1RIHH

Crystal structure of fab 14f7, a unique anti-tumor antibody specific for n-glycolyl gm3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
227
structure length
221
Chain Sequence
QVQLQQSGNELAKPGASMKMSCRASGYSFTSYWIHWLKQRPDQGLEWIGYIDPATAYTESNQKFKDKAILTADRSSNTAFMYLNSLTSEDSAVYYCARESPRLRRGIYYYAMDYWGQGTTVTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Molecular Interactions of a Unique Antitumor Antibody Specific for N-Glycolyl GM3.
pubmed doi rcsb
molecule tags Immune system
molecule keywords light chain of antibody 14F7
total genus 44
structure length 221
sequence length 227
ec nomenclature
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rihH02
3WN5C 4ZTOL 4J1UB 5L88L 3EOTL 5C7XH 5D5MA 1NLBH 4RISL 4XBEL 1H15A 3ZT5A 1OTTD 1EH9A 2YRZA 1P5UA 3CVIH 5J11B 3OHXA 3RWJA 1WIOA 4MB5A 2J88L 3MLWH 4ELME 4JCMA 4XPGH 4DQOH 4EDXA 2CK0L 5DK0B 2CLZB 2DIJA 4OZ4A 3G5VB 3QDJD 5IHLB 4OCSL 3MLVL 3JVGA 3KXFE 3BUYB 5K59E 2WSKA 3QRFM 2QJDA 5JQHC 4UQ3B 3MRCB 4G9DA 1YNKL 5IW3A 1LE5A 5EH1A 5HI4D 3VXUB 4X6DE 1A21A 5MI0C 3BKCL 5T1KD 5IMLB 4U1JB 4HD9A 3I9GH 1NFDE 4XMKH 4U0QB 4QF1A 5I1HH 3MRGB 3RQ3A 3KYKL 1SJHA 1MCRA 4YPJA 3UTTA 3HAEB 2P43B 3OAUH 4TTGA 3FAWA 1DBJL 1W0VB 3HNSH 4NZTH 3ZLQC 1GOFA 4M93B 3MRGA 4GLRH 4BFBD 5E5RB 5I17A 1QR1B 5D7IB 4M03A 1MF2H 1HH6A 3G04B 3WFDL 15C8H 3O6LH 4YHNB 1AQKL 3LKRA 3TZVD 1QBMH 2V5YA 1XGYL 3L6FB 3QDMA 3NA9H 2CDEB 4U33A 3EO1B 3C6LA 2H2SC 4XHJD 1T6VN 3DROB 2FH8A 3RDTD 3TYFA 5ITFB 1R0AH 2RIKA 3BVNB 3CX2A 3MSPA 5HHQA 3C5ZA 2ED9A 4RA3A 2Z0BA 4TQEL 4ZNEA 4Y5VC 4GAJL 5IT2H 2XTJB 5B8CC 3G5ZB 5DQJA 4OTXL 3RHWF 5KVEL 4PJAA 2ZUYA 4P9HH 3GMPB 2PXYC 5MI0B 1JNHA 3E3QC 3UTPE 1JRHL 5C0JB 5KTEL 1ZGLP 5TDOA 1T89A 4QHMB 2CO6B 1H3PH 4OFVA 4HUKB 3REVA 1NSNH 4MA7H 4PTUA 2YBRA 4JFDD 1CLZL 1ZA6A 3DRTB 3KYKH 4P3DA 5GRZA 1RZIA 3DTXB 4FFYH 3GRWH 2VZOA 1NCBL 3D25A 4AY0A 1XH3A 3FQNA 1JPSL 4LIQL 1IEAA 2L7JA 7FABL 3DUUB 3C60C 1CDBA 1BFTA 3EO9L 3FT2B 3JTTA 3WXVL 4RMWA 3GI8H 1V7NH 4Y4FD 1OB1B 3DMMD 1B4RA 1LDPL 4E42A 4CVZA 4Y5XA 1A02N 2YWYA 2NYYD 3PWPB 2VOTA 4BJLA 2CJUH 1EXUB 2BCKB 4HDIA 1NLBL 2JJVA 4HKZA 4P2RB 1AXTL 3FRPG 4YH6A 5GJSL 1NMCC 4Z7WF 3TIDB 5J3HC 3QNYA 4KDTA 5AYUH 1XT5A 5F9JA 2EDYA 3F7VB 4QF1B 5DI8A 1I9RH 2Y72A 2XRAH 2D7NA 3HLAA 4P2OD 2AV1B 5AAMA 4Z7OF 5CHNA 4AT6A 4DN4L 4Y89A 3EZ8A 4QRPA 4JKMA 5ELIA 2FHBA 5I6XC 3F7VA 2JJTC 1RZGA 4QHNA 2XA3A 5DI8B 4YXLL 5JXEA 3BP7B 2RFXB 5KN5B 5T1KA 4FMKA 1WV7T 5ADOH 1F6FB 5DVMA 3DX9B 3RVUC 4MHHG 5KJRL 4TOYL 4H0GA 2CLVA 4NQEE 4YNYB 4Z0XA 4N9GB 4HS3A 4LQFH 4S1SL 5FUCC 4M7LL 4M00A 2CDEA 3NN8A 2ERJB 1AIFA 1U3HC 1MAMH 4LCCC 3BAEL 2NY1C 4P2QE 1Y0LB 3JWDH 1QUNA 3OGCB 4BSJA 2WUCH 4FZ8H 3D0VB 3PL6D 3MTRA 4PP1C 1VEMA 1QACA 1CGVA 1J9CT 1NEZA 3FB5B 1XZ0B 2KDGA 3H9ZA 1YDPB 1IAMA 3MROB 5EFIA 5FCSH 1L7IH 4HWBL 3HI1B 3VD9A 4FXKA 4AEFA 3RDTA 5E00A 2EIBA 1SBSL 3PP4H 5LGKA 1JPTH 5IVOA 2WWKT 5IJKA 2H1PH 4PTUB 5C0ND 4I3SH 1LWRA 3MA9H 1XIWA 3IDGB 4DOHB 1DQLH 1S9YB 1OARH 1GC1C 2BHUA 4MXQC 4AENB 1MRDL 2Z31B 1K8IB 5DTFB 5HYEA 4YHYC 4HXAL 3U1SH 2VUOA 4JGJA 4PRNA 3LSOA 2VR4A 1J05B 3QWRA 4TUJB 5I16A 1TNMA 2YPVH 1T83A 2X2YA 3L9RB 3KPRD 2OLDA 1XGUA 5F8RC 4PJGA 2F54D 2JJTA 3MJ6A 3EAKA 5F71A 3SDCC 1PAMA 1A6UL 2P1YA 3FN0H 4O2CB 8FABA 1L7TH 5KS9E 5EC2B 4Z78A 5KAQG 1XF1A 3JUYA 4PJGB 4RWYL 3NFPB 1AKJD 4UNTA 1KIRA 3T3PE 4P3CL 1A4JB 1UM4H 4TVPL 5E2TH 3L3GA 3HNVH 5E99H 2AS5M 1C5DB 3U0TA 2GKIA 1O5DT 1KB9J 2VMFA 1I8KA 3LD8C 4MXWH 4H1LG 1PKQB 3K0WA 3LB6D 3ULSA 5HI3C 2JJWA 5JQ6L 4X80H 3U48A 3GMLA 4NJAH 3OKEB 3B9KA 2IH3A 3JWDC 4F9LC 4HMDA 5INCA 2PW1A 1U93B 4PY7A 4RGNC 5IOPA 2VTFA 1A7NL 3OGOE 4LGRB 2DLHA 3TJEL 5GRUL 5T33H 2EIDA 2MKWA 4W4OC 4U3XA 2H41A 3HE7D 2VLRB 4KC3B 1RURL 5SWSB 4LL9A 3MOBL 4Y5YC 3QPXL 1AP2A 3NCJH 3GM0A 3WNLA 2E9BA 2A6DB 5EWIH 1YN7A 1T3FA 1LGVA 3W9DB 2X4UB 4LCWA 3W0WA 1ACYH 1MHPL 5D5MB 2CR6A 2DQCL 3K1DA 1DQML 3N9GL 1IM9A 5HD8C 2PNDA 1NBYA 1D5MA 3CMOH 1Q9KA 3EDEA 1QO3A 1VEOA 3RNKA 1DSFH 3GSUA 1J5OL 3C6LC 5GIRA 2ZSWB 2EH8L 2V17L 3SKOB 1SJHB 1DL7H 3WNKA 1S9YA 3V52H 1OLLA 3RWCB 1BFOA 1YQ2A 3ARXA 5EOCL 1YY9D 1NFDA 2AJZA 5DD6A 1GJIA 4UILL 1JNNL 3S37X 3DGGB 1OAUL 1RHHA 4XCCH 3ALWA 1UXWA 2EECA 1RU9L 1H3TA 3BHBB 3PP4L 4U1SA 4FMFA 4JY5L 4KDWA 2AI0H 4AYFA 4OCYL 3S97C 4UIKL 4XNYH 1EAJA 5ID1B 1KJ2B 5D71H 5JUEL 1SJEB 1MAJA 1U6AH 3KXFA 3DV6B 1OAQL 3RRQA 3MXWH 2XTJD 5ISZA 3WHE1 2EYSB 5T3ZD 2YK1H 3V8OA 1JTPA 1AC0A 1IGCH 5E4IA 5BO1L 3DVNA 3DIFA 1G9EA 1JPFA 3PWJA 4D9QE 4Y8DC 2GJ6D 5HDLA 3IDXH 1JPST 4NKDB 3NCFB 4NC0B 4PTTB 1RULL 1Q0YH 4F37K 1KCVL 4HSQA 3MBXH 4PYGA 1M6OB 1YMHA 4NIKB 2Z93A 2Z8VC 2LTQC 2Y23A 4EI5D 4JDVA 4BH8B 1KENH 1Z9LA 3UYPA 2YRLA 4ZUSB 4YXKL 4P3CH 4TVPH 5KVGH 1P7HL 1J8HE 3GMQB 1KN4H 1MCNA 3DX7A 5C2UB 4G42A 2EDLA 4MXWL 1GGTA 1MVUA 3TV3H 1K85A 3IFPB 1B4JH 3GSRB 3KS0J 5DMKA 5GISH 2ATPA 1XGTB 4PB9H 1R3LB 2AP2A 3LEYH 4Z9KB 4NO0A 4Z6AT 1MFNA 4HUMB 5DT1L 4P2OA 4F15C 5DMKB 2ZP0T 4EDXB 5D1ZD 3UJJL 1XGTA 3BYTA 4DFHA 4YK4C 1G7JB 2WIIA 4ZS7L 3RWHA 3U0WH 2ZUQB 4NWTL 5E5MB 1MRCL 4QTIL 3IXTA 2YPLB 3JV6A 3MFGB 3S36H 4OJFH 4PB0H 3LCYA 3GIZH 2EDFA 4QOKB 4FTVB 1HSAA 3I2CH 1FVCA 4NGHL 1RK1B 4JG0L 1UB6B 4KGLA 3RUGA 3GSXB 5LGHL 4OI7A 1I9RL 4KKAC 4DUVA 3FT4B 1DQLL 3TFKD 1YJDC 4JVPA 3C60A 1NGWA 5BW7C 3KVQA 1VFUA 4MZ3A 3VXOB 2WBKA 4EUPA 4FFWD 2H6PA 2P5WB 4Q6YA 4LF3B 5FUOL 1AHWB 1AI1H 2D3VA 2FL5B 3BE1L 4Y4HD 3BGAA 2BY1A 3PL6B 2AJXH 4NRXB 3UZEA 1ZOXA 5MEPA 5D6DC 5CSBA 3IF1A 1F3DJ 1LP9F 4NT6A 4X6BA 2YUWA 5DFVD 4TVPE 3ARDD 5CJXA 2C26A 4JFOB 3RTQA 3NIGE 1EHNA 3UC0H 4IRZH 3BEWA 4JR9L 4YHYB 3U30C 2EE2A 3A6CH 1CFQA 4TNWF 4HS8L 4GAYB 1E6OL 1A7RH 1FGNL 1U58B 3FFDB 3IFNH 3ZKND 3MZGB 5JHLL 4Q2ZA 5BQ7B 4ORGA 1D9KA 3JWOL 4LP5A 5L7XL 2I07A 3BYYA 2Z4QA 3KPOB 1G0XA 4OLZH 3Q5TA 2HFEB 5A1AA 4PJGF 1ZMYA 3MRNA 3QUZB 4JHZA 4XNMB 4GW1A 1P1ZB 4JFED 2J4WL 1BF8A 1EO8L 3SQOL 4I18B 3S4SA 1OAQH 5ILTH 3U7WH 1T1XB 3A0OA 2BMKA 4V2BA 2NY4C 1V7ML 3DV4B 4K3JH 4ZFGH 5D7JB 1REIA 4MMXC 1X5GA 5E8EB 5ACLA 4EOWL 1WBZB 2HJKA 2QQLL 4LLVB 3TCLA 1RJCA 5LBSL 4JHBA 4BSWB 4KK8D 4Q9BA 3DETD 1RK0A 2B2XH 2E9JA 2FJGB 4POUB 1EBPA 2AK1H 5C07A 4JKKA 5EIVA 1YJDH 3VGAB 4PG2A 5I15H 4P59L 3QHZH 5E8DL 3TC9A 5TDPB 4R0LA 1T1WB 4JM4H 4KROC 4XNXH 3BIBX 5DD0H 5GGUA 3SJVE 4ZO7A 1M7DA 15C8L 4LOUC 2ZCHH 1A7RL 4UDTA 4H5SB 4EDWH 3HMWH 3M17A 5J06A 4GFTB 1DDHB 1TVBB 2KQMA 1T03H 3K2UL 1BQHA 4ZS7H 4PJ5B 2D31A 3ZE0F 4HAGA 5TPWH 4L29B 1SYSB 1LEGA 3VFOA 5IVXB 3UO1H 4CVWA 3L3GB 1MHCB 4NQCE 5I75C 3ET9F 4EXPX 3DVGA 2CR3A 4XZUA 4NPYB 2MNUA 1U6AL 4PLNC 3UJJH 4PJFA 4OCYH 3KDMB 1JN6B 3VXSA 1UXSB 4N9GA 3WN5B 3SCMD 1YN7B 3HPLB 5EUKB 1TQCC 4X4YA 4GOSA 4CMHB 1DUZB 1RMFH 4IMKA 3QEUA 5DURD 1ZVSB 4W4NA 3KPSA 3CFKB 3ULUC 2G2RB 3RL1B 5SWSA 4YQXL 4HIEA 2O61A 4IS6A 4ISVA 2BVUA 1CD1B 3WLBA 4KVCH 3ULVH 4JO3L 1R5WB 1VKXA 1T1YB 4ZPVB 5J6GB 4JHWH 3BESR 1BFOB 4MQSB 3S35L 3U0PB 3OKMA 2CIIA 2R9HC 6FABH 3WFHB 4GT7A 1C7TA 3B2UD 3NGBB 3PWVA 2NY0B 4I0PC 1DZBA 1H3UA 3BN9C 3QO1B 2FIKB 1KELL 4OLWH 4XMKL 3C87A 3UTSB 3O11B 1ZS8B 3LEYL 1P7QD 4FQXB 3FRPA 3MJGX 3QEHA 1EO7A 2PUQT 5DMYA 2FYYA 3JV5A 4UUJA 3TV3L 2E27H 2IAND 4OFYD 1UJ3A 2OCFD 1IFHH 5C09A 4G8GD 5D7JC 4GKSA 4Y0GA 1V3KA 4XH2A 1FVEA 4X8JB 3UYRL 4DZBA 2CUMA 4OZFG 1KB5L 2CKNA 4NHUB 4PS4L 1TTUA 2XNAA 1RIVH 1GL4B 4OUOA 3EDDA 3MLPA 4TULH 3SBWA 2XICA 4M93C 1F3RB 2H2PD 2AQ1A 3FQTA 1A4KB 2ZUTA 1K4DA 3H3PH 4HT1H 3AS1A 3QQNA 3GMRA 3C5JB 1CFVH 3SQBA 1EMTH 5FF6A 1NJ9A 3I50H 3WO4B 2RQ8A 4IIQB 3O9WC 3OAUL 1I1YA 4RZCB 1T4KB 4H26B 1QP1A 1BECA 4AL8H 2GJZA 2HFGL 3MOQA 5DQJB 4ZQKA 4AQ1B 3VFWB 3QCVL 2BNRE 2YEZB 4X4YB 4DEPC 2HJFA 43CAA 3ZTNL 3F12B 3MUGA 3WKMH 1T04A 2NR6D 3QHZL 5TDNB 1UEYA 2AW2A 4LASL 1NFIB 4OLEA 1T20A 4JZJB 1BVLB 1W72H 5DHXB 2AJUH 4HIJA 2JE8A 4MNQB 2Q87A 2OQJB 2NTSP 4PRIA 1OW0C 1NCUA 1MCSA 1PZ5A 5CEZD 5B4MC 3WFEH 4LSQH 1D5MB 5C6TL 2XZZA 4XP1H 3U0PA 4RISH 3V5KB 3L1OH 4AG4H 1IEBB 4XPAH 3L95A 3DBXB 2DIAA 5C08B 5ALCH 1QTYT 5FUOH 5E6ZA 1G7JA 4N0RA 3VH8A 2V9QA 5E5MA 3DVIA 4UV7L 3QXDB 2R0KH 5FK9B 1DUYA 5ANMB 5I1LB 1A3LL 5F7EH 3NIFF 5D2NB 4PJBA 4QCIB 3NIDF 3B5HA 3RGVD 4TSAH 4APQD 5DEGA 2VDPL 5T1LA 4OD1L 1JWUB 4HJJL 2R1XB 5GS2H 1JHLH 1LVEA 5JW4M 1OSZA 5I8EA 3VWJB 1WFNA 5GHWH 1BP3B 1C5BH 1U95A 1XCQA 5DD5H 3VW3H 3D85A 1JN6A 2NY7L 4K23L 1MRFH 3DSNA 1EERB 3EYUH 1ZGLM 2WP3T 4ZMAT 2P44B 3D9AL 2OTUB 1U91A 2DWEA 4BK5A 3MA9L 4MD4B 1HHIA 3PV6A 3MRHB 5I8CB 1R5VB 3RTQC 5CEZL 5I15L 2EO9A 3TA3A 2ZKHH 1A6WL 5CBEA 1TIUA 1C08B 3D39E 4M4RA 3WNMA 3M45A 3F58H 4JZOB 3MRFB 4WY7H 3UP1A 4G3YH 2ESVB 3QA3B 3W2DH 2D03H 1MCLA 5HVGB 1UH3A 4AQOA 3D69B 1BD2E 1BWWA 4R7NB 2IANA 1OD7A 4ZAKC 1K3IA 3OAYH 1RZKH 2VLMD 4I2XB 3SDYL 1ZEAH 3U7AA 2JB5H 2RGSA 2ATPB 1FL3A 4BSWA 1NCWL 1F13A 2EE6A 3T0ED 1JHLL 4AL8L 5GS1B 1OHQA 3ZO0A 3MJ7B 4KGJA 3RZCA 4N90D 2E9IA 1FYTA 1L0QA 3DV4A 2H3NB 5F1OB 2YN3A 5T5FH 3MRQB 3I50L 2Z9TA 3CSYB 4WU5A 5IM7B 3W9EB 4OB5H 4BZYA 2DIBA 2DL9A 5DGRA 4XCNA 5I8OL 3PIQB 1UEMA 2XNAB 1DDHA 1TVBA 4P5KB 1ZLVK 2HFFB 3MV7D 1HSAB 1BM3H 4ZUTA 1PKQE 5LGJA 1IKNA 3CXDH 1UB6A 2NQCA 1E28A 4NZRL 1G1CA 3QFJE 2FRGP 3GMRB 4C58B 5HVHC 1DBKH 4OZGE 1FNGB 2W65B 4TNWK 1H8NA 4XCYA 2GTWA 2EDQA 3HCVB 3WXWL 4OT1H 1FV1B 4JPIB 3U46B 5GRVK 4KMQA 4JN1H 1E4KC 1JMXA 4OGAD 4OZIE 3VRIB 3VG0L 1MWAL 5GSVB 3D2UB 3TVMA 5DUBA 3OXRB 4OM0H 2DQGH 4JQVC 4ZTPL 4ZQKB 1MJ8H 4HV8A 4GMTL 3RAJL 2OI9B 4A6YH 5TFSL 3QIWA 4JANB 4OZHE 3RGVA 4JFQB 1B0WA 1NGZB 4OAWA 4ZAKA 4GUPA 4N8CL 4A6YA 4ZS6D 4D0BB 3FB7B 5SWZD 4PLKD 1P53A 3ZT7A 2BOCA 4KAQL 4KPHH 5FYKL 3PQYE 2L7UA 3O2DH 4UT9L 4LSRL 3MODL 4X7TA 4HIHB 1KXVC 3B9KD 5J89A 4XHJC 3BP5B 2PTTB 4KVCL 3FB5A 3MFFB 4PJDB 3RHWK 12E8L 2E7LC 1FORH 3AAZA 1G6RH 1HH9B 3H9YA 4XCCL 5D71L 5JUEH 1EXUA 2BCKA 2VLJA 4Y19D 5F7YC 4GG6E 2BNRA 3FT3B 4CDHA 3MLZH 1T7YA 2ED7A 4P4RB 1T1XA 1JZ3A 5DJ6A 1I4FA 4UB0H 3QXVA 3FN9A 4XXCC 1ONQA 3UDWA 4Z7WA 2EIEA 1R3HA 3BH8B 1SJXA 4MA3B 5CBAB 5J4MA 5GS0C 1TZGL 4KY1H 4R97B 3QG7L 2CIKB 4UV4H 4ZSOB 1J88A 5EG6C 3U9PL 3MRBA 1X4ZA 3TN0C 3TT1H 3WUWA 4Y2DB 1CBVL 1DEDA 5GS0D 1U8IB 2CRYA 1H3PL 1N0LA 3IRZA 3L5WA 5DFVC 1HDMA 5TF1H 3DRQB 2Q6WB 4R0LB 1CD8A 4RSVA 3TPKA 1FBIL 3VXNA 4WWKD 1QR1A 3HE6B 3QIUA 3VGEA 1FDLH 5FV1L 5LGJB 2QKIB 1R5VA 2F53B 5D7LA 4Z76B 5AZEL 4HH9A 1JGLL 1RIHH 4XPHL 3QB7C 1MFDH 4X8XA 2F15A 3K4DA 4NM4L 4OCSH 1FE8H 3MLVH 3K46A 1A7QL 1OF2B 4HXBL 2PETA 1XF2B 1VADB 3MYJA 1ZLUK 1VA9A 3F7PC 1JNLH 1JPFB 1U58A 4LRNH 4JY6A 4N8PA 3DSFH 4J7RA 4NKIL 5IFAH 2COQA 1HZHL 4JM2D 3IU3A 5HY9B 4Q9CA 1B6DA 3A67H 2YEZA 2AJYH 3VXTB 3O3AB 1DBAL 2B4CH 4HUXA 4U05A 3RI5F 2DQEH 4QKXB 3EKCA 3FCTA 4QXUH 5IHUL 4K7PY 1VFBA 2J88H 5EZLA 4GAFB 4RQQB 2DB8A 2FD6H 4L4VE 5A2KH 1QEWB 1ZLUH 3UTQB 1HQ4B 4YX2H 4EN3A 3GMQA 1HINH 4GLRI 4UNUA 4ZOAA 4G7YH 5GS0L 3QPQC 2PF6A 3F7RA 5FECB 1INQA 3LKQB 4JQIH 4PLKC 4IS6B 5C0DA 4CUCA 3B4NA 2PTTA 4L9DA 5DD3L 4GKZB 2AQ3A 3DJ9A 5AZ2L 3AAZB 3CFDA 3DURB 1I7RA 4PRHA 2XACC 4WU5B 3BUYA 5IM7A 5IMOA 3PE9A 4P2OB 5KOMC 2V5TA 3BWUC 4MNQA 5KW9L 4RGND 1CE6A 2ZNWA 4X7DC 1RZKL 2ADFL 5IGXH 5KOVC 2DM3A 3IXTB 1CR9L 1BJ1H 5JR1H 4ZUUA 1HHKB 4LPYA 1YEIH 1TQBB 1XF4B 4RGNE 3RVXD 3TIEA 3MLXL 2YA2A 5IJKC 1KXQE 3P0YH 3TJHD 3QJFB 1M1SA 4LLQB 4HIXH 3FQUA 3D3VA 1LEGB 5M94B 2QQLH 1W0VA 5TQ0L 2PYEA 3EYVB 1X6NA 3IKCB 5DXWA 1UWXH 2EC9U 4XNUL 1FVDA 4QHKI 2X4SB 3CFEA 1NAKL 4ODTH 1X7QA 4E0RB 4NKMB 1QA9B 3EFFB 3F7YB 4WNQA 4LF3A 3HZMB 1CCZA 1D5XB 2V2TB 1NGZA 3BDBA 4WUKH 1FO0B 5ERWB 4LKCA 4MA8L 1AD0B 1KTDB 3HUJB 4OLZL 5F7KC 2XV6B 3VFSA 4NN6C 4JPWL 3RL1A 4X7TB 1CFNB 2AJSH 4JFOA 2JB5L 5CMAA 2CLZA 4OJFL 3S96B 1WWWX 3Q5OA 5C0NC 3FB6B 3V4UL 5D9SA 5D7LD 3GIVB 3VFUB 2CKBL 4LLUA 1YNTA 1I1AD 1OTUC 4ALAL 1I8IB 4Y16D 1G9NC 5L8JB 4Y88A 4M8QA 5ALBH 4C56B 4YXHL 5EA0H 2GJJA 2O26U 2AK4E 2ILLA 4RBPK 4DGYH 5EU6E 3HAEH 3QUZA 1QLEH 5H8DA 1OTUD 4E5XB 1ZS8A 5D2LB 5AWNL 4KJQD 2GUOB 3KYNB 4O2EA 4DGIL 3FO2B 3AMKA 4GKZA 4HKJB 5FCUL 1XGYH 1K8DB 4LLMA 3MRBB 4KHXL 4J3XA 1TTGA 2BY3A 2BVYA 5I1DA 3JSSA 2IBZY 2QQNL 35C8L 3BX7C 3WJJC 1JV5B 1N6UA 4QYOA 4I3RH 4O4YL 2C1PA 1CXEA 5HGBA 2HAZA 1KNOB 1XGPA 2UZYB 3ARTA 1MPAL 2B5IB 5DRNB 2J7LA 5GRXG 5K9OA 2BFVL 5BZDB 1KEGL 2JCCE 3S34L 3HMXL 1TJGH 4XBPB 1DTUA 4PR5A 3QRGL 1FG2A 3CUPA 3QXTA 3KWWA 4NQCD 1F4WL 4KKCC 5A16B 5D2NA 1B0GB 5DJ0B 2XA8H 5FA4B 1J0IA 4GXUM 1VADA 3RX8A 2C9AA 4MNGA 3KPLA 1U8MA 5D6CB 5SWSD 3KYAA 4MLIA 2DS4A 1L6ZA 2H6PB 5GSRB 5SWZB 5EU3B 1VB9A 1D6EB 3WD5L 5IR1B 1NCCH 1EMTL 5C0CB 2WANA 3DGCR 3T4YA 3FB8A 1JIBA 3CSBA 4ZAKD 3ZL4H 1SYSA 3DX9A 5IVXA 1D9KC 4G8IB 4IOFC 5DQ9A 4I3GA 4WW1A 5IOPB 1JL8A 3FB8B 3G6AA 5D1XD 2VXTL 1DBAH 1SJVA 1TETL 2B4CL 4HS6A 4EBQH 4LNRA 2J5LC 1FE8L 4XX1E 1CLYH 3G6AB 1QFHA 3GSVA 4BFIA 3QQ3A 4JRYA 5IQ7H 3L5JA 5HGAB 4UTAL 1AP2B 3HI5L 1BGXL 1MJJB 4YIQB 2UYLA 1HHJB 3V5DA 4FXLA 4Q7DA 5DK0A 1YNTB 1A1OB 5DD1H 5AZ2H 4NM8L 1MJJA 1I8IA 2WINB 3RGHA 1IGCL 4YDIL 2F5AL 3VWKB 2XXMB 2PO6D 3UTTD 5FYJE 1EO5A 4NNPH 4G7YL 1RJZB 3W0WD 4NKQB 3RY5A 3BKMH 1YYLH 5DEGB 2APTA 1E6JL 4L1HA 1CGSL 3LSOB 1XMWA 4LVOB 1PY4A 1SQ2N 4JFFD 4CNIB 5ICXB 4MX7A 4OV5B 1TJHL 3EYQD 1KJVB 2EZ0D 2XZAH 5EBGA 1FFPB 4NQTA 1PZUB 1F11B 5D1QD 1BJ1J 5C9KA 1BBDH 1QA9A 3EFFA 4BZ1H 5IV2A 1TFHA 3OTTA 5JW4Q 1M7DB 3ZDYF 2B8OT 2DQCH 4LVOC 5EBMA 1IBGL 3CUPB 1LP9A 5C3LD 4GRWB 4G9FE 1GAFL 5I76B 4ZOCA 2YC1A 4OFYA 1NAMH 3H3KA 4PJ8A 1NCDH 1CWVA 2HT3D 2EIZB 4NM8H 3Q48A 3O2VL 3CPLB 1FIGH 3QFJA 5CS7A 2ZJSL 4GW1B 4XI5D 3IETB 2X1WL 4OD3H 4I18A 4QRRE 3MV8B 3DNKA 2GYSA 2K3TA 4HJ0C 4UDUA 3VJ6B 2NZIA 3L3DA 5D2LA 3QDGD 2YUVA 1KTKE 4P3DB 1DANU 3B6SA 4WUKL 5FO8B 4QOKD 3P4MA 4QXGL 2NY6D 4AK1A 4B0MM 1G9ML 2Y5EA 1CN4A 3ARBC 2G9HA 2BSSB 2E9WA 1NDGA 3O4LE 3W39B 3SE4A 3ULUE 3OJVC 3QNZB 1CF8H 1YQVL 3GMOB 2NXYB 1HOCA 2MPAH 4QO1A 5IJVB 1IEHA 2LE9A 3ARYA 3QUXD 4KKNA 1OM3H 4ODHL 1G6VK 1UJ3C 1KC5H 4XBPA 5F7MC 5HI5D 3KHOA 1A6UH 4NOBA 2CSPA 4RRPG 1UJTA 2FGWH 3WL9B 5JORB 4L3CB 4G6AC 5EBWA 1A64A 1QHPA 4OCRL 4QRQA 4KMLB 1RFDL 3QQ9D 3R8QA 5F96H 4OGXL 4NKMA 2FBJH 1U8JA 5BV7C 3MRIA 3VGFA 2X4QB 1A14H 4HBQA 5D8JH 3LKNB 2JB6A 2MSPA 3QZWB 4NWUL 3WSQH 5DJXB 4JKPL 1LO4L 3IJHA 4F8TA 2DJUA 4R7DA 5HYJA 3H9SE 3DO3A 2PCPB 2EDWA 1MWAA 1MI5A 2PYFA 2R0WL 3OKLB 1S9XB 3S37L 3HFMH 4O58H 3V0VB 2VN7A 4KI1A 3W9DA 2H9GB 4JB9L 2BVPA 2R23B 4J12A 1MI5D 1YMMD 3Q0HA 3CFBB 3L7FA 1N4XL 4F2MB 4K71C 1QBBA 2I24N 3P73B 5FYJL 4LCUA 2C3GA 2X1QA 2NY3D 5JHDE 4ODSH 4YJZL 1DN2A 5F44A 1CICA 1CTOA 2CIIB 5HI4C 3MGTA 5LGHH 5D7SH 4JQXA 1F58L 1XF3A 2YSSB 5T5FL 5K9KA 4YBLC 2VXUH 5I1KL 1Q0YL 5KZCD 4OCXH 1JZ5A 2OP4L 1G9NL 2VDKH 4J4PD 1EFQA 1B0RA 2PN5A 3FO2A 2V2XA 4RGOL 1OAKH 5KVDL 3LEVL 1KT2A 4XNMA 3C09C 1XIWD 2G5BA 3GRWL 4ZNCD 2OL3L 4C56A 5BS0B 1J1OH 2BY2A 4ACPA 2OMNA 5DJZA 4HWBA 2BK8A 3VU2A 1KT2B 3P9LB 5A2JH 4NC2B 1YEHL 4GAJH 2Q7NA 3OXSB 2NXYC 1U8OA 4PRPB 4JRXB 3TFKC 1IGYA 4MSWA 2A73A 1JRHI 1T22A 3N1GC 1YPZF 3NIGF 2R0ZL 1MCEA 3BD3A 3KPRA 4K9EC 5HDQH 5DJ0A 2MWCA 2XKSA 5FA4A 4PRPA 2IF7A 1QPXA 2AJ3A 2VYRE 1NGYB 4KK9C 2XXCB 4PJXE 4M48H 4IMLB 5DRNA 4JM2C 3SCMB 1A9BA 3WFBL 4XPGL 5T1LB 4Z8FL 4PGCB 3BZ4B 5I1AA 1RJLA 5KVGL 3X3GH 2VLKD 1AHWA 2YD1A 1BQHG 1A7QH 2ICWA 4R9HA 3HE7A 4LGSB 1WIPA 2B1AH 2X4SA 4PGCA 3OB0K 3WUZA 4LIQH 4ZS6C 3EOAB 2WLYA 2F8VA 4IRZL 5DJ8A 1YEDA 3VFGL 1ZV5A 1JGEB 4MYWB 2Z31C 4KRPD 4G6MH 4WHTB 2R8SH 2HKFL 2VAJA 2DTML 1Y6MR 1UACL 1FGVL 5E2WH 1WCBA 4PJDE 3EIFA 4JZJA 2NNAA 1MCPL 3V6BR 3WS6A 3R06A 3S7GA 4GAYA 1I85C 4GUPB 5IF0A 1A6AB 2AABH 3QUMB 4M8VA 1B4JL 3ZHDA 4DUWA 5DVNA 3RWIB 3SGJA 3RY4A 4P23B 1BAFL 2ARJQ 1A7OL 4R90L 4JFFA 5CKAA 5KBNC 1RY7B 3SDDA 4TQEH 2Z35A 3W0WB 5IMOB 1QBML 1KB5H 1G7HA 2CXKA 1IGTA 2IANB 4OZ4B 4K94C 5FGCB 4WFFE 4L9LC 5JXED 3WXWH 3WMSA 4LCCB 2P7TB 3BW9B 3NABL 1DUYB 3WFHA 1ORQA 1FBIH 4Y4KB 5I73B 1EEZA 3V4VH 3WNPA 1R3IL 1EGJA 4DTGL 1CD9B 5L0QC 3V4PH 4K7FB 2R1YA 4I1NB 3BW9A 3B8YA 3CLEL 1EUTA 2X7LA 3N1FC 3PGFH 3NGBC 5DMJB 3W11C 3UAJD 1MFBL 3R4DA 3DYPA 5TE6L 4EDWL 2YPVL 5F7HA 3T0VA 5ID1A 1QFUH 3N06B 4YBLB 2OTUA 3PDOB 5D2NC 4E41A 1O7SA 5AYQA 2X5PA 3LKRB 4BSVA 4K94L 1CDGA 4TYUA 2YUZA 3JVGC 1QSEB 1JF6A 3U6RA 3LIZL 3VFTA 5BMFL 2X4NB 1CFNA 2LVEA 3TH3T 1FRGL 3MACH 3RWDA 2P8PB 1S7VA 2JF1A 2YUXA 5FM5M 1MHCA 2AEWA 5TH2B 3EJYD 5C0AD 1RZJC 4LEXL 3UZVB 1IGFH 5DRWA 4K55A 4EI5B 4NQVB 5HDQL 4EKXA 1S5IL 2ICWB 1D9KB 3OKDA 1U8PA 3OQ3B 4L4VB 5C0IA 3WV0A 2APBA 2QQQA 4NJAL 5C0AA 3O3EB 4DKAA 2VWEC 5B38B 2DMCA 2NTFB 3QNXA 5C0JA 4KQ3H 4KZEH 2R69H 5GGRB 1HYSD 2E27L 2QQKL 2Q3ZA 3ECBB 4L8SA 5EN2B 4F7EA 5BCAA 1BMGA 1FL3B 2CKBH 3CU1A 4E5XA 4HWZB 1ODAA 4H8WH 3FCTB 3LRSB 4WU7B 4X98A 3GJEB 1CFSB 1LK2B 2YS4A 1TZHB 3GMOA 1WTLA 2AK4A 8CGTA 5GGTA 4LNVA 2ORBL 3CLFH 3L5HA 1JF1B 3KPQB 3VFGH 1T20B 3K2MC 2CDFB 3UJTH 3KJ4C 5T1MA 3NIFE 1G6RB 2KPNA 3GMMA 4JRXA 2RJMA 2BSSA 2X42A 1JF1A 3TBSA 3ILQC 4ESKA 4Q6IA 2WBJA 2FIKA 1G1YA 2QSTA 3KPTA 3MC0A 3O6FA 2EH8H 4CU6A 2X40A 3U0TB 32C2B 1BQHB 3V9FA 5SX4H 3BT2H 1IT9H 2VN4A 1UZ8A 3MGOA 5D1QC 1S5HA 5HYIA 5E8NB 4ZSOA 4NJ9H 1I3RA 2UZIL 5EBLA 5GSRA 4ZDHB 5HGHA 1DQTA 2EKSB 4CJ1A 1UQSB 3KJ6H 4Y2DA 3MRKA 3UPCA 4Z7NE 5DJYB 3WSQL 3RTQD 4R4FH 3U9UB 4X7CC 3T3PF 3BP6A 3WJLC 3VI3E 4BFEA 2H9GA 1FN4B 1G7IA 1WT5A 4UOW1 2W0LA 1KIUA 5LXGH 3X3FL 3DHJA 3IDMB 3PNWA 3EYSH 3KPSB 3H8NA 3WS6C 3F65A 3RVWC 3GGWA 4CW1B 3H9SD 4HUVA 1AO7B 2IQAA 4O5LL 5HYJB 2Y7QA 4CVXB 3GSVB 3NAAH 1MWAB 4BFIB 2OP4H 2XN9E 3OKLA 2WAHA 3QYCA 3MFFA 4M43L 3LY6A 4MDJB 2EICA 4X0KB 1NPUA 5H2BA 3OKDB 5E9DA 2BRRH 5EIIB 4C56E 4D0CA 2WQ8A 1WWCA 4ONHA 4ODTL 1QO3B 2J3SA 2KUTA 3PL6C 1AR1D 3NMEA 2NPLX 3CXHJ 1X5XA 4IEFB 4ORGB 4UT6H 3BI9X 5GGRA 1DANT 2I07B 3CXDL 1FG9C 3KXFD 1CXFA 1IQDA 2AJUL 3LDBC 3SOBL 3CDGB 3HZVA 5FM8A 5INDA 1XF3B 5T3XE 4TRPH 5B39G 3ROOA 2V2WB 3RA7H 1XR8B 4LSQL 5FECA 4QHUA 3FHQA 4JO4L 2VLKE 5CZVH 1TCRB 1CFTB 3D9AH 4GH7B 3TH4T 3GIZL 5LQBH 3HG1B 4FP8H 3BD5A 3CSGA 4UBDC 3MUJA 4P2OC 3U82B 3VWKC 2IAMA 4XCFH 5CP7B 1GGUA 3E2HC 3D2UD 3EO1A 2AK4D 3SDYH 3ISWA 2AVGA 4YHPB 1PQZA 2R2HA 1NSNL 3VRJA 3E8UH 3MJ9H 5I8KH 1NGXB 4KROB 2BHYA 2HFFA 1R3JA 2FJFA 4JJ5B 1Q9WA 5JOEA 5E9DE 1G84A 3MO1A 5BRZE 2P8PA 4OQTA 1Q0XH 2VLLA 2PYEB 3FTGB 5J3HD 1CGYA 1NGXA 1YEDB 5JPNB 5HVWA 4KTDL 5HBBA 1J0HA 4X7FC 4XXDA 1T5WA 4FXGB 2I25N 3KPLB 2VITA 1RJLB 3D85B 1ZHBA 4XWOC 3D39D 3DLQR 3BE1H 3QJHB 2GCYA 4M61A 1BQLH 1LEKA 1Q8MA 4N5UA 1G7IB 4MJ6A 2X1PA 5IK3B 4GRWH 2N56A 3MREB 3UTZB 2BVTA 3MLYL 5SX5K 3QIWB 1NMAH 4OLYH 4JZJC 4MJIA 4NO0B 5EUKA 1D6VH 1I1AC 1WLHA 2BVPB 4OF5A 4JG0H 1LHZA 3OAZK 1BAFH 4JRYE 4UIMA 5EO1A 2R1WA 6CGTA 1ZXQA 4I8DA 2ESVA 2EYRA 5JW5B 1MF2L 3QA3A 4OZGF 4MD5B 4ZUWB 5CLWA 2P7TA 1ED3A 3RVUD 1FQ9C 1MLCA 3DOSA 1WQVT 5DJDA 4R2GB 3TN0B 1R5WA 2OR7A 4YE4L 1OAXH 4PY8J 4RMUA 1SBBA 1RK1A 4Y2DD 3KPPB 4U6VH 1B0RB 3HNTL 5DVKA 1MLCB 4ETQB 2MPAL 4KZDH 4QY8A 5CD5D 1P7QB 3BWAB 3NCEB 4MCYB 3SE9H 4D3CH 3HE6D 3D3VB 2CRZA 5I2IA 1V5JA 5K9QI 1S7TA 2H3NA 2N7BA 3STLB 1U8QB 1VCAA 2BDNL 4ZD3H 4MA3A 4PLJC 5CBAA 4E41B 1LQSR 1QFPA 1A3RL 2Q7YA 1B9ZA 5DHYB 3WHXA 5CP7A 1TZIA 4PJIB 3S36X 4G6JH 4LAJH 1RUQL 4Z0XB 5I19H 3BSZL 1DL7L 1EHLL 5J9PB 2XTJE 3DV6A 4DK3A 2FLRT 5ERWA 4KUZL 2C3VB 4L4VD 1JYXA 4NBYB 1HSBB 3OJDA 4F58L 1J0YA 3UBXB 4M6OL 4Z77B 4XCYB 4KDVA 5C0RL 3FQWA 1U8PB 2HLAB 4K7PX 1VGEH 5HYSA 4HK0A 4HCRL 1S7XB 2FEDD 5E1AA 1K4DB 3G08A 4YDVB 1YDPA 3MROA 2IALA 2ZUQC 2HT2C 1FZOA 2NY0C 3OAYK 4IJ3B 1INEH 1N0XH 4W70A 4FXKB 2HLFD 2X4NA 3PHOA 2DLFL 2HH0L 3RVTC 5EIIA 5FM5O 3RWDB 1XGQB 4JRWA 3G08B 4PGDA 1EAPB 1XGRB 4X9HA 5CWSB 3KR3H 4OCNC 4ODXA 5JMRA 4OLVH 5TDOB 1U3YA 5GRJL 5F9WC 4Z7UB 3VE0B 4D0BA 4PGZA 3T0DA 3PV7A 4P59H 4G9FD 5IB3A 1KCSL 3HR6A 1C5CL 3CX5K 2J5LB 5EZLB 4KK8C 3WDHA 4Z7UA 4HEME 3IJYA 4JFZL 4LVHB 1IEAB 4NNYA 1NAMB 3G6JA 3NH7H 4X98B 4TVPD 4X9FA 5I1DB 4NOFA 4NP4H 3IFOA 5FYKE 4AEIH 1JV5A 1J1OL 4I0CC 4MSWB 4NZRH 4QXTA 2AEQH 4F33B 4LMQE 4WUUB 1K4CB 4S1DC 2FCBA 1G9NH 2VDKL 2JLLA 3QQ9C 5CSZA 25C8L 5CD3A 3V7AE 5EC1A 1OQXA 5F3BB 2EE3A 2NY5H 3KJ4B 1DVFC 4UV4L 3REWB 5B38G 3SY0B 5LCVH 4QOKA 3D39A 3VMNA 3O0RH 1VSCA 3SCMA 3CFJA 5DC4B 2MFNA 5A40E 1ZT4B 4I77L 4N0CC 2E7MA 3O6FB 3T8XB 1VEPA 5SWZA 1XF4A 3SE4C 4HQQH 4E9LA 1MCIA 3H2WA 3H9SB 2EDHA 5L2JA 4IRSD 4JO4H 4R4FL 2GHWB 4PJFB 3VXOA 2P49B 4EUPB 2R9HD 5B4MD 2R0ZH 1H8SA 4KWUA 2B2XL 3ES6B 3PDOA 5DMIL 1JPGA 4O9HH 1A2YB 4H8WC 2F53A 5D7LB 4OZHF 4Z76A 4M7JH 4PJCA 4V2CB 4MMZC 2DQFB 3LN4A 3O8XB 4RX4A 1NUDA 4RFEA 1RIUH 4KUCF 2V9RA 3SKUD 3N0PB 5JHDB 3TNMB 3V7AG 1FO0A 1ZANL 1U3HB 4P4KA 4HGWA 2VH5H 3LMJH 1AD0A 1S9XA 2DKUA 3FFCB 2FX7H 4ZPTB 5I1IL 4RX4D 2ERJC 1VERA 4I18C 3LEVH 1G7QB 4RFEB 5ESVA 1ZVHA 5C9JA 4BYHA 4JHAL 5TPWL 4PJ8C 4L4TA 5GIRB 3SDAC 4FQCH 4W68A 3SKOA 1AFVL 5H2BB 1VFBB 2X10A 3PF2A 5I6XB 2MHAA 4FP8L 1TJGL 3MXVL 2MTPA 1FIEA 5F3HB 2FATL 4OGXH 3GFUA 1TCRA 2W38A 2Y5TA 2NX5B 3F62A 4Y16A 4N0FB 2DBJA 2X4RA 5BO1H 4MVBD 2DI8A 1NAKH 2WP3O 3OX8B 3BIKA 5BXFB 2BMKB 2VSDA 3CDGA 4S0TD 2IAMD 2FGZA 1NDGB 3RFZC 2QTEA 5C8JB 2VUYA 5FEBA 4U1KB 4Y7MA 5E94A 1HH6B 4G6AD 4NN7C 4Y1AB 2UUDK 5F9AC 2B1HH 5FHBL 4Z95L 3C6SA 3BQUA 3W82A 4OF0A 1KEMH 3MV7B 5DVLA 4U1HA 5I0DA 1K4CA 1RUAL 5KANG 1SEBA 4XPAL 4LRNL 1WWAX 4YXKH 4NKOA 3X12B 3TCXA 2YMXL 1X5HA 3C5JA 1FO0H 1A22B 4NKDA 3BQUD 1UYWH 2XZCH 3QHTC 2MQCA 1FFRA 5GHWL 1CR9H 1EEUA 3AS3A 3OJ2C 1MCCA 5J0BA 4FQJH 5GRYA 3EYVA 3QAZB 5CCKH 3WDJA 2ATKA 1QHOA 4LQFL 4S1SH 3VXSD 2VR9A 1FNSL 1Q9WB 4XAWL 1NC2D 3V5HB 4U1NB 4FNLL 3RIAF 3D1MC 4ODVL 3QEQA 3UTZA 4MLSA 1ZLSH 3VRIA 4GBXA 4U6YB 4D2NA 4LKXB 2F5AH 5HHXL 1KFAH 3OMZA 2Q86A 1U2CA 4RFOL 1G0YR 3QCVH 2E8YA 5B8CB 2AJVL 4IIQC 5ACZB 1HNFA 1Q9LA 4G6KL 3BSZH 4OLXL 1BHGA 1GHFH 2O5ZL 3QDGA 4JO1L 3SDAB 1FAIH 4L3EA 1MAKA 2QQKH 3X13A 5CMAB 5EO0A 3OR6B 1S7SA 1IGFL 4NO5A 1TJHH 2Q8AL 5F1SA 1I7RB 3DURA 1UT9A 5CSGA 1BEYL 3QEGL 3GUTA 1R24A 3MQIA 4ZXBB 3JV6B 3V6OA 3ZYZA 4F7CB 3BMWA 3QDHA 1IZKA 5CZXD 2DLFH 3O3DA 3MRLB 4RDQG 3MCKA 5AUMA 4M62H 1CDIA 3RPKA 4YEFA 4DKFL 2C1OB 1UM6H 3ZYJA 4XVSL 4U0RC 5I30H 1MREL 2FHCA 4JDZA 3FN0L 5KSUB 1S7RA 3OBAA 3TP4A 1YNKH 1BGXH 3DGGA 4KK5D 2QADD 4P5MB 5T5NF 5HHVH 2DDQL 2ZUXA 2CRMA 4GW5A 4M7LT 2VLJE 5DJXA 5HDOA 2DQIH 2FR4B 5AG8A 4R7DB 1HHGB 5TQ2H 4KJYB 5D7IA 3O45B 4MQTB 3IDIB 3HS0B 3FQXB 2WZPD 1DLHB 5ABDE 1NGQL 4DVBB 3HUJA 3MOAH 1R3JB 2FJFB 4JJ5A 4S1RL 3O45A 1OLZA 5I1EH 2QKIA 1E6JH 3DIFB 1JI1A 1K6QH 2Y4SA 4WI8A 3WHE0 4HGWB 4AMKH 2GITA 3AFLA 1IAIL 4LEXH 4C59B 3LQMA 1D6EA 1T0NB 4ODUB 5FOBB 5T3ZL 4XGZA 1INDL 3ZT6A 4JQXC 1IKFL 4OIIH 3C9NA 1MQKL 1E4WL 1CD0A 4B53A 4Z7VE 4LVNB 2GK0A 3IAPA 5I1JL 3CZFB 4JFYA 1CDJA 5C07E 2AAVA 2HFTA 2OJZL 2C5DC 3FQRA 5F7UA 5A2LH 3BPNC 2VC2L 2Y06L 3QFJD 5DUML 5INDB 5D7JA 5IMKA 1NKOA 2DQUL 2Z31A 2NNAB 2XTLA 4U3CA 4PJ8D 4N0FA 4WFEE 3ESUF 1SM3L 5IF0B 4FNLH 2IADB 3G6DL 3PDGA 4RGMB 5BZWA 5FV2A 4TNVF 1SVCP 2WUBH 1S7SB 1FL6B 3L3DB 5IFHH 4YHLH 3JTTB 2MOVA 1AGCA 3I6KB 2W0KA 4U1MB 5BRZA 4P2QD 4OM1L 2R56H 1M7IA 1IGTB 3OKYA 5F7FA 4UILH 5DJDB 4XRCA 1NH6A 1I8MA 3FJTA 5B39B 5C86A 5BMFH 4L3ED 4PRHD 4S1RH 4ZOEA 1JK8B 2X4TB 2HMIC 2VIRB 2H26A 2BSTA 1JCKA 3GKWL 4YHPA 1F6LL 5E6YA 1KIQB 1F3JB 2OL3B 4OZHA 4PFEA 2CH8A 3LQAH 1U8KA 4GG8A 2ZPKL 3ARBB 3ZL4L 5HPMB 4TUKH 2D7TL 1S7QA 1I8LA 3LRGA 1I85A 4M7JL 2VDQH 3WL9A 4Y4FC 5JORA 1AGFB 3CH1A 4G6KH 2VDOL 4DK6A 3AB0B 3T2NH 3QJFA 1IQWH 5JHDD 5KJRH 3MNZB 1YMMB 2IPTL 3ZDXF 3PXJA 3QI9B 4Z0BH 5DWUL 1UQSA 4U1LB 4B7LA 1R3IH 4JREC 1UM6L 3MJ8B 3GI8L 1MFCH 2XKNA 1KF9B 1MI5E 1U3HA 4P4KB 5JA8B 5JOFA 4ZFOL 4G7VH 2F19H 3IJHB 5IQ7L 3B2VL 3U30B 5FA3B 3P4OB 3ILQD 1BZ9B 3MRHA 4GRLA 2OSLA 5E2JA 3S5LA 2IH1A 3KYOB 1S7XA 1KTDA 5L2KD 4PRIE 1IM9B 4MHHI 1DQQA 1EBAA 1KCKA 4KH2A 3T08A 4YDVA 2H32A 3P4OA 2FSEA 4KK9D 1HNGA 3D0VA 3RGVC 1AO7A 2IQAB 3GB7A 3U36B 1CFQB 5I74B 3AS0A 1FJ1A 4MNGE 3FFDA 4KKBD 4JKWA 5FHAL 4PB9L 5CZXC 4YX2L 2E7HA 3AB0C 2W0PA 4LCUB 4HUWA 4LPCA 1N59B 4P46D 4U49A 5JDJA 4W81A 5LAXA 4WVRA 3PWLB 3SDCA 3MCKB 5AUMB 5CGMA 1JGDA 2HVJA 1YC8A 1KPVB 3LRSA 4WU7A 3RNQB 2D7MA 4WFFD 4U1SB 4ZUVB 5IW1B 1QKZH 1MJUL 2V2XB 1YEEH 2CMRL 3HZVB 1QVOB 4X6EB 3SHSA 3BH9B 5L8LB 4FQXC 2HRPH 4Y5XC 3L3IA 2GUOA 3KYNA 4DCQB 5CHNB 5TE7H 2RCSL 1U36A 5HHPA 4I0PB 4WTZG 3RWEB 2DQUH 1IGJA 5FUCE 1A7BA 2K7PA 5E94B 3OG6B 3MV8E 1JYVA 1NQBA 3MX0A 3RPIA 2WBJB 3H0TA 4QTHA 1IGMH 5CSZB 2VL4A 1ZWIB 4NQCB 4U1GC 5B22A 1RQ5A 4O2FB 3KPRB 4YDJB 5DR5H 4PTTA 4FOMA 3T1WA 1AKJA 3QEQB 4JY6B 1HXMB 4Y4HC 3ARED 4OLUL 3I85A 3T65B 2GJZB 1AKJB 1IRAY 1PEZA 3VFOB 4XVTH 4HUXB 2VAAA 1F00I 4MXVE 4WEUD 3U9UA 3DI2B 1ZA6B 1OGAB 4W6XB 2MCG1 2HH0H 3TZVC 1JHTB 1HI6B 1YUHB 4PJHA 3HHRB 1TENA 1X5LA 3KR3L 4OQTL 4U7KA 1VGEL 1PD6A 5FGBC 4U6VL 3ZTJH 5BJTB 1IARB 2BVQA 4JFHD 3SE8L 1JWSA 5IIEA 1W8OA 3SDAA 3MMEA 2D4FA 4HIHA 5SV3A 4DZ8B 5FYJU 1ZGLB 1MREH 2PO6A 3ARFB 4IRJC 4LCYA 4NQEB 1RUPH 4G6JL 1XFPA 4N8VA 5T5NG 1ZLVH 5L6YL 3SDDB 3LV3B 4V1DE 3GZKA 1GH7A 1MJ7H 1N59A 1CF8L 4NP4L 1KYOJ 4IRJD 4P57A 3O9WB 4O2CA 8FABB 5I1JH 2Q20A 1KJMB 1RUQH 1N6QH 4PJ9D 3QI9C 2CXGA 3TBTB 1QLFB 1D5IH 1PDKA 2ENSA 3MGAA 4LSTL 2OTPA 4NO3A 5DJZB 1OGTB 1YEIL 3P30H 1TCMA 4ZO6A 1G6RL 1F4HA 2X4QA 3IFLL 3DXAA 1P69B 1HKFA 4K7FA 4DAGL 3L5XH 1FL5A 4Z7OE 4E0RA 3HNVL 3B9DA 4LSPH 3HZMA 3VRLE 3QI9A 2BZDA 4ONGL 1KJVA 4EQ2A 4P99A 1P4BH 5E6IB 4U1HB 3ZTNH 5HHOD 4XPTH 3UO1L 1XR9B 4JJHA 3QDMD 3LN4B 4NCC1 4IMLA 5EWIL 2VL5B 5DDHB 5TGBA 2OJZH 3MV9D 3HS0A 2PXYA 3V4PL 4JDTH 4PJBF 5C09D 1FZMA 1JZ2A 4G8GA 5ITFA 4MDJA 3CIQA 3T65A 3LQAL 1AQDA 4N0UE 3F5WA 5KS9A 1KLUA 2X4UA 4LCWB 1S7UB 3GIVA 5DQDL 2BJMH 2O5YH 4WDIA 4BQ9A 4MAUH 4WI2A 2VDML 3VFPA 2P5EE 4M48L 3FMGL 2ZCKL 2OZ4H 4LEOB 4LSSH 2VERN 2GJ6E 2UVFA 1GZPB 4WWKC 1RU9H 2JCCF 2F54A 1YC7A 3BPNB 4G8EB 4PJXB 4OLUH 3PGDB 1D5BA 4XBGA 3DRTA 3NTCH 1ZLWK 4POYA 1B2WL 1RZIB 1AGCB 3I6KA 4LHUB 5JDSA 5KVFL 3O6LL 1I9IL 3QQ4A 4U1IB 3ALPA 3G6DH 4NUJB 1VENA 4GW4A 4XP6H 1VGKA 4LPUA 1K9TA 5EORH 1INEL 4OFKA 1NFKA 2MQ0A 4Z5RA 5ITBH 2AABL 3QQ4B 4U1IA 1Z2KA 4EXKA 3UXFA 4XMPH 2OQJA 5DRZA 1KPRB 3TBVB 5K93A 2EDNA 1KXTB 4NNPL 4NO2A 3SDXA 1X5KA 1KLGB 5I75B 4OQTH 3UROR 1P84K 5KSVA 5I1GL 3GSWA 4HDIB 1WCQA 1YYMH 2NXZB 2ZOKB 3VXSE 1MPAH 4UQ2A 3DPBA 2BVOA 1DE4A 4KJPC 5D5ME 3TT3H 3LRHA 4LAQH 3LQAC 1YN6B 4LCIL 4OD1H 3S88H 2HKHL 3AY4C 5A3IC 4QRRD 3QDJE 5L2KA 4WW2B 4FQ1H 4UZGA 3VFNB 3Q3GB 1FHGA 2FBOJ 4X4ME 1AO7D 2UY6A 4WJ5A 2P48B 1ZANH 1VACB 3C5SA 3SN6N 5DJ8B 2BNUA 1H3VA 5FA3A 1HHGA 1K2DA 1QBLH 2ZZUT 1QQDA 2RFXA 5KN5A 4Q9QL 4DUXA 1UWEL 2ZCLH 4GSDL 5EA0L 1JHTA 2I27N 4ZYKB 3FFCE 4WNQB 4HZLA 4NQDE 3UBXA 3O8XC 4YDIH 2NY4B 5JXAL 2R29L 1NBVL 1BD2B 1T7WA 2AKRA 3IJSA 2UYLB 3BKYL 4WHDA 5FYJD 3EYQC 4YDLC 5F6IC 2R23A 4F3FB 3QFDA 1DN0B 1YEJL 2CDGA 4PUBH 1M71B 2LQRA 1YEEL 2CMRH 3VFPB 2X1XR 2PXYD 3FT3A 2WINA 3PWPA 1CK0H 1A7NH 1FJ1B 5KS9F 3GSQA 1A6VL 3VFUA 3GMNA 1IAIM 3KPPA 3BOVA 4X6CB 3R0NA 4LARL 4JFEA 3SGEI 4ZFZA 1CFSA 1NC4D 1YEKL 3S4SB 4M4PA 4XI5C 1I8LC 3E6FB 3V2AR 1EK3A 5DMGC 3RUGB 4N8VG 4YBHA 2X7LB 4I48B 3MLSH 5L2KE 3BPCB 5GGSY 4JN2B 1NGPH 3MJ7A 5FYKU 2ZCLL 1G9MH 4ODBD 4ERSL 3BIKB 5CJQH 1AGBB 2GSGA 3DRQA 2B1HL 1P5VA 1QVOA 4X6EA 4X6DF 3QEQD 1WSST 2F58L 3PP3H 3TO4A 5FKAA 5CEZE 5DHVB 2ENYA 5J7CC 1S8DA 1E4XI 4QRTB 4U2ZA 4YAQB 2YKLH 2C3VA 3MACL 1GGCL 4L8DA 4OCWH 4PRDB 4KTEH 3GKZA 4NBXB 3RZCD 3UJIL 4M3KB 1S8DB 5B21A 2J8OA 1I1YB 2ZG2A 5JZ7D 1CGWA 1IC5H 2W65A 1B0GA 3WXVH 4YDJA 1DFBH 3WIIH 5EZOL 2FEEL 4Y5YB 4JDTL 4ZUSA 3RY6A 4KDTC 2UZIH 2IH3B 2CO7B 5B38A 5J12C 5F1IB 3DVGB 3U0WL 1AXSA 2DWDA 3UPAA 4UINH 5JPNA 2JIXD 3TT1L 2GIYA 3AXLA 5GGTH 3MUY1 1RUKL 4OIIL 1D7FA 1BX2A 2Z92B 2HFEA 2QBWA 2HN7A 3RKPA 2XTJC 3T2PA 4WY7L 2Q3AA 5F1IA 4LPXA 1NFIA 1BPVA 2EXYC 4I9WD 4NQED 4FQHB 1FLRL 2Y7QB 4OAWB 1CXKA 3FOMB 1AGEA 3JBG7 1BBJA 1K6QL 2APVA 3BO8A 4PJ9A 4F7TA 2R4RH 2YD7A 1RUMH 3HPJA 1EJ6A 4O58L 5D1ZA 3KLAB 5E6IC 2OTWB 2FLBT 5EU5A 4WI9A 5ENWB 1B3JA 5EU4B 2ZUUA 3EYFA 2IBZX 4FZEL 4P2RA 5IJVA 1RK0B 5L6YH 4YIQA 5LG1A 1CDYA 3HRZA 4D9LL 2BJML 2O5YL 5DMGD 1MELA 3O2VH 1CTNA 3PWLA 3SDCB 3GI9L 1I9JH 4HHAA 5CD3B 4XMPL 3FAXA 4ZSOE 4MAYB 1W0WA 1T2XA 2ZJSH 4NM4H 4LLWA 1AO7E 5IB5B 4J6RH 3HLAB 1EIBA 1F4XL 1JE6A 1NAML 3HZKA 4APQA 5M7QA 3K4AA 1DBJH 2WLZA 3MV9A 5C2BL 5AAWA 2CPCA 2LU7A 3K80A 3QR2A 1MCWM 3WO3B 4NO3B 4JY4B 4O02L 5HHOA 5BVPH 1ZHNA 3MV9B 1N2RB 3D0LA 3UTSD 1OGTA 2P5EA 4LSPL 4FABH 1KG0B 1U91B 2DWEB 4GKSB 1JPGB 4JFPB 5CUSL 3EGSB 2DM2A 3FRUA 5DEZA 2W91A 2R2HB 4MAUL 3BRFA 3UZQA 1UXSA 4KI5D 1AQDB 1AJ7L 4P5TA 2EXWC 1VDGA 5F8QC 3TZVB 1FP5A 3ARSA 4XB7A 4FG6D 5E2VL 3VXUD 4PD4K 1LP9B 1ERNA 5HHQB 2NYYC 4P5TD 5IHBA 4IIQA 1FNEB 2A77L 3ZE0E 4LVHC 2GITB 1DP0A 4R7NA 2M1KA 2DI9A 3KNBB 4QGYA 3SJVB 3EOBA 2E7CA 1GSMA 5IB4A 1BX2B 2Z92A 4YHIB 1XGQA 4BUHA 4YHOH 4PBVC 3FOLA 4HULB 3UPRA 1OPGH 4PGEA 4CAGA 1ZKAA 5DYOB 3QULB 3S35H 4ODVH 3HZYB 4U1JA 5IVNA 2WBJC 2DQEL 1FYTB 3U4EA 2R2EA 4KTEL 5C09E 1BF2A 1AE6L 1RZ7H 5FYLL 3OKOA 3H9HA 1I1RA 4PJFF 2FYYB 5TF0A 4Z8FH 3ZE1E 2F5BH 1YPZB 2FX9H 5ADPH 4XMLH 5FUZL 4Y5XB 2R2EB 3RIAK 4RGNB 4D9QD 5I66B 2BSRB 3LV3A 5K9OB 5FYJH 4RIRA 1GPOH 3HRZB 4YC2C 1LD9B 4AM0A 2ZNXA 3WS3A 4HG4K 2H2SD 2W9DH 3TBVA 1TPXC 3UYOD 3BN3B 4YE4H 4FFVC 4WUUA 5FIEA 1T5XA 3V7MA 1Y6KR 4EI6A 5TF1L 3NFNB 5ANMA 5I1LA 4C55A 3IYLW 1CS6A 3MLSL 4DOHE 1OAXL 4HK3J 1OW0A 1T5WB 3C60B 1ZHNB 4TOYH 4KUZH 4PV9A 5DD5L 3LN5B 1JNHB 5ESAA 4DEPB 3MRJB 4Z7QE 5FO9B 2BVEA 4HIIB 4OF8A 4IHOB 4BZ2L 5DO2C 1DUZA 3TPUB 4JG1L 1UH2A 1MVFA 5F21B 4P2RD 4CMMB 3NN8B 2X70B 1ZVYA 5IHZB 2ARJA 3ARUA 3F12A 4P4KC 5K59F 1DN0A 3PNWB 3DO7A 4KHXH 4HUVB 5F89B 2VDOH 3QT2A 1HHJA 3PHOB 1B90A 1QRNE 3JWNC 1X5FA 4QWWD 2VDRL 5EU6B 5FHBH 1I1AB 4QNPF 3ULVD 5GQBA 3THML 4ELKA 5GGTL 3I75B 3OB8A 1CDHA 2J8HA 5ALBL 3PUCA 4C56D 2V7HA 2YPLA 3HMXA 5MEOB 4Y1AD 2PTUA 4I48A 1WVZA 1FH5L 1PX4A 1VHPA 2DKSA 3VH8B 3ZSSA 1TXKA 5EUOE 4JN2A 2AJSL 4WCYL 4NUJA 1OWWA 4NNYB 4KUCD 2VQ1B 2DBLH 4M1DH 4XP9L 3WIFA 4XH2B 3B8SA 1ZEAL 1MFCL 1MUJB 2K7QA 4F7MA 2GEEA 2Y06H 3OF6D 2VE6A 4YAQA 1IGIL 1WBZA 2P46B 4Y19E 1FSKB 4NSKA 5DJ2B 4NNXB 2FH6A 3VXPB 1G7PB 5I66A 4UNVA 2WW8A 3MUZ1 2EDKA 4WO4B 4AEIL 2R0LL 2VIRA 4RGMC 2NLJA 2VISA 5M95B 3QEQE 1SY6L 1JF5A 4XVTL 3R8BB 3LKPA 3BZEA 1KIQA 2MKLC 3ARZA 2I5YL 2ZOKA 3DUSA 5SWZE 2DMKA 1G7PA 2R15A 4U3HA 5IW6A 1CXLA 3H0TB 3CFJB 4EQ3A 4XP1L 1PGRB 2VZUA 2V7NB 1M6OA 1YMHB 4H5SA 2VZ1A 3TA3B 2P24B 4H26A 1WJ3A 1JUFA 4R96B 2Y1VA 4PGBA 4H20L 4DGVL 4PJ7E 4S0SD 3SQOH 1FRGH 4QXGH 2YPLE 2A83A 2HTLC 1E4JA 1NKRA 1C5CH 3KNBA 5KSBE 4U1LA 4U6HA 3H7LA 4X9IA 4TTDC 3ULUH 2F54B 4PJCB 1J5OH 4JM2A 2DQFA 4HJJH 1GRWA 3CLFL 1J8KA 4ZNEE 2A6JA 5CZKA 5MEQB 5JIHA 7CGTA 5J13C 5ETUB 2GJ6A 2EDXA 4QWWC 3AREA 3TVMD 5F6HJ 2BXZA 3HE7C 5F7EL 2D4DA 2IWGA 4G8FA 1WC7B 5F89A 3GJFB 3QNZA 3OKOB 3BDYH 2A6KB 2X1OA 2YD8A 2C7UB 2XZQL 2FX7L 1I7TB 4G43B 5C08A 3SGKC 4XP6L 4HPYH 4O51B 5IB2B 4NN6B 4ZFOA 1K3ZA 1CDCA 1FAKT 3BT2L 3MMEB 1FVCB 3MBEA 1QSFA 3W9EA 4QRUA 5D7LE 4DAGH 4YBQD 4HG4J 2PO6B 4NN5B 2ZG3A 3OAZH 4JFDA 3WE6A 5CJBA 4IOFD 1JI2A 4XP5L 1I3GL 3QIUC 4MA1C 1BOYA 1HEZA 4ZFZB 4LDEB 1GPOL 2P45B 3SEPA 1P9MC 3QUYA 1WUNT 5IMLA 4HHAB 1NFDB 1P6FA 3ZDXE 1J8HB 2Y07H 2ESVE 3TIDA 4ZXBC 1ES0A 3VD5A 1P2CB 1OTTC 1VACA 3C5SB 5F9JB 3IF1B 1PLGH 2P4AB 4X4XA 5D1QB 3VCLA 2I9TB 5E8PA 4Z7VA 4KRLB 1FCGA 3B3IB 5FYKH 2CUIA 4QGTA 4WO4A 4DZBB 2Z8SA 4M6NL 4PP2A 3LKPB 3BZEB 1MH5A 4RAHA 1DLFL 3L6FA 3SE8H 2A9NL 3O3UN 3HPLA 5A2IH 5DS8A 3X14A 3V6OC 5I30L 3GNMH 4Z7UF 5BVJA 1Q94B 2H32B 4HS3B 3HI5H 3MV11 4FTVE 1XF2A 5TGBB 3Q6FB 1QSFE 4WHYG 2J6EH 3EHBC 3X11B 4N9OB 4GRWF 1T4KA 1ZT1B 4HLZH 1AXSB 1NMAL 2DWDB 2QV2A 4OLYL 2OZ4L 4NQSA 3QAZC 4CGTA 1VKXB 1OL0A 1D5IL 3T0AA 3C5ZD 1UVQA 4RAUA 3B5TA 4UQ3A 1IFHL 5A2FA 3INUL 5HHVL 1DQJA 5J11C 3RDTB 5ETUA 3K3QA 1NDMA 3MRPA 43CAB 4ZUVA 5EOTA 1J05A 5I16B 3F8UB 1CDUA 4TSCL 1CFTA 3M07A 1CIUA 1NLDH 4AM0B 2DOCA 5ENWA 5DSCA 2DTSA 3MRDA 4E42B 4F7CA 5K9JL 1IE5A 5GGSA 1I7ZA 2B1AL 2JKXA 4WUUD 5C0BE 4KHTL 4TUJA 4JFDB 5EPMA 3WE6B 5C92A 5E56A 1ZWIA 2WV3A 3HE6C 3AMLA 2IPUG 3TVMC 4PJ5A 3LS4H 5T3XL 2V5RA 4Q6IB 3LPGA 4WCYH 4F7PB 2DM4A 4PG9A 1MCFA 1WAAF 4L8CA 1JWMA 3JV4B 3QUMH 4HJGB 3REWA 1FO0L 5EU3A 4JFEE 1JNJA 5D96B 4P5MA 5C0CA 1N5YH 4QRQB 1T5XB 4FQQB 4R97C 1YEFH 1O0VA 1UADC 3GMPA 1Q0XL 1JWUA 3SKNA 1MCOL 2AXHA 2EH7H 5FB8A 5GZOC 5KVMC 4GBXB 3BEVB 1FAIL 2HT2D 3SE3A 1CQYA 1OOAA 2XQYK 3BGMA 4RCAA 5GS2D 3BP6B 3GK8L 4KVNH 2VL5A 5DDHA 4LBEB 3HN3A 2PTVA 1A6TA 1KIPA 4FRWA 1WZKA 3VFSB 1T66C 3MJ9L 4HZLB 5I8KL 2L4OA 2VZ3A 4PJ7A 5EZIH 4RAVB 4PJHF 2VLJB 3RNKB 2QADC 5JW3H 2DQTL 3CFCL 1F58H 2P5WD 2VDLH 4RFNB 4BH7A 3CFDB 1MIEL 5BV7B 2IFFL 3MBEB 5KZCB 5K9QG 2F53E 5LXGL 3KPNA 3S8WA 1Z9SA 4N5ED 5C0EB 5EIQA 4OCWL 3QDJA 4H0HB 4AEHL 3H42H 5DF0A 4L8BB 2XQYG 4FQ2H 1OTSD 3FO1B 4HIXL 5IKCA 4JRXE 4HWEH 1CXIA 3QUZD 1UJ3B 1L6XA 1MFEH 4M7KH 5E99L 1F8TH 4Y16B 4MJIE 1GGBH 1QZ1A 5IHUH 1NGPL 1YEHH 3G04A 4GSDH 5DSCB 4X4XB 4HPOL 4OCLC 5D1QA 1CL7L 1TZIB 2EDTA 2NZ9D 4PJIA 4EVNA 3SCMC 1GIGH 3MLXH 5HHMB 1J0KA 1KV3A 2BSRA 1WIUA 3GHBL 4UINL 5KSBA 1CU4L 2OL3H 2V5SA 4JPWH 3C6LB 5DEFA 3FONB 3BHBA 5E08L 2ITDB 5EBMB 2A73B 1LK3L 1AGBA 1NCTA 2G60L 5ICZB 1F3JA 2OL3A 3TJHC 1NC4A 3L7EA 5FKAB 1BFSA 1X5ZA 4Q97A 3BQUB 1Z5LB 3GBMH 1D5XA 2FZ3A 2V2TA 4ZUTB 4C4KO 2K1MA 1BZQK 4PG9B 2HTKC 1QKZL 1S7VB 5TH2A 5LCVL 2VXVL 4JDVB 4BH8A 1NUGA 4KJWD 1U0QA 3ZE1F 4KI5F 1H0DB 4HCRH 1U8MB 1DBML 1P9MA 2NY1D 3NCCB 3WJJA 2XRAL 1YECH 4LU5H 5IR1A 5AWNH 5D9SB 3S6CA 5DK3A 2ZPKH 3P0YL 1NBZA 5ISZD 2FWOA 3VE0A 4S1DD 3QIBA 4DKEH 1N4XH 4U6XA 4W6WB 3CU7A 2OS7A 4M6AA 4RFNC 1IAKA 1OQOA 3I3EA 1OAUH 3PG2A 1MCKA 2ADFH 2M26A 3A6OA 3QULA 4WHTA 1LNUB 2IMMA 3CDFA 5JTWA 3QCUL 2VLKA 4YHKL 5E2UL 5EOCH 1KCSH 1CG9B 4LASH 4DJMA 2YBRB 1I3GH 5FGCE 3W39A 3NOIA 4MQXC 4K71B 1JGVL 1BBJB 4PJ9B 1MVUB 5DJAB 1QFWH 3QG6A 5JZ7C 3QQ3B 5GPRA 4XTRC 3I84A 1MQ8A 3ZKSD 3ZMRA 4MCZA 1QFUL 4XRCB 2YD9A 4FABL 2EYRB 3GO1H 2DN7A 2Y6SD 5DJAA 3QUYB 1OP3H 4YHOL 4FQLL 4NC1C 1F3DH 3EJZD 4Y4KD 2Z8RA 4DVRL 3MJ9A 2FD6L 4ODWB 5SX4I 3NFPA 3IDJA 5IMMA 4QRUB 4L3EE 4IRSC 1QSVA 3OZ9L 2NY0D 1RJZA 3PGFL 4LLWB 4R2GC 1HHHB 3EYOB 3VWJA 4U31A 4MNGB 4NRXA 4UUJB 5IBLD 1U95B 4ELMF 4JDZB 3MUHL 2VDQL 5IG7A 5DJ2A 1JYNA 4KRPC 4WV1B 1BOGB 2HVKA 3BUTA 3NACL 4PRHE 4YFDB 1TJIL 4PJXF 1YEFL 1N2RA 1LP9E 1D5ZB 4K94H 3RIFK 3P77B 5J6HA 1Z5LA 1BZ9A 4GRLB 5E6IA 1PG7H 3ALXA 4LSTH 4JFXB 1UB5A 4YFLI 2CD0A 4KI5C 2MCPH 2X05A 1JHKH 4NQSB 2W60A 5EO9A 4TUOA 4HIEB 3NPSB 3ORJA 4D0CB 4J3VA 2Z93B 5DD1L 4LLDB 4U4BA 1IAII 4N5EC 1PSKL 1T2QL 1WAAE 1F4XH 4YUEL 5CGTA 1XF5A 3GSQB 3IDYB 4I9WE 1NEZG 4IOIA 3VXTA 4N0YH 3ME0A 3V6ZB 4LFHD 3QFJB 4UMGA 4JFFE 2ICEA 2OMBA 1G7LA 1T7ZA 3P11L 4CN6A 4KFZC 1AGEB 3FOMA 4BKLB 1T04B 2XN9D 5E2VH 1H3WM 4OKVB 1BBDL 1KGCE 3UPRB 1F4YH 3VG9B 3GJEA 1S5IH 3R1GL 4X5WB 1M4KA 5C7XL 2FEDC 1F02I 3ROLA 2QR0A 3IXAA 3WO4C 3LEXB 4MZ2A 3RWEA 2DD8H 5GGUB 4HXBH 1KACB 3OPZH 3HC0A 4K2UL 4LSRH 1BEYH 3QEGH 1RJYA 2G75A 1IM3B 4MNQD 3V5KA 1SEBB 4K9EH 2MMXA 3VRJB 3J8F7 5ICZA 12E8H 5DK2B 4AEHH 3LEXA 1PX3A 4ALAH 1MCJA 1LO5A 1KOAA 4JVWA 1MJ7L 3HC0B 4CN4A 3EDFA 4YEEA 3ULSB 4HC1A 2ZOLB 4M5ZL 4RDQF 3T77A 5GSVA 2I5YH 4KV5F 4GRWE 3S3JA 3NA4A 5EC2A 4QLRA 4Z78B 1OAYL 4LLQA 5HHXH 4KKBC 3IFNL 1ZA3B 3VW3L 3L3KB 1YN6A 1CGUA 3H7BA 2WNGA 4M61B 2O5XL 3JTSB 1OSZB 5I8EB 4EN3C 2K9UA 2DQGL 4ZTPH 4FQQA 2FATH 3EGSA 2NW3A 1LE9A 3JV0A 4P4KD 2HN7B 4FTVD 2KBGA 3UBXG 5EOQH 3AM8C 4IHOA 3PWUA 3VFRB 4OT1L 3MV8A 2PXYB 3IDUA 1XH3B 3FQNB 2IGFH 2X9YA 3GBNL 3SO5A 4PGJA 1T89C 3TGXA 4HF5L 4HX1B 4XPFL 2KKQA 4K3JL 4Y5VB 3CAFA 3LH2H 3RKDC 1UZ6E 5MP6L 5EUOA 1UA6L 4MD5A 3WLWC 3U4BH 1ORSB 4Z95H 1MFEL 4M7KL 4Y5VA 4JAMB 4URTB 2WIIB 1T3FB 1LE5B 3U7WL 3M8OH 3VWJD 4C4KT 3QUKB 4MDIA 5I1CL 5EU6A 4FFVD 2ESVD 3G6JE 2PW2B 2WUCL 1XAUA 1KB5B 4GMSL 5HHMD 2NMSA 1AR1C 1KTRL 3ZHKA 4BQ8A 3TF7C 3C6LD 4Q0XL 3F6IA 5EU7E 2Y5TB 5E9DD 3FT4A 5JXEC 3GBML 3ZKQD 4NQXB 5C71A 1L9MA 2YXFA 3CDCA 3SOBH 4JN1L 4D94A 3HRPA 2P8MB 3T0EB 1FFQA 3PQYB 1BQLL 1CU4H 4UT6L 1EFXD 2J2ZA 5JXAH 4X6FA 1I9IH 4GAGH 3GJFH 1J1XL 4L3AA 3MLTB 3GBNH 3VDAA 2XPGB 4XC3H 3ZDZF 4Z77A 1HHIB 2VWEE 3QWRD 1CZ8H 1LDSA 2JIXB 5B3NA 1YQVH 4HK3N 4TNVK 5FDWB 2NY2C 5C07D 4QXWA 5EZJA 4X9BA 4EI5A 1UCBL 4OD2B 4PJ7F 2JELL 1JNLL 5ISZE 3C2AH 4R26L 4G7VL 2X4PA 4PJCE 4PJBE 4LQ1A 2I60H 3CZFA 1ZLWH 3P73A 4UOJA 2X89A 4WTXA 1DJSA 2UWEF 3VXRD 2P47B 3NCBB 1ZHBB 4XWGH 3SKMA 3RVVD 5CGYC 4NO0D 4OF6A 3QUZC 4YUEH 1JPSH 3QDAA 3VFWA 5D7SL 5DLMH 5IESH 3U4EB 1HINL 4F58H 5AEAA 2VDNH 4WV1C 5DTFA 3ZSTA 1J1PL 4WRLA 2XKUA 4R0LC 2WM0A 4WHCA 1N64L 5BS0A 1U41A 3I6GA 4BELD 4HKZB 3B5GA 5JW5A 1BVLA 4NC1E 1I7ZB 2HRLA 1OP5H 1IKFH 1MFAL 1BJMA 3PGCB 3UYRH 2FO4A 4LAQL 1HHKA 4HLJA 2HTLD 1PJ9A 1AXTH 4M5YL 1JBJA 5DMIH 4PJEB 2R2BA 4IRJA 2VLRD 5C6WH 4JCLA 2ZOLA 3VI3F 3UTSE 3TBYA 2QSCL 3BDXA 4XPHH 1F45A 4WV1A 5CGYD 3WNOA 1RHHB 5E7BA 2GTWB 2LV4A 3CH8A 4Y4HA 4GRLD 1CVRA 2HKFH 5H35A 3B9KB 3NVQA 5IEHB 2BNQE 1N3NB 1CQKA 1JHKL 1TQBC 2HFGH 4YHNA 4JY4A 1KELH 5HHOB 1KCUH 2ITCA 2JJSA 1FL5B 4KK5C 2XPGA 1DLFH 4D8PA 4P46C 4YLQT 4KQ4L 3BP7A 3INUH 5IW6B 1OM3L 2EO1A 2HVKB 2DYPA 3VXQB 3S5LB 3FQXA 4RMSA 2A0LC 1JGUH 3Q5YA 4YPGA 3CC5B 3FQWB 4KKCD 1X5JA 4YK4B 1AIFB 1A6AA 3V6ZA 2NY5C 4G8GB 3RVVC 1QSED 2B20A 1WAAA 5E7FA 4OGYL 1YYLL 2MJWA 1BLNA 1CZ8L 3P0VH 5DGQA 5LAXB 3HA0A 3QUKA 4MDIB 4R4NC 3IDYC 4JM2B 3C08L 3S37H 5IFAL 2PW2A 2BNRB 1K8IA 1WZLA 5GRWA 1D9KD 5E8EA 3BKJL 3PJSB 3AC0A 3D25B 1IL1B 3HC3H 3IFPA 5C0AE 2AJZB 5TE6H 3KLAA 2YWZA 4G6FD 1N0XL 1KLFA 1UXWB 2BERA 2GAZB 1RJYB 1RUKH 2G75B 3QG6B 2EYTA 4JFDE 1BVKA 1PZ5B 3OL2A 5IBTL 1YEGH 2AV7B 5TE7L 1WZ1H 2NLJB 4XT1C 2IBBA 5FO7B 5C08E 1W0WB 4NRZA 3AUVA 4HFWA 2VNCA 4NDMB 4DGIH 3PWJB 4Y2OA 1ZA3A 2E5EA 4FZEH 4NRZB 1RI8A 5I76A 2O5ZH 4PJCF 3V52L 3DMMB 2X41A 4ZTOH 4IRSB 4TSBL 3HNSL 1C7SA 4NZTL 2P8LA 5JNYA 1V8HA 3QJHA 1FNGA 1JGEA 1J1PH 2VB5A 2D31B 2VLRA 3MRKB 3IS1X 3HCVA 4BM7A 5ILTL 2DAVA 4IDJH 2A0LD 4PJHB 3OKEA 5FM4A 2DQTH 3CFCH 2XQBL 1T0MA 4HQQL 5FKPA 3SKMB 3TEUA 3LKSB 1QQDB 1EEQA 1U93A 4PY7B 2KQNA 3HMXH 2AXFB 3O3BB 4XPBL 2IFFH 2NY4D 4BA8A 4JGMA 5GGRY 4ISVB 3RTQB 5F70A 3V95A 5EO0B 3TO2B 4PJ9C 4NQDD 3O8XA 1CG9A 4HC1H 2VO5A 4NO5B 5IVXF 2Z35B 3QDGE 4N90E 1NBYB 4JHAH 3L3JA 1I9JL 1I9EA 4LLYA 5L9DH 2DYPD 3MZTA 3VD7A 1GGBL 1NFDF 5T1MB 4XHQA 35C8H 3OG4B 4J4PC 5HYFA 2VXSH 3QFDB 4NUGH 1RVFH 3C2AL 5FGRA 4HPOH 1BIIA 4LLYB 3O11A 1AI1L 1MNUL 3NH7L 4PPTA 1QSEE 1G7LB 3HC4L 3QEHB 1BM3L 2MHAB 2YR3A 2CUHA 4BFGA 4GKNB 3OKMB 5EOTB 4Y1AE 4MD0B 4G80B 5CLTA 5A43C 2V2WA 4G3YL 4QCIA 3PWVB 5HHME 2G5BB 4OLXH 4LLAA 3JWOH 4LMQI 4K8RD 5BV7L 4HKJA 4XCEB 4JO2H 4KKAD 3TA3D 1B6UA 5J9PA 1FVDB 1EZVY 4QTIH 3O41A 3CFEB 3T2OA 4LDLB 4M6MH 4Y1AA 4GMTH 3FQTB 3PIQA 3RDTC 4CN1A 3TO4D 2HKHH 2E7BA 1FH5H 5LQBL 4NT6B 5EZIL 1FZKA 1NLDL 4X8JA 3IGAA 4NDMA 3VGDA 4KRNA 5ADOL 1WBYB 2AXGB 2FJHA 1KIRB 4H0IA 1PQZB 4XCFL 1Y0LA 2HYMA 3K8LA 1P6AB 3DUSB 3GGWB 4O2FA 5F93C 3OF6A 4UV7H 4DN4H 2F9BT 5KVEH 5CINL 5DVOA 3K74B 2W9DL 4OZIB 4OFPA 4PYHA 3FB6A 1SYVB 4MS8C 2AJXL 4PIRF 4OD2A 3RKDD 4ONHB 3GSRA 2EDJA 3ECBA 4L8SB 5IBLC 3VJ6A 2C3HA 5TJWK 1J86A 5D8JL 3SDAD 4ZAKB 1KIPB 5BZWB 3V0WL 1HI6A 1YUHA 3S36L 3WBDA 5FUZH 3EO9H 1U3ZA 5IROA 4YDLB 2IC2A 2UZXB 4RA0C 4OI8A 1YY8B 3FZUD 3RU8L 3B9EA 3UTQA 1CGSH 2YA0A 4JG1H 1CD1A 1EA9C 2FBJL 4LCIH 1R3LA 2AEIT 1T1ZB 1ULVA 1J8HD 3A6CL 3HG1A 4O5LH 2YRPA 1MRCH 2R2BB 2HLFC 3NZ8A 3QIBC 1T22B 4MA1B 4MAYD 5CD5C 2EDBA 3CZJA 2EC9T 4PLOB 2BVOB 5HYJE 4DW2L 2RHEA 3QCTL 1LILA 4ORZC 1QSFD 4JQIL 1IEBA 3KWWB 5DD6B 5DURB 3TN0D 5HXMA 3C8KB 4PJ5E 5CKGA 3UTTB 2KH2B 3RZCC 4PV9B 4M1CD 3V79C 3PQYA 4FQ1L 2W0FA 3G9AB 3HE7B 4D3CL 2AJYL 1BZ7A 1KCRH 2IPUK 1NCAL 4GXVH 4OM1H 1FIGL 1EZVX 3MOAL 5GXBB 1FORL 1NMCB 4KJWC 3P11H 4WW1B 2RR3A 3DXAE 2E7LA 1V7NL 2CKBB 3BGFC 1A1NA 3EBAA 1UM4L 5E2TL 2DQIL 3CFBA 4HPYL 4P2RE 3C5ZB 4F2MA 4X9GA 1JYWA 4P5TB 1NL0H 4FQXD 2YOCA 2DDQH 3Q6GH 1RZFH 2R2CA 4PRPE 3RWIA 1MQKH 4RZCA 4JRYB 4MWFB 1II4E 5HVFB 4JFFB 1J7VR 4PRAB 4JAMA 4YPGB 4WI5A 4OBSA 3F5WB 1P4BL 5KS9B 1K5NA 5D5MF 4XVJH 3TJEH 4C54A 4LSDA 3MCLH 2GY7B 4H1LH 3HI6H 5D70H 3X11A 4K3EL 4WWKB 1WK0A 2YPKA 2ZSWA 3ULVL 4JO3H 1A8JH 4XP9H 4ETYA 1INDH 3DTXA 3G6JF 3RJDA 3QO1A 1MJ8L 1ZHKB 5IBUG 4JFZH 3FO9B 3MNVA 3T0WA 1BVKB 1FYTD 2F58H 2B5IC 3BZFB 3GDBA 4NQXA 4GS7B 1J12A 4P2QB 2P42B 4DKDC 4F8QA 1I7UA 3D5OF 3TH2T 3X17A 3VDBA 1L7IL 3SE9L 1ZK9A 1EEYA 3CMOL 5ID0B 5DEFB 3NZ8B 4QRTA 3SDXF 5F9DC 3WHXB 2CGRL 1HOCB 4PJIE 1A7OH 4R90H 1E4XL 3GSNA 4N1CA 4ONOA 1EUUA 3WIIL 4G6ML 1BVZA 1EEYB 1E27B 2JIXA 3QPQD 5E0QA 4JPIA 3Q6GL 2ICCA 3DROA 3MA7B 4X7EC 4BSVB 4GG6A 1F42A 2C1PB 4JGUA 3K2UH 1F4WH 4OZGA 1OF2A 1D6VL 3UJIH 4NZUH 1JZ7A 1NGWB 4X5XA 3MYJB 4CU8A 5E8NA 1AY1H 1F6AA 2AI0L 3NABH 3I6LD 1C5DA 4POZD 4HC1L 3HTLX 3Q3GA 1CXHA 3V4VL 3DHMA 4PJDF 4ODSL 2SEBB 2PO6C 4NN5C 4S2SB 3REVB 5B8CA 4R26H 1QLEL 2JJUA 5C08D 3R0MA 4UAOB 2BDNH 4ZD3L 4RWYH 2KZ1B 2ICWJ 5JPMA 5SWQB 2OX5A 3ARFC 3ARWA 5TDNA 3U7YL 2VXQL 3T2QA 3WLBB 4EN3B 2IG2H 4XNUH 1FLRH 1XCTA 1LK2A 3VMOA 2ZSVB 3T4AB 4DZ8A 4OLWL 1V3JA 5KSAB 4LLDA 5CJOL 2VDNL 1IC5L 1Z3GL 4HGMA 4OGAC 3L95B 3ZKXC 5KVDH 4BQ6A 2IQ9L 2D9CA 4M3JA 4YHLL 1TDQA 1P1ZA 1P7QA 4GMSH 2DQDL 2J8UA 4NZUL 1C5BL 1ZHKA 3FO9A 5C0EA 1MJUH 4MX7B 2EXWD 1BQSA 3D18B 32C2A 3ZHLA 4YHML 3VXMB 3WIHL 1FNLA 5EB9A 2GAZA 2QQNH 4RWHA 3RX7A 1FVEB 2JK5B 3L3HA 3FQUB 1R5IA 4QRPB 2HJKB 3TCLB 5BXFA 5H94A 2Q6WA 3P9MB 3PDDA 1XGUB 5J8OA 4UU9B 3ARDB 2AXGA 2A77H