1RIVH

Anti-cocaine antibody m82g2 complexed with meta-oxybenzoylecgonine
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
223
structure length
220
Chain Sequence
b'EVTLQESGGGLVQPGGSMKLSCAASGFTFSDAWVDWVRQSPGKGLEWVAEIRNKANNHATKYTESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCTSVPQLGRGFAYWGQGTLVTVSAASTTPPSVYPLAPGSGGAGSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTQVDKKIVPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab M82G2, Light Chain
publication title Carving a Binding Site: Structural Study of an Anti-Cocaine Antibody in Complex with Three Cocaine Analogs
rcsb
molecule tags Immune system
total genus 43
structure length 220
sequence length 223
ec nomenclature
pdb deposition date 2003-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rivH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rivH02
1ORSB 1KTKE 3RL2B 1LO3H 2XPGA 3C5SA 4U6XA 5C3TA 4PJXA 3L5HA 1XMWA 2Q8BL 3RWJA 3EFDL 3JXAA 3WJJC 2EH7L 4P57B 2Q8BH 4X6EB 3EFDH 1KJ2L 3GMLA 2WNGA 1IARB 3ZKQD 5F1OB 3MCLH 3IKCB 1IAKB 1KJ2H 3F5WB 5EU4A 5EZJA 1MCLA 3QZWG 1CFVL 3U0TA 4PJFF 3U4AA 5D93B 2PYED 2VDPL 4Y4HC 1ZXQA 2C4FT 1FV1A 5H8DA 2BC4A 4C56E 3VFWA 1WFNA 5E8PB 3KXFE 2A73B 3D2UA 4F7MA 5EU3A 3AMKA 4DWHA 1Y0LB 1RZGB 3NIFE 1IC7L 3E6FB 3ARPA 1U8PB 3VXOA 1FJ1B 1IM9A 3O6KL 4EDXA 1IC7H 4QXGL 4PJIF 2XZAL 3QXDA 3RZCC 4LPXA 4D0BB 4QXGH 4NP4H 1IEBB 2XZAH 4PJ7E 5HDLA 3IJHB 3L5XL 5C0IA 3TBTA 1P4BL 2ZNXA 4X9HA 2O5ZL 5EFIB 4G8FA 4YDIL 3T0DA 4NPYA 3GMMB 1P4BH 3FQXB 5LG1A 1NDMB 4PJDA 2AJZB 3EUUA 5ALCL 4YDIH 5GJSH 2FX8L 4S1RL 2AI0H 5E1HB 5KSUA 1AXSB 4U49A 1CXEA 2MNUA 5ALCH 3Q1SL 1NEUA 2FX8H 4S1RH 5E2VL 3DTXB 3D25A 2P45B 2ZCKL 4IBLT 4K3EL 3Q1SH 3A6CL 1YNLH 5E2VH 2VXVL 1NFKA 2ZCKH 3ISWA 4K3EH 1A6TB 1OAYL 1JTPA 3SDDC 3A6CH 3ZE0E 3RDTC 4NRYA 2HMID 5TQ2L 2VKXA 2DBJA 1OAYH 3G5XB 4BSVA 4WIQA 4JRXD 4N9OB 2OP4L 4HWBA 4G6FD 5TQ2H 5MEQA 1U41A 1Z2KA 2I9TB 1NJ9B 4JFPB 5J11B 5JPMA 3RGVB 2OP4H 5C0AB 3OKMA 3NAAH 1FZOA 5L7XL 4DEPC 1H3WM 3GIZL 1A7PL 3RIFK 1AI1H 5I1DA 4KUCF 5L7XH 5AUMB 4M4PA 4LL9A 2EYTB 5L8LB 4J23A 3QDJA 1JZ4A 2NYYD 1TZHA 1DFBL 5MENA 4LVNC 1DFBH 2FLRT 5HDOA 1N2RB 2QQQA 1AO7A 4OZIF 2F5AL 4X6DE 1A14L 2ADJB 2VLRE 4NZTL 2F5AH 1MJJA 2YPKA 4PJHF 4PS4L 1CXHA 3RRQA 5HYEA 1A14H 1W0VA 1WCBB 4LBEB 4R9HA 4NZTH 2AK4B 4PS4H 5D5MF 1UKTA 3ARDC 3FN0L 4LARL 4QKXB 4L4VE 3O2DA 5CMAB 4C59B 5BZWB 5DF0A 2YD3A 1HINL 4Y2OA 5IEKB 4EBQL 5T1DL 5HYJE 1FG2A 1HINH 3VDAA 3V6ZB 4EBQH 3I9GH 5T1DH 4LLQA 4BA8A 4I0PB 5J7CC 5DC9B 2QADB 4N8PA 2V5RA 5A43C 1EH9A 3T4YA 2DN7A 3BN9D 5CKAA 5IVZB 4XH2B 2D31A 1LK3L 3HN3A 5MEOB 4LSQL 2Z35B 2C4FU 3S96B 1FFRA 4EOWL 1MVUB 2EYRA 1IKNA 3OGCB 4LSQH 5F96H 4FMKA 4EOWH 5T1MA 2Y36H 1DBKL 2C3GA 3SCMA 4FFVD 3ZDXF 1DBKH 2E7LA 4S2SA 5JW5A 4GFTB 4N0CC 4L9LC 1I1FB 2IAMA 2YHGA 5J6HA 2LAAA 2FHFA 4I2XE 1ZA6B 4N0FB 4PRBA 4BJLA 2AJSL 5C0RL 1HYSC 5D2NA 5D1XA 1EX0A 5GJTH 3O9WD 5FGSA 2GSIB 3QZWB 2WBJA 3SDAB 1F6LL 2FGWL 1TJIL 4DK3A 5FB8A 5CIPH 4YUEH 4JB9L 1TJIH 2BHYA 1MAMH 3ES6A 5DS8A 4QNPF 3O45A 4JB9H 5ITBH 2G75B 3LKQB 4MVBD 2BRRL 3MOBH 1NAKL 5HYSA 2H45A 3VD5A 3X14B 2BRRH 2BNUB 1CICA 1NAKH 1KB9K 2Q6WB 3W9DB 4PIRF 3JV4B 1CGVA 1CDYA 5K9OA 2HJLB 4LFHD 4PBWD 2P46B 3BZ4B 2W0LA 3MLRH 4P4KC 5F7LB 1WLHA 3G6JE 1P6AB 3U2SA 1JGLL 1JZ2A 5AZEL 5SX5H 4LIQE 1MQKL 1JGLH 1LEGB 2Y5TB 1YECL 3UTTD 3MRFA 5AZEH 3NPZB 1MQKH 2J3SA 5TDNA 3GHBL 2FB4L 3GHBH 4A2LA 2FB4H 2JIXD 5L2JA 5EBMB 1NCNA 5EU6A 3OL2A 2EDBA 1MIEH 5IMKB 3CFJB 1EEUA 4RFEA 2DI8A 4JO1H 4ZAKD 4K94H 3DGCR 3L5JA 2EYSB 4GKZA 4OQTL 1IGML 5DURD 5HJ3B 5D6DA 5JO5B 3N1PC 1IGMH 5HD8C 5BRZE 2YN5A 4G80B 1PYWA 4NQUA 4ZUWB 2XIDA 3O8XA 2BVUA 2NXZD 4CJ1A 4G9DA 5KSAC 5DJYA 1UYWL 1HCFX 1QSFA 3QUYA 5EU7E 5BMFL 3VFOA 3MNVB 5CP3A 1UYWH 3AUVA 3CFBA 5HI5C 4D9QD 4M43H 4LIQL 4KWUA 1T22A 5LXGL 5IB2B 3VD7A 5I1CL 1G7IB 1SYSA 3LSOB 4LIQH 5LXGH 2R2BA 3PJSA 5I1CH 3LKNA 1IQDB 4YBQC 1ND0A 4YXHL 4JLRA 3HRZB 1TTFA 1NAML 4PRIE 2EDKA 2XA8L 1HWGB 3ZKXC 1K8IA 4YXHH 3B9VA 3OKNA 2XA8H 2YWZA 3TBWA 3ZE2E 2K3TA 1T7YA 3AXLA 1F02I 5GGRA 1TXKA 3REWA 3IAGC 4P23D 3R06A 4Z7NF 2NZ9C 4KJQD 3LPWA 4M7KL 5DT1L 3LEXA 4R2GD 1YEDB 2H32B 4B7LA 1GC1C 1UXWA 4C4KO 2QSTA 1R5WA 1EK3A 4U1JA 5GQBA 1T6WA 2D03L 2A9MH 4GOSA 3IFOA 4XCCL 2ED7A 3EYFB 2D03H 3AM8C 4KVCL 1E28B 4OZ4A 4XCCH 5CEZD 2DRUA 4M3KB 1ZHBB 5L0QC 4I5BB 1U8IA 2L7JA 3VXUD 5KN5B 1IAIM 2VDNH 1CVSC 5DMIL 3JBG7 1FFPA 5BO1L 1KTDA 3RHWF 4P5MB 4OFYA 4M93B 5DMIH 1BIIA 1FNSL 3IYLW 5EBLA 3UPRA 4LSSL 1FNSH 1QFPA 3T0EA 4WNQA 4LSSH 2D7NA 3ULUD 4FTVE 1ZS8A 5EB9A 3OV6A 1A9EB 1UACH 4HWZA 1LVEA 2V5MA 4RAVA 4U1IB 3VGAC 5JMOC 1LNUA 3FO0L 2DD8L 3BI9X 2UV3A 5SX4H 3PGCB 3VA6A 2Z93B 1J1XH 2VAAA 3T0VA 5D7JB 4PJ8D 3M45A 3RVUD 3I6KB 4U7KA 1P2CA 1YMHA 1NGWA 2X4TB 1SMOA 3P4LA 5MP6L 1JN6B 1OSPH 2DQUL 5J12B 5FGBC 5GS1C 5IBLC 4LCCC 5MP6H 3RPIB 5C0EB 2DQUH 4GRLB 4X83A 2A6DB 2Q76A 2WUCL 2DTSA 4PLJD 1YDPA 5F1IB 5K59F 1UH2A 2WUCH 2W1NA 1XGTB 1OLZA 3R4DA 4MAYC 3FN3A 4P46B 4NBZB 1YC7A 1FZJB 1TTGA 1A3QA 3HE6A 1DQML 4OF0A 1EAPB 5SWZB 4NJAL 3ZYOA 1FL3A 3LKSA 1DQMH 2QSCL 3W11C 3TFKD 3AB0B 4OZFA 4NJAH 3VFSA 5CJQH 2QSCH 5C2BL 2DJ4A 4XBPA 1RZKL 4GJTB 1B3JA 1JNNL 3RUGB 3GFUA 5C2BH 3LPGA 2ATPB 2ZOLB 1JNNH 2CXGA 4LCYB 3D9AL 4Y4FC 2NLJB 4XPHL 2GCYA 5F7NC 1EUUA 3D9AH 3MRNB 1FVCA 4LEXH 4XPHH 4Y2DA 1BFVH 1E6OH 1TVDA 4KXZH 2X44D 4F58L 1I1AB 1BX2A 5I75C 2Z4QA 1WC7B 4F58H 2JJSA 1J0YA 1LDPL 5E0QA 4M4RA 2GJ6A 1JRHL 3GMNB 2XQYK 3BKMH 3WNOA 4Y5VA 4BKLA 1JRHH 3DXAE 5F3BB 2OR9L 2J8UA 1WWWX 3MRQA 1S5IL 1BD2E 1D5MA 5EZLB 3MUZ1 1CS6A 4JPVL 4RX4A 1FNEA 5JIPA 3PHQB 4HAFA 3FB8B 1GOHA 4JPVH 3QPQC 1B6DA 1NPUA 3IXAA 1A5FL 4XNQA 4CDGC 1DEDA 5CGYC 1HSAB 2N7AA 1JZ3A 5J89A 1AFVH 3KPMB 3OAUL 4KTYA 3IU4H 1A5FH 1K5NB 5E2JA 3SN6N 3WMSA 5I18L 4FQXD 1FDLH 1N26A 3OAUH 3VXSE 1MCHA 2B8OT 1CGTA 1LO4L 3ILPB 1JNHA 3TT3L 4F7CB 2NY2C 4PJGE 5K9KA 3IF1A 4ZMAT 1JZ7A 1T7XA 3TT3H 2P4AB 3HR5A 2XTJD 1KJ2B 1D9KA 4XGZB 2V7HB 3KJ4C 4KJWC 3BH9A 3VD9A 3DX7B 1KYOJ 1KCLA 4WUKH 3O41B 1Z6JT 3EYQD 4TSCL 4M00A 2FD6H 4JDVA 2D7OA 4PJEA 2F15A 3MJGX 3GSQB 5C07B 4V1DB 3WNPA 4WJ5B 5H94B 4P4RA 4QF1B 4L8CB 4GH7B 1F97A 3C6LC 3N06B 1OTSD 2Q87A 2H8PB 4IMLA 3TEUA 4GRWE 1IKFL 3V7AE 4XVUC 1ZHKB 4W4OA 3BPOC 4L3EA 4KZDL 4B0MM 4F33A 1PY9A 4KZDH 1C5DA 1UT9A 3EOBA 4GSDL 3OGOE 4NN5C 4PBXA 4PRHD 4UAOC 4NBYB 4P2RE 5F8QC 4X8XA 4ODUB 5I8EB 1G9EA 5ILTL 3CFDA 4GSDH 4Y1AD 1X44A 3VWKC 4UQ3A 5ILTH 1RZJC 4L8BA 1B6UA 3BXNA 3NIGF 1OLLA 2QJDA 1I75A 3IJYA 2G2RB 1N6VA 4HUXA 5IQ9B 3MR9B 4LPYA 3QDME 4IS6A 3IDMA 2VLME 2VQUA 4EI5B 4J2XA 4UMGA 3MJ8B 4DVBA 1DBJL 2HFFA 2VXQL 3HZMB 2EH8L 1NCBH 2OX5A 3U0PB 4D9LH 4M1DH 4YX2L 1DBJH 2VXQH 4CVUA 5KAQG 2EH8H 2HRLA 4C56B 1ZHLA 1U2CA 2VZVA 4GAYB 2D0FA 3KXFB 1U3HD 4YX2H 1CXFA 3O2WH 2NMSA 4XWOD 4XBGA 4Z7WE 3T2QA 4D0DA 4GRWH 4GXVH 2BXZA 3M07A 1OSZB 3B83A 2EDRA 4GQ9L 4ZG1A 4OKVA 3QWRA 3SE8H 3UYOD 4GQ9H 3KR3L 1HHIB 1QFOA 4R96A 4PJ7B 3SY0B 5HYQA 5I6XB 3KR3H 5IROC 5INDB 1IL1B 1OHQA 3OWEA 1OTTC 1CFQB 4ZXBC 4HAGA 5JNYB 3VWJA 2RB8A 4HKBB 1EFXA 4PV9B 2Y6SD 1E4WL 4OKDA 5B4MD 1CE1L 5ITFA 5ACMA 3K4ZA 4JDZB 4Y19D 4JZNB 5J6GA 4XPGL 3VMOA 1CE1H 4RFOH 5MHSE 4APQD 3WFEL 2MSPA 4XPGH 2BSRA 3RWFA 1EPFA 4OF5A 1K3ZA 3HHRB 1T66D 3WFEH 4W6YB 5FYKL 4MQTB 1AQDB 3BPLC 4PY7B 1BVLA 2R8SH 3KPRA 3GMPB 2YOCA 2KZWA 1J18A 1EV2E 2HJFB 3WNLA 2DS4A 4J3VA 2DQJL 1VESA 4KZEL 4XNUL 4U6TA 3H42L 4PFEA 4L29B 5JOFB 4A2MA 1KIUA 1QSZA 4KZEH 4YDLC 4YDVB 1AP2B 4XNUH 3SGDI 4BQ8A 5DVMA 2BERA 5B8CA 3H42H 1T80A 4FQJH 4WV1A 4EN3D 1K8DA 2UWEE 3LAFA 3VFVA 4GBXB 1R24B 3VGDA 1OAZL 3VXRB 1I3RA 3HLAA 3IDNB 1CQKA 4J6RL 3FFCE 2JKXA 3S36L 4TVPD 2PF6A 1YN7B 5I1AB 5EOTB 4JM4L 3S36H 2J8HA 4WI3A 4HX1A 4X6DB 3RI5K 4JM4H 5GGRY 4YHYB 3LDBC 5L9DL 3TO2A 4E5XB 3VU2A 2RQ8A 2FBJL 1PKQE 4YAQA 4O2EB 4PB0L 1E27A 2I27N 5L9DH 2DBLL 2XWJB 2FBJH 1A4JB 4O00A 4PB0H 2DBLH 1RZJH 4CDHA 2VQ1A 2VDML 4ZUSB 4ODXB 5HYJB 3U46A 5DA4A 1FAIL 3H7LA 2D2OA 3QAZC 1FO0A 3I84A 1T5WA 5CIPB 2VDMH 3NH7H 4LCWD 1NCCL 3HE7B 1I4FA 3W0WB 1FAIH 4I9WE 3T09A 2MCPL 1TQCB 3WJJA 4L4TA 2VDOL 3K4AA 2MCPH 1AKJA 4S1SL 1MUJA 2RHEA 1RZ8B 4NQEA 5CWSB 3QUXB 2V5TA 2VDOH 3PWPD 4UQ2B 3THML 3I6LD 1WWCA 2FO4B 1Z0NA 5C8JB 3GM0A 3E0GA 5EULV 3ULVE 4Y4HA 4NQSA 2E9IA 1RURL 5AEAA 4Y5YB 1T1XA 1TTUA 1EHXA 1RURH 3QIBD 4OZHA 4X6BB 3QXVA 5T1LA 3VD4A 5E8EA 4MMXC 2Q7YB 2CK0H 4I2XB 5IK3A 4EUPA 5LGJB 1JV5A 4LHUA 2XV6B 3DECA 4MX7A 4LQFL 3RZCA 2QQLL 1BVZA 4X5WB 4LQFH 2QQLH 3ARDB 4L5FL 3L7FA 4YE4L 2UUDK 4V2BA 3CFCL 3LKRA 1A9BA 2YBRB 4L5FH 2XWBA 3VXPA 2BCKB 5DEFB 5E03A 4M7LT 4HMEA 4P59L 5IVXF 1KIRA 4JREC 4EEEA 4P59H 3B9KA 4OGAC 2D7QA 5CHNA 5C9KA 3MRCB 4ZFGL 5DFWH 4HUUB 2G9HA 3KYOB 3MRRA 5F97E 3ULVL 3SDDA 3UYRL 4ZFGH 3RDTA 1F4WL 1RUKL 1QO3B 2VLJA 4FXLA 3BISA 4N1CA 1S78C 3WHXB 3TO4B 3ULVH 3UYRH 4CVXB 1WUNT 1F4WH 1RUKH 1IILE 4PJCA 3ROLB 5DC0A 3G6JB 3N1FC 5TDPB 1NDGA 2BOCA 5IQ7L 2NY1D 1LMKA 2OYPA 3VD3A 4LOUD 5E08H 4CVZA 5IQ7H 3EYUL 4FXGA 5KSVB 1HYRC 1TVBA 1BM3L 2HTKC 3I2CL 3QO1B 3EYUH 1CU4L 1BM3H 1U0QA 2J5LC 3I2CH 4KVNH 1CU4H 3ILQC 4GKNB 5JDSA 2NY0D 5T3XE 1CG9A 3VFRA 4XMKH 2X42A 1N59B 4MCZB 4XPBH 2YUXA 5I16B 4P2QE 1BFOA 4MNGE 5HSFA 4U1NB 5D7LD 4PD4J 2Y7QA 2H3NA 4PTTA 1C8PA 5I1HL 3TPUA 3MRLB 4R3SB 3CFIC 5IJVA 5HHMD 5ACZB 4HBCL 5BRZB 2YR3A 2I60L 4HBCH 3U1SL 1MLBB 4J4PD 4L1DA 1R3HA 4TQEL 3U1SH 3V5DB 3O3BA 3EJYC 1XF3A 2ORBL 4ZFZA 2B4CC 3FTGB 2AJUL 1OGAD 1WAAF 3WN5B 5CEYA 5JIHA 4JGMA 5J0BA 4NFCA 5IGXH 3IDGA 3UZQA 5FYJH 1A0QL 3B43A 3ZHDA 3OKKB 2CK2A 4N0UA 1VSCA 5DJ6B 4Q9RL 1FGVL 4U3CA 1A0QH 1XGRB 2OI9B 2FL5A 3VI4E 3LN9A 3TO4D 4PRIB 3LQAL 1EO8L 4L9LA 3D69A 5T3XL 3EGSB 2X4UB 2YUVA 1EO8H 3FHAA 1PG7X 3RVXD 5HVWA 2HFEB 3RUGF 1VFBA 1LE5A 1XGPB 2F74A 1U93B 1BQUA 2NX5A 4EQ2A 2BSTB 4JFDA 2V2TA 5HHNB 2LVEA 3K8MA 2P8MA 1QQDA 1G7HB 2LQRA 1Z5LA 3D39A 2M26A 3KPSD 3WXWH 3ARFB 4BZ1H 5EN2A 4HULB 2BHZA 4XC1L 1U8NB 1RUML 4WW2B 4Y5XC 1GOFA 1RD6A 3VRLE 4XC1H 5AYQA 4GRMA 4P3DB 1JPGA 4RAUA 2P8PB 4R0LB 3FT4B 4Y16C 5MI0B 5D7IF 1D5XB 4JQVC 4HEPG 1JYNA 5DMKB 1YC8A 3QA3A 3CSPA 5I0DA 3DYPA 2ED8A 2Y5EA 2XKNA 3BQUD 3MPCA 4PJAE 5EO9A 2ITDA 4RWYL 4GXUN 4PJ9D 1A8JH 3Q0HA 3QNZA 4XXDA 1NMCB 5E8NB 4P4KA 1ZLVH 4NO5A 4PV8B 4RWYH 5F9AC 2W07A 1KBGL 3V7AG 5TFSL 3HZYA 4MJIB 2ARJA 4U6HB 1JGEA 1KBGH 5I1IL 2GUOA 5TFSH 3WFHB 3L9RB 2J6EL 3G6AB 5CD5C 4FTVB 3BH8A 2J6EH 3DROB 3CX5J 1SJHB 3MOQA 4G6MH 2FEEL 3FQWA 1HKLH 2VL5B 5J13B 1XCQB 4UU9B 1G0XA 3WJLC 4IHOA 4U1LA 2C3VA 4JRYE 4WWKD 5DRZA 3RBSA 3FO1A 1A21A 2GI7A 2GFBA 2YD6A 4YO0A 2XPGB 4JO2L 5E94B 1QSED 5BCAA 1CFSB 2HVJB 1S7TB 4JO2H 4TOYL 4KJYB 1OT1A 2R4RL 3L95A 1J11A 5HYFA 4TOYH 3GMLB 1FZMA 2CUMA 2R4RH 4HDIA 3TYFA 2B4CH 3DRQA 5AWNL 4Y7MA 1B9ZA 1Q1JL 5EU4B 5KSAA 1UGNA 4BZYA 1DQLL 5TE4L 4PJ5A 3MYZA 4OCMC 2QR0A 4S1DC 5AWNH 3U0TB 1G7QA 1NL0L 2DMKA 1Q1JH 3SDCB 1MF2L 5TE4H 1DSFH 3VFTA 1NL0H 4UV4L 1I7ZA 1EVTC 4ETQA 1MF2H 1NKOA 4UT6L 3QWOA 5KOVC 4OLYH 4ENEC 4OZGE 1MHEB 3JWNC 5KVMC 4UT6H 3D2UB 4HGMA 2Y9RT 2XFXA 1A6WH 4JY4A 5E9DE 5GGVL 3GO1H 5LQBL 4F9LC 1SJVA 2PETA 2GTWB 2ZUQB 5GGVH 3SO3C 5J1AB 3RVVC 3F7PC 4HUNB 1PQZA 3BN3B 2ZUXA 2IBZY 3UJIL 3G5VB 4MJID 1J0IA 1KIPA 3MQIA 4L8DA 1YJDL 3HG1D 3C60C 1CZ8L 4K71B 4UDUB 4G8FB 3SPVA 1YJDH 2MKWA 1CZ8H 2ESVA 2CRZA 4KU1A 2IPKA 3DXAB 3B2UD 2BX5A 4OUOA 1CLYH 5FYKU 2CDGA 1ETZA 1BD2B 1B0GA 3BE1L 3V52L 5C6TL 2BVPA 3CSYB 4K9EC 3V52H 4YEFA 3VXQA 2X40A 3BGFB 4HXBL 1INQB 4LPCA 5JHDE 3IU3B 4OGYH 5GRXG 3QJHA 1CWVA 5HI4C 3K8KA 4HXBH 5DK0A 4MD0A 3WS3B 4FQIH 5CS7A 5F88B 5FDWB 1NFDA 3CZJA 3VG9B 2V2WB 3VXSB 1FN4B 1F3RB 3PV6B 1HILA 3DVFA 4PJGB 3MREB 5A16B 4XX1E 2CSPA 3GMRA 4JO3L 2X2YA 1W0WB 2EXYD 3MV01 1X5FA 4JO3H 4POZD 1ZA3B 5DHYB 2CLRB 4AM0B 2CIKA 1ZT1B 2F53E 3QO0A 1ZANL 1I1RA 2WLZA 1NGZB 5DD5L 2FR4A 3H9SE 3FJTA 3GHEL 1ZANH 4XMLL 1W0YT 4AIZA 2BMKB 5EBWA 5DD5H 4OD3H 3ARBC 3GHEH 4XMLH 1IM9D 5E6IB 1JUFA 2W91A 4GRWB 4LNRB 1UC6A 5FGBA 5GS1A 3G6DL 4RDQF 3L3OB 1KNOB 4X7EC 3X3FL 3G6DH 4EVNA 4MAYA 2AEQH 2H2PC 1S9WA 1I8LC 4P2RB 1KB9J 1T2JA 2YSSB 3U30B 1INEL 4PP1C 4LRIC 1IC5L 4LLYB 1INEH 4BH7B 1IC5H 1HNFA 5B21A 2C3WA 3L3GA 1G9NL 3QDMB 1CFTA 43C9B 4QCIA 5JW5B 3ARVA 1G9NH 4Y4FA 5DRXA 4XI5D 4PRBB 5I8OL 1AR1C 4H0HB 1AC0A 4AH2B 4NNYA 5EC1B 1CE6A 5D8JL 3QDJD 1VACA 4RA3A 5DUBA 2WBJB 4QHKI 4ETYA 5TPWL 4Z7WB 3NCFB 5MEND 1FO0L 5D8JH 1EGJL 5I71C 1A6UH 2EZ0D 4XCFL 5TPWH 4ZUVA 2ZSVB 1AO7D 1CIDA 1EGJH 1AXTL 2F54E 1RUQL 3DHMA 1TJGL 1JPSL 1UA6H 2NXYB 5CBEA 2BVTA 1AXTH 2DQFB 5ESVA 3U7AA 3PQYA 1V7NL 4Z0BL 1NFIB 1UZ8A 2KH2B 4R7NA 1BFTA 4Z0BH 1V7NH 3MJ7B 3KPLB 2OL3L 1TZGL 4LSDA 5C09E 5ISZD 3BD3A 3KVQA 2OL3H 1HIMH 4OSUL 3GIVA 4HIXL 3TCLB 5ERWB 1KELH 1LK2B 4HIXH 3O3AB 4XNXL 3QFJA 4J3TA 3H9HA 3L3KA 3SJVA 1ZV5A 4QO1A 4NZRL 1P9MA 2P7TB 1S7VB 4NZRH 4FQ1L 1VKXA 4X6FB 2FEDD 2GAZA 4FFWD 5GZND 5T5NF 3SCMD 4FQ1H 1DVFB 3G5YB 3KYAA 5E7FA 4OM0L 3T0XA 1DANU 2C1PA 1ZMYA 3EIFA 1RMFL 4AL8L 3WXVL 3IXTB 2IAMD 3FFCB 4PRDB 2Y23A 4OM0H 3DURA 4AL8H 1Y18A 1RMFH 5FYKD 3D85B 1RQ5A 3UPCA 3C6LA 4WCYL 5D1XD 3U0WL 4HG4K 4U3XA 4WCYH 2EEAA 4JVWA 3KDMA 2WBJD 3GMOA 2AJVL 1KJMB 1FVEA 3O8XB 1H5BC 1MFEL 3HB3D 3SDXE 1XIWC 2X1XR 4NSKB 1MFEH 3VFMA 3QUYB 4XHJC 2HKFL 3VWKA 2BNQA 2HKFH 4HS6B 1NEZA 1CICD 4Q7DA 4QRSB 1A1MB 1V8HA 2CDEB 2HT3C 5H2BB 2VMFA 3X17A 4LKXA 4MSWB 4FQCL 5J56B 4U1HB 2QKIA 3V6OC 4FQCH 3EW3B 4AENA 2IBZX 3QULA 2V5SA 4JPWL 3CUPA 1FLRL 5CZVL 1KJ3H 3QEUA 4FQ2L 3VFPB 4IOIA 1FLRH 5CZVH 4M6ML 5BQ7B 3IAPA 4RQQB 3LEXB 2NY6C 2NY3B 3V0WL 4WFGE 4KROD 4M6MH 1AGFA 5CZKA 4NQXA 3LY6A 4F3FA 4NWUH 4UV7L 5C0ND 4X99B 5DFVC 2XRAH 2UYLB 4UV7H 2AGJL 1LO0H 4RMRA 5EU6D 1I1YB 4G8GA 2GYSA 4C83A 2AAVA 1FNLA 1IGJB 5AYUH 1ED3B 4GG6E 3WDHA 5IROA 4F8TA 1G7LB 3FQRB 3MRDA 5F9OL 1S9VA 3WD5H 2A77L 4XRCB 4ZXBA 2A0LC 3GKWH 3GUTA 5ID0B 3D0VA 4XWGH 5F9OH 2A77H 2ATKA 1U58B 2CKBH 1I8IB 5KSBE 4FG6C 3G08A 4J8RB 4QRRE 2O93L 1KEGL 5DRNB 1CIUA 1HHJB 1U3ZA 1S7UB 3OJ2C 2YA0A 1BIHA 2ADIB 4QT5A 3HNSL 4JDTH 1KCKA 4R8WL 1T21B 3HNSH 3PNWA 4YQXL 5IKCA 1QPXA 2X4RA 1QSFD 2WWKT 3RIFF 4R8WH 4YQXH 2K9UA 1ZS8B 2X05A 4WW2F 2NY5C 1FFOB 4UBDC 3TVMC 4OLVL 2JB6A 2BFVL 5L2KE 5DSCB 4LMQI 1S7WB 4OLVH 1KCUL 2BFVH 1XZ0A 1A1OB 2A6IA 3VE0B 3MZGB 2APBA 3ZKMD 3RJQB 3H6JA 3QFDA 4XTRD 3TBVA 2DWDA 4I1NB 5HDBF 5JOPD 1CLZL 4HC1L 1U6AH 2Q76B 1P7QB 4Z8FL 1CLZH 3MNWB 4HC1H 4B5EA 3GI9H 1G84A 1A7RL 4Z8FH 5FAAA 3QXAB 1MCJA 1U8KA 1NGQL 4WHYH 1B0RA 4ZYKA 1A7RH 4P2QB 1QHOA 3OR7A 3EYOB 4KGLA 3T3MF 3N1GC 1J0KA 5EO0B 1VFAA 3DARA 3PXJA 3NTCH 3MLVL 5IB4A 3F7QA 3VFSB 2NTSP 3MLVH 3UBXG 5IMOB 3CCHB 3UAJC 4IRJC 1G0DA 2YPLA 1FZKB 3WFZA 1J0ZA 1XH3B 3HNVL 3OXRA 1D6VL 5BJTB 4DW2L 3VW3L 1PD6A 1UB5B 4YHPB 3HNVH 3QXUA 1D6VH 1MI5A 4PJXF 4DW2H 3VW3H 5F7FA 1EHLH 1S8DB 1FVCB 1RUAH 5DC4B 1WTLA 4ODSL 5DWUL 5C0DA 3QCUL 1SY6A 3UP1A 3P9MB 2Q20A 5IB1A 1XGUB 4NUJA 3TN0B 3QCUH 3T0ED 4PGBB 1TVHA 2MWCA 3QDGA 5D71L 1JPST 4CN6A 2A74A 5C08A 5TGBB 2ARWA 4UNVA 1VEMA 4LPTA 4N8CL 5D71H 3MV7E 1AD9B 5JLZB 1S7RB 3U9UB 4QRQB 2X4PA 2YPVL 3H2WA 5HGBB 4N8CH 4ELMA 1FFNA 1JGDA 3MRQB 2YPVH 2D4DA 3TT1L 3VXME 2D7MA 3TT1H 3RWGA 2VABA 3P4MA 2BVOB 3KS0H 3UTPE 1RU9L 4HZLB 4XX1G 3L3HB 5DO2D 1RU9H 2I07A 4NNXB 4GW1A 4X7TB 2HFTA 3S35H 3HE6D 1NH6A 4PJDF 1T3FA 3KGRA 2NY5H 5FO9B 2DKSA 3DHJA 3O3EB 3P0GB 4GG8A 1QBLL 1T0MA 4R90L 4PJAB 1FH5L 4I77L 4BM7A 3TIEA 5EIQA 1QBLH 3QUZC 1BBJA 4YIQA 1FH5H 5BS0A 4K7FB 5F1NA 2IJ0C 4KTEL 3M1BA 5I8KL 1IE5A 1Q9WB 2YUZA 1I7TB 4KTEH 1WZMA 5I8KH 3IDYB 3C5ZC 3O0RH 4G9FA 3GSNH 3Q5YA 1EZVY 3DV6B 4BUGA 1U8HA 4P2OB 4BFGA 3DSFL 1FE8L 2YRLA 4Y2DD 1LEIA 5T1KB 3QH3A 4IJ3C 3NFPA 4OF7A 2VDQL 3HC0A 1E0OB 4MDIA 1N6QL 2VDQH 2XZCL 3L7EB 5F71A 4TUKL 4L8SC 4JRYB 1N6QH 2GJ6D 1BZQK 2HT2D 2XZCH 4TUKH 5DDHA 4DFHA 2R2CA 1FORL 4M6OL 1CD9B 1KPUB 1V3MA 3TBYA 1DZBA 3N9GL 1FORH 3IDIB 4M6OH 4NKDA 3T8XA 1NQBA 1GH7A 4JRWA 1S7QA 4TUOB 4XMPL 2EICA 2PO6B 4CU6A 3IDUA 4RX4D 4BH8B 4KI5C 5BXFB 2B5IC 1EXUA 4XMPH 3O2VL 1K4CA 5GS0C 3IVKA 4X5XA 1TZIB 3QUML 3HTLX 4ACPA 3F7RA 3IDMB 5IB3A 3QUMH 2FJGA 2EECA 3LN5B 4WEBL 5IR1B 1HHHA 3M17B 4NN6B 3MRJB 1IQWL 2HFFB 3HCVA 5EG6C 2CQVA 4D0CB 3F58L 4BQ6A 3MLZH 2FSEA 4JM2C 5I76B 4XZUA 1IQWH 4TTDC 4X0KB 4LVHC 3F58H 3B3IB 4X80L 4NJ9H 1KLGB 2V7NB 4GW5B 3K1KC 1D9KD 1G7JB 5MEPB 3QNYA 5E9DB 3D6GA 4WI8A 1UJ3C 5A2IH 3FO9A 1RZ7L 2CD0A 3D3VE 3UBXB 4PP2B 2HT4D 4DVRL 3U4EA 2RCSL 1CTNA 1U8OB 4X8JB 4JQXC 4RGMB 3OQ3B 2XXCB 2RCSH 3LQZA 1EJOL 2YC1A 4Z7VE 3QDHA 4ISVA 2JELL 4XPAL 5EPMA 1EJOH 1QVOA 2B2XL 4YZFF 2JELH 4XPAH 2YUWA 5D72L 4JJHA 3TA3B 4R6UA 3MBXL 1FIEA 2E8ZA 3K4DA 4N0YL 1YY9C 4JKKA 5D72H 4ORZC 5EOCL 5ITFB 3MBXH 4L3ED 5CBAB 4N0YH 2VH5H 4NQVB 4Y5XA 5EOCH 3RAJL 4KDTC 3UTZB 5BV7L 1M05B 4C54A 3RAJH 3ARSA 5BV7H 1TNMA 5CCKL 5JHDB 1F2XK 1NGYA 4JQVA 1J5OL 2G5BA 3U7YL 2DKUA 5CCKH 3NZ8A 3QCTL 5FUZL 1UEYA 1NC4B 3U7YH 2GK0B 5FOBA 3AU1B 2W9DL 2B20A 5FUZH 1XFPA 1NSNL 4G3YH 1O7SA 5A2LH 1F3JA 4LASL 3MA9L 1NSNH 5B39G 2CIIB 4JPIA 3MA9H 3GSRB 5CP7A 3WIHA 1VEOA 2FNBA 4NYLB 4IRSA 4G7YL 2BK8A 4XPFL 5DZNA 2JCCA 1CTOA 3VXTB 2XZQL 4G7YH 3IFNH 4G7VL 4XCNA 3UTSE 2F53B 2PN5A 1OCWH 4G7VH 1UVQA 4PJFE 3TO2B 1QBMH 2DM3A 3ROOA 43CAA 1KT2B 2YK1L 2PTTA 3BJLA 3H9SB 4JCLA 5E4EB 3AGVA 1NGXA 1R6VA 2IF7A 2YK1H 5D1ZB 3QWRD 3MZTA 4MMZC 4RRPA 3U46B 1Q72L 3DBXB 4YEEA 2LABA 2AXHA 1KLFA 2G60L 4JKLA 3BIAX 5TF0A 1K2DA 1M71A 1GZQA 2EE9A 1A7BA 4OIIL 5DR5H 4JKWA 3VWJD 4UILL 3S4SA 1EFXD 1CDUA 1MUJB 4FNLL 1T1ZB 1A2YA 4PJIE 1ADQA 2IG2L 5D6CB 3S3JA 2BNRE 2DWEA 4TRPL 2VWEC 1S7SA 1MFNA 4YHNA 1Y6KR 3T2PA 2IG2H 3QIUC 2AERT 2FWOB 2WANA 4TRPH 3QEHA 3T0AA 1EJ6A 2BVQA 3F8UB 3V0AC 5E2TH 3L5WA 2FJHA 5EUKB 2OL3B 4X4YA 2KQNA 5D70L 2OQJB 3G9VA 3KPRD 3KWWA 1IAOB 1L0XA 1L7TL 5D70H 3T4AB 1LP9A 2NNAB 3A67L 3DV4B 3QJFB 3SKNB 1QBAA 2NR6D 3CZFB 5DQJB 5GGSA 4OD1L 3A67H 5EO1A 5CEXA 2YD2A 4WHYG 3P0YL 2Z91A 1F42A 1UH3A 3PL6C 1GGUA 3CSGA 3HA0A 3LEVL 1IC4L 4DN3L 1T1YA 2R1XB 3C60A 4ZFOL 3LEVH 4M61B 2Y4SA 4S0TD 1IC4H 1AHWB 4QWWC 3WO4B 4DN3H 1UADC 3E2HB 5DJ0B 5KANG 4HV8B 1RJLA 3QQ4B 4WUUE 1WBZB 5GRWA 3P4NA 3RY6C 3B9KB 3ZMRA 3CMGA 1ZLWK 4F7TA 1P4LA 3ZTJH 4RIRA 4FABH 4OZIE 5IIEB 4LLAA 2YD4A 3RNKB 1YNKL 2VWEE 5CSZA 1UZ6F 3BWAB 4PJHE 1YNKH 3BD4A 5FYLL 5C09B 4KKCC 1T03L 1MCOL 5D5ME 3RX5A 1XF4A 4CL7A 4L4TD 2IH3A 2O5XH 1T03H 1MCOH 1AKJD 1OGTB 5FF6A 3FRUB 4NQED 5F7YC 4PRPA 3H9ZA 3GSVA 4CW1A 3CFEA 5GSVB 4CVZB 1DQJA 1WBXA 2DM7A 4B53A 2J2ZA 1HZHL 3CDCA 4OCYH 1FL5B 2XN9E 4Y4HD 3UJJL 1HZHH 1VB9A 1KXTB 2H6PB 1U92A 2OMBA 3UJJH 3MSPA 1IAMA 2YRPA 3K80A 1BPVA 2P24A 4H1LA 5ICYB 4JVPA 4M1CC 2V2XB 1KPVA 5T1LD 1FYTE 2QQKH 4M7ZC 4JHAL 2M2DA 5D96C 2Z8RA 1RULL 4KHXH 1WBYB 2P5EA 4LLVB 4LHUD 2Y7QB 1QNZL 2H3NB 1OAXL 5D1QC 1IGTB 1RULH 3MV9A 3RZCD 1ZGLP 3ZDXE 2OZ4L 2VLRD 5EU5A 5IJVB 1QNZH 1OAXH 3L3IB 5B39B 4WFEE 4P5TC 5HY9A 2A6KB 3HPJB 4Z95L 1HWHB 3SDXB 2X7LB 1HDMA 1VADB 4Z95H 1R3HB 1I8LA 5J3HC 1LDSA 1ZKAA 4LSRL 3S3SA 1B88A 1D5BA 2ZP0T 5F8RC 1AGDA 1H3VA 2EXWC 4LSRH 4F80A 1IC1A 1MFAL 4LRIA 4N0UB 2NW2A 2VDLL 3SDDD 3ET9F 3RDTD 2VLJD 1MFAH 3MFFB 4A6YL 2FL5B 1ULVA 4QNPE 3Q48A 2VDLH 4A6YH 3EBAA 3NCYP 4JHZA 4DKEL 1WT5A 1KGCE 4RZCA 4DOHE 1G9ML 3O4LE 4EIZC 1VFMA 3NPSB 3V8CA 1JBJA 1IM3B 1T83C 1G9MH 2AXGA 3V4VH 6FABL 3BD5A 5C3LD 1VFBB 4QXUH 2GITA 2RFXA 5TDOA 1NUGA 1NC2A 1QQDB 2VZOA 4ONOA 5E24E 1T1WA 2APFA 1JWUA 2CLVB 4TUJA 3V7MA 2R56L 3T77A 3WV0A 3T65B 4PJBE 2R56H 4YK4B 4CUCA 1ZGLB 3WEXB 3RWCB 2X41A 4GG6B 4JO4L 4PGDB 4RAUB 5JPNB 2IQAB 4LLUA 3SBWC 1C16B 3EDEA 3KJ6L 2ENSA 4JKMA 1OP3H 1IMHC 4JAMA 2XKNB 4YFEA 2UZIH 4DGIH 3BW9B 3DMMC 4QRRB 5F9JA 5KSBB 2ITDB 2J8UF 1R5IA 3QNZB 5DEGB 5IW6B 4NQCE 4OCRL 3FQNA 1MRCH 1T0NA 3RTQC 3BP4B 3OJDB 3QHTC 4QXWA 1V3LA 3FRPA 1WEJH 3CSBA 3F12B 1QA9B 3CH8A 1F4XL 5TF1H 1ZVHA 2XICA 3GSOA 1MCSA 5A2FA 2BSSA 5IF0B 4D3CL 2IH1B 3QB7C 7FABH 4WI4A 1F4XH 4OI8A 4WO4B 1MHCA 3VFGH 3MJ9A 4D3CH 4F15C 3VRLF 5T33L 5L2KB 4JZJC 4P2CG 1T7WA 3MRPB 3RI5F 4JPKL 3LCYA 4PREB 4N0CD 5FKPA 1K4DA 1CT8A 2GSGB 2W38A 5IHZB 1VHPA 1HYSD 4K8RL 2W60A 2IADA 4NKOA 1SQ2N 1IGYB 2NX5D 4NQDA 4JFDD 3B6SB 4YBLB 2E7HA 4PJEF 3RBGA 3MO1A 4G42A 4QRTA 3D39D 5F7EL 5ETUA 5HGHB 1IEAA 2BY1A 2HN7A 1H5BA 5F7EH 2KL6A 1Q9LA 1IRAY 1XIWA 5FO7B 2ZCHH 4Z7NE 4JFOB 4LDOB 2FIKB 4BFBD 5IFAL 5KVEL 4ODWB 4PGCB 4CKVX 4Z7UA 4U0RB 5IFAH 4F7EB 5KVEH 5GGUB 2GT9B 3P11H 3MNZA 4Y4KB 3BSZH 1X7QA 2XQBL 4JY4B 4OB5L 3N50A 5KW9L 1Q9KA 3BP6A 3QG7L 4O2CA 4OB5H 4P4KD 3O6FB 3V6OA 5KW9H 2LTQB 5ESQA 3ZT6A 1G1YA 1PQZB 1KTLB 3QG7H 4PB9L 5B3NA 1EO5A 2P5WE 3LN4B 4QGTA 4QHKJ 4PB9H 1KIPB 1QEWA 1KIQA 1WZKA 2EDLA 1U3JA 3V5HA 1XF2A 3OKDA 4M1GL 1FNGB 4PUBL 4KK8C 3QIWC 3MV7B 4M1GH 5E00A 4UOW1 4K7PY 2CJUL 2NZIA 1C1EL 4TVSa 1HH9B 2FX7L 3VXMB 2R2HA 2CJUH 1C1EH 1EBPA 2PYEE 2AJXL 2Q7NA 4MJ6A 3SQBA 4FFZL 4PGEB 5IMLB 4JZOB 2AJXH 4Z18A 1UWGH 2X4NA 4FFZH 3PWJA 1AGCB 5TJWK 3P73A 4JFYA 3TZVB 1J7VR 1FNHA 3FZUC 5HD8D 5D93C 4WRLA 5EA0L 1R3IL 4X7DC 5KSAD 4JFFA 4PJ5D 3RKPA 5FGRA 2IANA 2R1WA 1P7KB 1RIVL 5K59E 3ARGB 5HI5D 3QUMB 4ZNCD 1RIVH 5ICZA 4HPYL 1YEEL 4WWID 3TVMA 3BHBB 2VR4A 4HPYH 1YEEH 2EKSA 3C6SA 4YBQD 2KKQA 2DDQH 1FLTX 2MQCA 2CRIA 2RIKA 2FR4B 3ZT5A 1Z9MA 4LPWA 1T7ZA 3KYKL 1N5YL 2VLKA 2APXA 3DGGB 3KS0J 1CN4A 2FYYB 3UX9B 4WI2A 4FQPA 5E5MB 5GGSY 3S88H 1DL7L 4NHUB 6CGTA 3MLYH 2PYFB 1DL7H 1DN0B 2NZ9D 2OSLA 3BN9C 4JRXE 3MRHB 2LU3A 2JLLA 1HI6A 4HIJB 2ESVD 2W0FA 4HKJB 1XT5A 1J9CT 1N7ML 4WEMB 4X4ME 3ZLQC 1S9WB 4YNYB 5JUEL 2DLEA 4X4ZA 5DHXB 1N7MH 1KB5A 4HCRA 4JANB 2BP3A 1DDHA 4DN4H 2HTLC 3OF6A 4E42A 3ALWA 3WIHL 2H1PL 1RJZA 4ODBD 5J11C 5FHAH 4HFWA 1V5JA 4XVTL 4PR5A 3RGVC 4IRJA 2H1PH 1VGKA 4NOFA 4XVTH 5BV7B 4U33A 3IJSA 3VI3F 5SV4A 4IMKC 1WZ1L 3VGEA 1CK0H 1J05B 5GGTA 2PNDA 1WZ1H 1YEIL 4TSAL 1FCCA 1OL0A 3D18A 2EC9T 1YEIH 5DUBB 3QG6B 3VH8A 2I5YL 2A6JA 2V6HA 5IV2B 2I5YH 4F8QA 3D3VB 3HI1B 4MVBC 1X4ZA 3GGWA 1BEYL 1YYMH 2X70B 4Y88A 2EDFA 2J8OA 1BEYH 2C1OA 3VFUB 3JTSA 2DM2A 4Z7VB 1ADQL 1GGCL 5CD3A 1QLFA 2GQHA 1WIOA 3JWOC 3FFDA 1CDIA 4XP1H 1GGCH 1JFQL 4ZTPL 5L8JB 4LCUA 4OZHF 3I6GA 1BQHB 3DUUB 1RVFH 2MMXA 2P48B 2PXYB 3MYJA 1JFQH 1AGEB 4FQQB 5IBLD 4I0PC 3EDDA 1EIBA 1RPQA 4H5SA 3STZB 4FHBD 3HKFA 4D2NA 2QADC 4UDTB 3GRWH 2K1MA 1DEEA 2DQTL 3W39A 2L4OA 5KVFH 2DMBA 4ELKA 2DQTH 4LEOB 4MAYD 5DYOA 1OARL 4MA1B 4Z0XB 5K9JL 2GJZA 2XT1B 3MBEA 5FOJA 2DYPB 3WHE1 1OARH 3W11D 1E4XI 5HPMB 4AMKL 4ZDHA 4MD4A 4OCLC 3ARWA 4AMKH 4LVHB 1PLGL 5KZCB 3MGOA 4P0DA 1MWAA 1PLGH 5FM8A 5C9JB 1YY8B 2SEBA 4Y4FD 1WFUA 3C5ZA 3LZFL 1D5IL 5IB5B 3NIGE 4XCEA 4JFEA 5A2JH 3DX8A 3X3GH 3LZFH 3SDAC 4KMQA 2I9LB 1ZT7A 1D5IH 3CK0L 3B8YA 5EOCJ 4HK0B 3TNMA 3UTSB 35C8H 2COQA 3CK0H 1OP5H 1XGYL 4Q74A 1LO5A 2M1KA 4PJFB 1JPFB 1SJEB 2AV7A 1XGYH 3PDOA 3J8F7 2NW3A 1PY4A 1IGIL 3GMQB 4L8SA 3OXSB 1N0XH 1DUZA 5H35B 1IGIH 1KCRL 5FM5M 1JK8A 3OHXA 3V6FB 1KCRH 1AIFB 1F4YH 4I13B 4YR6B 3HI5H 4LRNL 4ZFOB 3PQYD 5DJ2A 2Y07L 5CLTA 5C2UB 3UTTE 1DTUA 1VA9A 4KK9C 2DQIL 1PSKL 1X5XA 4R7DB 3QPQD 3WDJA 2DQIH 2WP3T 1PSKH 3CH1A 2O61B 2BNRB 5CGYD 9CGTA 4P23C 2HFGL 4QTIL 3WIFB 3UZVB 5BOZG 2HFGH 5FV2A 1UXSA 3CUPB 4JG0H 1XF5A 4QTIH 1U3YA 4JM2A 4ZPTA 5F7DB 2BOBA 4U6VL 4AJ0A 3SO5A 1PFCA 2NY2D 3QFJD 5IM7A 1IAIL 1BBDL 2WAHA 3E3QE 3SJVD 2CUHA 2IALA 2J7LA 1IAIH 3HAEA 5FKAB 1FHGA 4QHMA 4KJWD 5J57B 1U8LB 3QI9B 3JTTA 4Q6IB 4K7PX 4D8PA 4JQXA 4G8GB 5I2IA 1B2WL 1S9YA 3K8LA 5ID1A 4BFIA 3EOAA 5AG9A 2YMXL 4IDJL 3F7YB 3MRDB 3BVNB 3S37X 4D9QE 4HHAA 2DLFL 3C6LD 3PABB 3VG0L 2YMXH 4WU5A 1P84K 1A6VH 1JHKL 2DLFH 1S5HB 3VG0H 5AZ2L 2CR3A 2ZOKB 4XVUD 1YEFH 4WUUB 5D2LA 1ZLUH 4POYA 1JHKH 3PWPA 5DD1L 1ACYL 3V4UL 5LJYH 3F62A 4KDTA 5DD1H 4QT5B 3CX2A 5HHPB 3V4UH 5C0GB 3GJFA 4OZIB 4GT7A 3EOYG 4K07A 5JTWA 5CGMA 1NBYB 4PJHB 3RNQB 4X98B 3VCLB 3VWKD 4DZBA 5CGTA 1GJIA 4N9GB 4E41A 2BNQD 2GY7B 5D5MB 1EEZB 2WZPD 1H3UA 4DZ8A 15C8L 3ECBA 25C8L 4O9HL 1I8KB 8FABB 2ZSWA 15C8H 3D0LB 4Z7QF 1R5VB 2VLLA 2YEZB 4Z78B 5DTFB 5J1SC 1CL7I 2QSQA 1PDKA 3SKOA 4XAWH 3BKCL 1TITA 3OKLA 4JKPL 4F37K 3DYOA 2XN9B 4A6YB 5CEZE 3BKCH 3JVGC 3QP3A 1V7ML 4JKPH 1I7RA 1MCRA 3V6BR 3HFML 2VO5A 4NGHL 1RK1A 4HJGB 3B9EA 1TFHA 1V7MH 3EFFB 3VXUE 5E4IA 3OKEB 5DJCB 3IETA 4NC1C 3HFMH 1FYTB 2AVGA 2VRAA 4F2MB 3RU8L 3CGTA 1HK6A 2VZSA 4QRPA 4Z9KB 3O3DA 3GSXA 4MJ5B 4HIIA 1ACZA 3VGBA 5LAXA 1DBMH 5KS9A 2AQ3A 2W9EH 1PZ5A 3FOLA 2XNAA 1OTTD 4UOJA 3ULUE 4ZXBD 4O4YH 2MOVA 3VFNB 4XP6L 3ULSA 4NFBA 1KJVA 5IVNA 4M93C 2ZUTA 4QHNB 3PWVA 4AG4L 5FO8A 1CLOH 1MI5B 4OUUA 3QIUA 3RL1B 4FQHB 2KQMA 4KRPB 4ALAL 3MGTA 4NO3A 2EKJA 3DX6B 3QXWA 4H26B 4RWHA 1JYXA 4IIQB 5DHVA 3V0VB 1A6ZB 1VPOL 3U7WL 2WBWB 3MRIA 3KLAA 1VDGA 1S7XB 2HJKB 5IVXE 1S9KC 3U7WH 5CEZL 1E4XL 3DVNA 3I3EA 3BEVB 2A83A 3MA7A 5BW7C 5CEZH 2C7UB 1G7MB 5D7JC 1XR8B 4DOHB 1JF1B 4Z77B 5HVHB 2VOTA 3O4LB 5I17A 2IWGA 4HW6A 5IJKC 3P9LA 1ZWIA 4KKLC 3NCEB 4MHHI 3EO1A 1H8SA 5J12C 4NC1E 3PL6A 1ZT4B 3LV3A 5F89B 4GRLC 1JMZA 2OK0L 3FB6B 2P49B 2R39A 4PRNB 3CVHA 2OK0H 3PGDA 3S34H 4WTZA 1U2HA 3ULUL 4OV5B 3LQMA 4OLXL 4P46C 1W72A 4PJBB 3SGEH 4ZSOA 5EUOA 5HHOA 2EE6A 4K2UH 4OLXH 4WW1B 1MHHA 5ICXB 3RY6A 1CGSH 3FCTA 3AB0C 3GZKA 3EYVA 3KNBA 4HUVB 3X12A 4LLWA 2OTPA 5F1SA 5FA3A 1GPOL 1H15A 1T0MB 3NOIA 3BAEH 4W70A 3PIQA 2XY2A 2Q86A 4I18A 2X4OB 2YWYA 2MTPA 4NQCB 2YPLD 5BS0B 1Q0YL 4KV5F 2E9WA 5DI8B 4DCQB 1T04B 4RCAA 1F6AA 3P30H 2NY4B 3AREA 3TPKA 4CMMA 4MGXA 2YD8A 4BYHA 4YC2B 3TIDB 1MI5D 5LWYL 5EWIL 1I1AC 1U8HB 3T04D 4QXTB 3DUSA 5LWYH 1HOCA 5F7KC 3B8SA 4NZUL 1SBSH 3GJFK 1LEIB 3UTOA 3RX7A 1NFDF 3HC0B 4CNIA 3ESUF 4P9ML 4NZUH 1OAUL 1HEZA 3STLA 4HH9A 4RNRB 5FYJD 4P9MH 3R0NA 1C5BH 1G6RL 1OAUH 1WAAE 4WHTA 3QDGD 1RJYB 2JJUA 5C08D 1G6RH 3X13B 3VRIA 1ROWA 4UUJB 3BP7A 5IESL 2WINB 4RMVA 5SWSA 5D1QA 5IESH 1MCPH 3FQUA 1ZTXH 3KPPB 3HS0B 5EZOL 4GO6B 4OCNC 2XTJE 1EXUB 3SE3C 3MTRA 4P5TA 5EZOH 4X5XB 4YJZL 4QYOA 4U2YA 3BUYA 3ZTNL 4M8QA 3RUGE 5IB3B 1S9XB 3MXWL 4C58B 3QPXL 3ZTNH 1HHHB 2VN4A 2F8VA 3K1DA 4I4WB 3QPXH 4OGAD 3IGAA 4K8RD 2FSEB 3OB0K 4PLKC 1TPXB 2ADGB 4FS0A 2MCG1 4WTXA 3E1F1 1FVDB 4K3DL 5GSRA 1S78D 3NCJL 1MCQA 4EDWH 4JFQB 3DO7B 3DPBA 5BZDA 1R3JA 1R3LA 1HXMA 1DE4A 1GZPA 3U4BL 1HQRB 2HH0L 3GBNH 5BVJA 5CSGA 2W65B 3U83A 5D7IE 5BS0D 3OB8A 1RZFL 3BYTA 4U1SB 2HH0H 2P5WB 1NUDA 2CDFB 1J8HA 1T83A 1RZFH 2AKRA 4PRHE 4ZD3L 1EEYA 3MCKA 5E8DL 5EPMB 3MV8A 3OR6A 1CL7L 1TETL 3CAFA 4G9FD 1QKZL 4Y1AE 5L88L 4ZD3H 4JN2B 1YMMA 3H3PL 5E8DH 5DD3L 4YWGL 1CL7H 2HTKD 3SHSA 1QKZH 5DD6A 3H7BB 3H3PH 5DD3H 4YWGH 3FMGH 3ZYZA 3P77A 3ILQD 5E56A 5GISL 3TBSB 5D9SA 2R0LH 3O11A 5GISH 4NRXA 5E2WL 1FL6B 5F7HA 2A1WL 2PYEB 1LE9B 2EDOA 3SBWA 2EIZB 1CXIA 5SV3A 5GGTL 5IP4A 3E6HA 3LKPB 3N0PB 2AS5M 5FECA 1M7IB 4H0GA 1GL4B 3NZ8B 3OX8A 2VISA 2EEBA 4D9RE 4EI5C 2Z31A 1JHTB 5GRUL 2C3HA 5C0BA 1OAQL 1MREH 1NANH 3CDGA 4PLOB 4HLJA 5TH2A 3KPOA 1KLUB 2ZKHH 5EC2B 3RQ3A 3EJYD 3K46A 1OAQH 1K9TA 3EZ8A 4LFHG 3BRFA 1FQ9C 2FZ3A 3S5LA 1CDHA 4JZJA 1MOEA 3KYNB 2Q1EA 3PHOB 1ZK9A 4I48B 3NZHL 5I9QB 4LGRB 2OTWA 3LEYL 5ANMA 4Y19E 4J1UA 4JFXB 4PYHA 3T1FA 4G5ZL 2F8XC 1AJ7L 2VSDA 3LEYH 1YZZA 1Y6NR 3U79A 3UXFA 3HZVB 3PWNB 1BJ1H 4GUPB 3IDJB 4G6JL 1AJ7H 1F58H 2WWKO 3GI8L 1Z9LA 1JNJA 3GI8H 3MUJA 1GZQB 4JRXB 4U1KA 4URTB 4YGVB 1D6EA 4G6FB 2P8LA 1M4KA 2FCBA 1CFNA 3CXHK 3PWUB 2OJEA 3L3JB 2EH7H 4QOKA 1T89C 1BZ7B 3QEHB 4OI9A 4R26L 4R26H 4Y16D 4TVPE 1CFVH 3U6RA 5CZXC 4JY6A 1EHNA 1MEXL 1UB6B 2VDPH 1TCRB 2X4QA 4AT6A 3FO2B 3WO3B 3S35X 1MEXH 4DUXA 4R4BA 3WNNA 5GRVK 4WDIA 4GBXC 4CMHB 2FJFA 3P4OA 4PRAB 5EO1B 4QTHB 4CN4A 3V95A 4X4XB 3OAZK 1CD1B 5B38G 3ZDZE 3DVGB 4XP9L 3QEQA 1Q0XL 4DGYL 3BPCA 4YHYC 3O6KH 1OWRM 4IRSD 1F11A 5CD5D 1N3NB 1Q0XH 4LCWE 3OKOB 4RMUA 1P69B 1BOYA 4S10A 3L5XH 3EOTL 3QIWA 4NCC1 4ZUTB 2O5ZH 1KCSL 3P4NB 4U31A 2DJSA 1SEBB 3RL2A 3I6LE 5IMMB 4MB4A 4U05A 1XGQB 5A40E 2D4FA 3HE7C 4I3SL 5A2KH 2E5EA 4NKIL 5C0FB 3BIKB 4GQPH 1TQCC 3BDYL 4P57A 2ICES 4NKIH 4X6EA 1GOGA 4X7SL 1LO2L 1SM3L 4TVPL 2VXVH 5IOPA 1UM5L 3QUXC 1P7HL 3CPLB 4HIHB 3IKCA 1IAKA 3KLHC 1XCTB 1H8NA 1SM3H 3F5WA 4TVPH 3UDWA 2IPUK 3QDAA 1HXYB 3N1MC 4FN0A 4OF6A 1ES0B 3C5JB 4DGVL 2KDGA 4S1DD 3V5KB 2MPAL 4PY8I 3GSWB 4DGVH 3VXRE 3O9WB 3MLXL 5IFJA 5E8PA 3GIZH 1A7PH 2A73A 4U6YA 4Y5YC 1ERNA 2MPAH 1QG3A 2P44B 1X9QA 5HVFB 3MLXH 4L4JA 3UROR 1WZLA 4L3CB 4ENED 1Y0LA 1RZGA 3I3DA 3MRMB 4G6AC 5DJZA 3AROA 3E6FA 1YPZE 1FJ1A 1VFOA 1BWMA 3CLFL 2C5DC 4O58L 5BVPL 5E5RB 3QNXB 1BVKB 3CLFH 4UI2A 4O58H 3IJHA 1OOAA 3RVVD 5FK9B 3PF2A 4YXLL 5IEHB 5JORB 4LARH 3FN0H 3GMMA 4K94C 3FQXA 1NDMA 4YXLH 2AJZA 3C60D 1MCNA 1AXSA 3CDFA 2XY1A 3W0WE 5ISZA 3DTXA 1NCWL 3B5HA 4LKCB 5GXBB 3PGFL 3HUJE 4FRWA 2DQCL 1NCWH 3VJ6B 3PGFH 4MS8C 1A6TA 4U1MB 1D5BB 1OM3L 4M48L 3G5XA 3TO4C 3UTTB 3BZEB 1OM3H 3BKYL 1LK3H 4M48H 4JR9L 2I9TA 1NJ9A 4JFPA 3RGVA 5C0AA 3Q6FA 3I50L 5HI4D 4JY5L 2JIXB 4Z7OF 5IBUG 3I50H 4JY5H 4RZCB 5AUMA 4IMKA 2EYTA 3KG5A 5DVNA 4FA8A 4YH6A 4ZAKB 2LV4A 3QT2A 4PRPD 3CNKA 3HPLB 3MRKA 5DURB 5D7LE 1N2RA 2RFXB 4UNUA 1KXVC 2AXFB 2AJSH 5C0RH 1NC2B 5FA4B 32C2B 2ADJA 4F7PB 5HHME 1OWWA 3RA7L 4MA8L 2FECL 1WCBA 4LBEA 5GIRB 5JXEC 1YEKL 3RA7H 4MA8H 2NXZB 5BZWA 1ZVSB 2FGWH 1YEKH 3CXDL 5IEKA 5JHLL 3WKNA 1MRDL 1OGAE 3CXDH 2R1YA 3ARBD 3V6ZA 5JHLH 2P5ED 3MLPA 4PJ9C 1MRDH 3MV9D 3VDBA 4I0PA 3L5IA 4WGWB 4GLRI 5B38B 3G5ZB 4PTUB 2XXMB 4QRUB 4ELMF 1UCBL 3JV6B 5IVZA 4XH2A 1FCGA 5EU7C 1OF2B 2CMRL 3WN5C 5MEOA 1ONQB 2Z35A 4LLMB 3MJ6A 1UCBH 3S96A 3CDYA 1MVUA 2H2PD 5DFTA 1NUNB 3OGCA 3FT3B 1BOGB 4N68A 4Z5RB 2OI9C 1NBVL 4P23B 1QHPA 4PJBF 4JCMA 4PP1D 3WL9B 2QQNL 1NBVH 2QBWA 4R2GB 5C7XL 5DJDB 1YECH 2QQNH 1I1FA 4U1GB 4YHKL 2PW1B 3KPSE 5C7XH 1TIUA 1ZA6A 4N0FA 5KG9B 4YHKH 2QV2A 1UWXH 3O4OB 5FKPB 1K4DB 1FPTL 2OBGA 1QFWI 2GSIA 3QZWA 1AR1D 3SDAA 1JCKA 4R4ND 5F21B 1M7DB 1W8OA 2EC8A 4DKAA 4OQTH 3VXUB 2CLZB 4NKMB 3ARFC 5CLWA 5DUPL 1NC2D 2R2EB 3ZHLA 4WW2C 2G75A 1IEAB 3LKQA 1MPAL 2CO7B 1CF8L 4ONHB 3GB7B 1WIUA 4R0LC 1PAMA 3WUWG 3X14A 5MI0C 1MPAH 1CF8H 2BNUA 4NM8L 3QHFL 5F6IB 2Q6WA 5C0JB 3W9DA 4TTGA 5CJOL 4NM8H 1YNTB 3BGMB 5E8OB 3JV4A 1RFDL 1LEKB 2HJLA 5CJOH 3WLWD 4NN7B 5BMFH 3BZ4A 3MNZB 1NMCC 4K55A 4GKSB 4OAWA 4O2FB 3BMWA 1A02N 1IGFL 1GGYA 4O2CB 4PJ8B 4MZ2A 1NAMH 1RZKC 1LEGA 2Y5TA 3DOSA 3RVWC 5I0ZA 5IVXB 3F7VB 1QEWB 3LRSA 4N90E 5DD0L 4FZEL 1QSEE 4OLUL 2FLBT 1XAUA 5F72S 5J13C 1HH6A 5DD0H 1DLHA 4FZEH 4UIKL 5EBMA 3U9PL 1YUHB 3CFJA 4UIKH 4G8EB 3U9PH 4M7KH 1YEHL 5DT1H 4CAGA 2EYSA 4HWEL 3BZFA 3RVTC 1YEHH 5HJ3A 3NBNA 2R2HB 4HWEH 5IBUB 5JO5A 1EVUA 1AD0B 2X4NB 3WLBB 5I15L 4G80A 4P5KB 1G6RB 4ZUWA 4KVCH 3VDCA 3S98A 5F44A 5I15H 3L1OL 4NQDD 2AV1B 4NZJA 4MCYB 3L1OH 4MNHB 3GJEB 4MD5B 3SDCC 5HDBE 1JWMB 3MNVA 3BUTA 4MQ7B 4NRZA 2ZG1A 1XIWD 5IB2A 5BO1H 1G7IA 5I74B 3LSOA 4MJIE 4XHJD 3DRTA 4EZMA 1IQDA 3ZSTA 3HG1E 4MLSA 1GGTA 3ARQA 3TJHC 3MUHL 5M7QA 5C86A 4WU7B 3U36B 2R29L 1DP0A 1RHHB 3T3ME 2ZUQC 2HT3D 2CXKA 2R29H 4HS3B 2NPLX 3OZ9L 3W9EB 1J0JA 3FO0H 2DD8H 2OJZL 3HR6A 3OAYK 1I7UB 4M9OA 3OZ9H 4P9HL 2OJZH 4K71C 1PW3A 5FM5O 1I8MB 1YEDA 2CPCA 4P9HH 2H32A 2WW8A 1QUNA 3MRGA 3OG6B 4NBXB 4I3RL 5E6ZA 2IEPA 1FG9C 4PJXE 5F1KC 3BX7C 2NY6D 3KYMB 4FQXB 3UYPA 2JCCF 3VGGA 4WENB 3EYFA 1A1NB 3MLTB 4GW4B 4RSVA 5DFVD 1E28A 3HMXL 4WI5A 5F9WB 3BGFC 4I5BA 4M6NL 1X3DA 1JWSB 2W92A 3NA9L 4LDLB 2XTJB 4YPJA 4M6NH 1SYVB 3NMEA 2A0LD 4RMSA 1K6QL 4MZ3A 1NLDL 2OTUA 3VG9C 5FV1L 5KOMC 4P5MA 5DQDL 1K6QH 1RZKH 1NLDH 4XBEL 4FG6D 4AK1A 1MCCA 4P48A 1TQBB 5DQDH 3C2SA 2X5PA 1I3VA 4JJ5B 5F93C 3JSSA 4N5EC 3ZKSD 2GTZB 3EHBC 1HQ4B 4JFFD 4JFHD 1A9EA 1TJHL 4PG9B 5I19L 1U42A 4OCSL 4U1IA 4DKFL 4MNQA 2IAND 3WUWB 4OCSH 3LVEA 4DKFH 3PGCA 1UG9A 2Z93A 4Q6YA 3DSNA 5BW7A 4UBDD 3TVMD 5D7JA 4Z76B 3VXNA 5D7IB 3I6KA 5FUCE 2X4TA 4PJDE 4Q2ZB 3S7GA 5IJKA 4NO0D 1LDPH 5E6IC 2L7UA 4PRHB 5CD3B 1JN6A 1PG7W 4IOFC 1WV7T 3FFDB 3RPIA 4KRMB 5C0EA 4Y1AB 1JNLL 2PW2A 2VLKD 3B2VL 4LPUA 1LP9F 4GRLA 2A6DA 1QFWL 4WY7L 4M62L 1DCLA 1JNLH 5F1IA 3AS2A 5FCUL 2OR9H 1S5IH 4WY7H 1XGTA 5FHBL 4P46A 4M5ZL 1FZJA 4RDQG 3NGBB 3W39B 4M5ZH 1HN1A 1I3UA 1EAPA 4AEIL 5SWZA 3U30C 1BLNB 1FSKB 1QP1A 4M7LL 3TNNB 5J9PB 4AEIH 1T5XB 4DFIA 3MBEB 4M7LH 5I18H 2AABL 3OMZA 4DJMA 1LO4H 1U3HB 4PLNC 3QDJE 2AABH 3OF6D 2ATPA 2E7LC 3JUYA 1CD8A 4LCYA 3SGKA 4OD2B 4HKZA 5MENE 3UAJD 4IRJD 2NLJA 1AO7E 3RWDB 4H25B 3MRNA 3REVB 2D9QB 5DJXB 3EKCA 4XCEB 2X89A 4TSCH 1I1AA 2WBJC 1HHKB 1WC7A 1A6AB 4G43A 5DJ8B 1BHGA 4KRLB 3GMNA 4NDMA 4LAQL 5HHXL 3PDOB 1M6OB 2NW3B 2NXYC 1A4KA 1IKFH 5F3BA 4LK4A 4NT6B 4Y19B 4NO2B 3L3DA 1LHZA 1EAJA 2HLAB 4HWBL 3OHXB 4APQB 4LLDB 3CU7A 2IGFL 5DRWB 2I24N 4HWBH 3PHQA 3FB8A 3B9AA 4KK5C 3VMNA 2EDQA 3TV3L 1HSAA 3KPMA 3QRGL 3SE3A 3T3PF 1K5NA 3TV3H 4MA3B 3PWLB 5DGQA 3QRGH 1BREA 4CADB 1CGYA 4EN3B 1JJUA 1TDQA 4YZFE 4W68A 2EIBA 5ADOL 2R4SL 4YBHA 2VZTA 1KJ2A 1T20B 5FYKE 5ADOH 2R4SH 4XGZA 2V7HA 3MBED 3C8KB 5D2NE 3O2DL 3OJVC 4WI7A 3DX7A 1MQ8A 4W6WB 4N1HB 3O2DH 5I73B 4HGWB 1DVFC 4RBPK 1BJ1J 3NFNB 2ZNWA 3ARRA 4RFNB 2HLFC 3EO0B 3GSUB 4HS8L 3QUZD 2HAZA 3GSQA 5C07A 4V1DA 2VIRB 4WJ5A 4DK6A 4QF1A 5T5NG 4HS8H 4L8CA 1S9YB 1KSRA 5FIEA 3KLDA 2H8PA 3C5ZD 5ID1B 4OLWL 2LFGA 2NY7L 3NVQA 4JFED 4MWFB 1ZHKA 4LCWB 4OLWH 2ILLA 1NBZB 4N8VA 2H9GB 3W81A 3IFPB 4ZO9A 3O8XC 3MUGA 5EDXA 2EDHA 3PWPB 1JYWA 4ODUA 5I8EA 3KPQB 1E4WH 3QUYC 1H3XA 5KVDL 3EDKA 1GGBL 5JZ7C 3UZEA 4QY8B 1U8MA 5KVDH 2R23B 3RIAK 1GGBH 2G2RA 3V4PL 1KXQE 3MR9A 3QHZL 5FYKH 4UINL 4DZ8B 3D48R 3ECBB 4KI5D 3QIBB 4XAKD 3V4PH 4EI5A 3QHZH 5GS0D 4UINH 4XP4L 1KYOK 1ZHNB 1C08B 2DQJH 3ULVC 3TJEL 3C8HA 4MQXC 4XP4H 4FQLL 2BVEA 5EU6E 3GKZA 3TJEH 3E8UL 4NQTA 3GBML 4C56A 3OKLB 5LBSL 4FQLH 4GAYA 3MRBB 4WGVB 1AY1L 1LD9B 3E8UH 3GBMH 1OAZH 4KKBC 4JM2D 2NY3C 4J6RH 4TTDD 1AY1H 1G7PB 4RGND 4AY0A 2DB8A 1OSZA 3M8OL 1JI1A 1YPZB 3STBA 2WK2A 1FGNL 1QRND 2X4SB 4M7JL 1HHIA 5I1EL 1FGNH 4PJ7A 4QGYA 4LSUL 3SY0A 2FGZA 5INDA 4M7JH 4O02L 4LSUH 5JNYA 4KJPC 4HKBA 5IVOA 4PV9A 4O02H 1QSFE 3QQ3B 4PBVC 1PZ5B 4XNMB 4HUMB 1CQYA 1P1ZB 2ICWB 4JDZA 4JZNA 1NCCH 1YY9D 4JGJA 1JGUL 3HUJB 4R4FL 4ZOAA 2JE8A 2CRYA 3FONB 5EIIB 2NY1B 4YPGB 4S1SH 1AQDA 3DI3B 3OPZL 1PG7L 1UJTA 1UKSA 2DIBA 3GMPA 2HJFA 2MHAA 3SKMA 4JGUA 3THMH 3OPZH 1PG7H 4H8WL 2LU7A 2D0HA 4EXPX 5JOPE 5JOFA 4H8WH 1AP2A 4E41D 1Q8MA 2NY0B 1BQLL 4GBXA 1R24A 1NBQA 5E99L 3LHPL 2D7TL 1BQLH 3IDNA 4Z7UF 2DIAA 4QHLB 2EDDA 1O5DT 1P53A 2APWA 3LHPH 2YA2A 5E99H 3ULUF 1UZ6E 1JTTA 2XWTB 2LE9A 5I1AA 5D7LB 4MDJB 3AC0A 5EOTA 5FM4A 4FXKA 4NWTL 3I02B 4X6DA 1T4KB 5HDQL 2VLRA 5HHMB 4NWTH 2ZUUA 2VITB 3O3UN 5HDQH 4E5XA 4BFEA 4O2EA 5C0CD 4YE4H 4L4VA 1WCQA 2XWJA 2DL9A 2VE6B 1C5CL 3CFCH 5CP3H 4MXQC 1A4JA 4I3GA 3CFKB 4ZUSA 5HYJA 1X5LA 1OGAB 2BHUA 3K74B 4RISL 5CIPA 3R1GL 3HE7A 4QRPD 4G6KL 4RISH 2GY5A 3R1GH 1Q94B 2H26B 4G6KH 1RZ8A 5CWSA 3QUXA 5GS2D 4HEME 4R97B 3T0EE 3QQNA 4I18B 4UQ2A 3RWHB 5CJ8A 5HVGB 3DO3A 4XCYB 4G8IB 4WI6A 2FO4A 3AAZA 5C8JA 2JJVA 3AREB 1QR1A 4L1HA 1PVHA 1MFDL 3IAQA 4RMWA 2PR4L 2OXGA 5SWQB 2ZUVA 4WI9A 4E0RB 1X5YA 3QIUD 2B1HL 2EDEA 1WFOA 3TN0C 4OI7A 4OIAA 2JJSC 4LNVA 3UJTL 5JA9A 3AS3A 4X6BA 2ICWJ 1QBBA 3UJTH 1HEZB 2Q7YA 3KPSB 4HH9B 1NAMB 3CJJA 4I2XA 1NMAL 2DQGL 1ZAGA 5LGJA 3LB6C 4WHTB 2MFNA 1RZIB 1NMAH 2DQGH 1VFUA 3I75B 4X5WA 4KKAC 2JJTC 2PCPB 3F6LA 1QOKA 3ARDA 3WUZA 2QHRL 2NTFB 1DBAL 3JWDL 3FOMB 3X11B 1XR9A 4UIMB 2H41A 2YBRA 2QHRH 3JWDH 1DBAH 2Z8WC 3PL6D 2Z92A 3HZKB 2BCKA 5DEFA 3BQUB 5I1HH 4PJ9B 3FB7B 1F90L 4QWWD 4RMQA 4KPHL 4HIEB 3MRCA 1S3KL 2AK1L 2X9WA 4KPHH 2I60H 4HUUA 5HHOD 4M03A 1S3KH 3KYOA 5L8KB 4HKXA 1QO3A 5HGGS 2YD1A 4WFED 3WHXA 3IRZA 4TQEH 4CVXA 2ORBH 1RIUL 2AJUH 2D3VA 1HSBA 3ROLA 4ZOEA 3MOAL 1RIUH 3G6JA 1KPRB 5TDPA 4AIXA 1R3JB 4KKCD 4Q9RH 4YHOL 5JOEA 5ELIA 1FGVH 3IDYC 5BVJB 5FXCH 1C12B 4XB8A 1MH5B 4WWKB 4YHOH 2GJ6E 3LQAH 5KSVA 2X1PA 4P2OC 3ARED 3QO1A 3S6CA 5T3XH 4ZS6C 3OR6B 3SGDH 3Q6GL 1QSEB 4PPTA 2J8UE 4GKNA 3Q6GH 4LSVL 4JFZL 2JK5B 5TE7L 4MXWL 1QYGL 4H20L 3QUKB 5HXMA 2YA1A 4JFZH 5JXEA 1EO7A 1N59A 4MCZA 4MXWH 5TE7H 1UQSB 1QYGH 4ERSL 4OZFH 1Z3GL 3C9NB 1CCZA 4U1NA 3ZT7A 3HI6L 1YJDC 4ERSH 4M1CD 3MX0A 1F5WA 3HI6H 2CO6B 3MRLA 4R3SA 2PO6C 1GGIL 1RUMH 2AEIT 3FQTA 5ACZA 5BRZA 2RBLA 2AJ3B 1GGIH 5D1QD 3IS0X 5SWSD 3WE6B 4LVOB 3BIBX 2XOTA 4TULL 5GGQL 3V5DA 1FYHB 4P5TD 2Z31B 4TULH 1EHAA 3FTGA 4NN6C 3WN5A 4MQSB 4WEUD 3BFOA 2F19L 1U8JB 3KPNB 4HQQL 4K3GA 5J3HD 3OKKA 5DJ6A 1ODAA 4ORGB 7CGTA 1EBAA 4PJEE 1XGRA 1J1OL 1E6JL 4LF3B 4F57L 1KACB 3HG1B 2EXWD 3C2AL 4PRIA 5I1IH 1E6JH 4F57H 4F37F 3C2AH 4E9LA 1RK0B 4HT1L 3EGSA 2X4UA 2Y25A 1R3KB 1DQQB 4UT9L 4ZQKB 4RGMC 4Z6AT 1WWBX 4ZFFB 2XKSA 4HK3N 4L3EE 3T1FB 4J1UB 4UT9H 2HFEA 4XNYL 3BPNB 1XGPA 1U91B 1N8ZA 1U93A 4FZ8L 4XNYH 3SDYL 5ESAA 2BSTA 3UTQA 5HHNA 1J8HD 1G7HA 4BZ2L 3TA3C 4FZ8H 4PD4K 3SDYH 3MV8D 4KRNA 3C5SB 4KGJA 2P42B 4U6XB 3MC0A 2CKNA 4BZ2H 4CBPA 3ARFA 1YMMD 4PJXB 3RWJB 1U8NA 4WW2A 4NC2B 5SX5K 3EYSL 4P3DA 4QOKB 2P8PA 4R0LA 3GDBA 3FT4A 1WF5A 5EZJB 1D5XA 2GW5A 3B5TA 1DQLH 4L9DA 4ZOCA 4F9PC 3C09B 3S9DB 1UWXK 1KENL 4JY6B 1MCDA 3VMPA 1FV1B 2BC4B 1VENA 4UV4H 5E8NA 2ITCA 1KENH 4PV8A 1BZ9A 3VFWB 4KK6C 4LU5L 3DVIA 5HHQA 3DMMD 4F7MB 5EU3B 5LCVL 3P4OB 5HYSG 3PP4L 2EDXA 4U6HA 2Z31D 3EJZC 3WFHA 5LCVH 1MAJA 3PP4H 2ZCLL 3VXOB 3G6AA 4KI5F 5C0BD 3RTQD 1IM9B 4ONFL 5LQBH 4EDXB 4TSBL 1G9NC 2ZCLH 3DROA 3QXDB 4IOSD 1SJHA 4MAUL 3I3BA 4CU8A 2VL5A 3UJIH 4MAUH 5FUOL 5C0IB 5I1JL 1OQXA 3T2NL 1NLBL 1XCQA 5E4EC 4UU9A 3TBTB 2V9QA 4NPYB 5I1JH 3IFLL 3T2NH 1NLBH 4PJDB 5D1ZC 4JM2F 1LO3L 4EKXA 3IFLH 5KSUB 3ETBF 2E27L 5E94A 1CFSA 3D25B 3V8OA 5C71A 2NQCA 2VR5A 2E27H 2HVJA 1S7TA 5HI3C 1X4YA 4KJYA 3AM8A 5DK3A 4GKOA 3BE1H 3MCLL 4FP8L 5C6TH 4NRYB 5IOPB 2DLGA 4BSVB 4KMTL 3KPRE 4FP8H 3ZDZF 2UUDH 5MEQB 4KMTH 5HYIA 5JPMB 3SDCA 1QRKA 3OKMB 1FZOB 4QOKD 4J7RA 5ECJE 5I1DB 1MHEA 2E7BA 5D2LF 5IFJB 3QDJB 4U6YB 1MRFL 1TZHB 3H8NA 3QBTB 3RFZC 3P40A 5MENB 1MRFH 3K0WA 3CX5K 2DLIA 5DJZB 1AO7B 2GTWA 3NCCB 4X9GA 5J1AA 4CU7A 4NP4L 1MJJB 2YPKB 2DJUA 3G5VA 1W0VB 1V3JA 3RY4A 3B9DA 5TQ0L 3OTTA 4UDUA 2XQYG 5GJSL 5TQ0H 1AHWC 2AI0L 3QEQD 1UH4A 3WO4C 3E2HC 3VI3E 4LCCA 1FG2B 5J06A 3DXAA 1L0QA 4LLQB 5ISZB 2RGSA 4PGJA 1YNLL 3B9KC 4L4TE 1BD2A 4KK8D 2NCMA 3QIWD 2KZ1B 1QD0A 3CSYA 3LD8B 4NQEE 1DQDL 3T4YB 1K3IA 3X3FH 3ZDYF 1QLEL 2ZPKL 3AS1A 2WIIA 1INQA 2D31B 3IU3A 1DQDH 1YPZF 2P47B 1QLEH 2ZPKH 3WS6C 4M5YL 3ZKNC 1AGBA 3MFGB 3WS3A 1U8QA 2EYRB 3NAAL 3RY5A 4M5YH 5F88A 5FDWA 1EA9C 3UCRA 5T1MB 1JZ6A 3Q6FB 3L6FA 4HZAA 1AI1L 2V2WA 2HKHL 3UPAA 3VXSA 2C26A 1FN4A 3SCMB 3PV6A 3FZUD 4W81A 2HKHH 2VUYA 4PJGA 4S2SB 4OZHE 4XXCC 3MREA 2IAMB 5A16A 5KS9F 5J6HB 1W0WA 3MRKB 5D2NB 5D1XB 1ZA3A 5DHYA 2CLRA 2R9HC 5I8OH 4AM0A 3HUJF 1ZT1A 1L4IA 1NGZA 1MLCA 4YDKL 2BMKA 1CDGA 5FB8B 1MFBL 1FO0H 2H2SC 1RV6X 4YDKH 2A38A 5E6IA 4XCFH 3QRFM 3ES6B 1MFBH 5DS8B 3O45B 3I9GL 3JV0A 4LNRA 1RUQH 1TJGH 1JPSH 2R1YB 5HYSB 4X6CA 4LGSB 3EZJB 3L3OA 4DTGL 1KNOA 1CICB 3V9FA 4DTGH 2VLJE 5JDJA 4XNZB 5K9OB 4AEFA 4P2RA 2EE3A 4PJCE 5F96L 2YSSA 1RSFA 1ORQA 1TZGH 2ED9A 4AQOA 2Y36L 3U2SB 4X9BA 4BK5A 4OSUH 5SX4I 4LLYA 3IRPX 4BH7A 2E3VA 5EUOF 5C6WH 2HTLD 3MRFB 4EUPH 4XNXH 3QDMA 2E6QA 5DJAA 43C9A 3OSKA 5TDNB 3ARZA 5HBBA 4KROB 3RGVD 1OY3B 1QFWM 5C0AD 3ALPA 1P4IL 1MVFA 3NPSC 2R0WL 5L2JB 5GJTL 5EU6B 4AH2A 1P4IH 4OZFG 4KAQL 5EC1A 2R0WH 4RFEB 5KTEL 4N0RA 4KAQH 5EZIL 4Z7WA 5KTEH 4GKZB 3QYCA 3WXVH 4YUEL 4B41A 5EZIH 1MAML 2ZSVA 5ITBL 4JVUA 3U0WH 2DKMA 3MOBL 4YK4C 5GZOC 2DQFA 1PYWB 2YZ1A 4OCWL 2AK4D 1NFIA 4U7MA 2AJVH 4NZDA 4G9DB 4OCWH 5JW4R 1GYAA 5DJYB 1WWAX 2C3XA 1UEMA 3MJ7A 1JPTL 1QSFB 2BDNL 3KPLA 3VFOB 3CFBB 3MLRL 1HCVA 1JPTH 1T22B 2BDNH 5FGCE 4N0UE 4J3OC 4OAWB 1SYSB 4I0PD 2ZG3A 3WSQL 4KXZI 2FO1A 4KTDL 2R2BB 3PJSB 3LKNB 2QADD 2LU4A 3TCLA 1ND0B 4DUWA 5ERWA 4JLRB 3WSQH 1LK2A 1QTYT 4KTDH 3O3AA 1K8IB 3OKNB 4Q0XL 2GK2A 4OTXL 1GIGL 1GSMA 3TBWB 5AAWA 2C9AA 4Q0XH 4WO4C 3AXLB 1GIGH 4OTXH 3WFBL 4P49A 1M7XA 5GGRB 3REWB 3LRSB 1RI8A 2P7TA 1S7VA 1JRHI 3WFBH 4X6FA 1MIEL 4JPWH 3R06B 1HH6B 1DLHB 2UWEA 2NX5E 4JO1L 1DVFA 3G5YA 4K94L 4JFDE 4FQ2H 4HJ0C 1T2QL 3IXTA 3D39E 1UXWB 2VL4A 3FFCA 2DM4A 4KFZC 4PRDA 1T2QH 3V0WH 1R5WB 4NKQB 3BZFB 3C87A 1I9EA 3D85A 4U1JB 4Q9QL 2VR9A 4OM1L 3IFOB 5B3JF 4Q9QH 2AGJH 3BO8A 5CJXC 4YBLC 4OM1H 3SDAD 4OZ4B 1BFSA 4Z7QE 3WIIL 1PKQA 1KJMA 1U8IB 3WIIH 5CILL 3SOBL 4POUB 4NSKA 5CILH 2X9YA 2HG5A 4M43L 4RGOL 3SOBH 2VQTA 5EIVA 1FFPB 1KTDB 3HRPA 4NRZB 4U0RC 4RGOH 1KEGH 1O7VA 4NCDA 1U36A 1BIIB 4HS6A 5EBLB 3DRTB 3UPRB 2OXHA 1IZKA 1J12A 1ZOXA 4QRSA 1A1MA 4Y4KC 2CDEA 5H2BA 3T0EB 4WNQB 2EIEA 1X5HA 1INDL 4KK9D 4M9PA 4MSWA 4HWZB 4NNPL 4U1HA 4RAVB 2ADFL 1INDH 3O6FC 1LNUB 3BDXA 2LTQC 4NNPH 2ADFH 3WBDA 4HFUL 2VAAB 3PHSA 1NGPL 2O26U 5JW3L 1JZ5A 1KCUH 4HFUH 3VFPA 1P2CB 1YMHB 1NGWB 5BQ7A 1NGPH 3G04A 4RQQA 5JW3H 3DETC 2KBGA 5LVEA 2YRZA 2X1OA 2ERJB 3MRGB 2QTEA 3P3YA 3A6BL 1X5ZA 4X99A 2DL2A 2VNCA 2A9ML 2UYLA 3A6BH 1YDPB 5DMGD 3CLEL 1I1YA 2B1AL 2E9BA 5E95B 4GS7B 2YZ8A 4QEGA 1IGJA 1ED3A 3CLEH 4GMTL 2B1AH 1WK0A 2DOCA 3HE6B 1G7LA 3FQRA 1PX4A 1NGQH 4GMTH 4OLEA 4XRCA 4PJ5E 1FL3B 3LKSB 5ID0A 2VDNL 2VZUA 4OZFB 3TZVC 2WM0A 1U58A 1I8IA 4J8RA 3MUY1 5DRNA 4XBPB 2OTUB 1HHJA 4CJ0A 1S7UA 3OBAA 3C8DA 5A3IC 1SHMA 2ADIA 5K93A 3R8QA 1T21A 3WKML 1UACL 2GCYB 4N8VG 4NUGL 5K9QI 3ARGC 3PG2A 3WKMH 4X7FC 4NUGH 4Y2DB 1FFOA 4TN9A 4MNQB 1ZLSL 1J1XL 4HWUA 5DSCA 4UB0L 1BX2B 4ODSH 1S7WA 5DWUH 1ZLSH 2Z4QB 3IB4A 1A1OA 4UB0H 3VE0A 1I9JL 3VXNB 2GJ6B 3TCXA 3F6IA 1OSPL 2ESVE 1I9JH 3DI2B 4Y5VB 4WFFD 4BKLB 2E6PA 3DYMA 2PW2B 4NOBA 2J8UB 1P7QA 1D5MB 4DUVA 2AQ2A 2WWMC 1FNEB 3MNWA 3QISA 1JTOA 4KV5E 5D7KD 4EIGB 3TP4A 5FCSH 2Z9TA 3QXAA 2B7DT 3ARYA 3IXAB 4P2QA 4MNGA 1KN4L 4XNQB 3EYOA 1T7VA 1QLRA 5EO0A 5ABDE 5CJQL 1KN4H 1BAFL 2IBBA 3TH2T <