1RIIA

Crystal structure of phosphoglycerate mutase from m. tuberculosis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
243
structure length
243
Chain Sequence
ANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSLLRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSYDTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLRVGKTVLIVAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDPEAAAAGAAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.70 angstroms X-ray crystal structure of Mycobacterium tuberculosis phosphoglycerate mutase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
molecule keywords 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
total genus 92
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 2003-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1riiA00
4EO9A 2IKQA 3R7AA 2P6OA 3E9CA 2RFLA 4D4JA 4D4LA 3E9DA 2OWEA 2P30A 3E9EA 1ND5A 2QNIA 3LNTA 1T8PA 2YN0A 1XQ9A 2P9ZA 5AK0A 1ND6A 2P9YA 3NFYA 4FDUA 4TSRA 1E59A 5AJXA 3D6AA 3IT3A 2AXNA 1YJXA 3FDZA 3IT0A 3DB1A 4PZAA 3QPUA 2P77A 4ARSA 2A9JA 1H2FA 5HTKA 2HHJA 2P9FA 2A6PA 3FJYA 4ARUA 3QPVA 2EOAA 3BIFA 1BQ4A 1SK8A 1NT4A 2P6MA 1H2EA 4GPZA 1C7ZA 2H4XA 3DCYA 1SK9A 3F3KA 4D4MA 2GFIA 3D4IA 4AROA 2P75A 1SKAA 2ENWA 3FDZB 1TIPA 2H0QA 3LL4A 4JOCA 5AJYA 2WU0A 5AJVB 1DKPA 1DKNA 1EBBA 1IHPA 1DKOA 1RIIA 3PGMA 2P2YA 1E58A 3EOZA 2EKZA 2YN2A 5CU7A 1UJCA 2HPAA 4EMBA 4IJ5A 1DKMA 4PGMA 3K4PA 3ZHCA 2H4ZA 3C7TA 3EZNA 3O0TA 4ODIA 1QFXA 1BQ3A 1RPTA 1FBTA 1BIFA 3LG2A 3KKKA 3GW8A 2DWPA 2DWOA 2I1VB 2H52A 4MA4A 4IJ6A 1RPAA 5AJWA 4JODA 4E3WA 1UJBA 3MXOA 1V7QA 1QHFA 3IT2A 1FZTA 4PZ9A 1DKQA 2P78A 2WNHA 3GP3A 4JOBA 2PA0A 4ARVA 4HBZA 1SKBA 2F90A 3OI7A 1YFKA 2BIFA 2ENUA 4D4KA 3NTLA 2EKBA 4GPIB 5CX4A 5AJZA 5PGMA 3F2IA 2P2ZA 1K6MA 3D8HA 3GP5A 3QPWA 1DKLA 1CVIA 2WNIA 3IT1A 5HR5A 1C81A 1V37A 2OWDA 1C80A 3MBKA 1QWOA 2P79A 4QIHA 2HIAA 3K4QA 5CDHA 4FDTA 3HJGA
chains in the Genus database with same CATH superfamily
2I55A 3IAEA 5JJKA 1N5MA 1A98A 2Q1SA 3NIDB 2ONCA 1JMYA 4GSLA 4D4JA 1AA6A 4RJLA 4UBLA 1R0WA 2OWEA 2RC5A 4HKTA 4DVJA 3GY0A 5LQAA 1VL5A 4L9SA 3A1EA 4HRXA 2IOFK 4UUBA 2EJCA 5DX1A 4TSRA 4B76A 1PSWA 4R2LA 2H17A 1B0PA 1QAMA 2WSBA 4RA9A 2EG5A 1ZJ4A 3FKSD 3K16A 3CTMA 3F9CA 1T8YA 3V1MA 1TCCA 3FBWA 3DDCA 4R8VA 4WLOA 3OZTA 2PSJA 4NFYA 4PLCA 4XX0A 1ISMA 3BFXA 3HUFA 3MMZA 1QIGA 3KDPA 3QIVA 4RIIA 1K75A 4FLFA 3KOXA 3U39A 1TLTA 1XRPA 3E48A 3ECSA 3V97A 2GHIA 1UPUA 4MI1A 4MV6A 1QRSA 2HHJA 4CKBB 4F21A 1LLDA 1AKEA 2WJJA 4PG4A 3G9QA 1OU0A 2DM6A 3BIFA 1LNZA 5DI9A 1V1RB 2R62A 2X0JA 3RQSA 2HCBA 3MUOA 5ARCA 4DJTA 4XWAA 3GNSA 4BNDA 1MKYA 2P6MA 3M5DA 2BFDA 1NVMB 4OUDA 2HCJB 2B9VA 1SQ0A 2NADA 4XW2A 4ECAA 2IYZA 1FJXA 1SHJA 4OA8A 4OJNA 2R97A 2B8EA 2X9GA 1Z07A 3HDQA 4HHEA 4Q7KA 1ZMOA 5F33A 2WWVD 1YRBA 4J0CA 4KOAA 1W581 1UZMA 1YJBA 3VDNB 2VYND 3DTVB 1KP3A 3FPBA 4TMZA 4YLGA 1TAQA 5BPHA 4KWHA 3OQIA 3TB6A 1SBQA 5TT0A 2Z3WA 1RSZA 4AM8A 3DE1X 4P34A 4BX8A 3QIAA 2H1LA 4NAUA 2PX3A 5HA5A 3EVZA 1N2OA 1N4AA 4PVCA 1ZPDA 3HPRA 4RY2A 1ULBA 2XXJA 2CZCA 1V2HE 3B1VA 3P27A 4JJGA 2WPDD 4G36A 4JWKA 4KI0A 1SCUA 2WHEA 3GDFA 3OT4A 3KKPA 4ZIRA 4PWYA 2FEWB 3GJ3A 3PE6A 5B1EA 2YH2A 4L75A 4O02B 3ILHA 3OLCX 3NIWA 2C0CA 4BUZA 1J8DA 1RBMA 1RYZA 4E21A 2B4RO 3CF6R 1APBA 2YFQA 5FBQB 4YECA 3L9XA 3MYYA 4QAQA 5BMVB 1E61A 4ARIA 2PVCA 2Q7OE 4G8JA 2VUIB 3I9LA 5T8KC 4YUYA 3PQ5A 1FE8A 1OKKA 1V7QA 3P52A 1NI3A 1SUCA 3HDYA 1F7VA 2WJYA 3IIMA 2GEVA 1E2FA 5ARDA 2CL0X 3QVGA 4LSMA 2VS1A 3K09A 2IRWA 1IC6A 1MOPA 1BS9A 2EP7A 4WGGA 1J8YF 5L40A 3A8TA 1DO8A 1VLJA 5F9HA 4INPA 2IP4A 3BAZA 1JI0A 3JQ6A 3SI7A 4YCBA 3LXMA 5BXQC 2IEYA 1A9SA 5HG0A 4DCTA 2W2NA 4UQOA 2IUEA 1CBUA 2BHRA 5KC8A 4U0JA 4CEJB 1C81A 2PGXA 1IEQA 5GGXA 1I7NA 1P39A 1Q5PA 3CUEF 4I5FA 3VI4B 2NP6A 1TDJA 4LHXA 5JNVA 4J4BA 2EZ4A 4CN8A 1MP0A 4YRPA 3IS3A 1VHJA 4AWXA 4DDTA 3LOPA 4BVLA 4ZV4A 1M73E 1Z4MA 3RFFA 4CV2A 4DLBA 4TMVA 3VDRA 5ANRB 2HGZA 2W2MA 3EIXA 2X19A 1TUBB 3ZH9B 2H5IA 5IZCA 2EZUA 1QP4A 3IOMA 4P80A 3W34A 2BGUA 1WB4A 4KPUB 3GLIB 4DR3B 2R8OA 5TRTA 4BKRA 3N05A 1FLDA 1HM5A 3DMGA 3FF1A 1JQ3A 4ZHQF 5CYOA 2QA5A 2HJGA 3PQCA 3KLBA 4E14A 1PZMA 1Q3KA 4HQ6A 3EF1A 4RHXA 5J40A 4IWNA 3ZTYA 2FETA 4N3GA 1C9NA 1HDCA 4QNMA 4XQEA 4G1VA 1KVRA 4RABA 1VGRA 1G6HA 2H2WA 2G25A 2JH9A 3AFIA 4R8SA 4X63A 5J5CA 3RVBA 1YB2A 4EJ6A 4EKGA 1VKRA 2X7HA 2Z30A 1JI3A 2HCRA 4XVHA 2O8CA 2P40A 1Q1AA 2ZJ5A 4Y2UA 5DCLA 4N5HX 1W1IA 3I4FA 1VJDA 2Q5JA 1W4CA 5D7NA 4INZA 5BW6B 2H18A 3BYZA 3KIPA 4F2GA 5J2UA 1T8TA 4MKZA 1Q1GA 3P9YA 3LCVB 3UG6A 4LOAA 1V2GA 2O9JA 3TAXA 2C00A 1ILWA 1RWKA 1ZJYA 3T3DA 1QRTA 1HSOA 3KE9A 3SHWA 1NZFA 2YHUA 1EVYA 3STYA 4S04A 3RC9A 1XMXA 4B3BA 1QCDA 2XQVA 4PU0A 1LPNA 1OF1A 5ICSA 1WHTB 4OGGA 1Y3HA 5CDFA 5CFMA 4MDEA 3NDPA 4OFXA 1DV2A 3CUSA 5DT9A 4YQFA 2EBFX 2JASA 4CTMA 2KE5A 4B3HA 5K8VA 4X62B 3ETCA 4UARA 1EM8A 4Q1DA 5JV5A 1JH9A 4K88A 4EMUA 3V48A 1IPHA 3ECAA 1JDUA 1RKVA 1LSSA 2A0WA 2P2CA 1RBYA 1QRAA 1XDBA 2J3KA 2EP5A 3FLEA 5T64A 3OAAA 4N5IX 5AUPB 3V8VA 1YDMA 1DTWA 1USUA 2AE2A 2MT9A 3KEGA 4RGVA 1FS6A 3JYPA 1F48A 2TMYA 3MELA 4NBNA 4TV9B 2UYHA 4JODA 5K01A 3DHYA 1UXGA 3NWJA 5L53A 4LWOA 3IR7A 1JA9A 1QYCA 4HWOA 2EZ9A 4E1BA 1Q0HA 1F38A 4HSGA 4WNYA 4ZVRA 5C8YA 5BMVA 4AJEA 1SIBE 5AESA 5LQCA 3IR6A 2DHEA 4JT2A 1LTQA 5F51A 2IT1A 2OAEA 2VWPA 2BBTA 1KI1A 3H1PA 4UVDA 4UTVA 2QJWA 4Y2YA 1WX1A 1FIUA 5G1PA 4I46A 3NP7A 4HH3C 3X1XA 4C7XA 3PTAA 3HM9A 2OBFA 2DQ4A 2GNPA 4Y30A 3KKZA 3EG9A 4ZDKA 2J0UB 3WX0A 1HNZB 2O3RA 1WW8A 1I0IA 3O91A 1HTWA 1OILA 2YV1A 3LH5A 2J9XB 3RIYA 4TTVA 3WGVA 1RP1A 3C5CA 2J5QA 1SJ9A 3ASZA 1ZKMA 1PIWA 2ET6A 2FUG1 2D1TA 3H7AA 4ZEVA 5AW4A 2H1OA 2I1LA 1EVJA 1CUUA 1R4NB 3UMCA 1SKMA 3PE4A 5AKXA 3EVAA 2CXPA 5FPHA 1O6CA 2ZSHA 3MG9A 4NWIA 4YRCA 3O7MA 2JVKA 3ZIUA 1IM5A 2RG7A 3O38A 4HQNA 1JNXX 1W30A 3A4TA 3ADPA 1CG6A 3R6GA 4WUTA 4EFKA 4HDSA 3H05A 2C61A 4II2A 2MWMA 3GZNA 1WU7A 3MLEA 3NKLA 1T1SA 4D98A 5ITVA 4AJ4A 4B85A 3BIOA 5ELMA 1U7ZA 2R751 3R7SA 4I4TB 1IU9A 3U7EB 1GZUA 4PTLA 4DSAA 5BW5A 4HAWA 3ZJTA 1VGQA 2CE7A 1OIWA 2PR2A 5KHOC 4C76A 4DYDA 2ECFA 3H5OA 3MGAA 4LDAA 4NCNA 4C30A 4ZI5A 3PUJA 5KCZA 8MHTA 4R71A 3WXMA 1GRQA 1LLQA 1PQPA 1Q77A 4TROA 2PHZA 1A3CA 2XKBA 1Z6AA 4LJ7A 4MWBA 3PGKA 4YDSA 2D62A 4ZALA 5TSDA 3WL5A 2JAQA 3AEQB 4PIVA 4TMTA 3IEPA 4NMWA 1NG1A 1M2HA 1P1HA 1TECE 2BUAA 2XWQA 2XYPA 3GT3A 1C0KA 1A8SA 3Q7RA 4L6AA 4MXDA 3WJ2A 5BNTA 3GIWA 5DCYA 4IYRA 4CODB 2ZSKA 1AV7A 4GP9A 4KBYA 2Q50A 2C3MA 5DHTA 5GPBA 2IF0A 1U3DA 4YB8A 5DBOA 3DOEA 5KTNA 2X4DA 3EIEA 5KQSA 3CNBA 5CR9A 3EZFA 4PBTA 4CM1A 1RXIA 3KKOA 3ZU5A 5AUNB 4G65A 1C4OA 3NNDA 1RYFA 1BNCA 3EGDA 4OVKA 4Z1MD 3TECE 4HJXA 1B42A 3LUCA 4R0VA 3ILYA 4BMXA 1A7KA 3UCFA 1WLYA 4R40A 3S29A 5TE9A 4BNMA 4TV8F 3WDSA 1J33A 1NN3A 2VDRB 3T5PA 4EQ6A 2UUCB 2QAGB 5L3QA 4XCVA 3JASB 2J3JA 3I0ZA 2DUMA 1S96A 1IZZA 2XUKA 5KMGB 3H5LA 4U2KA 1CS0A 4PSVA 1NMYA 5EGNA 4HB0A 4A9AA 4EA7A 3O2QB 3T15A 1K1EA 1KI7A 1ORVA 4KN9S 3UK1A 3P0FA 2GM9A 3FKJA 3P0HA 1GKUB 4MYCA 4DZRA 4N0DA 3H1TA 4PLHA 3TNFA 5DFAA 3ZK8A 3GUHA 3T3PB 1W0CA 4ENUA 2ZUFA 4UTZA 4G4SO 1KK2A 1O4VA 2RGNA 3E22A 4DDKA 1L1FA 4F9TA 3AF5A 6GPBA 2ZUEA 2P6PA 3DMNA 1UEJA 3PIRA 3NVMB 2YVUA 3AUUA 2NXJA 1RU3A 3Q5DA 3QKRB 4IDHA 1SHKA 4KGXA 3WMFA 4DBLE 2RCNA 1RPAA 2ODEA 2W6QA 3QVMA 5J4KA 4BLPA 1DTSA 4CM5A 2ZYHA 4P58A 4N8SA 3U80A 3OTIA 3DHWC 3U5TA 4D02A 1DAGA 3ETHA 1JBEA 2C5GA 1KC1A 4DY4A 2XZLA 2KB0A 4WZBB 1YIAA 3C15C 3R6DA 2OBYA 5P8WA 2O2GA 1Z6YA 2BIFA 2QPAA 1OBCA 5KQMA 2YJZA 2JFZA 1GAQA 1NBOA 3NTLA 2OP0A 1MEOA 1U1DA 1JLHA 3QUAA 2SBTA 4H7FA 3AVVA 1MEJA 1M8GA 3M5CA 1D2GA 1USWA 3KO8A 5CFRA 1C4XA 3QW2A 1BEUB 1K6MA 1R0YA 1M1YE 2J0EA 1ST3A 1GKIA 3WOVA 5CA1A 4HFMA 4HH0A 4IIEA 2WBLC 4N65A 3AZQA 3LQ1A 4BQOA 4TZKA 3ZNPA 4HG2A 1C5KA 1X14A 3ND6A 3MTIA 3CJQA 3OBIA 2ZIXB 2X0KA 3EE6A 3GH1A 3CO5A 4GQIA 4KWEA 1C9MA 2ZSBA 5IH3A 3R5TA 1VRCA 1Y4DE 5M7EA 4ZRNA 1PJ3A 2NXWA 1CRWG 1YB6A 3L6DA 4IIVA 5BR7A 2KMLA 6REQA 2VTKA 2M6KA 4Q4JA 4BEWA 3LUPA 4HGZA 5JNLA 1TYEB 4F5DA 4HDCA 4FGZA 1VA4A 4PQRA 5EEGA 4BQEA 1RYYA 4YAKA 3L7AA 4CUZA 4IJKA 3ESYA 1R37A 2V4MA 4PAWA 4EY4A 3JQBA 2I33A 1V4BA 2FJUA 3BMXA 2PKCA 4F86A 3KJQA 2HUPA 2G9RA 2RGRA 2X5XA 2ZW9A 4Q3LA 4MIOA 1I2CA 2CHQA 4FU0A 4M1WA 3D6AA 2D0IA 1FRNA 1TM7E 3HB5X 1E62A 4TV9F 3A1SA 2BD0A 3OIDA 2XCQA 4L8LA 5FA6A 5KYXA 2VA8A 2IPLA 1EDOA 5H80A 2D2XA 1Q19A 4A8TA 4X24A 3PC4A 2PLWA 1AS3A 1DMSA 1U9IA 4FGWA 3DDZX 1KERA 5I8PA 4EFDA 2ZDHA 3S8EA 2UZ4A 3UAVA 1ZD1A 3ZE0B 2O2DA 3HJFA 3G1TA 2O0MA 4RPHA 1C3LA 2EOAA 1P0IA 4AKGA 1ICEA 1SZJG 1NZJA 4GC9A 1NTOA 1D1QA 3L5KA 4NX2A 4DMMA 3OMWA 4BO9A 3S4YA 1MPXA 5KSZA 3F3KA 2YV2A 3KT3A 4RTQA 1TIKA 4IZIA 3O2NA 1MX5A 1BG6A 4YROA 4A82A 2QRPA 4GIBA 2MCFA 2WFMA 3WNQA 1OCEA 1WQ1R 2VUHB 3F1KA 1XZAA 4GZMA 5EHIA 3ZLTA 1SIOA 4UD6A 4POAA 1O9GA 3KLOA 1NLFA 5EMHA 5LMUB 1V5IA 2QT0A 1JFLA 4AJLA 3Q72A 4DA7A 1CYEA 2O2IA 2HRDA 4X44A 3NDRA 5DISB 1KAEA 1NVAA 4AX8A 3ANXA 4QOIA 3OLXA 1WOMA 5A3JA 4B33A 3R5XA 2XW6A 1FUEA 1V7CA 3FPSA 5JT1A 4YJFB 1Y3BE 2A1UB 2A1IA 3K4PA 1UXIA 2BHTA 4UNPA 4XGQA 1XGKA 4AZ3B 4L15A 4YAIA 8LDHA 3AW8A 2ZQZA 1T3SA 1KBZA 1PFKA 1QFXA 3KOZA 4GFDA 4LY3A 4BJ6A 2OG2A 2D5LA 3IULA 5I7FA 3QK7A 2DWOA 4B3DA 2GYUA 3EOBI 3HS3A 1IBCA 2GDZA 1JXAA 5ITZB 1SUPA 4WKGA 4DDVA 2RD2A 3G9UA 2BWJA 2BFBB 4GMDA 1UJBA 3C3BA 1U7UA 3FNRA 3O3CA 1BC5A 3DTTA 2H7VA 3O8DA 1GLGA 2PZFA 3PFWO 4PZEA 3ZVKA 3WHPA 4LMRA 1QH9A 2NYUA 3K0EA 4JR1A 4UHKA 4UZFA 5FYQA 1XQVA 3FMPB 3K8QA 3KM0A 4FOPA 5CW2A 4Z54A 4LF7B 1ZC4A 2FX2A 1X7XA 2X8BA 2W70A 3RIMA 2DPMA 2WF5A 1FTWA 1NQUA 2XBUA 3GYBA 1HKHA 5LFAA 4NATA 2N46A 2VH1A 1L4FA 1QUFA 3P97A 3RDPA 5JYDA 4H16A 1R9GA 1H3NA 2AMVA 4LCJA 5EJ5A 1M6VA 1TA9A 2LCIA 3OPQA 4BEBA 4F9FA 4YX9A 4I55B 2XLCA 3Q98A 4YRDA 4DLSA 2EX4A 1EP3B 1S3SA 1R6XA 1Z25A 2WJPA 2MSDB 1Z08A 3C45A 1CQIA 1U9IC 1UIRA 1XLVA 2ZCUA 4WRRA 5FUMA 4JOQA 1VMIA 1XU7A 3PL5A 4U5XA 3SKYA 1EEXB 3WLEA 1G5HA 4AG6A 2H16A 3GUUA 2JZCA 2KLHA 4LK3A 3JR3A 4OLBA 4Z4HA 4J91A 2VF8A 3ZY3A 5CVUA 1VLLA 4CTJA 1PDVA 1RAHA 3PUYA 2FUNB 3U9TA 4FTWA 2Z2KA 1VB5A 3F6RA 2CL5A 5GOTA 3RS7A 3JAKB 4M46A 3ZJYA 3WWZA 3PXUA 4MYSA 1YFJA 3UJPA 5KYYB 3G8CA 3BXFA 1L8XA 4HLUC 1GPWB 2PNJA 2OGUA 1MAWA 1OX6A 5CM9C 3AP3A 4GX5A 1VLZA 3VA7A 2GZ3A 3MINB 3QLUC 1TYCA 1KZ9A 3L8EA 4HFNA 4QUGA 4X90A 1K5PA 3QE2A 4WK4B 5HF8A 4P4NA 2C83A 3ABSB 4W5HA 1YDWA 1H8HA 3DM9B 3HNPA 1TZBA 5EPUA 4QTYA 3FE2A 3RTBA 4K9QA 4O8ZA 2ZYSA 3E5RA 4LWQA 2VZEA 1ZCFA 1CDOA 1JSCA 5K3BA 5LQSA 5TGDA 3ZS8A 1Y4AE 2X1MA 3QEJA 3AEZA 3TR5A 1SC6A 2PZJA 4HZUB 2AVDA 4LOKA 3RCBA 1IIBA 1RT9A 1C7IA 4B43A 2P35A 1N2ZA 3WFIA 3Q3GE 2BT4A 2ZZMA 3O1IC 1A9TA 4GU5A 4B4UA 4PN3A 5J63A 4MEBA 2AFHB 4LMBA 1ZN8A 1P1BA 2AOXA 1NJ8A 1Y8QA 3ADKA 3EDOA 1I3MA 2FFJA 1B3BA 2QW8A 5L51A 4IEFB 2DECA 3HO6A 3QEMA 1FVXA 3SGLA 3DE5X 1Y3FE 1J0AA 3WK4A 3EQZA 4Y1GA 4NCHA 2RIPA 4QLOA 3RRJA 4URXR 4QT4A 2IZZA 4M0LA 2GYVA 4G0VA 3FNQA 2R9VA 2WM3A 3WJ7A 3BIWA 4BP8A 2PD3A 1ZNQO 4K6GA 1F2DA 4PGMA 4W1PA 3L93A 5A4IS 1SZPA 1NR7A 1ULAA 3TIGA 1P72A 1L4YA 3E8SA 2G6TA 4GNRA 4HAZA 5HHTA 1V16B 5JY1A 4N41A 2YDXA 3MJFA 1RLMA 4Z7OB 4EJMA 2EF1A 1O3YA 2P9EA 3IXLA 2QSJA 1NW3A 4XR9A 4YXWA 4PM4A 1ZJJA 4KWCA 3ZXYA 3ZWCA 3AVYA 3I28A 2COUA 3ELBA 1L5FA 3MNFA 4GX0A 2WF9A 2C7QA 4D4KA 2HV9A 4QRHA 3E9NA 4NQRA 3T8YA 3WLIA 2C78A 1JIKA 2PS9A 1E1QA 4HYYA 2GCGA 4HNVA 3ROTA 5F23A 4KIGA 3H3FA 3PL1A 3L49A 2C92A 3JPWA 1HLPA 2P9JA 4YGXB 3H5NA 4MGKR 1NQXA 2YVKA 3EMBA 4EHKA 2Q2OA 3QE4A 2IOQA 4F9GA 1PUIA 2C8LA 2H65A 1M5UA 3LK7A 2VZ9A 1XMIA 1XLUA 3N7AA 3FUXA 1MRZA 2QVBA 4BX3A 1VKOA 1XKTA 2ONKA 3BMNA 4IIJA 1Z45A 3CN9A 3G0IA 6ABPA 2UZ0A 2BZGA 5E1OA 1P0QA 1OZAA 1DQRA 2W2OA 5FNVF 1P7YA 3H19A 1RWPA 1U2GC 1Y1PA 3G3EA 5L7YA 1TEZA 2PZLA 2WIJA 4QGAA 4M1MA 4NV0A 3IBGA 3MMPA 1O97D 3VR6A 4L0QA 4IXDA 4W8OA 2HK6A 1KJQA 4YLEA 3WGTA 3HDHA 2WIBA 1UAAA 3AHGA 5MGBA 4KQMA 1V39A 3E9EA 2Z8ZA 4II7A 1H4SA 1FSFA 1KJNA 2DF8A 4Q3NA 1CJSA 1Q3HA 2HWYA 3U44A 2PZAA 4LZZA 4JLDA 4ZCQA 1FBNA 3SF0A 3I2FA 2Y27A 1CUAA 4X7BA 3WYAA 3CRW1 4KUEA 3B53X 1PTJA 4C4TA 1DLJA 3FMGA 5FBHA 1B0AA 3BCUA 1PSDA 4F3KA 2C3YA 1JHRA 1RVDA 2KPOA 2R6FA 4JBGA 1I2DA 1N2SA 2C54A 5AJTA 1D6MA 4HATA 2JLWA 5EL0A 1MO3A 1Z39A 4LV6A 4RDIA 4EUNA 2FJPA 4QYXA 1RCTE 2OZVA 1DAEA 4GZ5A 3AF0A 2A3NA 3D2CA 3B1KA 2MYUA 3H8VA 3U7GA 3SC6A 2ON6A 3M9XA 1EFKA 3ONFA 4JLUA 2G28A 4YT8A 4I99A 4QXMA 5CM2Z 4QZVA 1TKBA 3NHZA 2OL4A 2XT6A 3RGWS 3E9QA 4M4SA 5J2UF 5EHQA 1SC4A 3VKWA 2JJMA 2PPVA 2ADOA 3CVUA 1NR1A 2QVZX 4ZC1A 1OI4A 5A5EA 1N2CB 2BF7A 1JHUA 1G7TA 1U7XA 4R41A 4MRPA 4H0FA 2HW8A 2GPYA 3ADOA 3TRIA 2YV5A 4HQRA 1BHQ1 1XB2A 4OH7A 1Z0DA 3PUVA 1G0OA 1WM1A 3GXOA 1KDTA 3PIDA 4HMPA 1NP6A 5HKAA 1UBLS 4P5DA 1QHGA 3MD0A 4OX9B 1QDUA 3KQMA 5GJWC 3P2OA 3KCQA 2PH5A 1SCIA 1SRQA 2HMUA 4PQFA 4X7MA 5EJGA 2OB1A 4J07A 1FSSA 3N07A 3HCCA 3FCEA 1NMSA 1GKKA 4EYEA 4YXFA 4Q1FA 2VHQA 4NC9A 3UK7A 2RGBA 2JHAA 5LXTA 4ZHQB 1E0AA 4J0QA 3WWYA 3ICOA 4IVNA 3K1JA 3UOGA 4BFCA 3A4YA 2O54A 2JIDA 3ZE7A 4I19A 4BZZA 4YR7A 4TXMA 5BOSB 1DCFA 2VAMA 5EJEA 4JLSA 1BVUA 1JEDA 1G9SA 2VP2A 3NDBB 4H60A 4Y67A 2PGOA 3GP3A 3SEZA 1LEHA 4EG4A 1NXWA 1BCRB 2DTXA 3HJNA 4W8HA 5A7GA 3AETB 2WSSA 4IHQA 3BXGA 4U9UA 5CD1A 1SBNE 2CZGA 4BV8A 3PWKA 4K8RB 1NW4A 3PEEA 5BQ3A 1HZZC 1PR3A 3B6IA 4NCJA 4YJHA 3RLIA 1LBQA 1XJCA 1JIJA 2QR3A 4LZWA 5EE3A 5IU6A 3PEYA 4K5QA 1DBIA 3RWOA 1IEWA 3AR7A 3LLUA 3Q8WA 4XYBA 1J20A 1ECFA 2N0SA 3ML1A 2HA2A 3LWBA 4KGZA 4IHJB 4M7WA 3GXBA 3Q3HA 4CFZA 2G6BA 4CR8A 5EHZA 5I9TA 1D3AA 5HTOA 1XD9A 1V4NA 3FIUA 1RM4A 2NVUA 5IANA 1YTUA 2Q3CA 3MWJA 4FR0A 1AM4D 2L42A 2CJFA 4IQFA 1VMEA 3NAQA 1ULTA 3PQEA 1OYVA 4RSGA 2BTEA 1PNQA 1LVUA 2CSXA 3DLTA 3Q7PA 2DQSA 5BSHA 5E38A 1XRNA 1Z88A 3DWGA 3DAPA 5TARA 3V8EA 4ZCMA 1LQ2A 3M3DA 3R7AA 4HTFB 1F6DA 1BYIA 4NYJR 5K8JB 4FOOA 1LDNA 2QL5A 2LPMA 3LAWA 3R3YA 3KKMA 4KBFA 4UHCA 5CITA 1LVHA 5I8WA 2ORVA 5I4KA 3O4JA 1R4MA 2J3EA 3O9VA 2V8OA 3PT5A 3WGKA 3FOAA 1A04A 1TCAA 1DLIA 2C5BA 1VI5A 4HCJA 1E2HA 5HFNA 3GGPA 4YUAA 1ECGA 1YZ3A 5AM4A 4G01B 3PDHA 2IXTA 4RVDA 4MZXA 2B1RA 2JI4A 1E8MA 1P33A 1VFPA 2EG9A 2GS9A 3KALA 5BNWA 4JYPA 5FHQA 3U56A 2ZUDA 4EKEA 2ZM6B 2CEAA 2HA4A 1WZCA 3DMYA 1GDDA 4LJ8A 4B7AA 2PLNA 3ESXA 4L2IA 1DRWA 4PHFA 4CG1A 1JEYA 3EA4A 2CLMB 3GPDG 3VJMA 1KRXA 1WXWA 2QPLA 2ZRBA 4LVCA 5A4JA 1KJ8A 2AI3A 3HZRA 1ZWKA 3L9WA 4GE0A 3RBAA 4E2XA 1P17A 3F5QA 3QEKA 3WYBA 4RLFA 5G2OA 4YPOA 2JAUA 2I0FA 3IOYA 2WTBA 1XT6A 1YE8A 1RJ9A 2BEWA 2WUFA 3RG2A 5IX8A 4HL6A 3DZGA 3P0EA 4OXXA 2B1JA 1ISSA 1GGKA 3ZU3A 1OHHA 2O3SA 1MO6A 5JSKA 2GN2A 1LLCA 1XXHB 1XCJA 4FCWA 2RHDA 4C20A 3BG5A 1K7YA 1VG1A 4JI0B 4OBBA 3A06A 1UBGA 2M2IA 1TUIA 1DKPA 1I1QB 2NTVA 1JG7A 2AG1A 3LY7A 3PEVA 4HH1A 3I62A 3KEFA 2F1OA 4PLGA 1V6CA 2DFLA 5C4GB 3TSWA 3DCIA 3CSSA 1LPOA 2KBFA 3DBHA 3IPYA 1F3LA 2WD7B 2HPAA 3EA5A 3GMDA 2Z9BA 4LCEA 4CCYA 1EUDB 1JHPA 3UJHA 4BDSA 5IVIA 5I01A 1FFGA 4LOHA 3ELYA 1L7MA 2Q4DA 4UM9D 1N8KA 2OBBA 3VNAA 1N2IA 4B6RA 4S1NA 2LIPA 2B2CA 4ENSA 2YL2A 4AJJA 3HVRA 2G9UA 4MR8A 4YJDA 5BSUA 3SDSA 4MWDA 4MV0A 4INJA 4CWAA 1JU9A 2AEFA 3C8MA 4OYLA 1EXWA 5I9NA 3D2AA 2ZK7A 3NI2A 3JW8A 1E1QD 3DCJA 3I01A 3MFYA 3OLYA 3PQ6A 3ZD9A 5K9ZA 1JW9B 3BHIA 1FFBA 4Q48A 5GTDA 2M1XA 4E5SA 5JASA 2VTBB 3HKCB 3MUFA 4YJ3B 5JG7A 2WC1A 1B76A 3UJ3X 2R6CA 3VZPA 3G0CA 2A5GA 4P36A 5JAUA 3NRJA 4JNCA 1PJTA 1NQTA 4Q7LA 1NNLA 4DE5A 1GFIA 5AXCA 2ZWAA 2WWTA 2QGZA 3VKGA 2E4XA 3RHFA 3RUDA 1E2LA 3RTAA 4NTZA 1KJWA 2PZEA 3BH0A 4RM3A 4JLMA 1XKQA 1VI6A 5TLSA 5LP1A 4L0DA 1AX9A 4M7OA 3I4LA 1L3CA 4FYJA 1DINA 2C4TA 5FPPA 1XDGA 3RS8A 4DMGA 3JQ8A 3SY8A 3GLGB 3UANA 1WPRA 3MLBA 4E5MA 1JLSA 4CM7A 3SR4A 2I2AA 4CM9A 3D31A 2HXGA 2IKQA 2QB5A 3KT0A 3B6KA 5ICMA 4L4YA 2WSIA 2XF8A 5LOVF 2D2VA 1GTG1 2MSKA 2PBZA 2XLBA 3M5PA 1BVRA 1TD9A 2CLHB 4JOSA 4MQ5A 4XM1A 5HDBB 3SYTA 3WLHA 4EX7A 1NOIA 1XQ9A 2ATVA 3DBLA 4FDUA 3DR5A 2WHQA 4XR4A 3UMBA 1N33B 5HX7A 3KB2A 4PNZA 3IT3A 3W8EA 4IG4A 5F78A 1ZR2A 2BCJQ 1G2QA 2CJPA 1N1EA 2Q6TA 1Z4OA 3OTWA 3T4EA 3AF1A 4HAIA 2J5RA 1R9MA 1HT3A 4YQYA 1GGEA 4H27A 4GSKA 4HZUA 1I4DD 1E2DA 2V6JA 2W8BA 4Y2QA 5JZSA 1EAYA 1U2ZA 1BH6A 1KAGA 3A6HA 1IATA 2FZEA 2J5BA 2JCXA 2Q62A 1ETHA 3KAQA 4I1OA 3ZG6A 4ZCRA 5DBHX 1NC1A 5I5EA 2HLDA 5AVRA 2F8SA 4FDVA 4JX8A 1F9AA 4ZPJA 2Z57A 3OC0A 3EXEB 2VJKA 3PR1A 5JPCA 3EGDB 1ADYA 1MG0A 3W7AA 2MOKA 1BDHA 1ECLA 1NDHA 1Y37A 1TTHA 2J3IA 3BQNB 3ROKA 1BA2A 1JEQA 3C97A 2WAMA 5DBEX 1D4ZA 4E7OA 3QWHA 2I6UA 2IHVA 1NW5A 3VRHA 2JFBA 5TNXA 1PFYA 1T36B 1X19A 2P1DA 3UAZA 3ZHZA 2H1CA 3P9ZA 4M0CA 5SV2A 3R7FA 4ERXA 1GNQA 1TK3A 4NPAA 2AKAB 5G0SA 1CETA 2EWVA 2ISCA 4S1PA 1MO2A 3P20A 5BQ5A 3JVDA 3SICE 1TPYA 2XUZA 5FBRB 3QBDA 5A03A 4EMBA 3LTEA 3OQMA 1I7DA 1MQSA 1T1IA 3R6TA 2PWZA 4G5XA 4AUNA 5A0TA 1EFPA 1T5DX 1LD3A 3D8TA 2DHDA 4IYJA 1PL0A 1Y0BA 3CEJA 2PPLA 2ZVJA 1Y5IA 4UM7A 1RQ2A 3KSRA 2C1ZA 5U1PA 1LLUA 4ARAA 3EZ6A 1CQXA 1SCBA 4GOJA 1AQNA 1TZ2A 4DCPA 4UNIA 4LG1A 4KLZA 4QXOA 4ZVLA 2I7XA 2C7PA 1GGFA 4UBNA 2BMDA 1X9IA 1B6GA 4EO4A 2QPOA 5AM5A 5C7YA 1SFRA 3CTPA 5CX4A 2GHRA 1QIKA 1C0EA 1JQJC 1V5GA 4J6FA 1R4NA 1VG9B 2OTCA 4TTQA 5EWMA 3T06B 5LZ5A 4D3SA 1XQXA 2B36A 1Y80A 1EXDA 1MAAA 3KDAA 4IEIA 2I99A 3NYRA 4R8RA 3TOVA 4UTNA 1NIJA 3DBIA 2M6LA 4WBSA 4E5PA 2SECE 3LVQE 3K70B 2JHPA 3WK8A 1J2EA 4BB9A 2AEEA 2XDWA 5BT9A 1CK4A 4WI1A 1X70A 1SUAA 1IK6A 1PZFA 2WM8A 3E15A 1JR3E 3G79A 5AW8A 4TS4A 4N82A 4PFJA 4D9JA 3HHEA 3S5UA 4BFWA 5FA5A 5FUQA 3OZXA 4U9HS 2I62A 4HXFB 2QD3A 2PKYX 1EYZA 4CIXA 4TZ6A 2CKMA 3HU5A 1ATIA 4CMKA 3D6FA 4R1OA 3TD2A 5T6MA 4HH4A 2YHSA 1AS2A 3KJZA 3AU8A 2FPPA 2PSDA 2GA8A 3X43A 1FNSA 1PLJA 3QLUA 1O9BA 2G7ZA 2P9ZA 1YCDA 3AUFA 1BH2A 4W82A 5DTRA 1X77A 5EJIA 2GEFA 1KH3A 5AXDA 1VKHA 2OXTA 1K8YB 3UFXA 4L2IB 3X3HA 1XAHA 2ZWPA 4J0IA 1DOZA 1GRVA 1BU8A 3L18A 2DSTA 4X8MA 4MW4A 4UDNA 5JI3E 1W36C 1UANA 1LJ8A 3W3AH 4CL0A 1WRBA 4BO4A 4PYNA 2D8AA 4GOXA 5IDVA 1U7OA 4UEQA 2W83A 5GZ6A 4C07A 4D8YA 1EM8B 2EDAA 3LVBA 3MQ2A 3VZBA 1L5NA 4CQLB 1EFAA 3W8FA 2QUJA 2Z2IA 3ENWA 4B3TB 4JUIA 1JPNA 3FFXA 4N3CA 1Z73A 1ZN7A 3IOBA 4FWBA 1VSUA 4KFRA 4C4ZA 1TMGE 3IYLW 1RFGE 3COYA 4GGPA 2ZIEA 3QOYA 4CTNA 4BAGA 3N86A 4QOEA 4YP7A 5FUVA 2P2DA 1SBIA 2OCYC 3GEBA 3T34A 3WHKA 4GLLA 3UC5A 3D0KA 1XZQA 1KO4A 2FWAA 4N40A 4EKDA 3KFLA 4CKWB 1WY5A 1YGPA 5EQFA 2GWRA 3FTDA 1IN4A 4KR6A 3T1VA 4FZJA 5EKDA 3DV0A 5BWMA 1GY8A 3C3DA 3NXKA 3RJTA 5T57A 4LF4B 2XDQB 4IGEA 1NI4B 3OIFA 3PGVA 2FOIA 2ZIFA 3KJFA 2QG4A 3NIBA 1CERA 2HHAA 3WTCA 4JLOA 3DF7A 3KQYA 1QRDA 1SG9A 1XRLA 4DADA 3H7IA 4MYHA 3CRMA 4HXEB 3C7DB 4J0GA 2ZRDA 3N59A 4OIMA 8GPBA 4FX2A 2PL5A 1YA6A 2CF5A 1UC8A 1I01A 5HMMA 5A4FS 3UK2A 2PT7A 1JDTA 2P9BA 2DWPA 3RYCB 5CJJA 4K2HA 3OIWA 3VVLA 4NS1A 2G36A 1JQLB 2QG6A 3MMXA 3OWOA 4ZTBA 2OY0A 5GM1A 2OXIA 1J70A 4UHBA 3INGA 3OZBA 3HU1A 4LYEA 4PYLA 3U1BA 1L5MA 1PL7A 4ZDWA 9GPBA 3OI7A 3T3GA 1HF3A 1LS6A 4Q16A 2APJA 2ODNA 4BCBA 1EDEA 2GTHA 3CHYA 1I6LA 3OZIA 1G21B 3KZNA 4KYUA 1OYWA 1WUYA 1JYEA 1PRYA 1REQB 5EYPB 3UTDA 1QYVA 3ZCQA 3HN2A 4FN4A 5D86A 2PLFA 2P2ZA 1KZ6A 4KYTA 4CMHA 4XLLA 3RYFB 4JLKA 2R0QC 2PTHA 2P9GA 3AHIA 4CI9A 1DQPA 4HN2A 3WYNA 4AUKA 4ESEA 3HU2A 1UT5A 4DUYB 3H0EA 3WJAA 3KP1A 4I1UA 4KRGA 2XNJA 3AHFA 4CQJA 1K6EA 1I0LA 4HAOA 3SKVA 2ZAMA 3EFBA 3E5NA 3NGLA 4MS4B 4M37A 4UFNA 4MW2A 5HSGA 4GBGA 1W4LA 4FCCA 3E22B 5EUQB 1A4UA 1HUQA 1X0VA 2NU7B 1P2UA 2JPDA 1V26A 3BH6A 4IS2A 3NWOA 5JPDA 5LJIA 1XV5A 4AG5A 1FTGA 3P2IA 4AF8A 4UFOA 4M1ZA 5TF4A 1C9JA 4RIFA 2WYVA 4F84A 5BVHA 4D3YA 3VUFA 3ZIDA 4NOLA 1CS0B 1ZI9A 1A72A 2VSFA 2VCYA 2Z5LA 4Z4GA 1MIOA 4YCJA 2ZUSA 4PX5A 3PNLA 4DQUA 2PU7A 1E6WA 5EPEA 2H5LA 1EBFA 1DAIA 1EFTA 2NYAA 3IT0A 4R8KA 3LC7O 1CDEA 3ICCA 2YUTA 4AMBA 4PZAA 3SJCA 4WHMA 3BAFA 1IEXA 1MX1A 1PT8A 1XZMA 1XK6A 2VTEA 1SXIA 3BRWA 2YWFA 3L8HA 3NVKI 5THXA 2OBMA 1ODTC 4G9GA 1OW3B 4AUMA 4P86A 4X85A 2CXHA 4JZYA 1JGTA 4YREA 5D6NA 3SXUB 4F6LA 2ZJ6A 4OHOA 1UZAA 1A7AA 2XAAA 3N7TA 4PC6A 3GLTA 3OJ0A 2ZRMA 4G6ZA 5D5HA 3EFHA 2ZBQA 1VHWA 1E2PA 1FYDA 4DUGA 4HNSA 4E88A 4QXQA 1R27A 1GYPA 1O95A 5DM4A 3JATA 4PAMA 3MAGA 3QLVA 1ADGA 1F6BA 4J3FA 2PX2A 2BFDB 1PJ4A 1P61B 3CLSC 3HEAA 4TL9A 3RKSA 2HF7A 5BV8A 4JB3A 4MJ7A 4RD6A 2LCQA 4YCMA 1CY0A 5IDXA 3E4DA 4LTNA 3LHIA 1RWWA 3WAKA 2PZMA 4D9GA 4ZQCB 4TRMA 3GFTA 1W1WA 5BW8A 1GGVA 2XE7A 1GO2A 4DDHA 4J1NA 4EGJA 3HQ4O 2R6AA 4XX0B 1KEEB 5KDOA 3ZD6A 2DHQA 1KYTA 3K9WA 1WMEA 4MRMA 1SCJA 1O5IA 3JVIA 1ZXBA 5D7BA 1RPTA 2J7PA 4I6EA 1I51A 4RA9B 4RY0A 3A6LA 1UBMS 3FD8A 3R3HA 3I1JA 3SVTA 1QB8A 1PV2A 2PZGA 3FSRA 4JT4A 4BNDB 1R9JA 4ARZB 5FNVB 5KEIA 3AFHA 3SXUA 2XKJE 3BM5A 2R87A 4AJ2A 2BN4A 1Q11A 1A71A 4ND2A 1A69A 3FF4A 1J07A 1V16A 4XYLA 4ZYWA 3BTVA 1S2OA 1RKXA 2D3TA 2WU1A 4WXYB 3RB8A 1KS9A 4NCAA 3DO6A 2EWMA 4B3XA 4M49A 1I2MA 1HMPA 4G5FA 2RHOA 4LY0A 1EFDN 2QR2A 3VR5H 3ITEA 2WSSD 1K7XB 2WFZA 5NLLA 3TL3A 4JA2A 3RSSA 4WBXC 3MTGA 4Y2TA 3VZRA 1GAJA 2WTMA 5I9SA 4CIYA 3DAOA 1UWKA 3OD5A 2XUPA 1IG0A 4BLSA 3U4QA 1NXVA 1Y1LA 4G26A 3VSCA 4K87A 3T1HB 3JQAA 1PKXA 3QVOA 4KCGA 4COOA 1HFKA 1ZKDA 1T35A 6YASA 2XXAA 4W4TA 5GIPE 4GVXA 4HUQB 2GSDA 4IIYA 5HS6A 4EO9A 4LIPD 5AVYA 1QE0A 4G1UC 4HUJA 1AUQA 3TK1A 2AG5A 2EQ5A 1SXJD 3IDSA 1OI2A 2AQKA 3K72B 3MAAC 3ZU2A 3ZTWA 3PCXA 4X0EA 3U3MA 1E4EA 4FSXA 4N39A 3VR3A 1OBOA 4PX2A 5BYAA 2P9YA 1L7BA 4DV7B 1AE1A 1Z5UA 1BFUA 4G2TA 4MMXB 3RUAA 2BGRA 2IF2A 5G41A 1XA0A 3JQFA 4EA6A 1NP7A 2GCEA 1J42A 3CLUD 4M1YA 3UHJA 1E9AA 3OE7D 2JLQA 2QP3A 4QPJC 2RG1A 2PL1A 3IRVA 3CUUA 4MV8A 4EHIA 2ZPTX 1GCGA 4QUBA 2EVWX 4MV1A 2MINA 5DBGA 1YC5A 1CEQA 3IVMA 3QVJA 1OXUA 1F14A 1P6XA 2O3QA 1WLSA 1AHNA 1QWSA 4LXTA 1RCFA 3A28A 4KQWA 4NZPA 4XIFA 4MRSA 2IS6A 4YAWA 2Y1KA 2W8ZA 1H1DA 2CLKB 3C8HA 3HBLA 5G4KA 4DLVA 4CUJA 3DP9A 4LHEA 4PWZA 3T7EA 3ZHBA 1CRPA 4M38A 1ZCJA 4C0BA 3RSQA 2P5YA 4OKIA 2ERYA 4I9NA 4KKXB 3EVFA 1E63A 1PR5A 4ID9A 3TE7A 1AO0A 2QG9A 3R5KA 5ARBA 2G1UA 1LPPA 2TMDA 3H2YA 4ZQEA 1KMHA 1G7RA 4DZTA 1SOAA 5C3MA 2XNCA 1T29A 3D81A 1D1PA 3H1EA 3JQAD 4KB5A 1M6HA 2ZTUA 1FK8A 3LKZA 5IH7A 5BN4B 1O1YA 3PNBA 4RO0A 5A7HA 4PFKA 5KJ1A 1OREA 3FYTA 2V4UA 4OXRA 5JJBA 1OQAA 3KK0A 1DELA 1NLMA 3KQUA 1K89A 4PC1A 4RANA 4FFSA 1YRQA 3HKEB 4BLOA 2ZM5A 1TJPB 2FH5B 1YO6A 3ZGLA 1GDHA 1CZNA 3GLVA 3PC3A 1ZN9A 1SHUX 4IJWA 4ZCTA 3KKKA 4KLRA 3Q7TA 3VZCA 4RXMA 1F5NA 1TQ8A 2QRZA 4D4GA 2JBAB 1RQPA 1WJGA 3URMA 3ED1A 4L0MA 1QYWA 3EIFA 3OLWA 4U4AA 5K7SA 2C9CA 1G8HA 4YDQA 4CQLA 4BKPA 1U0GA 1YBAA 2M6RA 4RKEA 4AJKA 4YN3A 3D43A 1Z7BA 3HDTA 5T4FA 1G20E 4K6MA 2AKYA 1C9EA 3QPBA 4UOEA 3K53A 5DOVA 2QTRA 3LS2A 2HRBA 3T3IA 3MJHA 2R6R1 3TZ6A 1DG1G 2JLAA 2DKNA 3GPBA 4RU1A 1NM5C 3BGWA 4TKLA 3UV7A 4LGYA 1O57A 3D8HA 1U8FO 2CD9A 4UC0A 1GTZA 1MJGM 4EA9A 4GW3A 1FFCA 3IGFA 2A14A 1UKAA 4FHEA 5FOTA 4E2WA 3SD7A 1KFCB 4UHDA 2AIRA 2Q5LA 5MGNA 4U02A 2VLBA 2ETVA 2AOTB 4QYMA 3P5SA 2RGDA 2WJHA 3R3SA 4KQEA 4XUDA 1B73A 4RZ2A 5C37A 4B6PA 1BX1A 1V9CA 1GEGA 3HXKA 3R7BA 3RK1A 1EFLA 3SZMA 1UOEA 2PKQP 2FZGA 3LWDA 3FPKA 2IXEA 2WU4A 4MWSA 2Z6AA 1D2CA 1KPIA 1NN1A 2IFTA 1EUZA 4ZVSA 5MN4A 4YAJA 2DXIA 1L8OA 1IUOA 3BPSA 1E3TA 3DKRA 1KTIA 1Y6QA 1RRVA 2G0AA 3EBLA 3LXRA 5B7QA 2VTDA 4H77A 3P4XA 3UJDA 2DKOA 1N1MA 1Z4NA 1ZGHA 4IIXA 1SBHA 3S5JA 2F4NA 3SDZA 1GXSB 1AMOA 4DV1B 4LDPA 2Y0PA 1G20A 3PPVA 4LN1A 5A1JA 1Z2CA 5IKMA 2E4AA 2EXXA 5BVGA 2QJFA 3L06A 2ZVPX 1WIWA 2UYYA 1M2FA 4L50A 2IDMA 3DNPA 3EFEA 4ME6A 1QQ5A 4DWVA 1Z9BA 3FJOA 4Q3DA 4ARBA 2O8EA 1QJ4A 4R81A 5C0OE 3YASA 1A9XB 1IHDA 2XUIA 1JSRA 1PS8A 3GJ4A 2HT1A 3RIXA 1XO1A 3JQEA 3WLRA 5IM4A 1BMDA 2R4UA 3T7SA 2QRNA 5EESA 5IVDA 3WLPA 5IZCC 4AY4A 2ZRCA 1V1RA 3FCYA 1VGVA 1F4VA 1D0SA 2YHAA 3BH7A 3L6RA 1A5TA 4GXQA 4QU8A 3WKDA 2NSYA 4HK4A 1GPH1 5D87A 4E5DA 4DBVO 1YVPA 2KW5A 4PF1A 5FIUA 2GBLA 2GHQA 3F5MA 5ITWA 3Q1LA 5CA0A 5F73A 4ZI7A 4Q4HB 2AMYA 3E70C 1VE7A 2I67A 4YRBA 4TYQA 1VZ2A 5A0VA 1T13A 3EMVA 1Y81A 1S7GA 4M9QA 3UUWA 4KUHA 2ZIXA 1WCIA 1UODA 1I5EA 1E2EA 3JALB 2BEUB 3DYVA 1M2OB 1I10A 5I45A 4PCLA 4DF3A 2UXCB 1XMQB 1Y7TA 1YOVB 3QKIA 1K6JA 2PQ2A 1S2NA 3PGMA 5YASA 5CA1B 5LZ2A 4MO9A 2QWXA 3AVXA 4FHZA 4NMHA 4YC7A 1QIHA 1Q84A 2GPTA 3DC7A 2PH7A 5JZBA 4NQZA 1LGYA 1X42A 1ZVJA 3HSSA 4MR9B 2ZBFA 5I7UA 1YZNA 1FJGB 3E7PA 1UT6A 3MHPA 5ED4A 1R0LA 5B7GA 3EAFA 4GWKA 3DONA 4YBRA 2EKQA 2NSHA 3WFZA 5ALMA 3NB0A 1R0BA 2BDTA 3LDGA 2IOFA 3EWAA 5AJWA 1NW6A 5KDLA 3SOPA 1NNEA 4OQ4A 4F5YA 4AL4A 4LX0A 5BSFA 2VHUA 1E6UA 2XMQA 4Z9FA 3AY7A 3K0FA 4AMUA 5AR1A 1PNVA 4QBHA 2PX0A 3TQQA 3EDMA 3E03A 4IXTA 4EOGA 4W5OA 4C4XA 1K7CA 1GPDG 3H8WA 1Z74A 2KI5A 2POQX 2D1FA 3F3SA 3EEFA 2NZVG 3VJRA 1OPRA 1JHQA 4HN4B 1FXSA 1GL9B 3KXDA 2ZS8A 2QMHA 1RYMA 2OUKA 4CKCA 2F3SA 1LF5A 2HIHA 5HP4A 4KLAA 2AJDA 2OZKA 4ZMBA 5MFPA 4HAYA 3AB3A 1JE0A 3M1IA 4BNYA 2QJTA 4DCVA 3G82C 3WV4A 1XCGB 1ZW6A 4RVNA 3O31A 2V7GA 3UUGA 1IY9A 3ZZ0A 2W0MA 3GV0A 4D79A 1R7RA 4RE5A 4WTOA 1CEYA 4GEGA 2BMAA 5C7IO 5EE5B 4MGYR 4X8HA 2JW5A 2FGJA 3V4ZA 4BO2A 2VHZA 5JCZA 3RBXA 3LA6A 5AHRA 4AKIA 4F12A 5B6PA 4UUMA 1YZYA 3E9DA 3V3KA 4WCDA 4Y6LA 3V8MA 2WSMA 4H3SA 4DSOA 4HMQA 3G1WA 3I2KA 1SEPA 4E4TA 2CHFA 1ID8A 2W43A 4FDAA 5U4XA 2ZI6A 4BXOB 2JI8A 5JPIA 5LMZA 3NRBA 2IS2A 1EX9A 2OO7A 3DOJA 4QPCA 3R7NA 4PSKA 3PX2A 3TTYA 3SE7A 1SXHA 4CN9A 2FK8A 5COAA 2WHPA 1GUFA 1SVNA 1V3VA 1KE1A 1A95A 4HOYA 3ICVA 2RH8A 1QKJA 1GWNA 1Q91A 2AZDA 1XZPA 2B98A 2Y9MB 1KFEB 4UMFA 4YP5A 3V7UA 4LJLA 5BUQA 3NH9A 2RDMA 5CA0B 3IILA 4ML3A 2IPAB 4ZU6X 4OGFA 2AZXA 1Z2DA 4EPXA 3HDJA 4FR5A 3W8NA 1RZVA 5CYGA 4UQPA 4G4GA 2XMBA 1U4OA 3OM8A 3D7SA 2VVTA 4ND6A 4JVSB 3P0RA 4RTLA 1G18A 2HN9A 5AJHA 1C8LA 4PINA 1ZD8A 4KW7A 5FULA 4DDWA 5IDQA 1YIOA 3P19A 5HUJA 1MTZA 3G2OA 1YQQA 4Y2HA 5F52A 4EY6A 1A9XA 2CC2A 3ZOZA 2O7VA 2IPNA 1XEWX 3NPMA 1SQ5A 1EUDA 1IAVA 4XGRA 3IELA 1PO7A 3GHHA 3QXCA 2IH2A 2C59A 2J4FA 4UULA 3R7LA 3TDMA 3JAWA 3H1AA 2IYAA 4X8LA 2WP0A 2JFUA 5KU1A 2EZTA 1QX4A 2JIZD 4YYZA 1URPA 3I1YA 4LDQA 5EZYB 3ZI4A 5JROA 3PITA 1NMXA 3PPYA 2VNAA 1CXZA 1HTBA 1QKIA 1U9CA 1BYUA 1ZD5A 4GUDA 1SD2A 2GO7A 1TOAA 1F12A 4JIMA 4QGHA 2ZP1A 4OO3A 2VT2A 4TVKA 1KL7A 5FDFA 3HBMA 5CDTA 3NEAA 1KIAA 2VHXA 4HQLA 2Z8YA 1PZGA 4LC0A 2WLSA 4AKEA 1RPJA 4M6WB 3ETNA 1YFZA 3EEIA 2JI9A 4S24A 3DBVO 4ND3A 1ZM9A 3HK2A 4RKYA 2J9FB 4RWZA 2BEWB 4HDMB 5LBTA 1KI4A 2XI4A 1I2ZA 2Q6KA 3PQ3A 3G2QA 4PZPA 4EI2A 2H57A 4GUAA 2QW1A 2VRCA 3LPLA 3RRYA 3RW9A 4IDNA 3LYAA 2ZYRA 1MB0A 3FB1A 1RI5A 3UY4A 5JLJA 1KKUA 2HLPA 2J5XA 4C22A 1LSOA 5GQSA 1QH0A 1TIBA 1X1DA 1ZITA 3KJHA 4IO1A 4EEXA 1RWOA 3CIOA 1L7EA 4GPIB 3IERA 4G1FA 3W8DA 3UJCA 1KQPA 4FQ7A 5K51A 4QAJA 1KDOA 2ZITA 4L8YA 3EXAA 2I2DA 3PJEA 2X9NA 4X1KA 3KHUA 1EWVA 3N0VA 2BFCA 4JVNA 1VBNA 3KKQA 4J94A 5HCNA 4D8XA 1OV4A 4L5IA 4ETWA 3K6SA 3UWOA 1COWA 1ESCA 2ZSIA 5JECA 2YZMA 2Z5FA 1RM0A 1DT5A 2F43A 3L1KA 4PN7A 3B85A 1NMZA 1P80A 4ZTUB 3U7FB 3OFSA 3NIFB 3PE3A 4TSKA 1LCIA 4FDTA 1O97C 3MEQA 3GG2A 3BHNA 2HSGA 3CT4A 4ES6A 1TADA 5BR8B 1Q20A 1W25A 1XEXB 1XJ5A 3J7TA 5M2QA 2XB4A 3MXTA 4DOMA 4WNAA 2DUUA 4NF2A 1T3LA 2O2HA 3U3RA 1XTSA 3EZGA 3VX3A 2UZ1B 2HMYB 3BMOB 3A1CA 2YHIA 3JZMA 4RDXA 5KTTA 1T8PA 2E1PA 2LRHA 4I1VA 3W78A 5EIBC 2I65A 5K6AA 4L4RA 4Q9NA 2JAPA 3UMMA 2JZNA 1MZPA 1SVIA 3I9V6 1KK3A 3AF6A 1ZQ9A 1YJXA 2IHYA 4X64B 2Q5IA 1U7PA 3BMQB 3JCZA 3L02A 2JHFA 4WBNB 1TTTA 4OUKX 1AK9A 3FNIA 1SHLA 5ALLA 5K3EA 3EVEA 2GVNA 3FMOB 4G0OA 4C0HA 2OHVA 4F06A 3PEFA 1BCRA 4QQRA 5EP2A 2EW2A 3WB9A 5KAMA 4ZI7F 4V1CA 3EULA 2O19A 3DD5A 4DT1A 5HQ3A 3I2HA 1CUZA 5J1TB 5LYJF 3UOAB 1AKUA 2OQVA 4LA4A 1OXVA 3AI7A 3B3QA 3I9V1 4QGBA 3T9BA 3WWCA 4YT4A 3ICPA 4YMSA 5AHKA 2JKZA 5COQA 3ZE9A 3VSDA 1X7ZB 1JE1A 4B84A 1N6LA 1PFVA 2BFOA 4UU0A 3A32A 2EFHB 3INNA 2IEAA 3JRWA 3LVRE 3O0DA 1MT3A 4KQIA 1E7WA 4H9GA 4RGBA 5ILQA 2IV7A 3ROGA 4EWLA 2C20A 4LXUA 5CTJA 2O1EA 2VDWB 3TNJA 4EO7A 1QSGA 2NQ2C 4DUGD 3WO0A 1O9HA 3BZBA 1LSJA 5AI4A 3ZHRA 1NT2A 1OZHA 2X15A 1RRFA 2HQOA 2JJ2A 3F9RA 3LY5A 2MU1A 1D07A 2IUUA 1FMTA 4F1WA 5LQUA 1SBTA 4MVYA 3A04A 2B2NA 2HWUA 3BD6A 3WGUA 3THYB 3EXHB 3P1JA 1JKJB 3TSOA 5EYPA 3AM5A 4KMMA 4BB5A 2I22A 5CXQA 3TBKA 2LZ0A 4C88A 5EKTA 3W6UA 1V9SA 2JRLA 3LYHA 2ZVQX 1CV2A 1EVKA 4FP9A 1SU7A 2FW6A 4D45A 4UOZA 2FRDA 3AR6A 2WJZB 4M1TA 3TL2A 3ZWWA 1AUOA 3HV2A 4I50B 3VPHA 5IT5A 1FZTA 1QTRA 4F9EA 3VX4A 1ABEA 4CNQA 4DPLA 3LX6A 2DTDA 5FAXA 1ZSVA 4Y1RB 2QUHA 4PRLA 1XVLA 2PMBA 2YJ6A 5EGSA 2OKGA 2ZUTA 2H9IA 2A7QA 2C9ZA 2J85A 2OK7A 3EMDA 1U28C 2FZCA 1NBIA 5ECWA 1XTIA 2JFYA 2Z5GA 3KYDB 1MJ5A 2NG1A 4Q02A 4D81A 1FS4A 4G4JA 3WLMA 1E1CA 4C7MA 3KV3O 3SLKA 2D4AA 4EGAA 4I3GA 4ZO7A 4U2BA 2W2XA 4JC5A 3QXSA 3WG9A 3SYKA 1GPLA 3VU9B 4DNXA 2QMQA 1JHXA 2ZIZA 5LLDA 1QGED 4JBNA 4KTTE 1KFKB 1Z3CA 2J4CA 1LQTA 4PS1A 4BNHA 3GLGE 1KC3A 4DYVA 4BFVA 3L4JA 1MW9X 2PUFA 2AN1A 5FB3A 3C6XA 4EB0A 4ETNA 5IAAA 1M66A 1S8OA 4ITUA 3OOEA 1DS6A 1RRMA 2QI9F 3LC0A 3BJRA 4MRMB 1I7QB 2FXIA 2GRJA 2GPAA 1LPAB 3OFND 1JLLA 2X40A 3JX9A 4TKUA 4HLNA 3WB2A 3GEGA 1DXYA 2CE2X 3FUUA 1PKEA 3ESRA 3PG5A 4OIFA 4LW8A 4KTVE 4ZZIA 2NU6A 3KUDA 4WZAA 4YGYA 3NFYA 4JCCA 2Y1CA 4K86A 2IKSA 2KHZA 3L41A 1U8CB 1N5OX 3AR2A 4FYIA 3PHBE 4L0CA 5CFQA 4GL2A 3IIIA 4G0XA 5F3DA 3NXSA 3SS7X 4F04A 1X7WB 3NUGA 3EEOA 3NU1A 4WSOA 1N5JA 2RKBA 3IDZA 2IX3A 1PFGA 2AOWA 1W48A 4LFAB 1NFFA 4MK4A 4JXKA 1C9DB 4X93A 4DM3A 1Z8HA 3OZSA 3A14A 3MGCA 2YWRA 4D97A 1IQ0A 3W5BA 2NZJA 3WQHA 4MR7B 3F71A 5B1YA 3GT4A 2AF4C 3JVUA 5IVHA 4NP6A 2WIFA 1EIZA 1H2EA 1UQRA 3I6MA 4L8FA 2ZT6A 4KDFA 2YZ7A 4IDGA 3AHCA 2BBWA 3EXG1 2GCNA 2JF0A 3ZDFA 1SD5A 3MW8A 4A6DA 1VJ1A 2O05A 2ZATA 1KNQA 4AZ0A 4EGSA 1ISPA 4UPEA 4OFZA 3M49A 4K9MA 3D3NA 4GD3Q 5EHGA 3IJRA 1PGQA 4QVIA 4A1OA 1AN9A 2H0QA 4Z9BA 4R01A 3O83A 2GTPA 3ESDA 3H16A 2QLJA 1O96B 4AUEA 4W1SA 4HVTA 3PNPA 2ES4A 4G09A 3H87A 3Q0IA 4JI6B 1E5TA 1OLOA 4BCCA 3UICA 2IV3A 1M6WA 4KX5A 4TLAA 1ZA1A 5KQPA 4R84A 3RGGA 2AFHA 2SICE 5MHTA 4ZQIA 1ZMXA 2M1ZA 4L8VA 4RFVA 2TECE 3C7TA 4R16A 5TS2A 3C1TA 4J7AA 2NLOA 3SR0A 4EAQA 5JS7A 2NUTA 2CVQA 3GGDA 1IJFA 1QPGA 2W2KA 3HDGA 4B6OA 3CVJA 1RZRA 3QLJA 1JHDA 1EWKA 1SC3A 2AA3A 2NV0A 3ZS9A 1ORDA 1XYGA 3VYTB 2I91A 3OTQA 3U0BA 1BA3A 1O89A 5BV2P 3ZLBA 1KMCA 1Q7TA 1Q0RA 1WF3A 1BWSA 3OEYA 2JGKA 1KIMA 1RLOA 3N0RA 1NQAO 2PE5A 3G13A 1FDWA 4J0KA 3GRPA 2AK3A 3QKTA 1F9EA 2GEDA 2VH2A 3CH4B 4JQOA 4Z3KA 1EHIA 1BROA 1GLVA 1Z68A 5KYYA 4G25A 3U7IA 4B44A 3S0JA 1ZD2P 3D2BA 1SD1A 4GMFA 1GNSA 3UJ7A 3W5JA 1ZGCA 1X1SA 1ZSNA 2OAP1 2ZTHA 4FC6A 3VVCA 1GVHA 1GSOA 5G40A 4CLHA 3LSYA 4QOJA 3GVPA 4PRZA 2OOKA 5CNKA 1JAYA 2OO5C 5C8YF 1ZEMA 1QM5A 4LBWA 5JW6A 4GZ6A 5TPZA 5LYYA 5EPOA 2QVGA 4ITVA 1OLSA 3FI9A 4TV8A 4IDBA 2NIPA 3P9IA 4P3KA 4X9XA 2ZI7A 3DFKA 4FI3F 2ZPAA 3H5VA 4HVCA 1S02A 4G0QA 1M74A 3QI2A 1DCKA 4MLPA 3E84A 1LK7A 1IG3A 1Q22A 3NIGB 1YQUA 4P7GA 2JLZA 2VCHA 3OJFA 5CTAA 5C8XA 1FLAA 2HCFA 1RDFA 1S5PA 3BXPA 3C5VA 3RTGA 4BN4A 2J31A 4RNCA 2XZOA 5I4IA 3KDSE 3QBJA 2WLTA 3KC2A 3NS7A 3DSRA 1I7LA 5AJXA 3VR2D 1DHRA 4F72A 3GD7A 3CE6A 5ALRA 3KQVA 4L85A 2CNNA 3WIBA 1WMSA 4K9NA 4EB3A 1F20A 3C1OA 1AH2A 1EHCA 1X7XB 3H4VA 5DSZA 2JB9A 1F1JA 1S8NA 2JIBA 2P77A 5FO0A 4QYIA 4ASUA 4F46A 5KNDD 1Y3IA 1XNJA 4JLWA 3REFA 4IY1A 4D44A 1CY8A 1XVAA 4IIHA 1M1XB 3H2ZA 2JFNA 3MGKA 5C1DA 2B8JA 2INGX 1US8A 2XUHA 2Y05A 2DQZA 4LE0A 6CHYA 1BDBA 2BOVA 1PTKA 1WV0A 2I34A 3MWGA 4JBLA 3ZIAA 3SQXA 5IN5A 2H63A 2HK7A 5EJ2A 4ITRC 4N1AA 1UEIA 2I76A 4KIJA 4R0NA 5KNCA 1JFTA 1SCAA 4QODA 1YR1A 4UCWA 1JV2B 2EJUA 5KKAA 4BIMA 1GA6A 2R60A 1BS1A 1GA4A 2QRHA 3KBOA 1U1FA 3MUEA 4IDDA 5TV2A 3UMYA 3TYXA 1TM5E 1PUJA 4LCBA 2VLIA 3H97A 3G17A 3PNVA 4G8DA 4INOA 2X2OA 1UPTA 1RBZA 4A1FA 1T0PA 2R4TA 3C48A 3LGXA 5AVXA 2W2PA 5GINE 4UJ5A 5H3CA 2UAGA 3OQNA 1N3BA 4OHZA 4OXNA 3GHYA 4RVGA 1KO5A 3ABZA 1U2RA 3LQRA 3ZDBA 1SULA 1IJBA 3V4SA 2I03A 4BTLA 3UAOA 4EJSC 1WW2A 2ZAYA 3EZYA 4FJ0A 2WG1A 1NQ5A 3IHKA 4EMTA 1PCXA 3E3MA 1JJ7A 4MQEA 4Y18A 4L08A 4H7HA 5HMLA 1QFMA 1L5HA 1F8XA 3JD3A 3OWHA 4AYWA 3EZLA 3X44A 2CYAA 3PXAA 1M34E 2KWIA 1W5BA 1MQAA 1WHSB 5B4VA 4L7QA 3HWWA 2W42A 1UKBA 4QVKA 4ZCLA 4H35A 3C4VA 4X61A 2LIVA 1E0KA 2GN0A 4BFSA 1JKXA 2J08A 1OVMA 1VBFA 3KYBA 1X8JA 3PDWA 5AK5A 5K8IA 1DG3A 1D4AA 1TKCA 1J39A 2E6KA 3CLTC 1XMOB 4XPIA 3ESBA 5EMJA 3PLNA 1LI5A 4IV8A 2FPIB 4TMXA 4UVHA 5JZVA 3PFCA 1IXSB 4HDKA 3D3WB 5B2EA 3T9CA 2J0QA 3ODPA 1E2UA 3KL2A 3VU8A 4YPVA 3F6PA 1HLFA 2BPOA 2C8VA 4J90A 5A2GA 2FP3A 5AW2A 1JIQA 1V8PA 3U49A 1ZIDA 2VJLA 5FFNA 1UJ2A 5ULLA 5K03A 5JS8A 3N5KA 4I9UA 3D6TB 5LZ9A 2BKUA 1YDEA 1AHIA 4XGNA 2GEUA 4BU0A 4GBED 4MUHA 2CBGA 3RV4A 1H05A 1M76A 2KJQA 4NENB 3N39C 2PUBA 3DULA 4PANA 1PWZA 5DYIA 1QOQB 1H22A 2YYZA 1PGPA 1W8IA 5TS3A 4H18A 3C5EA 4YT2A 4TRRA 3WNCA 2NSLA 4BRWA 1JB9A 1RYNA 1P75A 1TJ4A 4KDCA 2RFLA 1GTRA 1OZ0A 4FBGA 3DEIA 1T1JA 1ORIA 4PYRA 1UR5A 1VB3A 2ECQA 4DKXA 3K9GA 1H3FA 1F17A 4Q3KA 3AFNA 2WTEA 4WEOA 3O90A 1SCDA 3AFGA 4DC1A 1JRLA 1P7WA 2AI1A 2AYZA 3BGOS 2VYFA 4DVGA 1WD5A 3C4JA 3IR5A 3VFDA 4HGRA 4HXGA 2H2IA 3NTQA 3WMEA 1ZK0A 4KR7A 4TS9A 1JP7A 1RXCA 1WCXA 4R51A 4V2UA 4WNIA 3AFMA 2NYRA 4A27A 4X3PA 5LA6F 1H8HD 3N2NA 1DEHA 3NW9A 3ILVA 1NJ5A 3GR6A 3JRNA 4KK3A 4BO8A 1F8GA 5A5DA 4XSGA 1KO7A 3D5TA 4BEJA 3N3BC 3T7TA 1QTQA 3A58B 4O2BB 4QSHA 3AVUA 2WI8A 2BGTA 2QE7A 6LDHA 1JTEA 2YYSA 1QIIA 2DRIA 1J6UA 2HCTA 2Q9AA 3GFGA 2E2WA 3IXQA 2FW9A 3ROPA 3HUEA 1N2GA 4UKDA 3ZHOA 5ADHA 1QIFA 2Q3BA 4KH0A 1EJBA 2LD4A 4NZYA 2O8NA 4GI1A 1TA4A 1C1DB 3FSJX 4QL3A 5FL7D 1RVV1 4AJ1A 4EVQA 2YYAA 3DBOB 1N0IA 5ALYA 3U19A 5IK2A 3AV0B 3DUFB 3FNBA 5F5LA 1OAOA 4CKEB 1UZUA 5BY2A 1Q1NA 3DDWA 5TPWA 2GK6A 1PL6A 1YHZA 2N3ZA 2V65A 4B8YA 5GV7A 4FZ5A 1TXGA 1H6DA 1C4WA 1H2HA 2PLRA 2FEKA 2QTMA 2JCBA 5I6DA 5HVNA 2H59A 3IRUA 4BNJA 2F8TA 1QF6A 3IQEA 1G8PA 2G0TA 621PA 5L3QB 3LQQA 4P5EA 1UUFA 2IEGA 1WUKS 3HO1A 4FYKA 1BW9A 5AD1A 3MWEA 3BXXA 1Q12A 2Q1TA 1W76A 1I36A 3DE6X 2OZLB 1QZ3A 5BQOA 5GADl 3WIUA 5CB4B 2YFKA 3AERB 4YEDA 2C95A 2E0IA 2SKDA 4O29A 4ZV9A 3VO8A 2LXNA 3Q88A 3MT0A 4DUPA 2IBMA 1TO6A 5AXAA 3GFOA 1Q0PA 2ZBRA 2FVYA 3MS2A 4KJXA 1X1BA 2BUCA 2ZBPA 3RWMB 4AZTA 1XZJA 2FG6C 3LUKA 1IZYA 5HEKA 4CETA 4IH4A 5KKNB 1P4GA 1XAGA 1TGVA 4A36A 1A9QA 4IFEA 1U94A 1FLVA 3TTXA 3ZD8A 3F5SA 2DUJA 2Z95A 2QRVA 3NHMA 5K4HA 2Y92A 4RVOA 4A0FA 4MYRA 1Q7GA 3BX1A 1CJMA 2V0CA 3P4YA 5KYNA 5BSVA 5JH7B 1QQTA 1XBTA 1G5QA 5DTMA 1YNSA 2PYIA 2WKSA 1YHYA 3QQPA 4HDQB 3U40A 3ZWMA 4ATNA 3GRZA 5J3JA 2CVZA 4RZSA 1UQUA 1V43A 4I4TA 3W3AD 4BRUA 2SCUB 1LJLA 2FE1A 1O5OA 3LL7A 4JH0A 3FFTA 3X1YA 4D3FA 4WESA 2LDBA 1PR4A 3FPHA 1J0DA 2J09A 2R66A 1OBHA 1T10A 1AGRA 1SC1A 2Q4TA 3WK7A 1ISIA 3ASYA 3QX3A 4H4CA 3HZHA 2FSHA 3KE8A 4FFDA 4MP6A 1XHEA 5SYNA 3T7JA 4RHFA 4DJ5X 4F5EA 2B4YA 5EE1A 1QQBA 1ZJWA 3ZGOA 3CZPA 3OECA 1DI0A 1HG1A 1QH8A 2WSLA 3JPYA 3P7MA 4QARA 2FCAA 2FSSA 1XTPA 2UUPA 3KXPA 1R00A 3LWZA 3L7DA 1E5DA 4IFBA 2QYHA 2Z1NA 4QDJA 4TYMA 4EG3A 5HYVA 2OV8A 3K31A 3J80A 3IVCA 5ILGA 1OXKB 3L43A 3UENA 4D41A 3HG7A 4JYCA 5KYKA 1T0BA 2UYCA 4M9CA 4C5BA 5H9VA 5AVSA 4L5BA 4CM4B 4LI3X 1V8DA 2DVMA 4KXLA 4HLUA 3R2JA 4D2IA 2XWSA 3GUZA 3CLHA 3OY2A 3QOFA 5ED0A 5IWCA 2QIOA 4NZ9A 5EJ9A 2HSWA 2FQXA 3KZOA 5DTQA 4AULA 2HREA 4RQUA 3JWEA 2CW5A 3PA6A 521PA 3U1VA 2A0FA 4MKFA 5FPTA 5AUQA 3WYGA 1XL0A 2BRUC 4OQDA 4BQFA 3DOIA 4CLXA 3EQ6A 2V4ZA 1HQYE 4F3CA 1PK7A 3WL3A 1UM9A 2GFIA 3F73A 2RH5A 3DW3X 3OEHA 3VC7A 2OV2A 4X1YA 2HFJA 3D4PA 4XWTA 5JALA 3ELWA 2DFKB 4HRVA 4I4TF 1J8QA 2VHEA 3S2ZA 4YAEA 1CY1A 2A86A 3N87A 2N1MA 4N3BA 1VE5A 4DR4B 4RFSA 4J0HA 4JL6A 4BNWA 4K2AA 2FDRA 5B36A 4KR2A 5K8TA 4HYTA 3AHHA 1ZOIA 2V6FA 4ESVA 1RRCA 2IYVA 1EUYA 3EGCA 5LZ4A 4UAVA 5GWXA 1KSHA 5C2JB 5FNZA 2FSUA 2QTVB 3ILSA 1YE3A 1YS4A 2V5AA 2ZANA 2D7DA 2WG2A 3WGMA 2ODBA 3G7SA 4PXAA 2FPLA 4W8GA 3L4KA 2J87A 3KETA 3THWB 2MSLA 5CDGA 3WAJA 4BXOA 5CXSA 3GUCA 2P68A 4Y2VA 4KOEC 3SX2A 3ZUGA 5FV7A 4DEXA 4CXMA 4NR0A 2WVHA 3WSTA 5HF9A 1U2DA 2C2GA 3KUKA 2HHLA 3UC9A 4CPDA 5AVUA 1DKQA 3ZJ5A 2ACWA 2WNHA 2QTFA 3A1FA 5F7OA 2DLCX 1YB5A 4OHWA 4EBFA 2UZ3A 1ZCBA 3OSZA 1B14A 2GK3A 2OSVA 5LQKA 3H9QA 2OZLA 3K7EA 2P2NA 1WV1A 2P41A 2RHTA 1V5FA 3HJBA 3MBIA 3RKRA 4J2OA 1HEIA 4E1AA 4DW8A 3GCGA 4AY2A 1AURA 5EA2A 4KGVA 1G64A 5LQRA 3P2YA 2NZ8A 1PAUA 1NAIA 3B3GA 2OPHA 1S6YA 2AV6A 3KRTA 4GP7A 5LB2A 1UDXA 1KY2A 1NF9A 3AHDA 4FJ1A 3HCFA 3FVRA 2VHWA 4PYKA 4WERA 2WJAA 2CVHA 3TI7A 2O2JA 2A0XA 2WJVA 2XJ9A 1EX6A 1YMUA 3F4LA 3M4JA 1JR6A 1F8YA 2GVZC 2WQZA 2C4HA 2P69A 3K0CA 2P6NA 3MFQA 2YVAA 4UBOA 4AJOA 4P4TA 1ZS9A 2Q2NA 1FW8A 1SZDA 2ZZKA 5KTRA 3RFXA 2MMGA 1FYXA 3FDIA 2R6DA 4J9UE 1UBKS 1SQ6A 3H18A 2HK9A 2ZYAA 1NBEA 1I32A 2IL1A 2R8EA 3NUZA 4R9UC 5CBPB 1X8XA 5EXDA 1GARA 2ZJFA 3K5HA 3L7IA 3MTDA 2XF2A 1P7CA 3RF6A 4YCSA 2QNIA 1EP2B 3Q7EA 1LNQA 1THTA 5G4LA 4KO1S 1BOFA 3KZXA 4EHHA 1YU9A 1ZONA 1JB1A 5LD2B 2BI4A 3BRSA 4K26A 4MUKA 1GRNA 1BXRB 1DWQA 3PUZA 2PGNA 1GL7A 4XGKA 1H9AA 2HADA 4W7SA 2IOYA 1AKVA 1H0SA 4G63A 3H11B 2Q0HA 1YUNA 4C7VA 4IFTA 1RXSA 1H2FA 3DV9A 4FSHA 3OJWA 3IE0A 2C94A 3KT6A 1N6IA 2GN4A 3IUYA 1JXMA 2WTUA 4RY8A 4MCJA 2QD2A 1N9ZA 1XL1A 4F4IA 1KJYA 2RAVA 1WCIB 1WP4A 3H2IA 4RD3A 1GUBA 1R8JA 4JASB 2IHJA 1LLFA 3ORYA 2C3UA 4MUBA 3V2UA 1LNSA 1E9RA 2G5GX 1YZLA 2NNWB 2GYWA 1OXXK 2YIMA 3EVCA 3KD3A 2BISA 3M6IA 2YXPX 4GM1A 4X94A 1MB2A 2J3LA 4EI8A 2C4MA 4RX1A 1HI9A 1WDMA 3GNQA 1SCUB 1FC0A 2BE9A 1ZD9A 3KKEA 3JZIA 4Q9LA 1B7GO 1O0SA 2DBZA 1DAPA 4HEQA 1EU1A 4EG0A 1QHHA 2GM4A 1PSZA 5KX5A 1DKNA 2CD7A 4BHTA 1O6GA 4CT0A 2HLNA 4L1KA 3ZDYB 3DE7X 1PQUA 3O3NB 1T43A 1Z5VA 3JVEA 3EY4A 2XVXA 1QZTA 5TVKA 2V7PA 2WE8A 1XVUA 5EZ5A 5F2OA 3GDGA 3ZHVA 5DE3A 1V11A 3E7FA 3HVUA 2ZULA 3QF4A 1EDDA 3UA3A 4BFYA 3O5AA 1JAXA 2CNDA 1HE8B 2AN3A 3AEUA 3GWZA 3HJHA 3T7IA 4G84A 2J41A 4K28A 2ZB2A 3ZBUA 4YCLA 4XB1A 1RI1A 1CUCA 3W5IA 1J5XA 3QKWA 3QU4A 1QFJA 3CUWA 3IEKA 3BMCA 3BK1A 2OHGA 3W2FA 5K4GA 4KP7A 2ZAGA 3QYPA 4N7BA 3RWBA 3ZVNA 2B9EA 2CMHA 1MQ9A 3NVAA 3NOQA 2ZSAA 3I53A 1RMYA 5DHQA 4G67A 3ZHUA 2VYCA 3CONA 3LGSA 4MJ3A 2E4VA 3W9YA 2IZ0A 2XX3A 2IIQA 2ZXEA 4HWGA 4HWRA 5ALWA 2AYXA 4D5GA 4F3RA 3PGA1 1K8RA 1YK1A 3T3EA 4E5NA 2AG6A 2AOTA 2VDVE 4D9NA 1VIMA 3CJRA 3CZRA 1R0KA 1IY1A 1NY6A 1JSZA 1AUPA 1EK5A 2GAOA 3HU3A 4HFJA 4LZJA 4KXFB 1CP3A 5KVCA 1CUFA 4P3PA 2Y1OA 4PNHA 2PSEA 5H0IA 2YUIA 1WUTA 5EAIA 3OPYB 1B4DA 2ODAA 4R9VA 2ZETA 2L0XA 3WDLA 2R7LA 1VYTA 3K9FC 1NYRA 4RF4A 2FJ0A 1E7RA 2PWPA 2VATA 3T9DA 1ZISA 4LBYA 3O94A 2Z56A 1CY2A 3BGIA 4W5WA 1USIA 2Q6IA 1C3JA 1CKEA 1QGDA 1ZMRA 3DS8A 4LVOA 1R0ZA 4GLOA 4PZCA 1TB4A 5EIEA 1MMFB 4D0SA 3EXFA 3G8DA 1EVIA 2H7YA 1E7QA 5JVDF 4PQYA 3V9AA 2PKXA 3NNSA 1VBMA 2R1VB 3KXKA 4PSCA 1LBSA 1E3IA 3PPWA 4HPJB 3UHOA 1DQNA 1FFXA 4W5TA 3VKFA 3PFGA 3PR3A 3R3VA 4Z1OA 1E20A 1PZNA 4YACA 3EA0A 2WHYA 4P7KA 5KKCA 1U1IA 4WXMA 1ML3A 1SVKA 4LYFA 1N7IA 2F1JA 4GR4A 4UAJA 3SX0A 1B74A 1E6KA 3OZUA 3LBIA 3L79A 4C6RA 1UMDB 3TNYA 1KZ1A 4XJTA 1SVSA 3O93A 4DCNA 3OOHA 3I23A 3GQVA 1L8LA 3AUJB 1LK0A 4G5RA 1UMBA 3TFQA 3ZN2A 1CEXA 5F64A 1ZFNA 4PYMA 3GEPA 2QTTA 2DC1A 3CZ5A 4LJSA 1QPZA 5BT8A 1NMEA 5JR3A 4R05A 3C8UA 1AKQA 3C3KA 3FOBA 3KVOA 3LPMA 1M6EX 4Z2AA 4B6GA 3DCYA 2Q0QA 3WWOA 5KNBH 1WCWA 4TS1A 1E2IA 3TM5A 2O7NA 2ZB7A 3TKYA 1OC2A 4TQAA 2V8BA 3GFPA 3G5UA 4DV4B 3PHLA 1G2OA 4IV0A 2I9PA 1JDBB 2VR1A 2AR0A 3KFXA 4LSWA 2FDXA 5IKOA 4LFBB 3BD8A 3GDOA 2X58A 3OQBA 2PM8A 3W5VA 3I6ZA 1FNMA 4UUPA 1PFQA 2F3UA 1PJLA 2RBGA 3WLSA 5K09A 1AQJA 3GLHB 4UCQA 5ER6A 1FFDA 4FGKA 3UAGA 3L07A 1VL2A 2VYQA 4M0EA 1ODIA 1LC3A 1KMIY 2TRSB 2OGTA 3HWRA 2NTYC 3CZMA 5JXHA 4URZR 1DFIA 2GASA 5B3JC 2H1FA 4L7VA 4UHHA 3FPJA 4RF2A 3DVLA 4TXJA 4UD2A 3K8OE 1PDWA 3R9IA 2BL4A 3RSZA 3D8NA 5KWJA 1XALA 3M6WA 4S2UA 3Q2IA 3F78A 3TW8B 3N2IA 5KZMB 3L7LA 8AT1A 3KJXA 3ZV6A 2B5WA 1GCIA 2N1BA 4B82A 2NUTB 3NYIA 1OYYA 4XJSA 1VBKA 4LQ4A 4E4RA 2AX3A 2Q6OA 3IAS6 2HPZA 4YMTA 3QXGA 2V6IA 4L57A 5CFLA 1MH9A 2FZWA 3L8GA 2CUNA 1K27A 3JQAB 3NOVA 3E8MA 1RD4A 3BS4A 5H02A 1E2BA 4XJXA 4G9BA 1QVVA 3TS1A 4K9DA 3CNEA 4GPAA 1TU3A 1J9GA 3DE3X 4R1TA 5EMNA 4DZZA 3UKDA 3E35A 2P1ZA 1PX0A 2QW0X 2QX8A 1IWPB 1Y8CA 3KAPA 2FKNA 3BSYA 3V2IA 1R8XA 4QDTA 2X6RA 3VVMA 3OQVA 4MQFA 4AYTA 3Q41A 1BRMA 1SC9A 1X7DA 5B37A 5HJ7A 3H9BA 3I42A 2XMDA 2QX9A 4MICA 4O1IA 3LDFA 3B8EA 2E89A 4INAA 4PC2A 5DW3A 1U6JA 1V1MB 1K08A 5KTPA 1QR2A 2QZJA 4IL5A 1EGVB 3G5LA 5D51S 4YO8A 3T7KA 1P2TA 1CQJA 2Q29A 1I7SB 4EFLA 4IDFA 3MJEA 1L8QA 1FEZA 1USKA 3N3AC 3MT7A 3A70A 3BE4A 3V6MA 2G5CA 5IT4A 1WXGA 2ZXUA 1D8AA 1Z83A 2NO6A 2FQWA 3ZHYA 4TTSA 4R2JA 3X2EA 3L7BA 1F2TA 4I50F 1CR6A 3CNHA 3AC0A 3U16A 5G1NA 3R9XA 4DANA 4RVCA 3ET4A 3U31A 4W5QA 1WUIS 4RESA 2JGRA 1OT3A 3L6UA 2C9MA 1OV6A 4LOLA 4X5OA 2EEPA 2LWIA 3NHSA 5FR1A 2P2GA 3UK6A 4BASA 1GILA 2CDAA 4O4JB 3B70A 4FMDF 4ZGWA 2EBUA 5IC6A 1RAFA 1MPTA 3DW1X 4AWBA 2QVLA 4J7CA 4JS0A 2P62A 1VHLA 1SGWA 1UDAA 2X2FA 4N03A 4F45A 5FV4A 3RUIA 2A5FA 3AI2A 3VPAA 1QLWA 3ND8A 3DZ8A 3KJEA 1VPVA 4PSUA 4DXDA 3H17A 3IQGX 1WABA 1FTNA 2NUBA 1I6WA 4FGSA 1XTKA 2HNKA 3JATB 1E5XA 1CUJA 1DPGA 1G5IA 4FOSA 3LKVA 1QIMA 4H7JA 16PKA 3IP1A 4LQCA 3W5SA 1JXOA 1NVWQ 1CT9A 4F2DA 1E4OA 4R1QA 4ZK2A 1CJVC 4KAAA 2YWEA 4ZVQA 2X41A 4OB6A 3CNQS 3KOMA 5FTNA 4D92A 1B0UA 5KVSA 3R6LA 5K5EA 3KTFA 1FOEB 3GJRA 4K0KB 3Q6NA 2FMIA 2B8TA 3D02A 4BEVA 5KX5B 4AXXA 1RJFA 3BJIC 3TZQA 1E69A 2EKZA 1QQAA 4OQLA 3E1GA 1DSSG 3H2BA 5IYZF 3Q11A 4GQAA 1TQDA 2W6OA 3SCZA 2V6MA 1X9HA 2CCJA 4QBKA 4TRJA 3WGLA 1IHYA 4CVNA 4LUCA 1E6LA 1TTQB 1BQ3A 4HS4A 3VR3D 2JGJA 2QD1A 4NAVA 2VP3A 2IHKA 2ZR8A 1L4KA 2I1VB 3GA0A 1NU8A 1GPBA 3OPXA 4I8DA 2AVNA 1NNI1 1IIRA 2G9VA 2XUQA 4RKRA 3RODA 1BE8A 3T54A 3WMGA 4CGYA 1V8ZA 4DV3B 3OY7A 3B51X 4Q39A 3A9WA 2PVSA 2DWQA 2FPSA 4AMVA 3AWDA