 2VITB 4JEGB 5HHPB 2CK0H 4APQA 3IDJA 2X5PA 3TNNB 3DIFA 3TCLA 4S0SD 1XF3A 2OZ4H 1D9KD 5EZJA 1ACYH 1URLA 2R2CA 4CN4A 1OARL 2ZNXA 5HGDA 2VXVH 2V2TB 4OCNC 3MBEA 2ZSVA 1IGFL 4YDKL 2AXJA 3D0LA 1G9MH 1D6VH 3MUJA 4PRIA 2J8UA 3H3PH 1IEHA 5JXAL 1IC4H 4QCIB 3REVB 1SQ2N 5FKAB 2R4RH 4G80A 1INEL 3MFFA 3VFWB 3VMNA 1MVUA 2EZ0C 2P7TA 2BOCB 2YS4A 4F2MA 5K9OA 3OKMA 4LCCB 5ALBH 4ZTOL 3OKOA 4OZFA 5B38G 1K4DA 3A6CH 4MQSB 1H9VA 1ZWIB 4KK9C 4L5FL 1TQCB 4JFZH 4YWGL 2W60B 1RVFL 4LBEA 2ZCHL 3OZ9H 1OT2A 4LVEA 3LSOB 4G5ZH 1MHPL 2BRRL 1YNKH 2XTJB 2EZ0D 1Q72H 3O3DB 4RFNC 5CD3A 3VI4F 2DIBA 3O4OC 4F15B 4KK9D 1PLGL 2BHUA 3T65A 1MCWW 1I3GH 4EOWL 4R9HA 4PTUA 1FGNH 3AXLA 2P42B 4HWEH 4G8GB 1N8ZB 2ORBH 1IAOB 3CU7A 1OP3H 2Q87A 3N0PB 4JCLA 2R4SH 3NBNA 3QRGH 5HHOD 1QFWH 4G8FB 2G75B 5SV4A 3QEGL 2LAAA 1YQVH 1VESA 4JGMA 4M1GH 3LHPH 2KZ1B 2F5AH 4P2RD 2XNAB 5B22A 3SE4C 2NY5H 5H35A 1B2WL 2AEIT 1GAFH 1YEFL 2NY1C 3KPRE 3L7FB 5DGQA 4RMVA 5JQHC 3MO1B 3VXUE 1EV2E 3EJYC 5EU4A 5I0DA 5T1KB 3G6DL 4Z7WB 3QJFB 2CR6A 5J6GB 4PG2A 2CJUH 3BEVB 4R4BB 1FGVH 3RA7L 4AZ8A 1NSNL 2C1PB 1N4XL 1Q9LA 4RGNC 2Y7QA 1UZ6F 2R2EA 2HN7B 4LHUB 3L9RB 2NY1D 5C6WH 1H3XA 3BUTA 5DZOA 1T89A 3P9MB 3EJYD 5L88L 1F3DH 3QUYC 1TITA 5IR1B 5CBAB 4XBPB 3LV3A 5AD0A 1VEOA 4FP8H 1DN0B 4M43L 3WXVH 3S34H 5EFIA 5IJVA 6FABL 1XH3B 4P0DA 2LTQB 4RGND 5ENWA 2X41A 1U8LA 2CGRH 1SY6H 1I7UB 4B5EA 5KVFL 1ZT7A 3WJJC 4UDUA 3QUYD 4JJ5A 4M00A 4X98A 3JWOC 2JJTA 3RNKB 1I9IH 4KXZI 5SX5H 4QT5B 4DK3A 1EEQA 1EERB 2J5LB 3SY0A 1U8IA 2XI9A 1TVHA 2IPKA 4PJHA 4IRJC 3D1MC 1VA9A 3LMJH 3KHOA 1JGDB 2MFNA 5FKPB 4Z7UE 2XG5A 3LOWA 4GAGH 3C60C 5D7LA 3I3BA 3WXWH 3LEYH 3MYZA 3BE1H 4YHLH 3QUKB 4KV5F 1EEZB 5BV7B 3FQWB 3P0VH 4L9LB 3K1DA 5F7EH 3UC0H 4L1HA 1E0OB 4IRJD 5F71A 1GPOH 4M7ZC 3FO1B 1MRFH 5DWUH 1QSFD 3ESVF 1NH6A 4P5MA 3CDGB 4DOHB 3C60D 4HCRL 4QTHA 1MLBB 3MUY1 3ARDB 1B0RA 4LQFL 4BH7A 1F02I 4P4RA 5DJ0B 1CGYA 2CLVB 4CVZB 3CAFA 4G7YH 2EDJA 3QXUA 4YXHL 3FT3A 5F7FA 3RWFA 4L8DB 2Q76A 5SWZD 4WENB 3U1SL 5L8LB 1BM3L 1L7IL 2UZYB 4AG4H 3D25B 2JB6A 3I75A 2FSEA 3GDBA 5DRXA 1VFOA 3FT2B 4NYLB 1KLUA 4NQXA 4TVPD 4P57A 1XGTB 4LF3B 1AO7E 1KJ3L 1MFAL 1QFUH 4A2LA 3CIQA 5D8JH 4MS8C 3IDXL 1MWAA 3VI4E 4K23L 1NANI 3NIFF 4XC3H 3GO1L 5T3ZH 3FQRB 2YN5A 4Z0BL 2BNQB 1S7TA 2VJXA 4Y16A 4Y89A 2F19H 3MX0A 1ZLSH 3FOLA 1I9RL 2HA1A 3G6AB 3AGVA 1T04A 1GIGH 2VDRH 1V5JA 1YEJH 3U7YH 1JZ3A 3BN3B 4R0LA 3MNVA 3KPOB 2YZ1A 3QEQB 4JRYD 3VFUA 3WFCH 1MEXL 4MS8D 4ETQB 1MCOL 3T0EE 3QEUA 1CDCA 3L1OH 3KPNA 4TRPH 2OLDA 1YEEH 3BJ91 3QHFH 5F7WC 3T0DA 1NDGA 3GMNA 1CU4L 3VWKC 3UPRA 1BBDL 4RFOL 1CIDA 5FHBL 5D7SL 4K94H 3RZWA 4LLMA 2JCCF 4KVNH 3U36B 1MCKA 4R8WH 1OAUH 3IDYB 3QIBB 4HIJA 1MHEB 5C08D 2P5WD 4ZS7H 5KVGH 3C08L 4ESKA 3O2WL 2HVKA 1MQKL 2ZSWA 1I9JH 4O2FA 5D1ZC 3VWKD 3OPZL 4GUPB 2NX5B 1GH7A 4NRZB 1X5IA 2B5IC 4ZQKA 3AREC 4U6YB 1HSBB 1A3RH 1I1FA 4PRHD 1HQRB 1QPXA 4JQXC 5D70H 4AL8H 3QFJE 4P5TA 1I4FA 3ZTNH 5F1NA 3BRDA 3SE3C 2IMNA 3B5HA 1TVBA 3S37H 4Q6IB 5FYJE 5IOPB 1R3IL 2VDNL 4KK6C 4OLEA 5I17A 5EH1A 2PYFA 5D1ZD 4GBXB 2YKLH 3TYGL 1BD2B 1R6VA 1NGXA 3V4PH 1YJDC 3ARED 4PJ8C 3U79A 1N5YL 1AIFB 3HMWH 5SV3A 2ATPA 2GTWA 4JFYB 4NCC2 2VOTA 4ZFZA 5TPWH 5IFAH 1A7RH 5FEBA 3NA9L 3VI3E 4Z76A 4NZUL 4XNQB 4FQIL 3VRJA 4KK6D 1AD9A 2PTTA 4JY6A 1KFAH 1LGVA 1T7VA 5I1AA 4XP9H 3RFZC 4PJ8D 5C09B 5GISH 1MIML 3NAAL 3Q3GA 3QWRA 1N6QH 1DE4A 1ZVSB 4ORZC 3KYKL 1A6TB 5CFHA 3F58H 1UA6H 1JWMA 1X7QB 4K7PH 3QHZH 1CFVH 2W65B 3HI1B 4QRQA 5EZIL 1T6VN 2F54E 4ZO9A 2ADGB 1E6OL 3EFFA 4XTRC 1OAZL 2QSCH 3IKCB 3REWA 4ZFGH 4EEEA 2GJ6B 3GKWL 2FNBA 4XAKD 1CD1B 4MAUH 1MUJB 4JO4L 3VXPB 5JORA 4JREC 1U8PB 4MLSA 3EDEA 5KVDL 4ZUUA 2I5YH 2X4TA 4WHTA 2FR4A 1HIMH 2AW2A 1MHCB 1RIUL 4XVSH 3MPCA 5DS8B 3PWPB 3GBML 1LEKA 3V6ZA 1FNEB 2FATL 4WTXA 5C0RH 4EVNA 5KN5B 3KPRA 2OL3H 4XTRD 1FC2D 1A6AB 1OY3B 1V7MH 3VXUA 2AV1A 4JFDB 5EULV 3T2NL 1ZKAA 3DMMB 3GSNA 4XVJH 5BVPH 4HUWB 3FQXB 4KDWA 3RWIA 4JY5L 3LB6C 3MRDA 3VRLE 2W9DH 4MCYB 1YEHH 4YFLF 5DZLA 2V2WB 2EYTB 4H88H 1YN7B 4H5SA 1TIUA 4FQHA 2OTWA 1G7IA 4NHCL 2FGWH 2ZWLT 3KDMB 4IEFB 4MLIA 2WNGA 4TVPE 4JFEB 1T83A 4PGEA 3LB6D 5FCSH 3NH7L 1SJEA 1FG9C 4OSUL 4S1SL 3TP4A 5CJ8A 2EYRA 1HEZB 4LARH 3ULUH 3GMRB 5KZCB 3GEWB 1KIRB 1R0AH 5F6IB 1RULH 4H20H 4WUKL 4DGVH 1CD9B 2VLJD 3DNKA 1VADB 1FLRL 3O0RH 3ARBA 4HKXB 1H8SA 5IQ7H 4RRPA 5C0NC 4RISL 5DFTA 3F8UB 3RL1B 1U95B 4N0YL 5IMOA 4D94A 4JRYE 4WTZG 3BESR 3X13B 3U7AA 1R3KA 2BDNH 1UH2A 3B6SB 4NT6A 4F37K 2VLKE 5F7NC 3LIZH 4ELMF 4NRYA 5IJKA 4JG0H 4Z7UA 5C0ND 3EDKA 4TQEL 1UT9A 3R4DA 4ONOA 2DQIH 4ERSL 3KPPA 3U83A 3HFMH 2YD2A 3V4VH 1CTOA 4KI1A 2Q3AA 3WSQH 3UXFA 4YK4C 4YQXL 3VDAA 3RDTA 5IVZA 3GJFH 1VHPA 3QO1A 5SWQA 3RWEA 2VDQL 1NUDA 5KS9E 4DN3L 5D7KD 4LLDA 1LO2H 2LE9A 4NOFA 4L8BA 2AJXH 1X5YA 5D6DA 3MUHL 3PIQB 4NJ9L 3Q6FB 3PNWB 1XF4A 5T3XH 3U30C 1IRAY 1D5XB 4R90L 3K80A 3G5XB 4QXTB 1RV6X 3PUCA 2P24B 5CS7A 1JF1B 1FIEA 2APFA 4PJEB 3QIWC 3SJVE 4LASL 1RZJL 2G60H 4LK4A 1YMME 3ZKQD 1GCFA 3GJFB 3GMMA 3NGBB 5C0IA 1JBJA 2ADJB 1FNFA 1UQSB 2OP4H 4HDIA 4JFQB 2LU7A 4U6XB 4ZXBC 2DKUA 1A4KB 4DVBA 3ME0A 4ZNEE 3IFNL 3TPUB 5BVJB 1UM4H 4YHZL 8FABB 3SKMB 1F42A 4JANB 4OCWH 1AO7A 2NXYC 3O8XA 3QIWD 8CGTA 2E27L 4JRWA 2KUTA 1BQSA 3O9WC 5CSGA 3TCXA 2VQUA 3TJEL 1AGFA 1FSKB 5DK0B 1RUPH 4FQQB 5HYJD 4ZXBD 3HLAA 4WW2A 1QHPA 5F1KC 3QZWA 3L6FB 4OI8A 2LU3A 1UG9A 1UVQB 3DRQA 4LPXA 1QVOA 4O9HL 5I30H 2VXQL 4QGYA 4ZSOE 3RWDA 5ICXA 3MV9B 2VXSH 3E6HB 4X6DB 2NXYD 3IDIB 3N85H 3O9WD 4XPBH 3P4MB 1OF2A 3T0EA 1MJUH 3MZTA 1FG2B 3O2DH 2ATKB 1XGRB 5JA9A 1EVUA 5E8NB 3UTTE 2P8LA 1IGIH 5FYKU 3C5JA 3OKEA 4N9OB 5GRUL 1HHHB 1LE5B 1BFVH 5T1LD 3GSRB 4W4OC 1AXTH 4IMKA 1F90H 4DZBA 1ZANH 5E00B 4F9PC 1WVZA 1IT9L 1PKQB 1D6EB 4M61A 1CE1L 5CGTA 4JFFD 3LN5A 4HMCA 4HKZA 4PRDA 3CVIL 3T2OA 4HT1L 5ITBH 2VUOA 5D72H 1NEZG 1W0WA 3VMPA 5GJSL 1U3JA 5GPRA 3BPCA 3V79C 1NBZB 1OM3L 7CGTA 4QTIH 4ZPTA 3QFJA 4X99A 5TQ2L 5ETUB 4D9LH 3PF2A 1U41A 2CPCA 2HMIC 4KRLB 1DQLL 5KANG 5DUBB 5EZLA 3FRUA 3HAEG 2V9TA 1F4WL 1QRKA 3RIAK 1VGEL 1NUNB 4Y5XA 5GGTA 1W0VA 3P4OB 3BD5A 3D18A 3OSKA 3MCKA 2UZIL 5LQBL 5GS1B 5J11C 2F58L 2CUMA 2HMID 5I1EL 1PVHA 3IS1X 5DQDH 3ROLB 4GG6F 1XIWA 2BSRB 3DTXB 1JGUH 4TOYL 2B1HH 2A1WL 5KAQF 2DQFB 3IFPB 2QSVA 1ITBB 5JHDE 3P11H 4XHJC 3VGDA 3GK8H 5FHAL 3ARYA 2PCPB 2GJZB 1X5AA 4FFYH 4PJXB 4ZUWA 3U0PA 2ZG2A 3FQTA 1DTUA 1JPSH 1JNJA 1A7QL 1FVDB 4RGMB 5E4EC 4HFWA 1U8KA 1IAKA 3MLZL 1GGUA 1G7LA 1IVLA 3MJ8A 3QCUL 2F54A 2R0WH 3RBGA 4FQ2H 1J8HE 3MLTB 3MA9H 4X7EC 2WBWB 4XHJD 1JN6B 1MFDH 3ULSA 4D0CB 4Y5VB 4LSSL 5SX5K 4Q9BA 4X7TA 2YEZB 3PP3K 2J4WL 2JK5A 3QDJB 1UWEH 5IVOA 1HHIB 3VFSB 1BJ8A 2AS5M 5D5MB 3TF7C 1JMXA 4OD1L 4IDJH 5GS3A 3CSPA 4ODTL 1OP5K 2AK4B 4NDMB 1EFQA 2VLRE 5K9KA 4OIIL 4KAQH 1L0YA 1BOGB 3NTCL 4OF7A 4LGPB 1FVCA 5HI5C 4EUPA 1LK3H 4WHYH 2BP3A 1FE8H 3HG1E 1AKJD 3NFNB 4XI5C 1N59A 5L6YL 3MNZA 4RGOH 4JFXB 1CT8A 4QY8A 3IGAB 3Q48A 2VMFA 5ALCL 1DUZB 4CN6A 5HHVH 3CSBA 1MCHA 2RFXA 3TM6A 1MAKA 2WBJB 1BZ7A 1BWMA 1OGAD 3A67H 5HHNB 3CUPB 5CJOL 2O61B 5D2LE 2FBJL 2Y25A 3QUXC 2EIDA 1HSAB 3B83A 1T0NB 3MACH 3GI9L 3BQUC 5SX4I 5GGRA 4XI5D 1F6AA 4MVBC 1HNFA 2DIJA 1JHLH 2FEDC 5BS0D 5DRNA 3EKCA 1CGUA 4X6FA 1YC8A 3CGTA 3EBAA 1GC1H 4Y4KA 4XVTH 2L7UA 5IMMA 2ID5A 1SMAA 5CCKH 4RIRA 2NXZB 3S4SA 3LH2H 1IGTB 1HQ4B 1KPUA 3SOBL 1AFVH 2MQ0A 3LRGA 2P47B 4R97C 2GKIA 3MRPA 3HCVA 3QUXD 2EEDA 3B9KA 3EW3B 2AJUH 2DI7A 3BQUD 1YECL 4GO6B 3TBTB 2Z8VC 1XT5A 4MVBD 1JRHI 2FEDD 4MDIB 4QGTA 5K93A 5HYEA 2YPLD 5HDOA 2Z31B 3HNVH 2Q8BL 4WFGE 5H37H 2VLKA 4YPJA 2JJSC 1AD0B 3ULVH 3Q2CA 1GVIA 5CEXA 4MXVE 5TE4H 4WUUB 3O2VH 1RUAH 4LAJH 1KPVA 5I1JH 4MJ6A 4LFHD 2QR0A 1H5BB 1UM5L 3U0TA 3U6RB 4IMLA 3QCTH 3NPZB 4MA8L 3DUUA 3RUGE 1NFIA 4FQLL 1KXTB 3ZYIA 4HLZG 2EEBA 3ZT5A 1LO4L 1XGPB 3UEZA 3CXDH 5KS9A 1ZGLB 4ONFH 2O5YL 1D3CA 1I8KA 1SEQL 1TZHA 2FJFA 1H15A 1HK6A 1MNUH 1UKSA 4NC1C 1EZVX 3FONB 4HJJH 4O5LH 5D7JB 4POZC 3SPVB 1NLDH 4AIXA 1X6NA 4YC2C 3SJVA 1JPST 5DEFB 1YMMA 3UX9B 1FFNB 4JFOA 4Z95H 2Y72A 4Z7QE 2WP3O 3G08B 4JDTH 4ZO8A 1KPRA 2R2BA 4K9EL 1DQJA 1QD0A 4ZNEA 1ZEAH 4HH8A 1ZK9A 5HYIA 2Z93A 4P9HH 3VFTA 1TMCB 1A3LL 3D39E 4LRNL 4ODVH 4POZD 2QBWA 3PGDB 4BFIA 2D7TH 2DQEL 1ZHKB 4FS0A 5AWNH 2HLAA 1ERNA 4DN4L 3NCYS 1NCUA 5MEQA 4G8IA 3GZKA 5GRXG 4K07A 5KSBB 2UWEF 4P3DB 3WCYA 5MEOA 3TEUA 3BP4A 4DGYL 3GFUA 3DVGB 3HZYB 3SBWA 2DBLH 2PR4H 4NP4L 4UT6L 5I9QC 5T5FL 3CK0H 5JDJA 1BWWA 4MX7A 1IC5L 1GGCH 4XMPL 3PABB 5A16A 4ZSOA 1CI5A 3V2AR 4KXZH 1ZTXH 2ZCLH 2ED8A 4RAVA 4WFFE 2B0SL 1Q0YL 5C0CB 3T4YB 5GS0H 5TQ0L 1R3HB 1A6VL 4ODSH 4AH2B 3KLHC 5ESQB 4AIZB 3UTTA 3WFBH 2NTFB 3PQYE 3MODH 3RAJL 5KW9H 1A2YA 3NZ8A 5FA4B 3IS0X 2XQBH 2EIBA 5C9JA 4OLZH 3IAQA 4J3UA 4LPYA 4OF3A 2BNUA 4LSRH 3UTPE 3KLHD 4JB9L 3BVNA 1MELA 3F7RA 2AABL 4C56D 5TF0A 1S7RA 4P4KA 2DYPA 3QUZA 5GRVK 5CEZH 4TSCH 4FN0A 5HYSG 4RAUA 5FA3A 3CMOH 3BPNC 3MXVL 3NA4A 1KIPB 2ZKHL 3NIGF 1A7NL 4HF5H 3EYQC 4AMKH 3GSWB 3ECBA 4IM8A 4WWKA 2I9LA 1BAFL 1A9BB 2Y5TA 4Q7DA 4TNVF 4D9QD 1CDJA 3THMH 3RL2A 3C6LB 3D5OF 3LDBB 3DX7B 4WI4A 2IAMB 3SDXB 1XR9A 1NCWH 3DIFB 1PEWA 1RZGA 4XP5H 3E1F1 5CZXC 1XF3B 1OCWH 5H8DA 4OZFH 2VQ1A 2XPGB 1IM9A 4PLOB 3EYQD 3V0WL 4OI9A 5TF1H 5D2NC 4MB3A 1RUML 5E70A 2CK0L 4HZLA 1JV5A 2Q20A 3J7HA 1NAMB 5E5MA 4YHYB 1KTDA 2CLRB 4R6UA 4M7KH 1QLFA 1C5BL 5KAQG 3W5MA 3D0LB 3PWVA 4PRIB 4N1EA 2HJFA 1FC1A 4HFUL 1NANH 5JHDA 1T1WA 1T5XA 4CMHB 1EHXA 5CZXD 5IEKB 3MFFB 4L8CA 1D6VL 4MD5B 4F2MB 1YMHA 2ZPKL 4OZFB 4EI6A 2HWZH 2Q7YB 4XCEA 5TFSH 5IGXH 3JV4A 1CS6A 1OAYH 1EHAA 1WGOA 1QHOA 3SDYH 4KC3B 4N9GA 5ID1A 1PY9A 1J8HA 2PO6C 2E5EA 1LK2B 1BQLL 5E2UH 4X6BB 3AS3A 1HH9B 4JFZL 3WN5B 1WFTA 4IHOB 4HCRA 4UTAL 5ADPH 3SN6N 4LCWD 2X89A 1YNKL 5ICYA 4FOMA 2WP3T 3I50H 5ISZB 1EGJA 1H3PL 1MI5D 3T65B 15C8L 3ZKXB 3B4NA 2WQ8A 2VLRA 4YBHA 4CW1A 3MUGB 2PO6D 3AXLB 5TH2A 1KEMH 1WT5A 4XX1E 1J0IA 5EU6E 2V5TA 3I85A 4UINL 2AQ1A 5C1MB 2A77H 4RQQA 3P4NA 1S5HB 1BQHB 3HG1A 3KPSD 4O2CB 4OGAC 4X0KA 4GW4B 4MXQC 3VWJC 5DD3L 4FZ8H 5I8CA 4I18B 4LNRA 4OAWA 1M4KA 2ZUSA 2DRUA 1AHWC 4NC2B 4WDIA 1WAAE 4YJZL 3WYRA 4KRNA 4LU5H 5D2LA 2IANB 3SKJH 3BDBA 5EU4B 3H9SB 3X12A 1FV1B 5F6HI 4OGAD 5AUMA 4MXQD 3VWJD 3MLRL 5I71B 5CMAB 4XNZB 4IIQB 1L6XA 4KQ3L 1B0GA 1Q9LB 2FIKA 1E4WH 4GS7B 2VLLA 4W68A 4XB8A 4LVOB 1RMFL 3LQZB 4Y2DC 3UYOD 3OAUL 4M62H 3LV3B 5AD0B 4U1SB 2R56H 3FRPA 4QRPE 4L4TE 1V3JA 2UY7A 4J3OC 5IJVB 2B2XH 3O81A 2WWKO 3V0VA 2EO1A 3AC0A 1XF2A 1FNHA 1UB5B 3PJSA 4IRZL 5I1IH 5KSVB 1ZT7B 4JDZA 1K85A 4Y2DD 4S1RL 2XA8L 4JJ5B 3U9UB 1DBKH 1S9WB 1ZHNA 4LFHG 1FNGA 3QEHB 5D9SB 1N5AB 1U8IB 4AT6B 3MXWL 3RUGA 4MNQE 5BV7L 1I9IL 4WI9A 3HC3L 1JPTH 4PJHB 3QG6A 4K3JH 4AEIL 3IRZA 2FHFA 4OCLC 1JZ7A 3SGKA 2OXHA 5IHZB 1L6ZA 5D7IF 1J0KA 5AYUL 1WQVT 5LCVH 4XPGH 2BC4B 3OB0H 3QNXA 4JY4A 4MJIB 4M8QA 4PJCB 5DK2B 5I19H 3HA0A 4QYOA 4HKJA 1NFKA 4HG4K 3VD4A 2OI9C 5IIEB 1U3HA 4PBXA 5C07D 1IM3A 1A7OL 1MFBH 1AQKL 4TTGA 5F7EL 1EPFA 2F53D 1B0RB 1PW3A 2PYEB 4I9WD 4BH7B 2HVJA 3D39A 4P4RB 2F8VA 2XIDA 2DB8A 4EN3A 1KUMA 1Z5LB 5F21B 3W9DB 4IOSD 3HPLA 1MFCL 3VXTB 3FT3B 2EDDA 1MWAH 3MV8E 1Z6JT 4X6CE 2OJZL 4OCRH 5HD8C 3ZYOA 5BXFB 2YSSB 4J12A 3WIHL 1U91A 2W92A 1JHTB 5DHXB 5B38B 3I75B 3BDYH 1C16A 2CR3A 4LKCB 1M7IB 1KLUB 4FXGA 4TNWK 2H32H 4CL7A 4OZIB 4NQXB 4P57B 5JR1L 2EH7H 1RZKC 1VFMA 5F96L 5DDHB 1CE6A 3BP5A 2WSKA 1LD9A 5BOZG 2JELL 1OD9A 3TIEA 5HD8D 4X7CC 3VXRD 4ZAKB 5LVEA 3EYOA 1F11B 1MWAB 2IQ9H 1WWAX 1T66C 1AH1A 4OLVH 1XZ0B 2QJDA 4PP1C 2BHZA 2W0FA 1QFUL 1XF5A 2D31A 2YRLA 3PQYA 5HYQA 4JZJC 3CFJA 1S7TB 3X3GL 1U9KA 4LCWE 5LWYL 4PJBF 1GZPB 3NACL 5GGQH 2H32B 4R0LB 1DBML 3MNVB 5CWSA 4JVWA 5ANME 3LRSA 5F7DB 4UB0L 5GJTL 2XWJA 3QG7H 5JDSB 4PJIF 1CGSL 1A9EA 5ESAB 3QEUB 1T66D 3LN9A 5I1KL 3KPLB 4PP1D 4EDXA 4BZ1H 3VFGL 4PJAF 3U7WL 4WEBH 4PRNB 5F8RC 1FRGL 3UPRB 4OZ4A 3B8SA 1QSED 3CX5K 5C0AD 5IVNA 5I75C 4KTDL 4PJ7E 5DRWA 3SO5A 1VPOL 4HIJB 4UZGA 3GMQA 2OQJA 4XCYA 4YO0B 4NOBA 4OTXH 1A7PL 5IT2H 4I48A 1CVRA 3O41A 3RPIA 1WFNA 3GB7A 1KC5L 1MCPL 3F7YA 4ZQKB 1VFAA 4MJ4A 1FYTD 4PJGE 4UOW1 1RJZA 4KUZH 5HPMB 2WWKT 3M8OH 4JPIB 1XEDA 3N50A 4G9DB 1TQBC 1DEDA 2VE6A 1X3DA 5F1NB 3QULA 1TVBB 3JTTA 1ZT1A 1JGLH 3MLVL 5JW3H 3QXDA 4LMQI 5CUSH 3W9EA 2G5BA 5K9QI 2E7LA 4G6KL 4AL8L 1T03L 4QXGH 3GNML 2DQTL 2GSGB 3VXQA 3ZT7A 1NC2B 3ZDYE 3KR3L 4OKVA 4GXUM 2GTWB 3OL2A 1OAQL 1R5IB 4YBLC 5C8JA 1OOAA 3FT4A 1BF2A 4JO1L 1AD9B 2PTTB 4ZPVA 5FYLD 3FQUA 1M7DA 4MB4A 4M03A 1FDLH 2E7BA 3QFDA 1AJ7H 2C3HA 5SWSD 4UIMA 3PGFH 4WCYH 2YD3A 4MA1B 1KTLA 3EYVA 4Z7VF 3HUJF 5CAYB 2IFGA 5EU3A 4GAFB 2MNUA 3OAZH 3UTQB 5LXGL 1ZA3B 4QRQB 5F6HJ 2GITA 4RSVA 4PY7A 1QSVA 4RX4D 3I9GH 5EU6A 5J7CC 3GSNH 3REWB 5KJRH 5DJYA 1QKZL 3HKFA 3BH9B 2PXYA 3CXHJ 3WKML 5JORB 2AGJH 3NCJL 3B9VA 5GSVB 4DZ8B 3CC5A 4Z78A 1OGTA 1BFOA 3UYPA 4HJ0C 2NY2C 5GRVL 4MAUL 5ITFB 4OM0H 5C07E 3M1BA 3FO0H 3IF1A 3B2UD 1NKOA 2I5YL 5F9WC 3TO4B 5B8CC 1WAAA 3TVMA 3VFRB 4LRIA 1CG9B 3OHXA 1O7SA 4FTVD 1RK0B 1KB9J 2AV1B 3VFVA 5JZ7C 5IESH 3KVQA 1T4KB 3L3GB 5JA8B 3MRDB 1ZLVK 4HJ0D 4ZOEA 4KU1A 2NY2D 4W81A 5JW4N 1DVFB 4PJ5D 1V7ML 4YUEH 1ZT4B 4KI5C 4XVJL 4L4JA 4LCYA 4EI5A 3TO2B 4H5SB 3RVWC 3IKKA 3MLXL 3Q1SH 4JRXD 3HC4H 4HIHB 1RHHB 2NY4B 4MZ3A 5F7UA 2VLMD 3RVXC 4H88L 4WI6A 3WLBA 1AC6A 1ZLWK 5JZ7D 3QO0A 2AXFA 4M6OH 1J9CT 4PGEB 1XGYL 4U33A 1SJEB 43C9A 3BZDA 2EYRB 4QRPA 2A74B 3VXRE 4LSVL 4L4TA 4KI5D 2FJGA 3SDCC 3HE6A 1HHGB 1D5ZA 3HS0A 5IVXE 3RVWD 3FO9A 3NPSC 3FO2A 4R7NB 3TZVC 3MJ7B 3MZGB 3RVXD 4KI5F 5D1QA 4XZUA 1LP9E 1INDL 3WFDH 3P3YA 4YFEA 2DLFH 5MEND 3SQOH 1A0QH 5IMOB 1F13A 3O0RL 2VDLL 3VG9B 2BVEA 4NQCE 1T0MA 3SDCD 2X1XR 5C0FB 4MNQA 5IM7B 2BCKB 4R2GD 1T7ZA 3EYSL 3RI5F 4M3KB 3TZVD 1U36A 4L4VB 1AI1H 4FXLA 5E6YA 3B43A 2QHRL 5EUOE 2OBGA 1CDHA 4M1DH 1HXMA 4Q0XL 3PWLB 1NGZA 2AJZB 5J13C 1IFHH 5FO9B 2YK1L 3C8DA 2IH3A 3AAZA 3LKQB 5FUZL 3NFPA 5FGBC 4WY7L 3KYNA 3MRGB 2QHLA 1OD7A 4PJFF 5FCUL 2AK1H 5B39A 4Y19D 3EUUA 3V52L 5F7LB 2ICEB 3QO1B 2BMKA 3WSQL 1FL6A 2BVQB 1QNZL 2X1WL 3WIIH 3AROA 4PRPE 4M4PA 1M6OA 3DVIA 1FYTE 1JCKA 4L8SA 3V7AG 2HT4C 4DW2L 2CD0A 4P9ML 3KYAA 1NMCB 32C2A 1WBZB 1GGBL 4JPWL 4UT7H 3G5VB 4OF8A 2J8OA 2JB5L 3MV8A 4X6CA 3PG2A 3HPJB 4OLWH 2ITCB 2XTJE 3GMMB 4ODXB 5BJTA 5FO8B 3PL6A 2C3XA 2HT4D 2YN3A 3OKNA 1LQSR 2R0LL 4YHML 5IB4B 4CADB 3JWDL 4IJ3C 4YAQA 4PJDF 4OUUA 4GXUN 4RMWA 4UDTB 3CPLA 4BQ8A 3O8XB 4XAWH 1NCAL 2A38A 1ZSDA 3MBXL 4G8GE 1RIVH 2MCPL 3PP4L 4GXVL 1HNGA 2HJKA 2FB4L 1MJ8L 4A2MA 4EXKA 3QIUA 1CLOL 1KB5A 3B9EA 1LO0L 3HLAB 2OJEA 2MKLC 3EO0A 4YIQB 3QZWB 1NGWB 2H3NB 3DRQB 3UYRH 2Z4QA 4WI8A 2C9AA 5ICXB 3BW9B 2ARJQ 5ANMA 5E1AB 3SKNA 5F70A 3X11A 1OF2B 4MB5A 2CQVA 3X17A 4YR6B 1K9TA 4UBDC 5I30L 3QQ3A 2K7PA 4Z7WE 1G7PB 2OXGA 5JLZA 1OSPL 4RFNB 4HH9A 5HHOB 3S8WA 4HKBA 1QBML 1DQQA 4PJ7A 4K3DL 3QQ9C 1FH5H 4P2RB 3VG0H 1WEJL 1TCMA 5HDLA 5FYJH 1MFEL 3AS0A 4UBDD 5MERB 1Q94B 4DZBB 4AEHL 5C6TH 4ALAH 5FUCE 3K4ZA 1XGUA 1AXTL 2NW3A 5C0JA 2EC8A 2HG5B 3KXFE 3VW3L 2FEEL 3H0TB 4FQCH 2A83A 1YEIL 4RBPK 5GGTH 4AQ1B 3OV6A 3QQ9D 4PJGA 3BPCB 1T22B 3GSXB 3NFSL 3KJ4C 1RZFH 1U58A 5ADOL 4ZPTB 2V6HA 3OMZA 3QFJB 5ITBL 4BK4A 4X99B 5EWIL 1TVDA 2LVEA 2NY1B 3CZFA 5E5UB 3GGWB 4M7LL 1Z3GH 3RY6A 1NCCH 2GK0A 4QTIL 5EU7C 3D0VB 1QEWB 1L4IA 3DBXA 1JYVA 1TCRB 2M2DA 5IB2B 4J6RH 4D2NA 3BKML 4YZFE 4GAYB 2LAGB 3VD7A 4RGNB 3D18B 1INQB 1UFUA 1U8MB 1YDPB 3OF6A 4KKAC 3RX7A 3ROOB 4FQ1H 3JWOH 5I18L 2NW2B 2VWEC 3ZZ1A 4HK0A 2AXGA 2DJUA 3BKCH 1E4XI 3ARRA 3QUYB 1RJLB 3RHWF 2NNAA 1GL4B 1FORL 1R3JB 2IBZX 4OQTL 3MRJA 4LDLB 1X5JA 4ONHA 5GRWA 1KBGH 4CBPA 3VXSD 3BXNA 4OZHF 4KKAD 4X7DC 4DOHE 2COQA 2VN4A 1CXLA 3L3DA 5GGSA 3OTTA 4DKEH 3LPWA 4XWGL 5GGVL 1QRND 4Y0GA 1HILA 4GKZA 5AAWA 1G0DA 3R06B 4BYHA 4MAYC 1I1YA 3N1FC 4EUPH 5L8KB 3OAYH 2NY6C 1DBAH 4TTDC 3JV6A 3ULSB 1B4RA 1UACL 2FD6H 1BVLA 4X7TB 3V5HA 3AMKA 3ARWA 3CFDA 2IADB 4FABH 2JK5B 4IRJB 4NHUA 5DC9B 2Q8AH 1FAIL 1MFDL 1M71A 1OB1A 2AQ2A 1F3JA 2OCFD 5BCAA 1EH9A 5FYKL 3LQAC 3QI9A 3C60B 2DBJA 1NGQH 4TVPH 4K8RC 4MAYD 5F93C 2XZCH 1BZQK 5I8OH 2VR5A 3UJIH 2NY6D 3DXAD 4QF1A 4TTDD 3ILPB 1F4XH 3T8XA 4U31A 1P84K 1CDIA 3DURA 4EUPB 1LEGB 2BXYA 4HX1A 3UROR 3O6LL 4M7ZB 5SWZB 3G5YA 1N59B 1CT8B 4NWUH 1I7TA 3ALPA 5KSAA 4KZEL 4Z6AT 2RFXB 1FE8L 2ARJA 4K8RD 2VSDA 4XPFH 3GSQA 4XCCL 1NBYA 4O4YH 1T21B 4YXLH 1MJ7H 2X9YA 1NJ9A 3BKYH 4NZTH 3TA3C 4GRMA 1U3YA 4XNMA 2X4PA 4Y8DC 4QHKI 4HIEA 5EOCL 4A6YL 3MR9A 4V2CB 5GGRB 3VXRA 2WUBL 1HHJA 2EC9U 5IVXA 1KXVC 2IQAA 1EFXA 4TPRL 1QYGH 4OFVA 4RWHA 3BH8A 2I27N 1BIIA 1Q9OA 4XXCA 1C08A 4Y4KB 1JZ2A 3MRBB 1KJVA 2EKSA 1LP9A 4NQDD 3SGEH 3WLWC 3DGCR 3TA3D 4PGDA 4X7FC 4XVTL 1VENA 4JRYB 4P2QD 4NQCA 1UXSA 5DC0A 4P46A 4PB9H 5C86A 5A2JH 4ACPA 2VITA 4YFDB 1OARH 4QRSB 3V5DB 2NX5E 5HHPA 3TNNA 2JCCB 5BZWB 2HRPL 2VLKB 4WW1B 3GBNL 1IGFH 1XCTB 2R2HA 2W9EL 4YDKH 5EUOA 5CEXB 5L8JB 3UPAA 1H8NA 4HBCL 5CIPH 5IK3B 2YWZA 3WLWD 5JXAH 1CICC 2BZDA 4U1MA 5E8PA 1KPVB 2V2TA 3QDGD 4G6FD 3V9FA 5C08B 1INEH 3WUWG 4X8XA 5C70A 1S9VB 3P77A 4I0PC 4M6NL 3HAEH 4ZTOH 3O2VL 3CFCL 4IRSC 1BD2E 3VFWA 3VWKB 4L5FH 4XBGA 2BOCA 3C09C 2O93L 4QHMA 3H3KA 4YWGH 5HHXL 4PRPA 3PE9A 3M45A 1RVFH 1CICD 1EO8L 3E8UL 2FJFB 2ZCHH 1ZWIA 5CIPB 1XR8B 4WV1A 1MHPH 2BRRH 2DQUL 1ZAGA 5EC1B 3LCYA 4I0PD 3TBSB 4IRSD 3DO7B 5DJXB 3LSOA 1I9EA 4G42A 3HAEB 1YMMB 1YJDH 4HJJL 2FECI 1PLGH 4QXUL 1JTOA 4TN9A 4EOWH 1DBJL 5DURD 2L7JA 3NOIA 1MSPA 3AREB 2C1OB 2DI8A 1DQJB 2XZZA 4P5KA 4NO0D 1EMTL 2Z93B 4OCXL 3E3QC 4ODHL 4BFIB 4UI2A 5FK9B 1C5CH 3VXMD 2B8OT 4XP1L 1PYWB 2HLAB 4G8GA 1IAOA 3QEGH 1JZ5A 4P9HL 2DLTA 4LL9A 3W0WE 2ITDA 3BP4B 4PJ8B 3INUL 2G75A 1B2WH 3VFPB 4K3GA 1YEFH 2OS7A 3W5NA 3SEPA 3VXOA 1FO0B 3LRHA 2XNAA 1UCTA 2R1YB 5A16B 2Y36L 3G6DH 4ZSOB 5LGHL 1M1SA 3ARUA 3VCLA 2GEEA 1ZHBB 3L7FA 4RAVB 3MO1A 3BD3A 4XGZA 2VZ1A 4JFDE 3RA7H 1NSNH 2UZXB 4Z7WA 1N4XH 3GHEL 4HUMB 1ZTXL 3BEVA 5EPMA 4RWYL 5GS0L 5F7MC 1WWBX 2VZVA 3NZ8B 5L88H 4LHUA 4POUB 3AM8C 5C9JB 1RZ7L 1XGQB 4M43H 4U7KA 1WSST 3OAZK 6FABH 1ZVYA 4JFEE 3BVNB 5IR1A 5CBAA 2XQBL 4FQPA 4XBPA 1NLBL 2CRIA 3MA7A 1DN0A 1I1AC 4JREB 3KXFA 3C9NA 4LSRL 5KVFH 1W72L 1S7RB 3QUZB 2FZ3B 1RSFA 2E6PA 5D1XA 4PRBB 4RAUB 5MHSE 4K7FA 4Y5YC 1YUHB 4J4PA 1ETZA 3ECBB 4P99A 4KDTC 2YPVH 4JR9L 3IDMA 4W6WB 4WVRA 3F12B 4Y4FA 1D7FA 2Y5TB 4KHTL 3RNKA 1GZQB 4QT5A 5E24E 1CZ8L 1I1AD 2K3TA 2P5ED 1NAML 3WFHB 2Y5EA 1U0QA 4LLQB 2P4AB 5EUKA 1SEBB 2VQ1B 3TN0C 2VL5B 4NNXA 2NMSA 3ZE1E 1JGDA 2L0DA 1HH6A 1EHLH 2VAAB 4CU7A 1NMAH 4PY8J 3PWVB 1EEZA 3F7VB 4KQ4H 5IFJA 2HJFB 1CFNB 4L9LA 1N6UA 3QA3B 4NCC1 1BX2B 1T5XB 4ELMB 4LQFH 3TN0D 1IAIM 5E6IA 3VGFA 3KGRA 2DICA 3C2AL 4NFCA 4AK1A 3CDGA 3SQBA 4YXHH 3JV4B 1MLBA 3ARDA 4PGZA 4JM2C 1FJ1A 4U2YA 5DJ0A 2CLVA 1T1ZB 3U1SH 4CVZA 3MGTB 4N9GB 1BM3H 1L7IH 4M4RA 4CN1A 5K9QG 4K71C 3QDGE 2ICWJ 3U48A 3QXTA 3OXRA 4PJEE 2LQRA 1QR4A 4L8DA 1CF8H 3MJGX 5EDXA 1E6JL 1IGYA 2GK2A 4LSDA 3D25A