1RIVH

Anti-cocaine antibody m82g2 complexed with meta-oxybenzoylecgonine
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
223
structure length
220
Chain Sequence
EVTLQESGGGLVQPGGSMKLSCAASGFTFSDAWVDWVRQSPGKGLEWVAEIRNKANNHATKYTESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCTSVPQLGRGFAYWGQGTLVTVSAASTTPPSVYPLAPGSGGAGSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTQVDKKIVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab M82G2, Light Chain
publication title Carving a Binding Site: Structural Study of an Anti-Cocaine Antibody in Complex with Three Cocaine Analogs
rcsb
molecule tags Immune system
total genus 43
structure length 220
sequence length 223
ec nomenclature
pdb deposition date 2003-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rivH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rivH02
2QBWA 2XKNA 5DJXB 2F8XC 1HZHH 4ZPVA 6FABH 5KJRL 4M7LH 5L2JA 3EO9H 4GSDH 5FAAA 3EBAA 3FRUB 4O2FA 4JDTL 4BELD 1FL3B 5GGSY 1FJ1A 1GZPA 1YJDH 2E7BA 1IRAY 4EI5A 1ADQH 5DS8A 5KZCB 1CXEA 1JN6B 4YE4H 4MD4A 4JRXE 4NC1E 1XMWA 4AIOA 3IXTA 3F6IA 1V5JA 3O3BB 3SJVE 2CGRH 2XY1A 2AQ1A 4QT5A 5IW6A 1RD6A 3TH3T 1AR1C 1KXQE 5C2BL 3FT4A 5D70L 4Z18A 3TBYA 3ULSA 3MQIA 4O02L 3FQRA 3RIAF 3LKSA 2AGJH 3ES6B 4IIQB 3TLRA 4R4FL 3LMJH 4QTIL 3QXUA 3D3VA 2UZIL 5LVEA 4R26L 2GTWA 3HLAA 3HTLX 3P0YL 2IPTL 1UACH 4GXVL 2J5LC 3FO0L 5AUMB 1PDKA 4YH6A 2NMSA 2DMCA 4LOUC 3GSQA 4HKBB 4WTZG 2WP3T 1LVEA 1VEOA 1ZLUK 3VDAA 4YEFA 3C9NA 2P49B 1F3DH 3MNVB 4HULB 1C5CL 5K9OA 3VXQA 2BFVL 1MFEH 1JNNL 2F53E 2NW3A 1HEZA 3BIAX 1I9RL 1PZ5B 4RA3A 1ZT1B 5GZNC 4JPWL 1U8HA 1MF2H 5HHOD 1JHLL 4PRAA 1EEYA 1IQDA 2Z4QA 3EO0B 4YDVB 1EGJL 3QBTB 1KG0A 1R3IH 1S8DB 1LO4L 2N1KA 5J11C 4U1MB 5F93C 1BBJA 1ITBB 4N8CL 3QIUD 3RY5A 1JJUA 1NC4B 2V9QA 1P7KA 1FG2A 2F54D 3LV3A 5GS1B 2Y7QA 4Z6AT 4LMQI 4KRLB 1D5XA 3CFKA 5SWSD 1W2KT 2BCKB 4GT7A 2FL5A 1ZOXA 2NXZD 1NPUA 1I3RB 2JK5A 3OKDB 4XGZB 5DMIL 2D4DA 2DQIL 4G9FE 3P4NA 4W6WB 3NA9L 3VXMD 2F5AL 2W65A 4XVTH 1VCAA 1CGSH 4DWHA 3DMMD 2X7LB 4U6VH 1F3JB 4WV1B 1FYHB 5EBWA 3UJJL 1CK0L 1UM5H 1XT5A 5AZEL 1Z3GH 4QEGA 3GHEH 3TN0B 4EXKA 2XWBA 4FZEL 4LPTA 3KPSA 1Y0LB 3IJYA 3UC0L 4UQ2B 3VMOA 3L3KB 1MNUH 3QAZC 4LKCB 5F21B 1DJSA 2V5TA 4HMCA 2DJ4A 3CFEA 3U0WL 3X11B 5D1QA 1X6LA 1TJHH 2BY2A 2OSLB 1LEIB 1WZ1H 5HYSB 2BNQB 4PB0H 3F62A 2FDBP 3QCTL 1FRGH 1ES0A 2GK0A 1FGVH 4NT6A 2FLBT 3T4YB 4OIIH 3K4AA 1EFXB 1DQML 2EDFA 4QTHB 5GJSH 4PJCA 5L88H 1RK1A 3A0OA 3O4LD 4H8WC 2C3GA 3QJHA 1AHWB 4TTGA 4Z7VF 4K71B 5SWQB 4A6YA 3BP5B 3BDBA 3D85A 1KEGH 1JPGB 1BOGA 2ADGB 1T1YA 1I9IH 1CL7L 4M7JL 2QADD 3QEUA 1NCTA 5DJ2A 3UTSD 1MCPH 2IANA 2BHYA 3HG1E 3X13A 4CRPA 4PJFB 1F4WH 2UVFA 1TJGH 4FTVE 1HCVA 4HFWA 5L6YH 4S1DC 5C07B 4I77L 4G5ZL 3MSPA 4DKAA 1OTSC 3T65B 1RURH 4JFXB 2NY2B 2CO7B 1JYXA 2A2QT 4Y5YB 2RFXB 4LEXL 3FJTA 4PJAA 5HJ3B 1P9MA 4P5MB 1QYGH 1JPTH 4ELKA 3AY4C 5J1TC 3HR5B 3ZDZE 4M43H 4FG6D 5JIKA 1JPFA 1I7ZB 4L4TB 4AMKH 4WHYG 5L0QC 4WU7B 5D2LA 2C1OB 1DBBH 4K3HA 2FH8A 1KPVB 5E4EB 2F19L 3KPNB 4MDJA 1K85A 1DLFL 4HIIB 5ISZB 4AK1A 1LO0L 1IGCH 4PUBL 4HF5H 3QUZB 1T2QL 3DX8A 4HEME 4LHUG 4IMKA 1I7TA 3WJLA 4M61A 5KW9H 1OARL 1QSVA 5JOEA 2VLJA 4NQDD 2W0PA 2V7HB 3MYJA 1I1FB 2I26N 1WWAX 1MLCB 2HFEB 3TH2T 4P59L 3HMXL 4O2CA 1QEWB 4D3CL 2W1NA 4BQ8A 3WIFB 4QXWA 1MRDL 5GRJL 2OZ4L 2AK1H 1CDHA 1CICA 1ETZB 1KPUA 1KLGA 5T1DL 3X14A 2JCCF 1HNFA 4EXPX 2BNQE 3FB6B 2FCBA 1AQKH 1FSKC 5DEGB 4MCYB 2DDQL 4CVXA 1GGIL 5B21A 4JQIH 4ZD3H 1MIMH 1I4FB 2Q6WB 4JZJB 4NYLA 4Q9QH 4UI2A 4YBLB 2W9LA 1DBKL 5IWLA 1INDL 1QG3A 2BSED 3AUVA 2XPGA 2OL3B 5JW5B 4UT7L 3GI9L 4Z0XB 4LLDA 4RA0C 1CXHA 4XVJH 4YBQD 1SJHA 2YC1A 4W81A 1FGNH 1N3NA 3MV8B 4LF3A 4PJ9D 3BKMH 3VD4A 5CP3A 5KSAC 1UH4A 2PXYC 1FO0L 5IB1B 4FQJH 5EWIH 1FNHA 3O2VH 2WBJD 4DN3H 2YHGA 1T1ZB 2BDNL 4D0CA 1H3WM 4Q6IA 1J18A 3CSGA 3LD8B 4HT1H 4C83B 2NXYD 5CEZD 3PJSB 4KMTL 1PFCA 1KJ3L 4HCRL 2R1YB 4NN7B 1CXLA 3T0EC 5MENE 4D9QE 5I8OH 3QWOA 1T03H 3RDTB 2E9JA 3DROA 5ICZB 2HJKA 3VFUB 5DMYA 1G7PA 2EKSB 2VZTA 1DEEA 4U0RB 2DS4A 4OZGA 4Y2DC 1QSFD 5B38B 1CU4L 4NKIL 2BP3A 3L7EA 2FX7H 4ELME 3MRHA 4XH2A 3M8OL 4RAUA 1KUMA 2NTSP 3ILPA 1ZHNB 4OM1L 3RY4A 4AH2B 4LASL 4NUGL 2AV1A 2H2PC 4PJXB 5INCA 4UOJA 3KNBB 1BVKA 1GGBL 1BLNA 1KJ2L 3GSVB 3QIUA 2OK0H 1KFAL 4X7SH 4XAWL 1BQLH 3D5OF 2UY7A 2F54A 2OR8A 4OCXL 3B83A 1OCWH 1FP5A 5BRZD 1NC2B 2J6EL 1N59A 2F74B 1OQOA 2B1AH 3LEVL 4R4BB 4ESKA 5ACZB 5GSVA 1J8HB 1A6WL 4IEFB 1JK8A 1VADB 5B3NA 2EE9A 3VXMA 1A7OH 1E27A 3DMMA 3EFFA 3CDGB 3NCJH 1G7LA 5I1HH 3TBVA 1KENL 3PXJA 5KVGH 1TENA 1DQDL 3LEXB 4H20H 5ALBL 4KH2A 1UZ8A 4I0CC 1XEDA 2CSPA 3WBDA 2ZNXA 1IAKB 4U1HB 1HQRA 1NL0L 1JWSA 3DOSA 1FL5A 3TBTB 1ZLWK 1UEMA 4XCCH 3F6LA 3SY0B 5JTWA 5FYLE 3NACH 4XC3H 3TC9A 3MLZH 1HINL 5F7UA 2BNRD 4CADA 1OOAA 4H26B 3BN3B 4U6YA 3MLYH 5LGHH 3LH2H 3FCTA 3LKPB 3O4LA 3W0WB 1IQWH 5H8DA 5E1AB 4XTRC 1AO7E 2E7MA 3SE4A 3V9FA 3V0WL 1A2YB 3E2HC 2DIBA 5DJ6A 1OAYL 2ICWA 3PE9A 2QSVA 12E8H 5DRXB 4UQ3A 3O6KH 4OT1L 1XF3A 3R0NA 4PFEA 4PJCF 3U83A 2CKBB 4UIMB 2X9WA 1M71B 5MI0C 3WNMA 5EOCJ 4L8SA 3QA3B 1WAAE 3MV7B 1Y18A 1KLUB 4X8XA 3ZYIA 3RL1A 4G8GD 4ZUSA 4FN0A 2P24A 1G0YR 1HSBA 1VA9A 2BHZA 3QG7L 4LOUD 4N8PA 4OZHA 2VR5A 3HNTL 1MWAB 4Z77A 4JQVC 3LQMA 2ZOKA 3BUYB 1MVUB 1Z5LB 2H3NB 3FB5B 2VH5H 3BPNC 5HDBE 5LXGH 1CGYA 3V4VL 2DLTA 5DXWA 1RY7B 3H6JA 1KCSH 1J86A 4JN2B 4OAWB 5JUEL 3RNQB 1RIHL 2OTUB 2GSIA 4UUJB 5GZND 4XX1G 1SBSH 1ZHLA 3JV4A 3G6DH 4OJFH 5BZWA 1AR2A 3BMVA 4HUKB 4RDQF 3VFRB 5I0ZA 4YHZH 2ERJB 5CINL 4F7MB 1OGTA 1WICA 4OUUA 2C3WA 4FQLH 3MJ9A 4LBEB 3OKOB 3I6LE 4PJXE 3D2UB 3G5VA 1WF5A 1YNLH 2DQCL 1VEMA 4UNUA 3EKCA 4NUJA 2EDWA 4OD2A 4DUWA 5EBMA 1CD1B 5FYJH 3C87A 4PJAF 5TDPA 3Q1SH 3KDMA 2O26U 4M48L 3HCVB 3VFPB 3VRIB 1TVHB 2FECL 5JHDB 5FA3B 3LS5L 2UUDK 5DD3H 1SEBA 1LDPL 5DDHB 3DYMA 2DD8H 3BT2L 3BPCA 4NFBA 3GMLB 5D2LF 1F4XH 2ARWA 4NQDA 3QDGB 3LQZB 1FZKB 2X4RB 5CILH 3F58H 3KPRE 1NEZB 1TQBB 1OAXH 1V8HA 2V5YA 3MRLA 1CLCA 2NZ9D 1MFCH 3KXFE 3FL7A 2UVEA 4Z5RA 4MAYC 3RIFF 5I66B 3F7VB 3MRQB 3T0DA 2N7AA 3TF7C 3CVHB 4WO4B 2AXHA 1AFVH 3OTTA 1NDGB 3EUUA 4UV7H 3MUGA 1SMOA 4L1DA 4WJ5A 3IDYB 3DUHA 4K3DH 5GQBA 3I50L 4NHCL 4RX4A 5D93C 4KJQD 4PRHB 4X5WB 3DX6A 3VRLE 3LKQB 3O6FB 2CDGA 5MEQB 3KVQA 2VDNL 5DD6B 4C56B 3ZLQC 3OMZA 3WUWB 4M1GL 4NCC1 4I4WB 3ZE1E 4JPIA 1S9WA 3L95B 4OSUL 5F1IB 3QEQD 4GQ9L 1UCTA 2PETA 4PYGA 1ZWIB 4Y1AB 3PABB 5CKGA 3DURB 5JQHC 1CLOH 4MXQD 2AJZA 2FR4A 4NGHH 3VXUE 3C60A 3P4MB 4OCRL 2AS5M 3TM6A 4E42A 5J06A 5I1EH 4Q9RH 2Q20A 3VD3A 4YQXH 1U8JB 1WZKA 1LHZA 5F8QC 2W0KA 4S1DD 2ZSVB 3NCYS 5FDYA 1QFOA 3KYOB 5TF1L 5MHSE 2IF7A 4YX2L 4FQIH 2XTJD 5JORB 4QHMB 2BSRB 5F9JA 4X6DB 2MHAB 4H5SA 5CJXC 3T04D 3UROR 1WT5C 3RGVA 1MHCA 1JGUL 4JVPA 1MFDH 5CBAB 4ODWA 4NRYB 1T5WA 3W39B 1RMFL 1Q9LB 2FD6H 3G5ZA 1HCFX 1QSFA 4QRPB 4Y8AA 1LP9B 5E5MA 4LAQL 2MPAH 3U36A 3B6SB 1IGJA 5JA8B 5J9PB 1U8IB 4RISH 1DDHB 3MBXH 1MSPA 4E41B 3H0TA 4JGMA 3DX9A 1S3KH 2ZUUA 1AGBB 4FXKB 1MVFA 2FIKB 4Y5VA 4ZOCA 4OZGF 3GK8H 4WI6A 2HKHH 4DZ8A 5FHBH 1IVLA 2W92A 4PRNA 3V7AG 4NO0B 5D7LA 4HLJA 2ZCLH 5B4MC 1UVQA 3GHBL 1EZVX 2EDNA 1BIIA 4P3CL 5TQ2H 2E3VA 1RUMH 4JFOB 4XCFL 2YSSA 3QDGE 4GQPH 3RWHB 1G9ML 4U1NB 3MBEA 1HDMB 2XFXB 4XZUA 5HBBA 2YPKB 3OV6A 3G6JE 5E8DL 1BBDH 4ZFOL 1PQZA 4IRZL 5CJBA 4RFEB 3HRPA 2MMXA 1R0AL 3EYSH 4G43A 1B4JL 1Q9OA 1CFTA 5HVHC 5FB8B 4Y4KB 2FJFB 3ESUF 3T3PF 1QSEB 5LCVH 1U8PA 4F7EA 5I1JL 5J6HB 3QT2A 5IB2B 3JV0A 1IAOB 1NLDH 4S1QL 4PRHE 3MLSH 2VTFA 3O2DL 5M94B 4LKXA 2B5IB 1JZ8A 4ZXBD 1Z9MA 3CXHK 4N5EC 3U30B 2BNRA 3U7WH 4RGNC 1HQ4A 1H0DA 2Q3ZA 3RPIB 3I9GH 5CMAB 4S1SL 2BOBB 3BQUB 4L4JA 5IVZA 5KSAD 2PXYD 2AXFB 2R69L 4WFFE 4HUXB 5D1ZC 1IGFH 1FVDB 4E0RA 5D1XB 5GRWA 1FL6A 4TSAH 2HRLA 5IVXB 2AEQL 5IQ7L 5BVJA 4WW2F 1JGEA 3RVTC 3GJFA 4G8GA 3RUGB 1UZ6F 1JL8A 3CFBA 3FHQA 2AJUH 5CJOL 2JIXD 4H25B 4RGMC 3VXSD 4URTB 4JO1L 4X6DE 4ZOAA 3MRBA 5IV2A 3D0LA 1FFPB 4HIEA 4Y2DD 3FFCE 4O00A 3AU1A 5HVWA 2EH7L 3MOBL 1FZOB 3QCUH 4HPOH 4CNIA 2WNGA 2GW5A 4HWBH 5EA0L 4YDLB 4PRPB 5HDQL 5AAWA 4UDUA 2J7LA 3WV0A 4OZHF 5I19L 4QRPE 5MEPA 3ARFB 1GH7A 1JHKL 3IU4L 2VE6A 3L3JA 3TP4A 2H2PD 4E41E 4J7RA 2Z93A 4K9EL 5CSBA 2WWKO 5E2WH 3ZYZA 1YYML 1A9BA 1OWRM 1EAPA 4F9PA 4OGAC 4X4ZA 4XNYL 5HHPB 1OPGH 3PWUB 1CFSB 4JZOA 2JJVA 3E6HB 3CSBA 4N90E 4LHUD 4JRXA 1RI8A 2IQ9L 1BQSA 4KKAC 5BO1H 3BP6B 4XMPH 1UC6A 2ADJB 3I2CL 5AG9A 2VDKL 3VRJB 5E8OB 2HWZH 3H9HA 5IHBA 1NCAL 1MJJA 4TTDD 5DHVH 2VSCA 1FNGB 3LQAL 3A6CL 4GBXB 4Q2ZB 2AERT 5LWYH 1HXMA 5GJTL 3H3BC 4Y5XC 5IOPB 4MCZA 3F7RA 2YMXH 3VWKC 4PJIB 4DGVL 2FJGA 2VDPH 1I8IB 2CLVB 5EBLB 2GT9B 5HHQA 2W07A 2D7QA 1DVFD 2C1PA 3T8XA 3RZCB 4GO6B 3CXHJ 3SO3C 5C7XH 5IM7A 1DP0A 4WFGE 1QSEE 4XPTL 1URLA 4G6KH 4I5BA 4XPBL 4NN6C 4UILL 5H35A 4KZEH 4ONOA 5FA4A 5JDSB 2EDYA 3NTCH 4M7KL 5JHLL 4HWZA 1DL7H 2ICWI 4N0YL 5DURB 5IB5B 4YXKL 4KZDL 1TZGL 4PV8A 4NQEB 3W82A 1R3KA 1DBAL 2ARJA 3ARBB 2Y5TB 4F8QA 1PYWA 4UDTA 3O3UN 4MNQB 1UWGH 3BZ4B 1RU9H 4XTRD 3BRDA 3MLVL 5CCKH 1T0MB 3REVB 2IFFH 4LIQE 1BM3L 4U1GC 2PCPA 2JLLA 4XNMB 2HN7A 3ZYJA 4QRSA 5D8JL 2G60L 4YO0A 1X9QA 4TNWK 1N0LA 4X5LA 4HX1B 5KSBA 1GAFL 3QFJD 4DUXA 1W0WB 2WM0A 1D5MB 5BJTB 2EXYC 5IW3A 4M8QA 2YD2A 1A7PL 3RUGE 3RWIA 3WFHA 1MHPH 3H9ZA 4P3DA 4JLRA 3PL6B 1SM3H 2P5WD 5I8KL 3MGTB 4OIBA 4NRXA 2XKSA 3WIHH 4G9FA 1FZJB 3T2OA 2X1XR 3ZYOA 4QRRD 1JPSH 2VDLH 5GGTL 1U8KA 1LO5B 1Z9OA 4PRPE 3MFGB 2YD4A 5H37G 3BZEA 3IF1A 3SDYH 4J23A 4ODSH 1OAQH 3IDIA 1NMBL 1BIHA 3B2UC 5E8EA 3WXWL 5ESQB 3RBSA 4CBPA 2Z8WC 4M7ZB 4PJ8C 3H7LA 1KB5B 4KRNA 3H7BA 1EV2E 5E99H 1N7ML 5GPRA 3VD7A 5EN2B 3RGHA 3BGFC 3BAEH 3IKCB 3PWLA 1MRFL 4K94L 3AXLA 3I6GA 3MRJB 3HI5L 1UM6L 2VABA 2X89D 4DTGH 2YR3A 4UT9L 1MIEH 3O8XB 2NQCA 4ZFZB 1VDGA 2FNBA 4OLZL 3UZQA 2ESVD 2I5YH 2ZCKH 4RMUA 3QO0A 4KJYA 1XGPA 1MH5B 3M1BB 5MP6L 3ULVL 4DVBA 1BWWA 1K4DA 2YPVH 1P6AB 4WIQA 3UTPD 3H9YA 2IBBA 3ARGC 2DBLH 1VFAA 5I0DA 1CR9L 1R5IB 3WO3B 3QUXB 2FH6A 1DLHB 1NFDF 2NY3C 4OLXH 2P5EB 35C8H 5JR1L 3I75B 4NKMA 5F44A 2AK4D 1CZ8H 5CJQL 3K2UL 1CVSC 4UINH 1F6AA 4FTVA 5C0FB 4DAGH 5CBEB 2LV4A 3FOMA 4CW1B 4FQ2H 1UKQA 1RZ8B 4JKWA 2G75A 2W9EH 5FGRA 1FFNA 2IADB 2NY0B 3U4EA 4NM4L 4OLVL 1M6OB 3DVGA 3DJ9A 4ZXBA 4XCYA 5ITFB 7CGTA 2W91A 2BSTA 1YEFH 4OLUH 1F8TH 5FO9B 1X44A 3M17A 2IBGA 4TVPL 1OB1B 4F57H 3VGAC 1G9MC 3P2TA 2IALA 4JDVB 1YECL 1A64A 4PS4H 4X0KB 3VFTB 4WEUD 1NBZA 4NO5A 5FF6B 1WBXA 3LS4L 4F33A 5TGBA 4WY7H 1A22B 5HYQB 2D7TL 4NRZA 3MGAA 5LBSL 5D7IA 2XZCH 4B7LA 4KTEL 4XNQA 3FRPA 4PGDB 1QBML 4PJ7B 3MLUL 5GGVH 2VUOA 3O3EB 5DJ0B 1VGKA 1IAIH 4HGKC 1FNSL 1FV1A 4PY7A 1DQQB 3QUMB 1FAKT 1X4YA 2R0ZL 4NWTH 4HS3B 5K9JH 4JGUA 5H94B 3VXSA 4F58L 3V4PL 2HA1A 5AD0A 4KUZH 4PYHA 2OBGA 4WDIA 5J1SC 2D0GA 3L3IA 5A2JH 3CC5A 3OG6B 3KPOB 5LQBH 4MA1C 3TIEA 5HHNB 2C7UB 1DUZA 4O4YL 3BE1L 1MAMH 2P7TB 4WW1B 3G6AA 4MQ7B 4D9LL 4PBWD 2ZOLA 2R4RH 3OKLA 5F89B 2VZ1A 4P23C 4IOSD 4GKZA 4R3SA 5E94B 5C0RH 1WTGT 1XF4A 5FUCC 2R1WB 1Q94B 1P4LA 4QRQA 5B4MD 4JZNB 1RUAH 1IEAA 2ARJQ 2Z31B 3QDJD 4PJDF 4GAJH 3U9UB 2UWEF 3QRGL 5EU5A 4PP2A 4S1RL 1NUGA 1V3KA 2R1XA 1IM3A 4JFZL 2ZG2A 2IWGA 3IRZA 3T0WA 4ZODA 4MDIA 1FN4A 2J3SA 5BVPL 4JG1L 4NJAH 5C0BD 1LE9A 2C3VA 1EGJA 1OAUH 2H8PA 3SPVB 1S7TB 1AQDA 2XQBH 1T04B 5F96L 4GUPA 5TJWK 1NBYB 3INUL 4K9EC 1DVFA 3MLRL 4GKSB 1A3RH 4Z78A 3TVMC 2K9UA 3R1GH 5EOTB 1IT9H 3RWFA 5JXED 1WIUA 1A5FL 2GI7A 1MCFA 1YC8A 5CEZH 5MENA 1RZFH 4N5ED 1E4JA 1WIPA 4RGND 1YC7A 1AJ7H 1D6EB 1JMZA 1J87A 5EU7C 2V5MA 5C0CE 4F2MA 4HUUB 5I71C 3BH9B 4XCEB 1DANU 4CN4A 1IBGH 3LQAC 3MRGA 3MRPB 2AW2A 4NNYA 3RHWK 4ELMA 1N8ZA 3QWRD 5I9QB 2DI7A 4AIZA 3AREB 5CWSA 5D96C 5D1ZD 4MA3B 1CT8B 3BD5A 3OR7A 7FABL 3CFIC 1GGUA 1JP5A 1U36A 3N50A 3TT3H 3MUZ1 3MCKA 3NZHL 1XR9A 4ENEC 3RWCB 1DZBA 3QFJA 2VWEC 3QIWC 3EOBA 4OCMC 5EIIA 4GS7C 1CLZH 4NSKA 4QOKE 4YZFE 2NY7H 4EKXA 5K59E 2VC2L 4L3EB 5J56B 1M05A 3N85L 4BUHA 3VXNA 3ZKNC 3HPJA 4CDGC 4L5FH 4G6AC 4X4XB 5KSBF 4OFVA 3MNZB 4MZ2A 3WEXB 4KI5E 5ERWB 4ZUWA 3BW9B 3EYUH 4APQB 3WFDH 1WBYA 4QRRA 5GZOD 4CUCA 4POZC 4EI6A 1IC5L 1ND0B 2EYSB 5CAYB 2YA0A 4NZTL 1TVBA 4ZDHA 2HFGL 4LEOA 2DMKA 5D71L 4POYA 1ZK9A 2A6DB 4PG9B 3S37H 2Y06L 4NC1C 5IGXL 3IAQA 1ZAGA 3O0RH 4YHPA 4WCYH 4OGAD 3IGAA 4M6OL 1S7UB 4P2YA 3Q5YA 4KKCC 3R06A 1XCTA 4XWGL 4KC3B 3EJJX 3W81A 4LSQL 5IROA 4LVEA 5CHNA 2WWKT 2X89A 4KKAD 2ZUVA 3MRMA 5C0AB 5CEXB 2D7OA 4KMLB 1KCUL 3MFFA 3NPSC 2ESVA 4NNXB 4PB9H 3V6OC 5C09B 2VR9A 3C5ZD 3WFZA 5E9DE 1C12A 3FQXA 1AO7A 1HZHL 2B8OT 1I1AA 6FABL 1WCQA 1RJYB 3VWKD 3EO9L 4GSDL 2V2WA 2H6PA 3UTQA 4NQSA 5ESVB 3KPPA 4M1DH 1R6VA 2IEPA 1UKTA 3JZ7A 2YN3A 4YE4L 4OKVA 3AB0B 4HIJB 4ZQKA 4JCMA 1IGYA 4NJ9L 3BPOC 4PJ5E 1FFOB 4GRWE 3QI9C 2AK4A 4MHHI 2CGRL 4XP1L 3TNNA 4N8VB 1F2XK 1T83A 1T22B 1NGYA 4Y88A 4P5TC 3B8YA 1VKXA 3MJ8B 4GMSH 4R0LC 1EO5A 4ZS6D 3TO4C 4OFYD 4PRIE 2B2XH 3ULVC 4P9HC 1VEPA 1Z9LA 1ZVSA 2AGJL 4KJPC 1HHKA 2R0WH 1JUFB 2E7HA 4LFHD 4NO2B 3LMJL 4YHYC 1ORQB 1JZ7A 4OIAA 5CGYC 3OKMB 2R0KH 3Q3GA 4ODXA 1UACL 3HMXA 3SGDH 4MMXC 3ZKXC 1HOCA 4CDHA 1RUKH 1YMHA 2RB8A 4H1LH 3MRRB 4MJIB 2OZ4A 1MOEA 2D9CA 5EZJB 3BYYA 3QYCA 2EXYD 3CLEH 1MFEL 5EORL 1C08A 1K8IA 1JPST 4IDJH 2HKFH 3JTTB 3CXDL 2FZ3A 5HVGB 2X4NB 4JPVH 4L3EE 1TQCC 1MF2L 3VGEA 3HAEA 5IG7B 1NGWA 4RGOH 3SDAA 2Z8RA 2DI9A 4OM0H 3UYRH 5GISH 1WCBA 5HYSG 3FQTA 5D7SH 1KJVB 1R3IL 3TBSA 1JTOA 1NANH 5LJYH 5D7IF 1R3HB 1WT5A 3K1DA 2PO6D 2IPUG 3ARTA 3KPRA 1ZS8A 4J1UA 5F9OH 15C8H 3KXFA 3RVUC 3HZYB 3GIZH 4LCYB 3FT3A 4RIRB 3MC0A 5DT1H 3WLWC 4ZAKA 4YDJA 4HGWA 3THMH 1FO0A 1RIVH 3TWCH 2BNUA 3OZ9H 1GZQA 2ITCB 4HAFA 3WNPA 5DGQA 1AH1A 3F7YA 4U6VL 2RIKA 2I07A 1UM5L 4GKNA 3GHEL 3MX0A 4K55A 1OF2B 3RNKB 3UXFA 4J3SA 2QKIA 1MNUL 4F3FA 4HCRA 3GBNH 5C0AE 3VDBA 1QZ1A 2ZCHH 4RWYH 4U1JB 2C5DC 3MR9B 3BHBB 4AZ8A 3ARGD 5C09E 3QDJA 2J8UF 2P8MA 4H8WH 1TJHL 1DCLA 2VN7A 4YHMH 5BS0E 2ATPB 1WZ1L 4LGSB 4WI5A 2NY3D 4MD0B 5I1LA 1MAJA 5CD3A 1RJZA 1ZA3B 1L9MA 3GMNB 1FRGL 3UTTD 3MV9D 4FMFA 4HXBL 4R4NC 5DRWB 3GMRB 2EDOA 2AKRB 2F58H 4X9BA 4MSWA 2V2XA 4IOIB 3VXUA 4JDZB 3RTQB 3NN8A 4DKEH 1TZIB 5GJSL 5TQ0H 2HVKA 5L88L 4OB5L 1IGTB 1U93A 5IIEA 1DUYA 2E9IA 3QEHB 4LCCB 5B3JF 2A6JB 3LRSB 1KJ2A 1HKLH 3FB8B 4TYUA 1U9KA 1G0DA 2X70A 2YPLE 2Y1VA 4RQQB 1KEGL 5JXEA 3AS0A 1XIWA 2J6EA 3ESVF 4EN3C 1I9IL 2VXUH 2LU3A 3CK0H 3H9SB 3JBG7 3BMWA 1U42A 2CDFB 1BD2D 3SCMD 3VWJB 4LCUB 5GS1C 3QULB 4P2QE 3FQNB 2IMNA 1UXWA 3WFCL 1MCPL 3FO2B 5F71A 1W8OA 3P4OA 5J3HC 1F4WL 3WSQL 2VAAB 1TJGL 3UEZA 4D8PA 5F7NC 4MJIE 5I16A 5FYJU 1MHEB 5L6YL 3F5WA 4WV1C 3WFEH 5IJKA 4PY8I 1FVEA 3OXRA 5IMOB 3TN0C 3BH8B 4O9HH 1RURL 1XGUA 4HUVB 2KQMA 4RWHA 4NPYB 4V1DB 1EHNA 3ZKQD 4P46B 1QYGL 1JPTL 4MB3A 3MLXL 3RJQB 1N6VA 2YRZA 4HS6B 2IH3A 3MRNA 4M43L 5EZLB 3T2PA 3U0PB 3Q6FB 3U1SH 2EYTB 4PJEB 1MREH 1H8SA 3OB0K 4KVCH 4OV5B 1NLBL 1AXTH 1MWAL 3P73B 3D39B 4WTWA 4F15B 5IMMB 4QHUB 4DQOH 3G6JA 5DC9B 4WFEE 3P11H 3K74B 3WS3B 2Q86A 2FEEL 2DLHA 1IGCL 3DUUA 2YD6A 5T5FL 1AHWC 5E6YA 8FABB 4HLZG 2V17H 3LB6C 4K71C 3GB7A 5KW9L 1VFBA 3VFGH 4P23D 1WQVT 4XC1H 4KROC 1YMMD 4WWKC 4JAMB 1JVKA 1E28A 2W59A 3NABH 1EPFA 2M2DA 4R9HA 1EMTL 1NCDL 3P40A 4JFHE 5EOCH 5BV7B 3ULUH 4JQXA 3C09B 4PJHA 2V5RA 1P84K 5EOQH 4B5EA 5HHVL 3PGDA 3RWEA 4FFYL 5F9WB 3N1GC 1TETH 1II4E 4AG4L 1J1XH 4BK4A 3C5ZA 1YEGH 5MERB 4MJ6A 4HIXH 4WNQB 4Y5XA 4GG6A 1HXYA 1T1WA 1MIML 4BSVA 1OTTC 1WTLA 2BRRH 5IB4A 3QZWA 5SV4A 5FK9A 1OAZL 2H32H 2IPUK 2NY2C 4Q9QL 2FBOJ 4QYOA 4BH8A 5E2VL 5B38G 4JHAH 4PLKC 1WZLA 2E6PA 3TVMD 3S36H 1I8MA 1UG9A 4JKPL 1M7IA 1RK0B 3GSNH 1ZE3C 3GKWH 4L9LC 4B0MM 5CSZA 3QXDB 4HKZA 4U2ZA 4WWID 4XVJL 1X5ZA 3G9AB 4JDTH 2XKUA 5HGHB 3H9SE 1JWUA 1ED3A 3IFOB 5E4EC 1P7HL 5IMKB 3T1WA 4OFYA 1BQHA 4FQJL 5EWIL 5JIIA 4OF5A 1GIGH 3T0BA 1G7QB 1JFQH 3QG6B 4DN3L 4MJ5A 4Y4HD 1LWRA 2EYRB 3R8QA 3BFOA 4R96B 2BXZA 5C2BH 2E7LC 3QFDB 3LRGA 5D70H 4ENED 4X6FB 1G0XA 4LSRH 4X4YB 4UB0H 1HH6A 3QIWD 1OT2A 1N2RB 5I8OL 3ZHKA 3C5JB 5DQ9A 1ZLWH 3X12A 4V1DE 3F7QA 4WRLA 4WHYH 3KPQA 3P0YH 1GPOL 3ZKND 1C16B 1UXSA 3SKMB 4FFVC 3T0XA 1CL7I 1MUJA 2E7CA 3JV6B 2FX7L 3MUY1 4GAYA 1O5DT 2EIZB 2WV3A 3BP4A 1QPXA 3O9WA 4GMTH 2OJEB 3D39E 5ALCH 3JUZA 5EUOE 1UQSA 2GAZB 4Z76B 1I9RH 2G9HB 4LDEB 1T0NA 3H3PL 4JZJC 4X7SL 2PO6A 5GGRB 2EDKA 4YBLC 1TIUA 1BQLL 2CUIA 4JPWH 4R2GC 5DUBA 1R5WB 2HJFA 1OCWL 3NH7L 5CIPA 1S7VB 5A16A 2B1AL 1P84J 1JF6A 4Q74A 3PWJA 1T3FA 3O6ML 5GGSB 2RBLA 4G8IA 32C2A 1A7OL 4KGJA 1IM9D 4YNYA 2PW2B 3WKMH 1EXUB 3S37X 1CS6A 2X4PA 3T2NH 1VFUA 1G7HA 3NCJL 4EUPB 2COQA 5KVGL 1U2CA 3IDMA 5C0CD 1WVZA 4P4RA 5B39B 1MCEA 2A6KA 3EZJB 3PIQB 1D9KD 4LGPB 4CKVX 2I9LB 2GY5A 3LD8C 2F5AH 3O3AB 3ARGA 3BIBX 5C08D 4ZOEA 4I3RL 5AZEH 3MRDB 3QIBC 3U0TA 3TIDA 4NN7C 1JF5A 4FZEH 3BO8A 5BQ7A 3VRLF 1A1MB 4HJGB 4KJWD 2XIDA 4GRLA 1X3DA 2A73A 3RDTC 4ONHA 2CLRB 3NACL 1DE4B 4U0RC 4XC3L 5HGAB 1T80A 3OQ3B 3PQYD 3NIGE 1RSFA 3LH2L 1LO3H 5C0GB 4HC1A 3NFPB 1IQWL 4OF8A 3S88L 2DLFL 4ZNEA 3OF6D 4R7NA 1T7WA 4P5TD 3LDBB 4D2NA 2IAMB 4PBVC 3GI8H 4HJJL 4FP8H 1GOFA 1AY1L 3ULVD 4KJPD 3JUYA 12E8L 4G6ML 4LMQE 5EFIA 1JZ2A 3OKKA 4RAVA 5CGYD 4Z7WA 3SCMA 1BD2A 3HKFA 1HHHB 3QQ4A 4JFDD 5AWNH 3FHAA 3WKNA 3OG4B 5L2KB 5CUSL 5D2NE 4QHKI 4ZFOA 1U6AL 4P49A 3CUPA 4P2RD 3CD4A 1JI1A 2VH5L 5ID1A 4M7JH 3WJJC 5D7KE 5LXGL 5DSCA 1NEZG 4MA8H 4G3YL 1S7WB 4XBPA 5B8CB 3PWNA 4KDTC 4JM4H 1MHHB 3RA7H 3BP7A 4OJFL 3X3GL 3S5LA 3B9KB 1I8KB 2A6IA 3DI2B 3RVWC 3WYRA 4GW5A 4ISVA 5E9DD 2ORBH 4I77H 4TUJB 4FQLL 4LARH 3MCLL 3BZFB 1MRCH 3SDDC 3MRFA 4OZ4B 4G80A 2BX5A 1JZ3A 1YNLL 4TVPD 4Q9BA 4ZUUA 5KN5A 1YN6A 3RVUD 3PWPE 3WLWD 3L9RA 5FYJL 1LEGB 1BF2A 1U95A 3WUWG 3V79C 3SDXB 5ID0B 2X05A 1QUNA 3ROOB 1QRND 5JO5B 1JIBA 5FUOH 2H26B 3CSYA 2HTLC 4I2XE 4EIGB 2OX5A 2Q7NA 4MJ2A 3N1FC 1BZ7A 2VLME 4PV9A 5SV3A 1MLBB 2DD8L 4P23A 1F4XL 4KQ3H 2F19H 3CDFA 3U4AA 1YMMA 3DV4B 5KSUB 4WUUB 5CILL 3F58L 4PPTA 1B0RB 2ZNWA 1RZKC 4UIKL 1OAXL 2A77H 3C6LC 3P9MB 5J12B 3DGGA 4LP4A 1UT9A 4EOWH 3GUTA 4K23H 2V7NA 1A4KB 1NJ9B 2CXGA 3IDUA 1S5HA 4TOYH 3AAZB 4R4ND 2FO1A 4J8RB 5HPMA 1A0QH 4P59H 4MQXC 1YY8A 1KN2H 4JRYB 5GS0C 4D3CH 2Q1EA 5C6PB 3HE7C 3QPXL 1YDPB 5EPMA 1MRDH 1J0ZA 4PJHF 5DRZA 4I18C 1C5BL 1I3VA 3STZB 1UENA 4YBHA 5T33H 1D5ZB 3RU8L 4N0UA 4OZFA 5T1DH 5KVMC 2Y25A 1CXKA 2VYRE 3TVMA 1A6TA 4PR5A 4GW1B 1MCIA 1UWEH 3CZJA 1NGQH 4EQ3A 4WU5B 2ERJC 3MREB 4U6HB 2DDQH 1RUPH 2JCCB 1GGIH 3VA2C 4HKXA 4GG6F 4NO3B 3BRFA 1AXSA 5IVOA 2VITA 1ZHBA 4EN3D 1ZT7B 3B4NA 1NC4D 1KIRB 1ZMYA 4XRCB 3JTSB 1P1ZB 4JEGB 2YKLH 1CLOL 3BSZH 1J05B 1DBKH 3MJGX 2OTWA 3QJFB 3QNZA 4NGHL 4W4OA 2RAMA 1QBBA 1F58H 4YPGA 2GFBB 4UAOB 5I1EL 4J3UA 5J3HD 1FE8L 5E8PA 4Q9RL 2XKNB 4YQXL 4Z7VE 5EBGA 4Y4HA 4NHUA 4ZPVB 3CGTA 5L2JB 5TF0A 2DQFA 1MCKA 4FQIL 4O2FB 4W68A 1YNKH 3ARRA 5HSFA 1I9JH 1FJ1B 3DV6A 3CU7A 1TPXB 1TQBC 4EI5B 5DS8B 3E6FA 4MD4B 1GL4B 1RPQA 4YXHH 4CMHB 4NOBA 2AJYL 3IXTB 3F8UB 1IZJA 1NKOA 1PJ9A 3IDGA 4HCRH 3BPLB 2MPAL 5BS0D 4DGYH 5IW6B 4QT5B 1WWCA 4RISL 1ZA6A 3C8KA 4NZUH 1OW0C 3FT4B 3IDYC 3MRCA 3TBYB 2DQJH 3ULSB 1S3KL 5F7DA 1HHJA 3LKSB 3RX5A 1UADC 2XACC 4FABH 5IKCA 3HC0A 3GK8L 1CU4H 1QLEH 2HKHL 4NKIH 5FHBL 3D3VB 5DJDA 2GTWB 3HLAB 4F7TB 3STLA 3LB6D 2WIIA 3Q48A 1GCFA 3GSQB 2APWA 4KROD 2PF6A 1QR4A 1V3JA 5TQ2L 4LCWD 5AYQA 4WWKD 1RUML 2YPLD 1GGBH 1MCDA 5K9OB 1KB5L 3VXQB 5EZIL 2NW3B 1IM9A 1HEZB 4YK4B 3IAPA 5E2JA 1ZLVK 4J4PC 1U8HB 4X6BA 4PRAB 5C0CA 1EEYB 1IQDB 1T1XA 4Y7MA 2Z4QB 3EYSL 1D9KA 5GGTA 3P0GB 4MNGA 5C07D 1KG0B 2DYPD 1DTUA 3DECA 1UWXK 2D2OA 3C2AH 4WTXA 3FFDA 4OQ1A 5LCVL 1OTTD 3TZVC 1BBJB 4JRYE 1NLDL 5DWUL 4M3JA 1QFUH 2NY2D 5J8OA 1E4XH 3MLSL 2XOTA 2FECI 1FG2B 3LV3B 1DQDH 5ALBH 2Y7QB 1D5XB 3CFKB 3WIIL 2JJUA 1TCMA 3ME0A 3U7WL 2ZG3A 4QOKA 2FL5B 5T5NG 2FGWL 4XCNA 2JK5B 2JCCE 1NL0H 1HIMH 3P4NB 2DQHH 2W65B 4MX7A 1S7QA 3ZTNL 3BOVA 3MGOA 4L4TD 3OF6A 4KTDH 3S36X 5EBWB 2RQ8A 5D7JD 2YBRA 5KVDH 2XWBB 5F70A 3DO7A 3KPSB 3IJYB 3Q5TA 4G6FB 4IRSA 5D9SA 1IGFL 5ISZD 1RFDL 2DIAA 2CDEA 1HKFA 2EE2A 4JFDA 5D1QB 5DTFA 1E4WL 1CD9B 1YEJL 2QL1A 3FN0H 3V0WH 4DOHE 3U7YL 5FYJE 5DVMA 2AJUL 3L5XH 5SX4I 1ES0B 1FDLH 2GK0B 4OT1H 5A3IC 4P2RA 4NT6B 5E0QA 3RWJA 5FYKH 4Z7WF 2OS7A 4JFFE 4PJCB 4NBYB 5I8CA 1RK1B 2ZUYA 4HPOL 2MCG1 4HWBL 4FFVD 1EJOH 1OGAD 3QJHB 5LAXA 3HNTH 2YUVA 4LL9A 3C08H 4NM8L 4A6YB 1K4CA 3D85B 5E9DA 2OCFD 1D3CA 1T21A 2JB5H 1BOGB 3WHE0 4JO3H 1T1YB 5DRNA 1FNEA 2R29L 1RZIA 1RIHH 5E2WL 4GFTB 1YY9C 3RBGA 5DJ2B 5JOPD 4R2GD 2R8SH 3CCHA 1XF5B 5C0JA 2B5IC 1R3LA 3D3VE 2IANB 3U30C 5JQ6H 2ITDA 3X13B 5CINH 4GG8A 4POUB 1ZLSH 3L5WA 3QXWA 1B90A 1QRNA 4DFHA 4HFWB 4PJ5A 4XMPL 1PSKH 3EZ8A 3MV8D 3BQUC 5CKAA 1ULVA 2ZG1A 3LOWA 3OKYA 5D1XC 2YMXL 4X8JA 1ZVYA 2VDPL 1CXFA 2XNAA 4PJAB 4P2OC 3OHXA 3V7MA 4ELKB 3DPBA 1OWWA 4ONFL 3QIBD 2X10A 2NY4B 3TNMB 4LSPH 3QCVH 3BDYH 2NR6D 4U7KA 3MNWA 1ZGLP 4KZEL 1JPFB 1CQYA 1WV7T 3DYPA 1AKJA 3U2SA 3RDTD 5GSRA 2X2YA 3NTCL 3TT1H 5D2LB 1DL7L 1DR9A 3OR6A 2EDDA 4MDJB 5CFHA 1FORL 1JRHH 4YDLC 2VKWA 1UWGL 1PLGH 3ARFC 3IDNA 3O3DA 1OVZA 5CCKL 5AYUH 2IFFL 4E5XA 1I7TB 4M61B 3WO4C 2VLJB 1AI1H 3ARWA 3RI5F 1JBJA 3MYJB 3V4UL 3ZE2F 1MAKA 4EN3A 3KPSE 3SO5A 4O2CB 5DK3A 4QRUA 4RMSA 3TA3C 3OL2A 2H9GA 2E6JA 3TFKC 1CICB 1G7MA 1KPUB 1KLGB 3LKNA 3OSKA 3EYFA 5IQ9A 3X14B 1MHPL 1J8HD 4XGZA 2MCPL 5ESAA 2VDRL 4DN4L 2VLRD 4CVXB 3WIHL 4QHNA 4OTXL 4GBXC 1A4JA 4Y16A 4NYLB 5E5RB 2HYMA 4PJCE 1JPSL 1UCBH 4Z7QF 1HI6A 3RVWD 2ZUXA 2WMPA 1VHPA 3SDYL 4ODSL 2XPGB 1OAQL 4D0DA 3RZCC 3X11A 1VERA 2VZSA 3AMKA 4LLDB 5DQJA 5E7FA 1H3XA 3SDDD 5BS0A 4DCQA 4ZO6A 1SJHB 2YC1B 4XPAH 1N3NB 1ODAA 4LF3B 4L3CA 4X6CF 3QDHA 1WBZA 5ETUA 4MS8C 3ALPA 3ARBC 1RMFH 3GDBA 3MODH 5IEKA 2IANE 4DTGL 3W0WD 1MIEL 4D0CB 1QFHA 5T3ZH 4LAQH 4Q6IB 2HTLD 1K2DA 3QH3A 2MQ3A 2I5YL 1B4RA 2ZCKL 5GRZA 4LLAA 3KPLA 2YPVL 3IRPX 3LN5A 3IU3A 2EIDA 5HHMD 4YGAB 1RVFL 3CDCA 1MPAH 4LCWA 1Z6JT 2OMBA 4WWKA 2EC9T 2YPLA 4ODVL 2WIMA 3QWOB 3DROB 1U8QA 2HJKB 1G7PB 2V6HA 3MV7D 1G6RH 1DEEB 3C6LD 2F9BT 2NLJB 4WENB 4OZGB 3SBWC 1N6UA 4PJAE 35C8L 4P2QA 2P48B 3GHBH 3V0AC 4P3CH 3L7EB 3VFWA 4S2SA 3MRHB 4XH2B 3K3QA 3PL6C 2ADIA 2G2RA 4XCFH 1OAKH 3ILPB 5FGBC 1CZ8L 5GS0D 2DYPA 1W72H 3WNNA 2AV1B 5I18H 3HE7D 5JPMA 1G9MH 1N4XL 2R23A 5INCB 2LFGA 5D2LE 4OFPA 1BVKB 3E3QE 5I8EA 4DAGL 1BLNB 5E8DH 3QIUB 4IRZH 4FQ2L 4QGYA 2F54B 1T89C 2W9EL 3A6BH 4RNRA 1N59B 1DQTA 2BSSA 5KS9A 4OLUL 2NXZB 4LSTH 5GSVB 5I1JH 1IC7H 2VLJE 4L9LA 1JK8B 5K9QG 4F57L 3I84A 4S1QH 1EO7A 3VXMB 1XH3A 1T4KA 1JYVA 4PGEA 3O2DH 1E27B 3DMMB 3EFFB 3V5DA 5CP7A 5T3XD 1G7LB 5D7JA 3TBVB 2L4OA 5FM5M 1KEMH 2AEIT 3RL2A 1IFHH 2XZCL 5FKAA 3HNVL 1UZ8B 2IH1A 3K80A 5DVLA 5JHDD 1C5DA 5F6HJ 3NGBC 1IAIL 4NQXA 2AQ3A 5H37H 3WN5A 2XT1B 3AC0A 2E7LA 4S1SH 1FH5H 1HQRB 5JIPA 2DTML 1ORSA 1JWSB 1FL5B 4NWTL 4DEPB 4S0SD 5K9JL 3ULVF 2Y9RT 2Z92B 5E00A 5IK3A 4KUZL 1I1RA 5IQ7H 5HHXH 4CADB 3G08A 4U6YB 2Z8VC 3ZE0F 2CK0L 3FCTB 3EIFA 4U3HA 3O4LB 3VXTA 3F7PC 5LQBL 4JCLA 1OGAA 1KN4H 3LSOA 2DQDH 1AIFA 3ZKMC 2Y4SA 5IF0A 5DFVD 4WUKH 3NCEB 3EDKA 1MAML 2J2ZA 3TCLA 3HI6H 4UQ3B 4JKLA 1OLLA 1XF3B 5IFJA 2R4RL 2WSKA 3MOBH 1QD0A 5EA0H 4C56D 2QADB 1GHFH 4L8SB 1Y18B 5C0RL 2NY0C 1M7DA 3T77A 5JW4R 3RL1B 4ZUSB 1JHKH 1VFMA 2P24B 1Q38A 2ADFL 1HSBB 1RUAL 3QQNA 4OZHB 4GAJL 4Z77B 2CIKA 2ZOKB 3GSRA 4RMTA 4Y1AD 1I1CA 3K1KC 4XXDA 5I30L 3QPQC 1YYMH 3P9WB 3HS0A 1EBAA 4PG2A 4J4PD 1GGCL 1JNJA 4OZGE 2GSIB 4Z7OF 4Y89A 1ZHLB 3JV4B 4NJAL 5TDOA 3R4DA 1OAUL 4XMLL 5BZWB 2IQ9H 5HHOE 2XQBL 3IDXL 4YWGH 1P2CA 1OGTB 3UJIH 4OUUB 1A3RL 3TZVD 1LK2A 2Q3AA 3U82B 3LQAH 3QIBA 3R1GL 5ELIA 1IT9L 3G5VB 5IBLC 2MQ0A 2V9TA 1G6VK 4JFED 4NUJB 4OD2B 4DGVH 3JSSA 2FEDC 5EBMB 3BN9D 2F54E 4F7CA 5TDPB 3W9EA 5AZ2H 1AJ7L 1F90L 3KDMB 5SWSE 2CK2A 1VSCA 5DF0A 2GSGA 1IBGL 1SEBB 3ARZA 4UILH 3CNKA 4XVSL 3T3PE 3AS2A 3VXME 3KWWA 2EEBA 4M7KH 4JY5L 5JHLH 4YXKH 2RCSH 3CMOL 4LNVA 1IEHA 4NQDB 1DBAH 1KSRA 2W60A 3ISWA 3GSVA 5EUOA 3TT3L 2N56A 3MRLB 4XAKD 5IBUB 4Z5RB 2Z35A 4Y19E 1QR1A 3OKNA 1CLZL 3PV6A 2NY7L 2Z31C 2BJMH 5D8JH 1EO8H 1XGRA 2CR6A 3MUGB 4WJ5B 1LD9A 4Y4FB 4L5FL 5I74B 3OKEA 1GAFH 2VLRA 3GJEA 4LQFL 3DX6B 1UB5A 1D5BA 2X5PA 3EYUL 2V2TA 1TJIH 3WFDL 2A1WH 1FIGL 2CDGB 1AE6H 3QSKB 1JF1A 4KDTA 1A7PH 3LEYH 4MLSA 2VRAA 4BZ1H 1Q0YH 3BGAA 4CVZA 1S9WB 1UZ6E 3MXVH 4U1HA 4TNVK 3S37L 5HI3C 1B9ZA 1FNFA 4RFOH 4L4VD 3SDDA 2ENSA 4N8VG 1YY9D 2FJHA 1SHMA 3O0RL 4TRPH 4PLJC 4WCYL 5DGRA 1IARB 2MKLC 2AJZB 2FR4B 3S7GA 3C60B 2DQTH 3UTSE 4M6NH 4JANA 4E42B 3HFMH 3L6FA 2EDEA 4HW6A 3WXWH 4OZHE 1N7MH 4PB9L 1QFWH 1E4KC 3SHSA 3BQUD 4WI8A 5IW1A 2P44B 2OI9B 5I73B 2EIBA 5F9JB 5HGGS 4H5SB 5IUSA 1UM6H 2YN5A 5A40E 5D6DC 1NGZA 1S9XA 1TXKA 4JM2D 3RGVB 4P2OD 3C6LA 4ODWB 1T5WB 1M4KA 4NQCE 3G5ZB 2YRPA 3TPUA 3RVVC 1QSFB 4M1DL 3ULVH 2BOCA 4P9HH 4N5UA 1NDMA 3SGJC 1OT1A 4XNZB 3U36B 1IGJB 4NP4L 4ZFFA 5FYJD 4BK5A 1KYOJ 5FO7A 5D2NA 3H0TB 4Y2OA 1KTLA 4U33A 2DB8A 3HE7A 5TE6H 3G5YA 4Y5VB 4APQC 2I24N 4I18A 2OTUA 1MFAH 4GMSL 4H0IA 4DZ8B 4C4KT 4PRNB 1IAIM 3ARFD 2O5ZL 3L7FA 5AEAA 1G1CA 5D7LB 4PJFF 2R0WL 4LPWA 2CUMA 3TYFA 1UVQB 3JVGA 3K2UH 4WHTA 1BIIB 2R0KL 2Q7YA 3EJYC 4I9WD 3O4OB 3PDOA 3HR6A 4Z0BH 1WSST 4NQDE 2YSSB 3U79A 1K8DA 1RUKL 1U3ZA 1SMAA 2LABA 3MBEB 3TA3D 3TFKD 3G5XA 4NNPH 5HDLA 2O5XL 1JGLL 1U8OA 1PQZB 3PWPA 4HK0A 5FIEA 5I6XB 2MTPA 3KPMA 4IDJL 4IJ3B 2XY2A 3VG9B 5H2BA 3VFPA 2X1QA 4KRPC 5KS9F 4G43B 1L7IH 4TVPH 1Q9OB 1CFTB 4JPVL 2J8OA 1IGMH 3LZFH 1YECH 4W4NA 4RGOL 4M5YL 1U8PB 4CVUA 4F7EB 4OM0L 4I2XA 3UYRL 5EC1A 5D7SL 4MXVF 3V6ZA 3QNXA 4LKXB 5LBSH 3MTRA 1QBMH 1A9EA 1A1OA 5F9OL 3D9AH 3RZCD 2BNRB 3PGCA 1HQ4B 5E6ZA 5C0EA 2JF1A 15C8L 1H0DB 3SKNA 5I17A 2Z9TA 3X3FH 4KK8C 4PJGE 3VGGA 2P8LA 4G7YH 4NFCA 1PY9A 4D0BA 3FONA 3THML 4F58H 5DURD 1RIVL 5IVZB 3TWCL 3OZ9L 4MS8D 4NQED 3ARBD 4E0RB 3PDDA 3NZ8A 5EO9A 1FL6B 2XN9D 1U58A 5FOBA 3UO1L 4PGJA 5BVJB 4LRIC 1NCCH 3U48A 1JGEB 4O4YH 2J5LB 3GJFB 4G8GB 4RWYL 1KJMA 3IS1X 2K7QA 3CFBB 1I7RA 5CEZE 1QHOA 1JV5A 4H8WL 4YHML 1J12A 5KVFH 3MRBB 3KYKH 4NN5B 1WISA 3HB3C 4QXGH 3D0LB 3NPZB 4HIEB 5IV2B 1OHQA 3AU1B 4HMDA 4J4PA 4CNIB 4KHTL 2F58L 1RUQH 4UDUB 5MEPB 1QSFE 3GKZA 2YA1A 4DKEL 3T3MF 3PL6D 5CEYA 3N1PC 1RHHA 4V2CB 3CSPA 1T7VA 2VE6B 3L3JB 2VIRA 1RJLA 4Z7VA 2Z93B 3DXAD 1HKLL 3TZVA 1WWBX 1UJ3A 2HTKD 3OGCA 1A9BB 2W0FA 1EAPB 3KLAA 1QOKA 1NFDE 1QRKA 4JFEA 1JNHA 4PIRF 5C6TH 3SE3A 1CQKA 3CK0L 4JZOB 3PG2A 4LLQA 2YRLA 3UYPA 5KVEH 1ZSDA 3KYMA 5BRZE 3MLRH 5A1AA 2X4OA 4JRXB 4ORGA 2YD5A 3WHXA 1U3YA 1HYRC 4XPFH 3H9HB 1F11A 1BQUA 1L0QA 1MJJB 1N0XH 1SYVA 5BW7C 1KC5H 2X4TA 5A2LH 4JJHA 1HXMB 1U3HC 4MCZB 4ORZC 3QAZB 2OP4H 3WFEL 1I8LC 2GJ6D 1V7MH 2FJGB 4I0PC 1MEXH 4O9HL 5HHQB 5GRVK 1MJUL 3H42H 2VZOA 2C1PB 3T8XB 3MJ7A 1ERNA 1FNLA 5LGJA 4EDXA 3U9PH 1L7TL 2A9MH 4HSQA 4I5BB 3HE6C 4XBGA 4L8CB 5H35B 1P4BH 4U1KA 5FA4B 1BF8A 4HWZB 1CFNA 5FUZH 3U1SL 4QGTA 2CO6B 1FBIH 1MREL 4PV8B 4KVCL 1R3KB 4PJBA 5IFAH 2DQGH 2FSEA 1PYWB 4UDTB 1RJCA 2BNRE 3DUSA 1Q0XH 3RTQC 3ZKMD 4DQOL 4RFEA 2EC9U 3OJDA 1PKOA 3PXHA 1CBVL 3N85H 2PCPB 2ZUTA 1FNAA 2GITA 1Q1JL 2HN7B 1QACA 4LCCC 4QRSB 1EVUA 2L7JA 4YO0B 2V17L 1CFVL 4L4VA 3VFGL 1EZVY 4NC0B 5KSBB 1W0YT 2IGFH 4XC1L 5C0IA 1A7QH 2DKUA 1IC5H 3ZSTA 3GRWH 4NZTH 4M8QB 3VWJC 5EOCL 3ULUL 4G8GE 5D71H 3RWIB 3WFHB 3GMMA 4YDKH 1H15A 4P3DB 4JLRB 5EOQL 2Y06H 4NBZB 5DEZA 4NRXB 3VA6A 1L6XA 3CAFA 4G9FB 2HJLA 1IC1A 2HLFC 5HTSA 1TETL 2P4AB 1J1XL 3S97C 1JMXA 1YEGL 3ARDC 3LPGA 4HIXL 3UPCA 3ZTJG 2XTJB 4XWGH 4AENA 2OTPA 1U8KB 3B5GA 2AJ3A 2BRRL 3S4SA 2AVGA 4JM2A 3IYLW 3WHE1 4YHNA 4P2OA 3BZEB 3IF1B 1MCRA 3IDIB 3KR3L 5HI5D 5E8EB 1OP3H 4PJDE 1T20A 3H7BB 2UWEE 3CFCH 1NFIA 1QVOA 4MLIA 3GSNL 4P46C 1BWMA 4HQQL 5DC0A 5F7WC 2VL5A 4LLYA 1CFQA 3HA0A 1AD9A 3GKWL 3PWLB 2FEDD 4FQHA 3AXLB 3I6GB 2O5YH 1QHPA 4L3AA 1UJTA 4P5KA 2XWTA 3D25A 2VABB 1O7VA 3WNKA 1MI5E 5E70A 4JFFA 4F15C 3K8LA 4IDLA 3QO0B 4NJ9H 1GIGL 4KJYB 1IE5A 1XGPB 1XGTA 1JFQL 5EZOH 4DVBB 1K4DB 3NIDF 5KG9A 4XP1H 3WNLA 4XPHL 3WL9A 1JTPA 1YEDA 1CG9A 3V6FA 4LSRL 3IT8D 3UPAA 3EJZC 4UB0L 4EUPG 3TA3A 1CFSA 3VJ6A 5DMGC 1G7JB 2Z31D 1VB9A 5B39G 3C09C 4NKMB 5F7YC 3HG1B 4ACPA 1BVZA 3NFSH 5I1GH 1F6AB 5F9WC 4FTVB 4NZRH 1HSAA 2OL3H 2QR0A 4LVOB 3FOMB 4HLZH 4GMTL 1Z9SA 5EORH 5ALCL 2G75B 2Y23A 1FFNB 2BY1A 3U4EB 4ONGH 5HYJE 4IRJA 3CXDH 3CFDB 3DVGB 4ZXBB 2DJUA 4XCYB 5IJVA 3N1MC 1JGVL 2BSTB 3LKRA 2DQUL 4W70A 4M8VA 3UX9B 5HI3D 5I75B 1YUHA 3M17B 1H3PL 4C57C 2EXWD 3QEQE 2IALB 5ICXA 4PLJD 2X1PA 1NBZB 5KSBE 4EJ1C 1WBXB 4F33B 5TGBB 5DJYA 4NRZB 2KL6A 5D7IB 1QO3A 5CZVH 3WKML 4XNQB 3T2NL 1V3MA 2XN9A 4RRPG 3VFOA 4JFPA 2WLZA 4U0QB 2B0SH 4FQ1H 1GJIA 5J57B 1VGKB 4KPHH 3EYOA 1FV1B 2XICA 1UM4H 4U1LA 4HUWA 5DJAA 3VD5A 2APFA 5JW3H 2VL4A 2X4QA 3WLBA 1PEWA 2HG5A 4XXCC 4PP1C 3VXSB 3ZT6A 2XTJE 5AD0B 2FEEI 1NGPH 1NCBH 4WDIB 5I76B 3L3IB 3RVVD 3CC5B 3MLTA 1I7UA 5TPWH 4Y19D 3TIEB 5F1OB 3OPZL 1DUZB 1G1YA 4X98B 3PL6A 4TSCH 1LO3L 5FGBA 2VB5A 4MVBC 4X99A 2CXKA 1GOGA 1YPZA 5FYKU 4OUOA 3G6AB 3DXAA 2B1HH 3PF2A 3PNWA 2FO4A 2ZOLB 3OKLB 4HXBH 4APQD 2BERA 3GI8L 4GKZB 4FP8L 3CPLA 4R3SB 2ENYA 1XF4B 1P4LB 4OB5H 4QRQB 1TDQA 2A74A 2B39A 2D31A 2JTDA 4EZMA 1IEAB 3DIFA 3EJYD 1X5KA 2EO9A 5AWNL 2YUZA 5EU5B 1KNOA 4PGCA 4PP2B 2R1XB 3VMPA 3CFJA 3DSFH 4MMZC 3WD5H 1KACB 1IM3B 4RSVA 5JZ7C 4M1CC 4OF3A 1BZQK 4MDIB 2DQEH 2VISA 1A3LH 1FN4B 4JG0H 4CGTA 3I3EA 3P77A 2PUQT 1LE9B 1FYTD 2C3VB 2H8PB 1H5BA 4KRPD 2GJ6A 4R7DA 4MA8L 3RIAK 3SGEH 5DLMH 3WFCH 1AQDB 1LP9F 3SDCD 1P4IL 4GUPB 1DVFB 4JM4L 1NMAH 4M9OA 3RA7L 3WSQH 4Z78B 3OBAA 3QDMD 2KZWA 2FWOA 1U41A 3RP1A 3RWFB 2ORBL 1WJ3A 2E8ZA 4LARL 2YWZA 1FPTH 1QFPA 4F9LA 1MRCL 4IBLT 5MENB 1QPPA 5EU6D 5C3TA 1RZ7H 2BVQA 2XYCA 5DZOA 4YXLH 2YS4A 3ARVA 3QNYA 5FM4A 4NQCD 4F2MB 1PX3A 2CKBH 3MROA 5J7CC 1RZKH 3MRGB 3OAYK 1I85C 3MLXH 3U46A 4ELMB 1N8ZB 3IKKA 5FUOL 4AIZB 3CZFA 5CWSB 5J6GA 3DARA 4OBRA 4LRNH 2B4CH 3OR7B 5E6IA 1NLBH 1MWAH 5CBEA 3LDBC 2IAMC 4PJBF 3MCKB 3VH8A 1XAUA 1XR9B 5D7IE 3VFSA 2AJSH 4KQ3L 3QFJB 1L4IA 5GS0H 3BI9X 3EOBB 5EIIB 4HKJA 4TQEH 2IQAA 4NSKB 4AL8L 2A77L 5KSVA 5T5FH 1K6QH 3TJEH 2PTUA 5HGBA 1T7ZA 4EOWL 1M05B 1OB1A 4K23L 3VXNB 3HPJB 3T0EE 3VXSE 5DI8A 4TOYL 4HWBA 4ZUWB 5I1KH 3RX7A 1A0QL 3ZHLA 1KN2L 2AAVA 1WBYB 1EMTH 1NCDH 5DHYA 2HAZA 4YR6A 4EI6B 1A7NH 3B9AA 1D6VL 4OGZA 4PGDA 3S9DB 3MOQA 4PJ7A 5HHVH 1TVBB 1Z0MA 4ZDHB 2W9DH 5T33L 5T3XH 4LEOB 4FFYH 5CD5C 4AG4H 3B9KC 1U8MA 2J8UE 1UWEL 1NGQL 4KHXL 1RUPL 4YHPB 3IGAB 4JO2L 1CE1H 3ULUC 4OBSA 4P57A 5F6IB 1XCTB 5IVXF 1OAZH 4JM2F 5HYIA 5IVNA 4LU5H 2J8HA 4U1SA 5CHNB 2YKLL 5E2VH 5IEHA 3BSZL 3MRMB 1U2HA 4YFEA 4JKPH 4O2EA 3MFFB 5HHNA 1F58L 2ESVB 5DHVA 4ALAH 1ZLVH 2VZVA 2VJXA 5B3JE 5JOFA 2IBZX 1C12B 3FQXB 1AO7B 3LHPL 1U3HD 3KYNA 3CVHH 5KAQF 1I1AB 1LEKA 2JELH 4MNHA 4I0PD 1UWXH 3MMEA 2V2WB 5ANME 1Y6MR 1YNKL 2H6PB 4LLUA 1I9JL 1BZ9A 3UTQB 4NQSB 4HIHA 5HD8C 3KPPB 5T5NF 3S8WA 1N5AA 4OKVB 4ZQKB 4YXHL 5FHAL 1IGYB 3HE6D 2YZ8A 4YHIA 4LPXA 3NFNA 2AK4B 5JIHA 4F37F 3ET9F 4NCC2 3TNNB 4DGYL 2E27L 4NZUL 2QHRH 1NGYB 1T7YA 3BRGC 3T09A 1VKXB 1MCQA 2DQJL 1J0KA 1CIDA 3RTQD 1ZVSB 4X7CC 4NZJA 1HHKB 3ZKSD 4FABL 1GPOH 2VSDA 3V5HA 1QLEL 3ROLB 4HHAA 4HBQA 1CDBA 4HWEH 5HHOA 3Q3GB 4ODXB 3E0GA 3L3GA 1HOCB 2DL2A 1YMHB 4HWUA 1MCNA 1RV6X 5DJ8A 5EDXA 4OF0A 2A0LC 2WZPD 4PJIF 2JJTC 3FOLA 3C2SA 3QFJE 3H3PH 3VWJD 4CAGA 5D6CA 1K8IB 4XB8A 2FZ3B 3NH7H 3WIHA 1X5XA 5SWSA 3MOAH 3HAEB 4UAOC 2HLFD 1NGWB 3SDAB 1T5XA 2P5WE 4JFQA 1WCBB 3ARDD 3O6MH 5I15H 4HPYH 3FQTB 3FQWA 4NQVA 4N9GA 1SJEA 3TBSB 1KCVL 3W5NA 3C2AL 3RX8A 4N1HB 2NY5C 4QRRE 1QFUL 3HUJA 1E4XL 3KPRB 4J1UB 1X6NA 3MCG1 3QRFM 4NC2B 1KB9K 5F6HI 4FXGA 3KXFB 4EI5C 4HG4K 3SGJA 3FT3B 4P46D 1TLKA 4Y19A 2C3XA 4ZAKB 5EIVA 4CMHC 3ETBF 2FIRT 3RJDA 4GOSA 1INQA 4HGWB 4PRDA 4I3RH 1FO0B 1IKNA 1HIML 2BNUB 3BPLC 1GZQB 4UU9A 2DQHL 2NYYC 2Z0BA 1QKZH 2UV3A 4XBEL 3F7YB 4KTDL 2I07B 4GKNB 5KVDL 1NCUA 1PG7H 2APVA 2QKIB 4F3FB 4X7TA 5DJZA 3BYTA 2ESVE 5HDOA 3LCYA 5SX5K 3S88H 3QDJB 4WW2A 2P8MB 4UZGA 2DLFH 4P4KC 1YPZF 1AR1D 3UTPE 4BSWA 5I1LB 3FN0L 5C9KA 4HJJH 4YHKL 1RJZB 1AY1H 3EJZD 3L5XL 5FO8A 4G6MH 1FDLL 3FAWA 3HZKA 3QXAB 3UJTH 1KGCD 4MSWB 1S9YA 3VXUB 4YK4C 5FYKL 3NN8B 1J8KA 1FYTA 3UTSA 4J2XA 2HVKB 3ELAT 3SDCA 1U93B 3QUYC 5IIEB 1DUYB 1EJOL 2GHWB 5FV2A 4EVNA 2HT2C 5CUSH 1KJ2B 2XRAH 2AK4E 2IC2A 1U6AH 3C08L 1LE5A 2X70B 3QDMA 2R9HC 1X7QA 4LIQH 1XIWB 2JB5L 1FLTX 4JO3L 3QP3A 4G3YH 3MLPA 1TCRA 3AM8C 5EU6A 2FBJL 2R8SL 1UXWB 4NQCA 3X3GH 4X83A 4NKOA 3TBWA 5JQ6L 3EDDA 1OLZA 3P4OB 1ZLSL 2A83B 3MCLH 4LAJH 4D8PB 5I16B 2YWYA 5C92A 4FZ8L 1PSKL 2GJZA 3TPKA 3F5WB 4MYWB 2YXFA 1FVEB 2X4SA 3OXRB 4P48A 2YUWA 5TDNA 1I9EA 4JFYA 1CXIA 5C8JA 5BXFA 3JWOC 1XGUB 5J1AA 1MI5D 2EECA 3E8UH 1S7XA 3EOYG 4CU6A 3HC4H 1I1YA 5DD1H 5JMRA 5F3BA 2EDXA 1KB9J 1HHGA 4QKXB 5D1QC 3UMTA 4N0FA 2IH3B 3MRNB 3GMQA 2CR3A 1WITA 4LSPL 4MA7H 3QXTA 1QLFA 3QCVL 3VGFA 3BDYL 1RHFA 3LIZL 3RAJL 2APXA 1IILE 3T4AA 3TT1L 4XX1E 4ZUVA 4UIKH 3ALWA 3G6JB 4KWUA 5A43C 4BKLA 1JCKA 3WS6A 4WEBH 1JRHL 4NDMA 4MVBD 2Q86B 5EU3A 5FCUL 3DUUB 2YD8A 1PLGL 1MFBL 4JY6A 5AYUL 3GB7B 3QQ9C 1VFBB 3P9LB 4JR9H 1AI1L 4J3OC 3T2QA 4TUKL 2DRUA 2Q8AH 3QPXH 3WDHA 4LVHB 1E28B 5FM8A 1C5BH 5GGUA 4PJ7F 1X5LA 1UB6A 5HYJD 3L3OB 3RU8H 1FVCA 2O93L 2DLIA 2ZKHH 1QNZH 3QDJE 4OFIA 4X9HA 3PGDB 3RWEB 1ACZA 4PJGA 4M93B 2AXGA 4U1IA 3C5ZB 4MJ6B 3P30L 3L3DA 4J6RH 1U3HA 4Y5XB 4GG6B 4KI1A 1HXYB 1T1WB 4BSVB 4ERSH 5IB4B 1BHGA 3QZWB 4I0PA 5FK9B 3GMOA 4PJ9A 5C0BE 4U6XA 4QYOB 4BH8B 1UCBL 5TFSH 3SO3B 1FE8H 1I8MB 2WBJA 4ZTPL 4TNVF 1M7IB 1P9MC 5C86A 3PHQA 3HE6A 4NN6B 4N0CC 1OTSD 5DK0A 3DTXA 1NBVH 2NY4C 2HRPL 5CSZB 4HKZB 4L29A 4HH8A 1MFNA 1WEJH 1JWUB 4XPAL 1F13A 4RBPK 3FFCB 1ED3B 4RGNE 5ICYA 5ENWA 1BQHB 1F45A 3MODL 4G9DA 5DYOA 2AJYH 2MWCA 1MCLA 4MJ5B 2SEBB 5T3ZL 1JZ5A 5C0DA 1QQDA 4O58H 1DFBH 3MO1A 3WJLC 4OLWL 5CGTA 1A21A 3MA7A 1K3ZA 1MPAL 3QR2A 1HH6B 1X5IA 1NFDA 2WWMC 5DQ9B 3X12B 3GGWA 3K8MA 1G6RL 3K8KA 1KXTB 3KPQB 2ZZUT 5BRZA 1DBMH 5L2KD 1MUJB 4TVSa 4XI5C 4GAYB 1C8PA 2VAAA 1OAKL 1YNTA 2BMKA 3ARDA 4K7PY 3UBXA 3BP4B 5DMJB 1KB5H 3O9WB 2AEPH 1CGTA 1W72L 5EZIH 4GLRI 5I18L 1W0VA 1UQSB 1VGEH 3RFZC 1T0NB 2PO6B 3SKUD 4L9DA 5CD5D 5DUBB 3VXRE 1XZ0A 3EHBC 2HJFB 3B9KD 5IWLC 5CIPB 3A6BL 5A16B 3RIFK 4AEHH 3PWJB 4P2CG 5FYKE 4LSTL 1T3FB 1IC7L 3ULUD 4KV5F 4LK4A 5DWUH 3I02A 3RWDA 3EDJA 4G8IB 3HUJF 1R24A 2PKDA 4YNYB 1G7IA 5C6WH 4O5LL 3DVNA 3W9DA 1G7HB 1FZMA 1HILA 3V7AE 4PJHE 3WIIH 3IDMB 4XP4H 1KEML 4P4RB 1IFHL 5BOZG 2A6KB 1RZGA 2FGWH 1NUFA 2DICA 3TV3H 3ARGB 3ZTNH 5C9JA 4TSBL 1WC7A 2F5BL 2DMBA 2ZSWA 3OJMB 1FH5L 4KQ4H 5TE4L 3OWEA 3U0TB 4GG6E 1ZANH 3TIDB 2OLDA 3BO8B 4YIQA 5BQ7B 4WUUD 4GRLB 5HD8D 2A73B 4ONHB 1RFDH 2FLRT 5GGVY 1Q72H 5HHXL 1NAML 4ZNCD 5F1NA 1UH3A 2Z91A 1E4WH 3SE8H 1YEJH 3U7YH 1KN4L 2DQDL 2OYPA 4R7NB 3T0ED 4WUKL 1T6VN 1XGQA 2EEDA 3HI6L 2QEJA 5EFIB 3QIUC 3OKKB 3C8HA 5GHWH 4RAVB 1GHFL 4Z7WB 3SCMB 3QQ4B 5JMOC 4H1LA 4NM8H 5I1DA 2P8PA 4PJDA 4WGVB 5HI4C 3UPRA 2UWEA 2NXZC 4OZIA 3PUCA 4MB5A 3CUPB 2R29H 3N1QC 3QUMH 5ID1B 4ODUA 3ARXA 1A6AA 5DQDH 2VLKD 3UZEA 3DMMC 5DSCB 2VLLA 4M62H 4RMVA 1S9VA 5EUKA 2DM2A 5IBUG 4XBPB 5HXMA 2P47B 2OR9H 4GLRH 1MI5A 3PWNB 5TH2A 1SEQH 3IJHA 3X17A 3BP7B 1N6QL 2LU4A 3S5LB 2A6IB 3GSWA 4YWGL 4GW5B 1EEUA 3V2AR 4ISVB 3S6CA 3UJIL 2NW2A 4KDWA 4UTBL 1F4YH 3MRFB 4LDOB 4G80B 4QXTA 1IL1A 4DEPC 1PD6A 4U7MA 4ZUUB 5KN5B 4LNRA 1YN6B 2X9XA 4EI5D 1U95B 4FA8A 5I2IA 5AZ2L 4GJTB 4ONFH 1A1NA 3CSYB 1BX2A 2GEEA 2NYYD 3D69A 1DEDA 3SE4C 1BZ7B 1UGNA 4PV9B 1J1PH 2BVPB 4P23B 2RCSL 2VOTA 1KIPA 2YD3A 2X40A 1JYNA 4ZUTA 1CDUA 1U91B 1YMMB 2QTEA 3K0WA 5CZXC 1FORH 3DVFA 5HYJA 1FC2D 4YGVA 3DGGB 2DLEA 2Y36L 4P4KD 3GUTB 4X5XA 2V7NB 1H9VA 1P7QD 4AEIL 1PG7X 2BJML 4R90H 1S5HB 1K5NA 4AT6A 3QEQA 1EO8L 3V4UH 3MLWH 3PV7A 4DKDC 1SY6H 5HPMB 1YY8B 1LO2H 2WANA 3UTTE 2NX5D 3MV9E 1V7NH 5EPMB 2IPKA 3AFLA 5DRZB 1MCOL 4QRTA 3QUYD 1TJIL 2EC8A 2A1WL 3DX7A 1AE6L 2LVEA 1CDCA 2HT2D 4MQSB 4OZFB 3LEYL 4PJGF 4BZ1L 1A6TB 1Q0YL 2VN4A 2MCPH 4PR5B 2VDRH 4FS0A 4ZNEE 4DN4H 1U8LA 3B9DA 4WTZA 4HKXB 3MXVL 1AXSB 4XP9H 2P45B 2VITB 1ZHBB 6CGTA 4RFOL 4OTXH 3EDFA 1FAIL 4OFKA 3SQOH 1FQ9C 4TRPL 3NIFF 4FFZH 1IAII 2YEZA 2OTWB 3C8DA 3QNZB 1OP5K 4Z7WE 1BD2E 2DQTL 4YPGB 4M6NL 4PRBA 3HFML 1I85A 3AY4A 2LTQB 5E8PB 2VR4A 5EH1A 1YQ2A 4Y4HB 1DQJA 4NHUB 1QFWL 2DQFB 4PREA 4I3SH 4NKQB 4G6FD 1EEZA 3KLSA 2ZJSL 3DV6B 4PGZA 3RKDC 4AQ1B 4LLVA 1FIEA 4ZYKA 2MFNA 3VGBA 3E6FB 3SGKC 3VD9A 1ZT4A 5D1QD 1C7SA 4UTAH 1OQXA 4P9HL 5HY9A 5E1HB 3OAZH 3VMNA 3IDGB 1RVFH 4QXUH 3LN4A 1ZA6B 3N0PB 3C8KB 3AMLA 4ODVH 3MRCB 4Y4FC 5I74C 1MJ7L 5F7DB 1HHJB 1X5HA 5TE6L 3C6SA 4MAYD 3HC0B 2WINA 4TULL 4FQCL 3T08A 1MFAL 5DMKA 5DJDB 3MV01 4LSVL 2E9WA 3STLB 2CRZA 3QQ9D 1AGDA 1EVTC 2WIIB 4F7PA 1L0YA 2BVTA 4PLOB 3QO1A 1N4XH 4GAFB 4N9OB 4NBXB 1LNUA 4Z0BL 2VQTA 1XCQA 4B53A 1YMME 4YBQC 2WUCH 1F2QA 5FUCE 5CS7A 1IM9B 4CVWA 2Y72A 5F3HA 2VXTH 5HYEA 4NNPL 3C60C 3TYGL 5JPNA 3TO2A 3Q6GH 2DBJA 4X6BB 5C0CB 2N7BA 2HT4C 3PP3H 1CD8A 4X7EC 1D9KB 3DRQA 1L7IL 4MNGB 1BVLA 1IGML 4PJEF 5JXAH 3LZFL 4C58B 4FQXB 3FFDB 1ZTXH 2H32A 1PKQA 3ZE2E 5I73C 5KSAA 3RWGA 2PXYA 2WAHA 4BZ2H 4PTUA 4HMEA 2FHBA 2ICWJ 3HNVH 3GSNA 5F7EH 3RGVC 1KT2A 3PGFL 4N0UE 4OCYH 3D9AL 5AG8A 5EO0B 4QOKB 3S3SA 4N0CD 4XCNB 1WFUA 2NY4D 3GSXA 3X3FL 2DTMH 2HLAA 4XNZC 1PBYA 4MX7B 1S7QB 5BOPA 3O45A 4G7YL 1T2XA 3MGOB 1F6FB 2JIXA 3T0EA 2YBRB 3FTGA 5DD0L 3DO7B 4P99A 5DJCA 4IRSB 4Y5VC 4Y2DA 5D9SB 3BESR 5EU7E 1ZGLM 25C8H 3W2DL 2CK0H 5TE7L 4YHYB 4Z7QE 3NCCB 2CDEB 1BGXH 1NCCL 1J88A 3REWB 4JFDB 1PGRB 5DTFB 4YJZL 2J8UA 1X5GA 4KK5C 3I3DA 3O4OC 4G8FA 3UBXI 1RULH 4P2RB 2WWMD 2XWJA 5KVFL 2D7PA 2VWEE 3RWJB 3KYKL 4QXGL 4X6CE 2VLKA 3MBEC 4D9RD 1J05A 1XF2A 5I8CB 2I9TA 1KXVC 1TZHA 2ADFH 5I6XC 1RUQL 2PYFA 3FO9A 5LAXB 4XI5D 1OSZA 3VG9C 4LHUA 5T1LD 4OZIF 3WCYA 4XP6H 1K4CB 5I30H 1Q9KA 5E9DB 1RAMA 1T21B 4UBDC 5DRNB 1FNEB 5FECA 1RZIB 1GGCH 4GAGH 2Y07H 3VFMA 3IVKA 2R2BA 2A38A 3EHBD 3MRKA 5ANMA 3CCHB 3VG0L 2QHLA 5C0JB 5C6TL 1R3LB 3MJ6A 4XMLH 1C1EH 1S5IH 2C3HA 3IDXH 2GTZA 3OAUH 1GC1L 2ITDB 5KVEL 4GG8B 2VO5A 2VXVH 3IAGC 3BVNA 3L5WB 4K7FA 1QRNB 4PJ5B 3KHOA 4MHHG 1KF9B 4GRWB 4XPFL 1CGWA 1N0XL 2F8OA 5JLZA 4X6EA 2BY3A 3ARUA 4ZS7H 4YHLH 1KC5L 2IG2L 3VCLA 4MXWL 3V5KA 5E2UL 1ACYH 1F02I 2OP4L 3K2MC 2CRMA 1F90H 4PRIB 4X8JB 2ATKA 1V7ML 1MEXL 2XNAB 2NNAA 3QEGH 3V6OE 4UNVA 4F7TA 3KJ4B 3H42L 3OHXB 1NUDA 2DOCA 4P4KA 4MNGE 4XVSH 3DO3A 1TTGA 1P7QA 4JY5H 1KELH 3U9PL 2A9ML 2EICA 3CMOH 5C08E 3MNWB 3WFBH 5IMLA 4CU7A 1P4BL 3U2SB 1AKJB 5GSRB 1Z2KA 5T1KD 5FUZL 4NN5C 2R2HA 3OR6B 1FBIL 3VI3F 2NX5A 1UA6L 5IFAL 3RVTD 5K9KA 2DQGL 3SGDI 2LU7A 3QUYA 1Q0XL 1NUNB 3PQYE 3IDNB 4KY1H 3O3DB 1QFWM 4JQVA 4E5XB 2P5WA 1TITA 1FLRH 4LQFH 4EN3B 3OB8A 3ULVE 3AM8A 4QRUB 2IGFL 1FIGH 4F9PC 2HFFA 1A7QL 3ECBA 2H9GB 4M5ZH 4X80H 1IJ9A 3GRWL 3G04B 1G7MB 3VXRD 3LKNB 3ZE0E 4I8DA 4JFDE 5HI4D 1AD0A 3GJFK 4JREB 5L8LB 3EYFB 5IQ9B 4YDKL 1I3GH 4ZSOE 5C0NC 1NANI 5ESAB 2G5BA 5FYKD 1A6ZA 4O51A 4M4RA 2QLVB 4P2RE 2X4UA 4QHNB 4RFNC 1UH2A 4K07A 4OD3H 1A4JB 4WI3A 4Y16B 3I6KA 1ZLUH 3UTZA 1HI6B 4U49A 5CZKA 2NZ9C 4FQQA 4YFLF 4D0DB 5J13B 4GW4A 2NTFA 1QBLH 3EW3B 1WFNA 3T1FA 5DQJB 4ZFGL 3CFCL 4OCSL 5BS0B 4DCQB 4K8RH 2DWDA 2DLGA 2VNCA 4L3CB 3CX5K 2R0LH 4TVPE 2O5YL 5F7MC 1WBZB 5ETUB 3DVIA 4KJQC 5IEKB 1NGXA 4Z7OE 4MAYA 4QF1A 1BPVA 1XR8A 5D5MA 2HH0L 3S3JA 3U7AA 1K2DB 3QH3B 4NP4H 4KUCD 1QRNE 5BV7H 3KPLB 5EZOL 3LN5B 3IU3B 3PHOA 3IDJA 1DSFH 4KROB 1ROWA 4LCWB 1EHAA 4WWKB 2YPLB 5CZXD 1U8QB 3D18A 3B43A 2FB4H 5EO1A 3TH4T 2O5ZH 1XF5A 3FRPG 2AABL 4MXQC 1YN7A 3BKCH 1KIQA 4P2QB 3HI1A 3VFWB 1KTDA 4S2SB 2C26A 3IS0X 4LSSH 5FYLL 2ADIB 2G2RB 4NKDA 4Z7NF 5IHZA 1MCCA 3NFSL 5I1GL 4I48A 3ULUF 2DYPB 1CI5A 1ZEAL 4NZRL 5JPMB 2R23B 3D1MC 4KAQH 2OL3L 5I8EB 1MCBA 2O5XH 1JGLH 2XTJC 4Z8FH 2H41A 1K3IA 5F8RC 5JNYB 3SDXF 3ARPA 4ONGL 2VDOL 4WHCA 4RNRB 1IKFH 2BSSB 1EUTA 2UYLA 5FKPA 5KS9B 2FX9H 4M5YH 4YFLI 3S98A 1B88A 3JV5A 4L9LB 3TEUA 3TNMA 3WUZA 2I25N 1XH3B 1T4KB 4HEPG 4PGEB 4WI2A 1CYGA 2G5RA 3V5DB 5CP7B 5CJXA 4YFDB 1EIBA 1OL0A 5D7JB 3EO1A 4XNUH 1NQBA 4U05A 4U31A 4EIZC 3RL2B 5FKAB 5CZVL 3B2UD 3ZTJH 4HGMA 4PJ8D 2IH1B 1C5DB 2FX8L 1KBGL 2B0SL 4FQ1L 4KPHL 3PP4H 4WI7A 1UM4L 4NQXB 4NFDA 3WN5B 2AEWA 2CQVA 1ORSB 1PEZA 5JW3L 2L7UA 3RKDD 3STBA 3W11C 1SYSA 1FC1A 1AGEA 4YC2B 3DSNA 5E00B 5IK3B 3UO1H 4AM0A 2D4FA 2D0HA 1NGPL 1NCBL 3G08B 4LHJB 3CX5J 4IIQC 5IT2H 43CAA 2BVOB 3VXTB 5TPWL 4HDIA 1OGAB 3LSOB 2F15A 1AIFB 5FEBA 5IF0B 1BOYA 1F5WA 4TSCL 4Y4FD 5BZDA 5T1LA 3DYOA 4C59B 1GRWA 3BEVA 4RX4D 3OAYH 1TMCB 2RJMA 4F80A 4JY4A 3TCLB 5DEFA 5T3ZD 2B1HL 5IFJB 4LVOC 3TCXA 3IFPA 8CGTA 4KHTH 5DK2A 3FMGH 5C0BA 4R2GB 1M7DB 3T77B 2EH8H 3PWVA 3FQUA 4ZXBC 2KH2B 2EDBA 4EUPH 1BAFH 1G9NC 5I75C 2CIKB 3GSRB 3FT2A 4UOW1 4XXDB 4LCWE 5SWZD 3DSFL 4RZCA 3WD5L 3WDJA 3HS0B 3C60D 5E4IA 3BIKA 3GM0A 2DQEL 3V0VA 4DUVA 1A3LL 1N64H 3BKJL 4JG0L 2J4WH 3LN9A 5TDOB 3BD3A 1R5VA 4OI8A 2ZPKL 2HT4D 2XZAL 1RZJL 3ZT7A 1KOAA 5DLML 3VFNA 4PJFE 1E6OH 1P2CB 4DKFH 5E24E 1WLHA 1NMAL 1LK2B 5C07E 1HH9A 3QIBB 3QWRA 2UY6A 5D1ZA 2EDHA 3D0VA 2ED9A 1FPTL 3RGVD 5T1KA 1F4AA 1GC1C 2RHEA 3BISA 2NLJA 4L8DA 4F7CB 1MJUH 1RZ7L 3W9EB 4YXLL 1P69B 4BFGA 4DJMA 2ZUQB 5KS9E 5CJ5A 1L7TH 3KGRA 2CKBL 5GRXG 3GSOA 2GSGB 1RZKL 2P42B 3MRIA 4ZO8A 1CVRA 2PYED 1E0OB 3KWWB 2AV7A 4L4TE 3HNSH 4LRNL 1J0JA 2B4CL 4HH9A 3GIVA 4MXVE 2W60B 4M9PA 1T2JA 5EUOB 2CH8A 2AJSL 5D7LD 4G8EA 5ISZE 5GS0L 2R15A 2Z35B 1QR1B 1CBVH 4NIKB 3VXRA 3OKNB 4TQEL 4HV8A 1Q1JH 3PV6B 3KJ6H 1WUNT 4YAQA 1K6QL 2XG5A 3O41A 4KK5D 3TJEL 3QHFL 1XGRB 4OLYH 1LD9B 1CFVH 5ITBH 3BEWA 4JB9H 3OKEB 1U92A 2VLRB 3GJEB 1EUUA 3MBED 4M7LT 2H1PH 4TTDC 1A7BA 2XZZA 2BC4A 1UB5B