1RIVH

Anti-cocaine antibody m82g2 complexed with meta-oxybenzoylecgonine
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
223
structure length
220
Chain Sequence
EVTLQESGGGLVQPGGSMKLSCAASGFTFSDAWVDWVRQSPGKGLEWVAEIRNKANNHATKYTESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCTSVPQLGRGFAYWGQGTLVTVSAASTTPPSVYPLAPGSGGAGSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTQVDKKIVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab M82G2, Light Chain
publication title Carving a Binding Site: Structural Study of an Anti-Cocaine Antibody in Complex with Three Cocaine Analogs
rcsb
total genus 43
structure length 220
sequence length 223
ec nomenclature
pdb deposition date 2003-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rivH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rivH02
5IFHL 4XWGL 2DLHA 4LLQA 3FQRA 1JF6A 2J8UF 1LMKA 4XTRC 1BOYA 3RVXD 5T3XE 2AJXH 4WVRA 1IEAB 3GHBH 3SDXF 4AJ0A 4NUGL 3ARGA 1X5YA 4NHCH 5ESAB 3UJIH 5EBMA 3ARFB 4FQXB 3RHWK 1DJSA 1MFDH 1MUJB 4LRIC 4GW1B 4YHOH 4ZOBA 5I1IH 4R7DA 2NXYD 3SE4C 2R8SH 5IT2H 1OGAE 5E8DL 5E08H 4P5TC 3HNTL 1RJYA 4LPCA 4Q6IC 3VGGA 4GAGL 3R8QA 1V05A 1HHIB 3U0WL 3WUZA 3ARXA 4HG4J 4PB9L 5ID1B 2F53B 3SCMA 3DX8A 5EZLB 4OGZA 4TTDC 4JKMA 1J1OH 5GS1B 3Q5YA 1UYWH 2XTJE 3SDAC 1RUPL 1F3DH 5DJXA 3HE6C 4L29A 4L9DA 3L5WA 2NQCA 2VTFA 2ZSWA 4JY4B 3SDCC 2BSTB 1JZ7A 1FRGL 5CWSA 2OMBA 2VO5A 3J7HA 3Q6FA 4Z7UB 3ZLQC 2X4PB 5HGAB 5IVXE 1FNAA 1RV6X 2YUWA 5LVEA 3UTTB 4N5ED 5E6IC 3RX8A 3QDGE 1K6QL 3BH9B 3WIIL 3PNWB 3DOSA 1AGDA 4ZG1A 2A73A 2MQ0A 1JMZA 4QT5A 2CIKA 3U4AA 4LSSH 1EO8L 1YDPA 4X99B 3G5YA 1WZLA 2X4QB 5HHVL 5L7XH 3GSXB 5HGGS 2EEAA 1JZ2A 5F9JA 1JWUB 4FHBD 4LLYA 3T65B 1JNJA 3GJEB 2GSGA 1CDGA 2DTSA 3GMQA 3HG1E 4PBVC 1E4XI 2KPNA 5EORL 3DX7B 5K9JH 3B2VH 1RZIB 1IGJB 4KY1L 3BRDA 2VH5H 1AJ7L 2PR4H 5IB5B 1KENL 4XNUH 2D2OA 2IQAB 1EVTC 4XHJD 1R3LB 2CK0L 4LDEB 4L3CA 3I9GH 2BNQE 4XC3H 2PTUA 1I3VA 2C1OA 5HHOD 4OCRH 3I6GA 1JGVH 2FJGB 4U3HA 2Q76B 5SWSD 3DURA 3EYQC 4EZMA 2Y36H 2MHAB 4Z7WF 4IMLB 3BHBA 4IOSD 4ZO6A 1OCWH 1G7LA 2XWBB 3PDOA 4L1HA 4FXGA 1AXTH 4RGNE 5EO9B 3F7VB 5I73B 2EDKA 1KXTB 2WM0A 4CW1A 2CDFA 4PJBB 2DQUL 5JHDD 4U0RB 4H5SB 5A2IH 1RZ7H 3LKRA 3VG9B 5IWLA 2CRMA 4M1DL 5DJ6B 2FIKB 5FYJL 3BKYH 4G6JH 1HCFX 5KG9A 3CVIL 4R90L 3O9WD 1CICC 1F02I 2HA1A 1FPTH 1Z3GL 3K4ZA 1GGBH 3LQZB 3W9EB 2AJUH 2DI9A 2BVQB 1S8DB 3GKWL 3UAJC 4GKZB 4ZAKA 2IAMD 4K8RD 5FF6A 4GRMB 1CXLA 1UM5L 5DHVB 5DJYA 3ULUL 5FCUH 3O3BB 1J0KA 3RTQD 5BV7L 2NXYB 3FB5A 3AXLA 3DUHA 4F7MA 1U8MA 4N8CL 4XCFL 3F5WB 3EOTL 1MFCH 4XP9L 3P9WB 5ITBL 1I1CA 5IEKB 1YEJH 3LH2H 1FVDB 2WMPA 3CLFH 5IV2B 4JHAL 2P5EA 4UOJA 1MIEH 4OGYH 5B38A 1EJ6A 1YNLH 4KRPD 4H8WL 5IMMA 1F3DJ 5DFTA 4QXGL 5DTFA 2NY2C 3NIGF 2V2TB 3NCMA 4PG2C 1E6OL 5DK0A 3GGWA 2F19L 3H3KA 3V6BR 3VWJA 1QZ1A 3WE6B 1ONQA 2GFBB 5HJ3B 4LPXA 3T0XA 4UMGA 4Z76A 5BRZD 5DRZB 3TT3H 4LVOC 2DD8L 4H1LA 1WFOA 4BZ1H 3SGEI 1A6WH 1E0OB 4HLZH 4LFHD 5FYKD 3BDBA 2CQVA 4Y19D 3QHFL 1TITA 5DMJB 1ZT7A 3SQOH 4X6FA 4D0CB 2VDKL 5HI4D 4A6YL 3OAYH 4JAMA 4JR9H 3QXAA 4Y4KA 4GH7B 5IB3B 3GO1H 4OUOA 1PKQE 4PJFA 1ZV5A 1U8IB 4LCUB 4HCRL 4OLZH 2DKMA 3H2WA 5C0AD 2Z91A 5BJTB 3I02B 4YDJA 2V7HA 1MHPL 3S5LA 3G9AB 1HQ4A 5ANME 5I1HL 4J3TA 1RURL 1S3KH 4DZ8B 2RFXB 1K8IB 4UINH 4MXQC 3OAZK 1QO3A 4JM4H 4PB0L 3WNLA 2BY2A 4ZPTA 2XZQH 1FL3B 1FIEA 5HGDA 4OT1H 4TNVF 2NNAB 3MGOA 3W0WE 3MRHB 1PG7W 4YEEA 3QUYB 3REWB 1WTGT 1UJTA 5DRWB 1ROWA 3PV6B 1IAIH 2F54A 1NMBH 5HHOB 3MLSH 2XN9A 5SWSB 3DVNB 4MS8D 4HWNA 1TETH 3QDMD 1B6DA 2X4OB 4FQQB 5FO8A 1WQVT 4RAHA 2L4OA 2KKQA 1GZQB 4I18C 3B83A 1HSBA 3AU1A 4QTIH 5CHNA 3TCLA 3NIDF 4KK8C 3H3PH 4XNXL 3H7LA 5JHDB 3MX0A 2A6KB 3CFDB 1LP9E 2VZVA 1XF2B 1T1XB 4RFOL 5EU3B 2JELL 4XX1G 3V7AG 2VQUA 3GDBA 3HAEA 4QHMB 3MV9E 4AEIH 4NWUL 4H25A 3OSKA 4GAJL 4X7SL 2PCPA 1YA5A 5JDSB 3AAZA 4JO4L 3PWVA 1KJVB 3BUTA 1UZ8B 3O9WB 2VB5A 1MJ8L 2VIRA 2BRRL 3QISA 1YN7B 4KQ3H 3QT2A 4XGZA 5SWZE 1DBAH 5IM7B 4QRRA 5I1LB 1GPOL 5B22A 2QBWA 4Y1AE 2VRAA 4Y2DC 1LO3H 4U6HA 1XGYL 2C7UA 2IAMB 4POYA 1IGTA 2C4FT 5F89B 1GSMA 1BLNB 1QFWM 3PQYD 3PXHA 3RTQB 3FTGA 4C54A 1CI5A 1PEWA 2NZ9D 3MLWL 2H32H 1LE9A 4OCYH 2GSIA 2R29L 4OBSA 4ORZC 4XRCB 1B0GA 4HHAA 3H0TA 4O4YL 4HMEA 2OBGA 4U3CA 1SJHB 2OR8A 3BP7B 1OGTB 5E70A 4RBPH 3CDGA 1HKLL 1VSCA 2PO6D 5ADPH 4D2NA 1FO0B 1AFVL 4KRPB 5FGCE 3OKDB 4Y0GA 4M8QB 4Q0XH 5IBLC 4JANB 1VGKB 4YZFE 3DXAD 3G5ZA 1FFPA 3D0VB 5GRWA 2FJHA 2YA0A 1R6VA 4PJEA 1GXEA 4ZDHB 1AGCA 3CSBA 4Y7MA 3VFSB 5BRZB 1CLZL 3LKOA 5BXFB 4CMHC 1U8QB 3QUXC 4XPTH 3O6ML 3IVKB 1BD2E 4GS7C 1G9NH 3S36L 4PRDB 3BZEB 2DWDA 3KNBB 4HC1A 1OL0A 3BQUA 1JWMB 4Y19B 2CKBH 4TSCH 4PP1D 1SQ2N 2AEIT 3IJSB 4UT9L 1DVFD 5CJOL 3SKJH 3FOLB 5C0CE 4BH7B 4LARH 3VFRA 5E5MA 1R3KB 3VXOB 2GJJA 3QDJE 5CP7A 1JBJA 4QHKI 1MCWM 4G6ML 4IRZH 5C0AB 3WLBB 3TBVA 4IM8A 3RKPA 4PD4K 5HPMA 2HWZH 2R23A 3FZUD 4QWWD 5I8KL 1U92B 5F7YC 1YN6A 4JZJC 5T3XD 3GSWA 4HPOH 4P5MA 4N8VG 1S7RA 4GRWE 4PJXE 4RISH 4DGIH 2ZSVB 5F21B 1IC1A 4Y16A 4DKFL 1J05A 3AUVA 5H94B 5JZ7C 3A67H 3MR9B 3KLHC 4MCZB 2A1WL 3P11L 3QDMB 3UJJL 1NL0H 3WFEL 3RU8L 3E8UL 1KPRB 4GLRI 1M7DA 2A74B 1Q9WA 4U2ZA 4MA3A 3LQMA 3HC3H 3MGAA 5TH2B 4YDKH 3IDYC 1BWMA 3IT8D 4G6AC 4U1IB 4AEHL 1G0XA 2P1YA 3WYRA 3DBXB 4HIEB 4FFZL 4HS3A 4GBXD 4WWKC 2P5WA 4LIQH 4P46C 2CRZA 4NQSA 3KHOA 2XTJD 5IBTL 5EIIB 2QR0B 1U8NA 4PJCA 5GS3A 2O5XH 3T1WA 5F6HI 1U3HD 4R8WL 1YEIL 4LKCB 3KYMA 4RNRA 4EQ2A 2WW8A 3ROLB 3WFCL 3FT2B 4XXCA 1JHTB 2X10A 4JPWH 5F71A 5KVEL 1LK3L 2EXWD 4DZBB 3QDGD 2V7NB 2H41A 1NAMA 1T89C 4NQCE 4AM0A 4UI2A 2AGJH 1T7WA 3PQYB 1RJZA 4PJIE 4ZPVA 3L3GA 1T6WA 2ID5A 1EEZA 1ZT4B 5DA0B 4Z78A 2OP4H 2VAAA 1ZA3A 3UZQA 5FUOL 2VXTL 5EN2B 3ARSA 3U7WH 4OIBA 2HJKB 1WIPA 1XGRA 5TDOA 2WK2A 1WEJL 5EO0B 1T66C 4M48H 4M4PA 1UKQA 1L7TH 2PO6B 3MV01 5CEZH 2P8PA 3HG1D 4ZOAA 4ELMF 5DDHB 4CAGA 3WFHB 3PXJA 3DXAB 2Y23A 4ZTPL 1IGYB 1RPQA 5E8OB 1XGTB 5AAWA 2CDGB 3LS4L 4ODUB 4TSBH 5A43C 3U2SA 4P2OD 1YMME 4R26H 1E27B 3QCVH 4X4ZA 3V0VB 1U58A 1NLBL 5L88L 1BOGB 3OHXB 1OTTC 5D5MA 1CL7H 3N9GL 1JRHH 2GT9A 2VXQL 3C8KB 4PJHA 1RZKH 3UTQA 1S7UB 5GRJL 2Q20A 5EZIL 3WV0A 1DUZA 1KACB 1PX4A 2F5BH 2VJXA 3EJZC 1DVFB 3V4PL 4K8RL 4LL9A 4RGND 5JW5A 2VUOA 2FX7H 4UV7H 4QRPE 3MGTB 4LSUH 3OF6A 5JORB 3IFNL 3RL2A 3O2DL 3MYJA 4K23H 3B9KA 3G6JE 5IMOA 5M94B 3WUWG 3V7MA 3GM0A 3NGBC 1TJIH 3QBTB 1EVUA 4BKLA 2EO1A 2QQKH 1J12A 3VU2A 4JY6A 3LMJH 5CMAA 4F7PB 4MAYD 3NFSL 2ZCKH 1A9BB 3MRKB 5J11C 4QRQA 1I8LC 3INUH 1Y0LA 4LLVB 1QPPA 1I8MB 1H3VA 3QXUA 5MEOA 1EEQA 5DMGC 3SGDI 3S8WA 3PL6A 4LP4A 2A6JB 5KSVA 1NC4A 3UDWC 3MRPA 3WKMH 4FNLH 5TF1L 2F58H 5I16B 4FXKB 4UTAL 3VXTB 3VWKA 2Q6WA 2EDTA 3VDBA 2W38A 1VADA 3ZTJH 1HEZA 1A1NA 3MNZA 4N9GA 3OBAA 2R9HD 3DI2B 3BP4A 4LSQH 1CDCA 4HEME 4JQIH 2DLIA 4H0HB 4L4TB 2XT1B 4GBXB 1HINH 1C7TA 2PXYD 4WJ5A 1NFDF 2DLFH 2XTJB 1KEGH 4WUKL 1ORSB 4UNVA 4JLRB 4IMKC 5HDLA 3NACH 5DEGA 1U3HB 3RWJA 1JCKA 2EKJA 1X5GA 3WXWH 3SGJC 1FLRL 3PWUA 4RX4A 4I3RH 5IQ7H 5IVXB 2DQIH 3DARA 3F65A 5GSVB 3QDGB 4CVXB 1W8OA 1NEZA 2HJFB 1WCBA 4X4XA 3NCCB 5J3HC 1MVFA 3H7BA 4LHUA 3HE7D 2ZP0T 2YD6A 3R8BB 5D7SL 1QFOA 1EJOL 5GGUB 4Y5XC 3CUPA 1CFVH 3EGSB 4WO4C 2LU4A 4GG6F 1IC4L 1JYNA 2FATH 5D1QC 4XVTH 4HUXA 3HG1B 3RWHA 2YC1A 4XNZC 3I6KB 1I3RB 2CIIA 3H3BC 3H9ZA 2QLVB 2EKSA 4NYLA 1BAFL 4MNGA 5CJ5A 5IG7A 4ETQB 4S1DC 1ZA6A 5L6YL 1Q8MA 5T3ZE 2FGWL 1P4IL 4P2OB 4HK3J 3W0WD 3O6KL 5C2UB 4PJAE 5L9DL 4Y5YC 1A22B 1CU4L 3UPRA 1RZJL 4PGDA 5KAQG 4OLVH 5DZOA 4HJ0D 2DTMH 1GC1L 4OLEA 5EBGA 3O3EB 4WCYH 1FL5B 1NGYA 4X6DE 4KKNA 3SKUD 4RGNB 3DRTA 5DJ2B 1OAUH 1S5HA 3BWAA 3T4YA 5KVMC 1AQDA 4JO3L 1HXYA 4KMQA 3DVIA 4NZTH 2Y72A 1MJJB 4V1DD 5DC4B 2XFXA 3G5XB 3ZYOA 5LGKA 3MV9D 1JK8B 1YEGH 4HULB 3FHQA 5AZEH 1MCIA 3B9EA 3MA9H 1FCGA 1OSPH 2QQNH 5I1JH 4G6KH 2YMXH 2EIDA 2W92A 4HXAH 4PYHA 5SWZD 2YA2A 2OTWB 3FQNA 1Q94B 4GFTB 4Y1AD 4DKAA 1E4WH 3ARUA 4EOWL 1YMHB 2WIIB 4Z7NF 5D7JD 3RGVA 5I17A 1U9KA 1DQMH 5E2JA 3TLRA 3MRLA 4K94H 4NQDE 2IC2A 3QAZC 4J1UA 2UYLA 3AS3A 4HMCA 4WUUE 1UB6B 5I1KL 5CIPB 4HUVA 5CP3A 4XP5H 1XGPA 4WNQA 3EFDH 1P7QA 1JFQL 1T5XA 5JDJA 1I1YA 3VXRA 4OD3H 4BELD 1A6UL 5DUPL 2PXYB 1C5BL 1A2YA 4NN7B 1BBDL 3HLAA 4LLMB 4U1LA 3RIFK 5EU4B 3S97C 1MLBA 3IFLL 1T1WB 2VLKA 4UDTA 1D7FA 2OI9B 1A21A 1JNLH 1NUGA 1SYSA 3T77A 3OKEB 1AR1D 1BD2D 5FV2A 5HYIA 1AGEB 1GCFA 5K9QI 4ZTOH 4LGPB 4IOFD 3TH3T 3EHBC 5KVFL 3HE7B 3DUSB 3TGXA 3H9HB 4P23A 3KS0H 3STZB 5C0FB 4MYWB 5C0CD 2ICWI 3QG7H 1EV2E 2GHWB 4AIZB 1EMTH 5HYFA 4LSTH 4D8PA 4DN4H 1DCLA 3QDJD 4HT1H 5C0BE 2YSSA 1OOAA 1PKQB 2ZPKL 3T0BA 3HHRB 5JLZB 1MH5A 5TF0A 4YBHA 5DJDA 1KF9B 5BS0A 3QUZC 1OPGH 4ZFOB 5GRYA 2R2HA 3EFFB 1RU9L 4J6RL 3BUYA 3PWPE 3W9DB 1XT5A 4P9HC 5IIEB 4ZUTB 2IANE 4MD4B 4YHPA 1XH3A 2GJZB 1Q0XH 5I19H 5C0IB 4FQLH 3RIAK 5DS8A 4JFOB 3W0WB 3RRQA 4G8EA 1NCDL 2JJTA 3SE8L 2B5IC 1NDGB 2B4CC 2PW2B 4PY8I 3ROOA 1KTLA 2DDQL 4YDLB 3QR2A 4JFQB 3C60D 5C09E 4PREB 1FNEB 3HB3C 2D0FA 1IEAA 2BSRB 1MLCA 1UM6L 2EEBA 4CUCA 5ESAA 3QWRD 4XNYL 3ARFA 4FQXA 1MUJA 3ZDXE 4GW1A 3WS6C 4HG4K 1C1EH 3T0EC 2IADA 5HYEA 1LP9B 4V1DB 1IGIL 2CUIA 4HX1B 4I13B 4LOUC 4X9BA 2VDNL 5I75C 4FN0A 1HNGA 3MV9B 5A2JH 1HHIA 4AZ8A 1A7RH 2HT3D 1R3IL 1IKNC 1T22B 1MWAH 2IFGA 2F53A 1T6VN 4B7IA 1UFUA 5DD6B 5F88A 5BVPH 3UEZA 5D7IE 5GS1A 5SWZB 3P9MA 5IVOA 1DN2A 4Y1AB 3JV0A 1DQQA 5D7JB 4NQCD 3RVWC 4JDTL 1P5UA 2J6EH 3L3IB 4O5LL 1KB5B 3T3PF 1U8HA 1EEYB 2E7LC 5CBEB 5EOCJ 4Z7UA 4FQ1H 2LAGB 4F7TB 3ESUF 4ZSOE 5HGAA 1QBLL 3UTTA 3U0PB 3BH8B 1DN0B 3BH9A 2YRLA 5IFHH 4XWGH 3U7AA 3VXPB 3OZ9L 4MB3A 1B4JL 5JNYB 5MP6L 2C5DC 1NBZB 4PJFF 1F6LL 4JO1L 4NUGH 3D39E 2IF7A 4P9MH 2X4QA 4PGZA 3RVTD 2I07B 3GSXA 2DKSA 1F97A 3L7EB 5BO1L 2OMNA 5C3TA 3DNKA 1JWUA 1JF1B 3T65A 1A6ZB 3GJEA 4WW1B 2QEJA 4TTGA 4XCEA 4JPVL 5E8DH 4CKVX 2A2QT 3HNTH 5FXCH 1YMMD 1ACZA 4GAGH 5C07B 3IS1X 1BD2B 1OSZB 3MREA 3DX7A 1FZJB 4KHXL 3IDJB 1RZIA 1IGJA 4YHNB 1GHFL 2DMCA 4U1KB 1OHQA 3F58L 1B6UA 1FFNB 4PB9H 5IB5A 4RDQF 1UJ3B 3RVUC 2NYYD 1PZ5B 4EI6B 3KS0J 2IQAA 4K71B 1R3LA 4OM1L 3N85L 1RUPH 1WBZA 3P77B 2R56H 5EPMB 4LF3B 3BPOB 5C0CB 4M62L 3BX7C 4QRPD 3BZDA 3DX9B 1BMGA 3QDJB 4PLJC 5INCB 2FJGA 1FRGH 5TE7L 3BP5A 4XZUB 3ARYA 4PLKD 5FA3B 2MHAA 3GZKA 4IMLA 1N5AB 3P40A 4YPJA 1FAKT 3FN0H 5DEZA 5T1KB 4MMZC 1K6QH 5D6DA 5D1XC 3T2QA 1RJLB 1X5LA 5EO9A 2YUXA 3F7VA 5DEFB 3MLYL 2GI7A 2ARJB 1UGNA 4PJBA 12E8H 3HC4H 5FO9B 2GK0B 2D31B 2YWZA 4PS4L 2JB6B 3QQ4B 4GRWB 4H5SA 4PJXB 5FOJA 3ZKMD 2P47B 3RAJL 2WSKA 1G7JB 3X3GL 1KCKA 1G1CA 2A83B 5DJ6A 2FIKA 4OZHE 4GG8B 3MUHL 1CXKA 5IB4B 5CAYB 4I3SL 3C60B 4EUPH 1BQHG 2BJML 1KN4L 3LQZA 3W9EA 4LBEB 4KY1H 1NANI 2VDOL 4ODTH 1AJ7H 3UC0L 1CK0H 5F3HA 2YS4A 2NTSP 5IMKB 1XFPA 1KENH 5T1MB 5KAQF 5DHVA 1QRNA 5D1ZD 2CK0H 3EBAA 5J0BA 4ODHL 3F5WA 2EIZB 4ODXB 4NCC2 2A9NL 5IEKA 4RGMB 1FVDA 2WINB 3AB0C 2DL9A 5IV2A 3PIQB 2VXSL 4MDJB 5E0QA 2EIEA 1QFWI 5ITFB 2JK5B 3IFOB 1KXQE 4Z7QF 1GH7A 3LKQB 2CSPA 4NQCB 3WE6A 4MCYB 4PJ8C 2GFBA 2KDGA 4PGEB 3VD3A 5ISZB 4PJIB 2DQUH 3TN0D 3Q1SL 5JQHC 4JFDA 1OP3H 3O2WH 4G8GE 1UENA 2VSCA 4M1DH 1VCAA 3L3KB 5AWNL 5FYJH 3VXUD 4EUPG 3CVIH 4R90H 1TTUA 1Z3GH 1S9KC 3WJJA 5L2KE 5IUSA 4PPTA 3GKWH 2CJUL 4GUPB 4S11A 5ALCL 3AMKA 4KU1A 5IB3A 4FFVC 5BV7H 1U8IA 1ZLUH 4LCUA 5T3ZD 2WAHA 1M71B 1YMMB 3EKCA 4XCFH 1JV5B 3EOTH 3I02A 4XP9H 1O0VA 3SN6N 5ITBH 3EO0B 5I1GL 5GGRY 4XVUD 2I24N 4JQVA 5DQ9B 3IDMB 4P4KD 3P73B 1AHWC 1VFUA 2RFXA 1K8IA 4PIRF 3NZHL 4JHAH 2QKIB 4UU9A 5F9OL 4IOIA 1F90H 4H8WH 1FL3A 1BGXL 4QXGH 5GGTL 2JJUA 1E6OH 3NCJL 2F19H 3MRHA 3REWA 3QUYA 5D2NC 2ZUSA 4QRPB 5DRWA 2OL3B 3PV6A 4JN2B 3VRJB 3OX8B 4MJIE 2R4SH 5HHOA 3G6JB 1KTDB 3DETD 5SWSA 1P9MA 5GGRB 2BERA 2XY2A 5LQBL 1DFBH 2X4OA 1QFWL 3GSNB 1EO5A 3TA3D 4FQQA 4O58L 2DIBA 5I8EB 5E8NB 2O5YL 3V6OC 3SPVB 3KPPA 1NGQL 3RZWA 3MJ6A 1AO7D 3BE1L 3BD5A 3QHFH 5JR1L 2VDKH 1KELH 4S1QH 2A6KA 4A6YH 4NSKB 5F1IB 1XF2A 1T1XA 5TQ0L 1H3TA 2LTQC 1J0ZA 1IM3B 4YFEA 4GRLD 4LVNC 2D0GA 5BCAA 3NMEA 4G9DB 1KJVA 4HCRH 1A14L 1UZ8A 5F1SA 2P44B 4NQDD 5JXED 1YN7A 1T1ZA 2HG5B 5IM7A 1MHPH 4KROD 5I1LA 1TJGL 2MWCA 4WUUD 5I1HH 2IAMA 5JA9A 4PB0H 5F89A 3H9SE 1KG0B 3RTQA 3MLZH 4I3GA 4PJ7F 1Q38A 5D1ZB 3OB8A 1OARL 1QFPA 4OCLC 5ICXB 4NRYB 5CGMA 1CE6B 1VFBA 5HYSG 4XRCA 1OP5K 3ULVH 4KZEL 5BOPA 3O3DB 1SVCP 2P24A 3MUGB 3BN3B 1SJHA 3BP7A 1HIML 1ZMYA 4ERSL 1PFCA 4P99A 1FV1B 1DQLL 1FO0A 1GAFL 3QNYB 1FAIL 1E4KC 4JANA 4QY8B 1NAKL 4JG1H 1TTFA 1NUDA 5BW7A 3G6AB 1BM3H 4ZDHA 1IC7L 3CX5J 4XNXH 5BRZA 3VFSA 2WBJD 4U1MB 5BXFA 2O93L 3VFPA 2C3GA 3MRRB 1U8QA 5DUMH 1JL8A 3RUGA 3IVKA 1WVZA 4NWUH 2DQEL 4X7SH 1OAXH 3HNVL 3VXUB 4JM2D 4PRDA 1CF8L 2DQFB 5C0BD 3KNBA 1CDYA 3ZSTA 1MJ8H 1JWMA 4Y19A 2BRRH 3D1MC 5EUOF 4RGOL 2APVA 1I85C 5DJ8B 3FOLA 2H2PC 4BH7A 4GAFB 3O2VL 4ZUVB 3ZE2E 3PWPD 3KR3L 3DJ9A 1R3KA 3VXOA 3BKCL 5HHQA 2IAND 2OXGA 3FQUB 5DXWA 3MLWH 5C0AA 1IBGL 2R29H 1SJVA 1IAIM 5HSFA 3VI4F 4PJAB 4FP8L 2V5RA 4O4YH 5C0EA 2N4IA 4P4KB 3U30B 2FX8H 4WIQA 5HHPB 4KVNH 1AFVH 5C09D 3BAEL 4QF1B 1UWEL 4X6DB 4ZXBD 3WUWA 3V5HA 1T1YB 2ZSVA 4GAYB 1H3UA 5SV4A 2QV2A 4M1CC 3BGMB 3N1GC 4P0DA 1T83A 3H42L 5D2LE 1B9ZA 4LPUA 4MCZA 4E0RB 4AL8L 2EXYD 1CLZH 4UTBL 3T09A 3HFML 3S98A 3UX9B 5CZVL 3O6MH 1KPRA 3TA3B 3EDDA 5TH2A 1QACA 5DFWH 5F7DB 3S36H 1DLFL 2E9IA 4NN5C 1B0WA 4KI5F 1AO7B 3VXQB 3WCYA 3DBXA 4HIEA 1NFIB 5CJOH 4MVBC 2V6HA 2OYPA 3BXNB 3QXVA 4X4YB 3S96A 1ZTXL 2QR0A 3TYFB 4KUZL 5J56B 2XV6B 4GRLB 5HHME 4FFYH 5ENWA 4M61A 1YEDB 1HDMB 5I0ZA 1EHLL 4G6MH 3Q6GL 1BZ9B 5ADOH 4NQDB 4J7RA 3ROLA 5HYQB 3FT2A 1IQWL 1JHTA 4KROB 5GIRA 4WUUB 5C6TL 4DZBA 32C2B 2V7NA 5I8KH 3O3UN 3MMEB 5C2BL 3PQYA 3IDIB 3TJEH 1UCTA 4PJGF 1UACL 4KUCD 4D9QE 3D39D 2ITCB 5EN2A 3RWFB 2HJKA 2BVPA 4OCNC 2EE6A 4LDLB 2W0FB 3P11H 3LRGA 5EO0A 5HDOA 2YD5A 1I7ZB 4NZRL 5IEHB 1BZ7B 1MCFA 2PO6A 2ZUXA 3UJJH 3RU8H 3E8UH 5DDHA 4LGSB 3WFHA 3ZYJA 3DXAA 1TVDA 4XWOC 3JWDC 4HUWB 1IGYA 3VFWB 1NCAL 3O81A 3ETBF 2HH0H 5E8OA 1FL6B 1XGTA 2CDGA 4ODUA 3V52L 1QHPA 4J3SA 3FQWB 5E4EB 2WBJB 5IBUG 2HTKC 3THML 2A0LD 2IBBA 1E27A 5J8OA 2NZIA 2PYEE 1BOGA 3OHXA 2B0SL 4JM2B 2FEEL 3MLRH 3O6FD 3PP3H 3BZFB 4U49A 5C0BB 4KWUA 2CLRB 3ZKND 4U0QB 5KZCD 1HOCB 3WFCH 2I27N 3ARBD 5KVEH 4F15C 4MMXC 2HP4A 5KJRL 2AKRB 1S9XB 3VRLF 2X4UB 3MGTA 3MJGX 3PWPB 5CBAB 3P4NB 5JORA 5I0DA 5JUEL 2JJVA 1QEWB 3CFIC 2Y5EA 2XWTB 4BZ2L 5FUOH 2VXTH 5I1AA 5CSGA 5EOQH 3QZWG 1KT2B 1Q1JL 3DGGB 3VFOB 1ZLSH 5JHLL 4MGXA 4F7PA 3UJTL 3FFDA 3D6GA 3SO5A 1A9BA 4U7MA 4XPGL 3TC9A 4LLWB 3MRKA 4ZXBB 4XH2B 1IT9L 3HRZB 4LLVA 3PP4L 1I8MA 3ILQD 3RKDD 1I7RA 4WTZG 2EDFA 5A40E 3WFBL 3LDBC 2A6JA 1I9IL 4W4OA 5I16A 5DMYA 4FXKA 3CH1B 3VXTA 4KRLB 1VACB 3N9GH 2VXQH 4OLUH 3F7PC 1KCLA 4U1GB 3UBXI 5GRJH 3RNQB 1G9NC 3IU3A 5EZIH 5F1NB 4L4TA 5D7IB 4AIXA 3QFDB 4GBXA 3WIHL 4RFNB 5JXAL 2G5RA 4BFIB 4K8RH 4JHBA 4Q9BA 1TQCC 4PUBH 4NJ9L 1INDL 2EH8L 4ZS7L 1WLHA 5HHXL 3TJHD 4JLRA 3IFNH 3O2DH 1H15B 2NXZD 1U3HA 2P5EE 5C1MB 3FO0L 4TUKL 3MJ7B 3MV7E 4ZSOB 5IQ9B 4G8GD 4KGLA 5GSVA 4KRMB 4CVXA 4JRXE 2ICEB 1M4KA 2HJFA 3B3IA 1Z2KA 1JHLL 4XMPL 5A2LH 2J5LC 3NFSH 3BN9D 1S7SA 1QQDB 4OCWL 5L2KD 5FUCC 1MRDH 5K93A 3D39B 4WFEE 1SJEB 4GW4B 1CLCA 4L3AA 5GGUA 4L9LB 2ITDB 5C8JB 3EGSA 5TJWK 4WV1B 3V5DB 1YJDC 2AV7A 1OAYL 1R3HB 5TF1H 3KYOB 1I3RA 2VR4A 3RVVC 1FNSL 1RULL 5TGBB 5IWLC 3P0GB 1XCQB 3C09C 1UADC 1GIGL 1JGEB 3FT3A 1KIRB 1FZKB 1NMCC 1MIMH 4E41E 4WUKH 4HAGA 4ZAKC 4HJJL 3KPSE 5F1KC 4NNXB 2ESVD 3O6FB 1FZOB 4MJID 5A2KH 1FLRH 5KZCB 5HVHB 5T1DL 5CUSL 1QFHA 3O3EA 4TRPH 1AQKL 3ARBB 1FL5A 2XZZA 4CVWA 5IESL 4EN3D 3HI6L 3ABZA 4GXVH 4LNRB 4QHKJ 4WW2B 4NJAL 5DJ2A 1AI1H 5HDBF 5IVZB 1DE4B 3HN3A 4NZDA 4Z6AT 4WFGE 3TPUA 2W60A 1MJJA 2OTUB 4D9LL 1KIQB 5D7SH 3CLEL 3HMXL 1VPOH 4Q9QL 1EJOH 3G5XA 4EBQL 1Z9LA 3NZ8B 3OJMB 3PABB 4PRPA 2XWJB 4J12A 3VWJC 3HC0A 3OKKB 4I5BB 4Q6IB 1T80A 4OZHB 4F3FB 3TBTB 5EU5B 3GEWB 5I74B 4HWBL 3ULVF 4R2GD 2J88L 2OTWA 1Q94A 5DHYB 5KTEL 4OFVA 2WIIA 3A6OA 2ERJB 1BAFH 1N0LA 2E6QA 4I4WB 3B4NA 3IKCB 1T04B 2V2WB 4RMQA 2FGWH 1P4IH 4OLXL 4DGVL 4DFIA 4YHML 4KTDL 1IAKB 3O6KH 1BBJA 5L9DH 3CDFA 1UB6A 5CIPA 1CU4H 3RY6A 1RZJH 1ZWIB 4PBWD 3O3AB 4OSUL 4I1NB 1YY9D 2VR5A 4QXTB 4L8CB 5K9OB 4QLRA 2PXYA 1TZGL 1RZKC 5F6HJ 1PG7L 4XAKE 3QUKB 3CDCA 2DYPD 4LLMA 5B8CB 2XKSA 5EU4A 3WN5B 1FBIL 4TVSa 1T1WA 2NXZB 4OIAA 3VGAC 1D6VL 1S7WB 4Y88A 1TZHB 1T7XA 3QIBD 4MSWA 2VDPH 4OZIE 1U8KB 4G8GB 3OKEA 1SM3L 2K9UA 3QUMA 2BX5A 3AM8C 3FCTB 1AGEA 4PJEE 3KJ6H 4MQXD 2VOTA 1KIPB 1LDSA 2IFFL 1AC6A 4J3XA 4AEFA 4ZFFB 3DUSA 5L2KB 1UCBL 3A6BL 3H9HA 3STZA 5HGBB 5C0FA 1C5CL 1BIHA 3W11D 3CK0H 4Y8DC 2R4RL 4HMDA 4AIZA 1MRCL 3U0TB 5HVWA 3LD8B 2YEZA 1PKQA 1MFAH 3B8SA 4MA7L 3ARQA 7CGTA 1ZE3C 4PJBF 4R96B 1JTTA 2ZUYA 3SDXE 3S35X 5D70H 4ZFOA 4U6TA 1JFQH 3EFFA 1UZ6F 3W2DL 3W9DA 4YBQD 5IIEA 1A6UH 3DYPA 4MD4A 3L3HB 1C5BH 2GJZA 1CGSL 1D5IL 5GJSL 5C0IA 3OKNB 3MBED 4PLNC 2AERT 2FH8A 2UY6A 3LEVL 5F7EL 3W0WA 2Q87A 1CGTA 3IFLH 3B9DA 1RQ5A 5KVDL 1NDGA 5ECJE 2ESVB 4MJIB 2PW2A 1LK2B 3WDJA 4JFQA 2WP3O 2WBKA 2NY5L 4PREA 4G7VL 4JQXA 3ARGD 2BSRA 4EN3B 1CLOH 5DK2B 2PN5A 1S9WB 5H2BA 5KVFH 1ZLVK 2XY1A 5C0RL 1NCWH 4HV8B 5LGHL 43C9A 5IP4A 1LP9A 3GRWL 4V1DA 4HX1A 4AK1A 2E5EA 1JI1A 3MV9A 3NCEB 5HHMD 3AMLA 1T22A 3SCMD 2ZPKH 2IH1B 2ICWB 5DD6A 5EBLA 4PRNA 1FFQA 4R2GB 2F8XC 5SWZA 1I8IB 2G5BB 1WJ3A 3HPJA 3KWWA 4Y1AA 5LBSL 2AJSL 4J6RH 5D7JA 3L3IA 3W81A 1KB5A 4IRSA 4N0YL 2ZKHL 1EEYA 4D9QD 3QCUL 4YWGL 1W0VB 3T4AB 1C5DA 2NTFB 4QXUL 3SE8H 4F7TA 3VA6A 1UC6A 3PWNB 4YR6B 1H9VA 3BH8A 1DN0A 1REIA 2DDQH 4KJYA 3VXPA 5JNYA 4MD0B 3M17B 1EGJA 1RHHA 1NBZA 1OTSD 5SX5K 1UM6H 3X3FL 2DYPB 4GJTB 4QRSB 2WP3T 2I07A 4LSVL 3L7EA 4JFYB 3QULB 4NPYB 1WWCA 2HFFB 1JF1A 4NC2B 1A6ZA 4WW1A 1IGIH 4X80L 3QIBB 3N1MC 4R4FL 5C07A 3EO1B 3GHBL 1G0YR 1F58L 1OSZA 3QP3A 1FZJA 2PYED 3IDJA 2VLME 4LSDA 4U1KA 1TTGA 1R3IH 2JJSA 1XZ0A 1FFNA 5TPWL 1IZKA 5I1IL 1UJ3A 5EC2B 4EI6A 3FHAA 5IT2L 3E6FB 3ZDZF 1J1PL 1ZVYA 4OGXL 1CGXA 2CLVA 5EPMA 4LF3A 5C0CA 2Z9TA 4JDTH 4D0BB 1ITBB 2CDEB 3DX9A 3STLB 4ODVL 1BVKB 1W0YT 3PG2A 3QEHB 1MJUL 4XZUA 5FA3A 4ODWB 3BPNC 1N5AA 2XNAB 1QBLH 4K94C 2E3VA 5T1KA 3CGTA 3T2OA 3F8UB 1RJLA 2X09A 1YYMH 1BJ1H 5DEFA 3OZ9H 2UWEB 3ME0A 1B4JH 5MP6H 1D5BA 2ARJA 3GIZL 4JO1H 5FO9A 4XXCC 2GK0A 2D31A 3UTZA 3MBEB 4GKSA 2JB6A 2XRAL 3QQ4A 3UP1A 3AC0A 2E7HA 5BO1H 4HDIB 5GZOC 3DSNA 2A83A 3VD7A 5D2LB 4GG8A 4J23A 4X4ME 4WI4A 5IB4A 3QJFA 3C60A 4PRBB 2ZG3A 1CFBA 4KHXH 3V6FB 4LBEA 4HIXL 1GHFH 3C5JB 1W72B 3F58H 3QWRA 3F12B 2D7TL 4X9HA 5IMKA 5JQ6H 3VMOA 1C16B 5CEYB 5T1MA 3SGKC 1JYWA 1CTOA 3GJFK 3TIEB 4OM1H 1ZAGA 3N85H 1RJYB 5E00B 4M62H 1V3LA 3B2VL 2FLBT 3Q5OA 3VFMA 4J4PA 2EIZA 1J5OL 4ODXA 5HHMB 2ARWA 3SCMB 2VZUA 2P4AB 4HF5H 5TE7H 1HYSD 2P5ED 1WBXB 2CKNA 1NKRA 4XNUL 3PIQA 3NPSB 4X9IA 4ENEC 3MV7D 4JFZL 5FM8A 4MDJA 3WNOA 5E8EB 4R3SB 1QVOB 4Y4HD 5DJXB 4DFHA 4L29B 5ITFA 3UPCA 4JRXD 3L5WB 3IAQA 3LKQA 3MLYH 4K3EL 4NC1E 4MCYA 1T2QL 5TE6L 4M7ZC 5ISZA 4PJIA 1X5KA 4PS4H 4WY7L 4WEMB 4WFED 3RAJH 1OCWL 2ATKB 4Z77B 2VZTA 3X3GH 1AXTL 4YXHL 1P4LB 3K46A 5CJBA 1AGDB 3L3KA 4UBDD 3OR6A 3B9KC 1JGDB 2YPVL 4I3SH 2BNUB 3ARED 2BCKB 5E9DE 1BJ8A 4QNPF 4CGTA 1N8ZB 1U8LA 4KV5E 1K5NB 1KN4H 4KKCC 3G5YB 5HI3C 4HWZB 4KKBD 4Y4KD 4GUPA 2VDOH 2NW2B 5A1AA 3ARWA 3QXDB 5C6WH 1LDPL 3UC0H 4OZFB 2GSGB 5E2TH 5IW6A 5J1SC 3EJYD 1M1SA 5GQBA 4G6JL 3HR6A 4ODHH 4DCQB 1F11B 4E41D 1GGBL 1FSKB 1JPST 3LPWA 3ZDYE 5CGYD 5AZ2L 1JZ5A 2PYEB 1P1ZA 2Y6SC 4G43B 1R24A 2VC2L 3EO0A 3KPSD 2A9NH 3JTSB 1E4JA 1Z9MA 5DQ9A 3IDMA 3P73A 1A7PL 5FCUL 2QKIA 1NFKA 2ICWJ 3RZCA 4FQPA 2NY3D 4L3CB 2QSVA 3WEXB 4FQHB 5D71L 1MFCL 2KUTA 1PGRB 4QRPA 2OL3A 3I6GB 4JN2A 3VRJA 3RI5K 3U9PL 3LB6D 4WFGD 2EE3A 3OX8A 5IF0B 3G6JA 1IAII 3CLFL 1KTDA 4NWTL 3ES6B 2UV3A 5GGRA 5B39G 3Q1SH 4OGYL 1YNLL 1G7LB 3GSNA 3LRHA 4FXGB 3VFGL 4K7PL 3P0VL 4KI5C 4MXVF 5E8NA 5AWNH 3SPVA 1WZ1H 3CVHB 1WBYB 4WWID 4NO5B 4JG0L 3VRIB 3EYFA 1JNNL 4BH8B 1U6AH 5E5RB 1ZEAL 5F1IA 4PY8J 3LKRB 4ONHB 5C92A 4G5ZL 3LIZL 4BZ1L 4GQ9L 4EXKA 3MLPA 4FG6D 4TQEH 3QYCA 4G9DA 1NLDL 3C08L 2ENYA 1DP0A 5CJQL 2HMID 1RZFL 2HG5A 3QI9D 4XC1L 4DEPC 1S9YA 5I1GH 4JVWA 4P2YA 5IJKA 4TPRH 1EPFA 5DJYB 3UTPE 3VG0L 1KG0A 4FFWC 4Z0BH 5F9OH 3TNNB 4O02L 1BGXH 4PRID 5D1ZA 5GGTH 4JFPB 1SJXA 3NCJH 4XAKD 1GL4B 4NRYA 3K3QA 1CE6A 1VGEH 5I30H 1KB5H 3F7YA 2RGSA 1GGIH 5ALBH 3OKMB 3O3DA 3MUGA 4OM0H 2P5EB 3VXRE 1A0QL 5LQBH 2DL2A 1FV1A 3MACH 4CRPA 3QNYA 4IHOB 2PW1B 3MV7B 4OAWA 5DTFB 4O58H 2VLRD 5KS9A 4ZNEE 2QQLH 4QY8A 5DK0B 4Y4HB 3ZSSA 1WT5A 4NNYB 4JRXB 5KSUB 3PGFH 1NMBL 3BE1H 1G7MB 3G6AA 1V7NL 2CPCA 3MLSL 5JR1H 1MCCA 3BPCB 4OUUB 2XA3A 1TETL 4HUNB 1GGYA 2HFTA 4U1MA 2ADJB 5FCSH 3JWDL 5TQ0H 3MRRA 3RX5A 3OWEA 1MRFH 3VXUA 4GMSL 3AREB 1A14H 8FABB 3A6CL 5A3IC 4X6FB 3H3PL 3KPOA 3GSOB 1XIWD 4JAMB 5DMKB 4X6CB 4Y4KB 3ET9F 3WLWD 5AEAA 1A6AB 4KTEL 3CFBB 5DJ8A 4ZUVA 1X4ZA 2EDEA 3GSQB 1NUNB 2HLFD 4YK4B 3FQUA 2HT2D 4QHLB 1R0AL 3BGFC 1OARH 1L9MA 5I6XB 4E41B 4N1CA 3KPSB 1HQ4B 3OJ2C 3QIWC 1YEKH 1LO3L 1R3JB 4P4KA 1HIMH 4ERSH 5HHPA 1INEL 1DQLH 1GAFH 2C4FU 3SBWA 2YHGA 2RAMA 4QF1A 2NY3B 5JO5B 4X6DA 3MJ9H 1ZANL 1T1YA 4Y16D 4X6EB 1RUML 5J11B 1QSFE 3CMOL 3BGMA 2DWEB 4KK5D 3BMVA 4GRWH 2AW2A 4E0RA 1OLLA 3MCLH 5ADPL 4Y5VA 1EZVY 4Q0XL 3QPXH 5C08B 3TA3A 3C5ZC 2DQEH 5CS7A 5F7DA 1HSBB 3GBLA 2JE8A 4HQQH 1AO7A 2VDLL 3VXQA 1CDJA 3VXNA 5F3BB 4WEUD 3JV5A 3HAEB 3RFZC 4CDHA 4OGAD 4C55A 4H25B 3BXNA 3O2VH 5IVXF 4BYHA 4X4YA 3GFUA 3TYFA 3KR3H 4OLWL 1G9NL 2ZCHL 3BKCH 2F53E 1YEDA 4U3XA 1HDMA 2CR3A 4XI5D 1BZ9A 2CKBL 4NQDA 5JXEA 1U8JB 4IIQB 4P23C 5HYQA 3QI9B 1OM3H 2XOTA 4G42B 4P4RB 2C7UB 32C2A 4A2LA 1WSST 2VWEE 4UILL 4KVCH 3MMEA 1F00I 3BAEH 3IDIA 4PRIB 1FNHA 3WKNA 3S37L 1UWEH 5FECB 3RGHA 3LRSB 1CVRA 4N0RA 2GSIB 4H8WC 4M7LT 1C12B 1CDBA 1B0GB 3L5XL 2ITCA 3SDDD 3RWFA 3IYLW 3LQAH 2GUOB 2W0FA 3HUJA 4AL8H 4UTBH 3CDGB 3HFMH 2OM5A 3QRFM 3I50L 1I7ZA 5IEHA 2AK1H 4WO4B 4HPOL 2VLRB 4OZIB 1IL1A 4DGIL 2X2YA 1NCUA 2VLMD 4HUWA 1DLFH 4XNZB 3VFWA 4ZNCD 4PJEB 3EOYG 3OXSA 1YJDL 1FL6A 1AGCB 3FQWA 3ARVA 1J1XL 2WBJA 1NL0L 1S7XA 4BK5A 1HZHL 4YDKL 4KUZH 3B2UD 1KPVB 4JRWA 1I9JL 2UZYB 4JM2A 3GM8A 3BZFA 4X98A 3QPQD 1CL7I 2PKDA 5C0BA 2DLGA 4Y5YB 1JRHI 1HOCA 3FO2A 3QEUB 1DDHB 1XIWB 5ICZB 1EHAA 4S1SL 5C6TH 3SDXB 1UKTA 3WNNA 4NC0B 1S9XA 2X4UA 3PWPA 3ZT7A 5C2BH 3P4NA 2ADIB 4XP1H 1IGCL 2LV4A 3CC5B 1OP9A 5GS1C 4F8QA 3W5NA 2XWTA 2ORBH 1KCVL 1HXMA 2GY7B 1JYXA 2ZUQB 3DYMA 2R2EB 1JNHB 1G9EA 1KT2A 3LOWA 3ESVF 4HGKC 3LN9A 3ARDD 3DGGA 4NZRH 3ULVC 3MJ8A 4OFDA 3DLQR 4OF3A 2GCYA 4YBLB 4LLWA 4W6WB 4ZXBA 4XH2A 3ECBB 3HRZA 4XCYB 1NCAH 4Y16B 3ZKXB 3V52H 4JO2L 3PL6D 5EUKB 5AUMB 2FHCA 1NC4D 5BZWB 4LU5L 3C6SA 4MA3B 2JB5L 4R0LB 4PGBB 3GSVA 3VWKD 4XX1E 3V7AE 2B0SH 3NBNA 1VACA 5DI8B 5H35A 1QRNE 5C9JB 3AROA 4HS3B 5F1NA 4V2BA 5D7IA 2E9BA 3QFDA 2X5PA 4NQSB 4BFIA 4TVPE 2R0WH 4B50A 3MZGB 5KJRH 4NFCA 3RNKB 2H2SD 4HAFA 1H15A 5JUEH 3KYMB 4Z7VE 4BZ2H 2WNGA 3MJ7A 4YXLL 1TVHB 4ZSOA 5IQ9A 5J13B 3HZVB 1Q1JH 4AM0B 2ICEA 5JHLH 3G6DH 2IGFL 1VFAB 1D6EB 2Q7NA 3RA7L 1YPZA 4LHUD 3UJTH 5E9DD 4XPBL 1WAAE 1QQDA 4XPGH 1CE1H 1BFSA 4JFDE 3D39A 4CN4A 1SJEA 3PP4H 4GW4A 5D6DC 2AJ3A 4LMQI 4NFDA 3SDDB 4L9LA 2ITDA 5GRVL 4NFBA 5C8JA 5I73C 4WV1A 3OAUL 4RQQB 1FZMB 3BGAA 1I9IH 2ICCA 2HVJB 4JREB 4S2SB 2ZCKL 4LPWA 4Z7WB 2CXGA 1X9QA 3RWDB 2YKLL 5TGBA 4U1SA 4I0CC 5GZND 4ZODA 3VG9C 2EYSB 2HLAA 3I3EA 2YXMA 3OJDA 4XVSL 1SY6A 1JGEA 2HRLA 4K2UL 1FZKA 4IDLA 1G6RB 4JGMA 2OTPA 3RVXC 4DOHE 5JXAH 3O8XD 1TDQA 5EO1B 4FNLL 2F58L 3UBXB 1INDH 1N2RB 1U58B 5HHXH 4NNXA 1A7NL 3O6FA 1FZOA 1AXSA 1A02N 1X5IA 1K4CB 3FO0H 3UTQB 4TUKH 5D8JH 4LSQL 2NXYC 4LDOB 2IPTH 1DUZB 2DM2A 5GPRA 3ARBA 3CX2A 1LP9F 1KCSL 5FM4A 4HFUH 1CLYH 2BFVL 4LNRA 4WW2A 4MQ7B 3RL2B 4BUHA 1JHLH 4XMPH 5LJYH 3E0GA 1WFTA 1B2WL 4OCWH 3QRGL 4MA8H 2OTUA 4RSVA 1WICA 4LRIA 1KIQA 3C87A 2VDML 4ZQKB 5ACMA 3NZ8A 3PABA 4NKQB 3SE4A 4JEGB 4F58H 2XWJA 4I5BA 4P5TA 4Q6IA 3Q2CA 4OZHA 1H0DB 4F3FA 5I75B 3ARDB 3TBTA 1OAYH 5EU5A 4QRQB 3FQTB 1FNSH 1RULH 2G60L 2M1KA 4ISVB 4L4VE 2D7NA 3I6LE 1QR1B 2DI8A 1GIGH 3RGVD 1PJ9A 2X44D 3UTPD 1CFVL 3PL6B 4I4WA 3RL1B 3SDAA 3BOVA 2F5AL 2FATL 1T04A 2V2WA 3IKCA 4XVTL 3WJJC 1NC4B 1FP5A 1PAMA 3MRPB 2O61A 1IAKA 2GEEA 1XEDA 3GMMB 4HJJH 3SDCA 3VWKB 2AV1B 4YZFF 3T8XB 1ZWIA 1E6JL 3BEWB 3FL7A 3K74B 3O3AA 5EZJB 4F37K 3VXRD 2EE9A 3CIQA 3O4LA 5CUSH 3U4BL 2AS5M 4QXTA 3L5JA 4L8CA 1AQKH 2CXKA 5EFIA 1QBML 1ERNA 2HKFL 3FO9B 3HI6H 3WJLA 3QUKA 4NJAH 3LSOB 3VH8G 5B8CA 3T0VA 3WN5A 4JQVC 2HRPL 4KXZH 3SHSA 4OLVL 2DBLH 2X42A 5FIEA 2DQHL 4D9LH 2DTML 3PWUB 1S7WA 3CLEH 3HMXH 4XHJC 2WZPD 1TZHA 4Q9QH 4EBQH 1LNUB 3SKNA 1T21B 3LKPA 4UQ3B 5DZLA 5I1CL 3FCTA 2RCSL 4X4XB 4LHUB 1KIPA 5E9DB 1XCTB 4FQIH 3FN3A 4NZTL 4G9FE 2KL6A 4HWBH 4ZFFA 1KTKE 2DQTL 2J88H 1BJMA 3SE9L 3RUGE 5KTEH 5HGBA 1YEGL 1KNOB 3SE3C 4KAQL 3U0TA 5FYKE 4DGVH 1OAZL 4OLXH 2QQNL 5I1JL 2HT4D 4YHMH 4Z5RB 5GRUL 2C3HA 1U95B 4R96A 1URLA 1X4YA 4GRWF 4PJXF 4L8DB 2OR9L 4NYLB 4PFEA 4DTGH 2M26A 1GJIA 5GHWH 5IG7B 3O9WC 3QWQB 3TO2B 2Y4SA 4LQ1A 5HHNB 1TZGH 3O8XB 2VDQL 1PG7H 3OKNA 4HIHB 5D93B 2P8MA 3MUY1 3BT2H 1FBIH 4WI7A 4OJFL 4XP5L 4KHTL 1QSFD 2IAMC 4K8RC 3WO3B 1D6VH 2ESVA 4I0PD 3RTQC 1LK2A 5D6CA 2B7DT 4XPFL 3MRGB 4OD3L 1VEMA 2YK1L 1NGYB 1NAML 4O2FB 5H8DA 4RRPG 1EUUA 4JPKL 3DRTB 5DK2A 3RX7A 1S5HB 4NUJA 1S9WA 5HD8D 1UXSB 2Z0BA 5EA0L 4MNHB 5L8KB 1TFHA 4HV8A 1UCBH 3O6LL 3A6BH 4KRPC 2XFXB 1JNLL 4UB0L 2HN7B 3GBML 2R4RH 1MRCH 5BW7C 3IDGB 4LCWE 1YQVL 3CFEA 4XT1C 2F53D 3PDGA 3KDMB 4BA8A 2IH1A 2NY1D 2ICWA 4PJIF 4LHJB 1CFTA 4R4ND 1DTUA 4J3WA 3SDYH 2DB8A 3QG7L 3RGVB 3K80A 1EMTL 1KGCE 3W2DH 3BVNB 4PG2A 1CGSH 1D5IH 2C1PB 5GJSH 3ZKSD 4J1UB 5HI4C 3PF2A 1W0VA 3T4AA 5I8OH 2NTFA 5KVDH 3PWNA 1OPGL 3TYGL 4YR6A 1KTRL 4KMLB 1ZGLM 4OFKA 3ZO0A 3VMNA 3VXRB 1GRWA 1I75A 2NY5H 1MHCB 1OT1A 4G7VH 3M17A 3UTSE 2OXHA 3KXFE 2DYPA 5IFJB 2NY4D 4J3OC 4QOKB 4QRSA 2IG2H 1KYOK 1VESA 4UDTB 4JFYA 3QULA 4NPYA 3OG6B 3SY0B 5T1LD 2J12B 2BDNL 1NGPL 5LGHH 5IGXL 1YECH 1SYSB 3QIBA 2D3VA 3EO1A 2G2RA 1CIUA 2PYFB 5C0GB 1G9ML 1T83C 5IW1B 2E7CA 2LABA 3BYTA 1WC7B 4BUGA 5IJVB 4MS8C 5EC2A 3G6JF 3VXSE 4JFEB 4Q2ZB 5F96L 4WU7B 5LBSH 4PTTA 1AD0B 3AS0A 4YXKL 1U8PB 2WV3A 3TVMD 1NBVL 5DLML 2CDEA 2YSSB 4N0YH 3STLA 2ZKHH 4LNVA 1BVKA 3NCYS 3QEHA 1YEFL 4Z18A 1MH5B 3ILPB 4QXUH 4ODWA 1J10A 2YRPA 2XNAA 1YZZA 5F7WC 3BO8B 1RJCA 3UROR 4MXWL 2FSEB 4U6YA 2UWEA 2MFNA 4YHPB 2QSCL 3S9DB 3MBEA 1JIBA 4G8EB 4LSVH 3MROB 1QSFB 2BXZA 4HDIA 5DQJA 1KTLB 1PYWB 4I0PB 5IHZB 4NHUB 1H8NA 5D2LA 4X80H 2CH8A 2NZ9C 4PRBA 5DR5L 4R4FH 3S3SA 1MLCB 5GSRA 1F58H 3TO4D 3ISWA 3V6FA 4P9ML 1CQYA 3C5JA 1W72A 2ARJQ 1HSAA 3F12A 5TPWH 1FC1A 5KSAD 1R5WB 1QSEE 2LVCA 1C16A 1D5MB 1QRND 5CEYA 2PO6C 2IADB 4Y2DA 2BSSA 5CINL 3TIEA 1J1PH 4OGXH 4PYGA 2FL5B 5E00A 4TVPD 1MFBL 3T0WA 1QD0A 2X89D 2DF3A 2P7TA 4ODVH 3MV11 5IROA 1MJUH 5F88B 1WBXA 2GQHA 2NY1B 4L4TE 2DAVA 1KSRA 3P9MB 3O0RL 4HKXB 4XMLL 1CFQB 1DBKL 1LO4H 5E8EA 4R3SA 1QVOA 4ODBD 1FGNL 2R56L 1DQQB 1I9EA 5CJXC 1F42A 4B41A 1U8HB 3B9VA 3GIZH 3CFCL 3MNVB 4GOSA 4PP1C 4YX2L 3QO0A 2XRAH 4JFDD 4MQSB 1DVFC 2ATKA 3FN0L 1CGYA 1N26A 2L7UA 2MPAH 4Z77A 2UZIL 1M7XA 1P4LA 4NM8L 5IK3B 1JGDA 1UXWB 2BNUA 2BCKA 1EEUA 1N8ZA 12E8L 1V3KA 3HC4L 3GMNA 3OGOE 3H8NA 3V8OA 1K5NA 2YN5A 4HIXH 4HWZA 2Y9RT 3FZUC 2NY4B 4QWWC 1JUFA 2NW2A 2D7TH 3QXDA 4OZFA 3WSQL 4PJAF 1WFNA 1NGXB 4U6XB 5T1LB 4D94A 1BEYL 4U33A 4EIZC 3P4LA 4XCEB 3MV8E 1Y18B 4MJ6B 4NQVB 2VABB 3N1FC 4QRTA 5B3NA 3X14B 4DCQA 1F11A 3IF1A 3MREB 2DQJL 4X6DF 2PYEA 4G43A 2OK0H 1J5OH 4ODTL 1O5DT 3JTSA 2LE9A 3DTXB 3IKKA 1FH5L 1CK0L 2AXGB 1INQB 4X9FA 1V8HA 4W4OC 4JFZH 5EU6E 1WBZB 2RR3A 3WEXA 4PV9B 4FQHA 3QUYD 3FONB 4CJ0A 3LKNB 3TVMB 4K3EH 3E1F1 1T2QH 2XIDA 4O51B 5TE6H 3BP5B 4DK3A 5IF0A 2X9YA 2LQRA 3ES6A 3NH7L 1NMAL 4WY7H 4GBXC 2VMFA 3QWOB 4APQD 3SKOB 1I1AD 2XTJC 4U6VH 4YXHH 5T5FH 4PLOB 4NRXB 3C8DA 2EDOA 3RPKA 3CVHA 2YPVH 1U3HC 1UB5B 1WBYA 2P45B 3G08B 2MNUA 4NO5A 3VRIA 4BH8A 3TFKD 3KPNB 3RBGA 2VLJE 4L4VD 3I6LD 5F6IB 4OQTA 2EXWC 3KPRE 2EYRA 1LDPH 2R1XB 3O2WL 4ONHA 4PRPE 4CADB 4LSRH 1EIBA 4IEFB 6FABL 5AZ2H 3U9UA 6CGTA 3TO4B 2A77H 2H8PB 1D5XA 2VC2H 2EZ0D 1PQZB 1Q0YL 4TNWK 5F3HB 1A7PH 5KSAB 1QRNB 3TNNA 1AE6L 3HNSL 4G8IB 4JFPA 1JPFB 2VQ1A 4XBEH 5D71H 4MQTB 5DVLA 3MFGB 3BW9B 5KW9L 2G9HB 4OI8A 3U9PH 3OKMA 4NWTH 4FQCL 4GG6B 1CGWA 4G7YL 4Z7VB 4P2OC 2DKUA 4DN3L 1F90L 4IHOA 2PW1A 3MV7A 3VFGH 4K7PH 3MLTB 2R0ZH 1A3LL 3P0VH 4Y4HA 3BKML 4NNYA 4JRXA 3F6IA 4F7EA 5KSUA 4HIIB 1KFAH 1G7MA 2R4SL 4JG0H 1JNNH 3BPCA 4G9FD 2B2XL 4OUUA 1ZEAH 1MEXL 1ULVA 4JFDB 2DLEA 1DFBL 2ADJA 3EYUH 4G5ZH 3LIZH 4RGNC 4GQ9H 4YC2B 4I2XE 2EDHA 3VI4E 3E3QE 2L7JA 4CVZB 3AREA 8FABA 1NLDH 4LCCB 4F37F 3C08H 5F7KC 2BHYA 5CJQH 1RZFH 1MF2L 1KELL 4S1QL 4XC1H 5GRZA 3GSOA 5DMKA 4X6CA 1S7QB 1KJ2B 1A6AA 3QQ9D 4KJQD 5K9KA 2I9TA 3CFBA 1MCBA 3D25A 3VG0H 4P2RE 3GSQA 1EA9C 5KSBE 4O02H 4MAYC 1GZPB 4K3HA 4QHLA 4DOHB 1CG9B 1TMCB 1ZXQA 4E41A 2FHFA 5E03A 2VKXA 2VYRE 3KPSA 5HI5D 3F62A 1JYVA 1R3JA 5IR1B 1A0QH 4UU9B 5T5NF 2H32B 5L8JB 4IOIB 3MLZL 2OZ4A 1RMFL 5CGTA 1MCQA 5JO5A 3C2AL 2WIMA 2YUVA 3RY6C 3IJYB 4X6EA 2NW3A 3KHQA 3ULVL 1EXUA 3BD4A 2D7PA 2DWEA 2R9HC 1V7NH 4M1GL 1I8LA 1BQLH 5FYLL 4JE4B 1T7VA 1CXFA 1EK3A 4MJ5B 2PXYC 3JWDH 4NN7C 4APQB 1OT2A 5D7IF 1I1AB 4HLZG 4N8VB 5C08A 2FZ3B 3OKLB 4JG1L 3KPPB 4GMSH 4LCWD 1OWRM 3FKUS 4OI9A 2OI9C 5FDWB 4YAQB 5GS0D 2FO1A 3A6CH 1BM3L 3BRGC 4V1DE 5F3BA 3OR7A 3MLVL 4PJGE 2XG4A 4L4VB 4TUJB 4KTEH 1K85A 5ESVB 5F93C 5DUML 1OAXL 3E3QC 1P7KB 3PWJB 1KGCD 4D9RE 2I5YL 1J0IA 3HE7C 1IAOB 1R0AH 2DICA 3S7GA 1NDMB 4Z8FH 2H6PB 1T1ZB 2NY0D 1D9KD 1U8JA 4IIQA 3QI9A 4KUCF 4G42A 4P4RA 5CD3B 1INEH 2AJVH 2JCCE 1U42A 5I9QB 1AXIB 3JUZA 4PRIA 5FECA 5DO2D 4KKLD 3LRSA 3ORJA 1ZANH 3OAZH 3KXFD 3UTSD 1VFBB 1C12A 1RUMH 5IVNA 3CMOH 4KK6D 4V2CB 2P24B 2FX8L 2GUOA 1UA6L 4KVNL 2MKWA 4WO4A 5KN5B 3CZJA 5DD5L 2VLRA 4OZIA 5D1QA 4XPAL 2BOBA 1U3YA 3LCYA 5DSCB 1MQKL 2BNRE 1OTUD 2VDLH 1Y6MR 3FB8B 3MRCB 4HJ0C 4G9FB 2YD7A 3C09B 3U82B 4C59B 1OW0A 3VFPB 3VXSD 4JQXC 2DJUA 4OZFH 3B9AA 5C07E 1NMCB 3RUGB 1C8PA 3VXME 2J8OA 1P69B 1CVSC 4HBCH 4OLWH 5E2WL 2OX5A 4CU7A 1A4KB 1KPVA 2ZCHH 3L7FB 4X0KB 4BQ8A 4WW2F 1M6OA 2Z8VC 1S5IH 1OB1A 4DVRL 4Y5YA 3G9VA 4JZNB 5BZDA 3K8MA 4NKDB 2J8UA 3QEUA 8CGTA 1DDHA 1XIWA 5ICZA 3BJLA 1IFHL 5GXBB 3SDXA 3DYOA 4UILH 4I9WD 4ONOA 3ZE1E 4FFYL 2ADIA 5HHQB 4JY5L 3VFUA 3CC5A 4OZHF 3QG6A 3S37H 5FGBC 2VL5A 5ADOL 1QLRB 3HZKB 1WFUA 4LLUA 2GAZB 2AXHA 3EZ8A 2P49B 1TXKA 3MOBL 3L5XH 1X4XA 4RMVA 2ZWLT 5C0EB 4U1NB 5D7JC 2R2EA 1JNHA 2Z31D 3MBXL 5MERB 5SWQB 1K2DA 3Q3GB 4X5LA 2QTEA 3I50H 1IEBB 3TJEL 5DD1L 3FRPA 3WUWB 4TULL 4NO2A 3V5HB 5FYJE 3ECBA 3PGDA 4JFFE 4XCYA 2XKNB 4HKZA 1YJDH 1XAUA 4X5WA 1QSED 4MD5B 5EUKA 5AUMA 4GO6B 4CNIA 5B3JE 4POUB 1KLGA 1J1XH 3BPLB 4OIIL 1XMWA 5BZWA 3JUYA 1A7OL 1HZHH 2X1WL 4R0LA 4PGBA 3ULUE 2X1OA 1I9JH 2P8LB 2RQ8A 5DI8A 4LCWB 4LGRB 5EU7E 4I77L 2HH0L 3IETB 4IRJD 2W07A 4UQ2B 5C9JA 4L4TD 4Q58C 4S1SH 1AR1C 2QADD 3K8KA 4NQEA 4OV5A 4O00A 3S96B 3KJ4B 2JLLA 2JJSC 1HWGB 3RNKA 5ENWB 4M61B 1IGCH 2YD2A 3WBDA 4IOFC 1IEHA 2AQ3A 3MLRL 2YA1A 4NO3B 1UJ3C 5IHLB 5IHBA 1DQJB 1VEPA 4K71C 2VLLB 4L5FL 1KCVH 2BVOB 2NY0B 1D9KB 2R1WB 4GKNB 4JDZB 5GIRB 1TVHA 2FX9H 4P2QE 5E95B 3BPOC 5CKAA 3HZVA 5J1AA 3RHWF 1VFAA 1D6EA 5ISZE 1B0RB 4NN6B 4EI5D 2CUMA 3KXFB 3UTSB 4DUXA 4N5UA 2GTWB 5EOQL 2BVPB 3SDDA 4JO2H 2UUDK 3R0NA 4TOYL 1ZLSL 1YEEL 3MV8D 4RQQA 1FZMA 4H1LH 5GGQL 4LU5H 2HVJA 4S2SA 2ED7A 2JB5H 4Z7WA 3OB0H 4XVJL 3RWDA 4HFWB 4ALAH 4DQOL 5I1EL 4CU6A 2EYSA 3OG4B 5C0ND 1HHJA 1FFOB 3I3BA 3MZTA 1H5BB 3A0OA 3C60C 3MRDB 1G6RA 4CVUA 2OQJA 3BZ4B 3VXSB 5EU6D 5EO1A 1RFDL 2HTLD 3UBXA 1N2RA 1CQKA 5EIQA 5D7KE 4FMFA 2EH7L 4WDIA 4OLUL 1K4CA 2RHEA 4PY7A 4NP4L 2ILLA 4YXLH 4HIJB 1MNUL 2IQ9H 4HUMB 1RUAL 5B38G 3D3VB 4HLJA 9CGTA 5J06A 1ZHKB 3C9NA 4F2MB 4PUBL 5ABDE 1ZHBB 2HT3C 4YIQB 4PJDE 3WXVL 2IGFH 4MQ7A 4RGMC 3RA7H 1FNLA 4XMKL 1CFSA 4XPBH 3VGEA 4UV4H 1MAML 1WGOA 2VLJD 3WS6A 2XI9A 5I1AB 4ZQKA 3KPRD 4PRPD 2J2ZA 3I3DA 3M45A 4H1LG 4RRPA 3FJTA 2AEQL 2Z31B 5TDNB 1KCRL 1FO0L 2P46B 1A6TB 1H0DA 5FDYA 1LO5B 3ARDA 3OAUH 4X4MA 3FFDB 1LVEA 4KMTH 2FHBA 3LQAC 1N64L 5K33A 2BVEA 1IKNA 3FQTA 1MRDL 4WI8A 1K3IA 2X41A 2YKLH 4ISVA 5FHBL 1QR1A 5D72L 1I7RB 1B90A 4XVSH 2A6DA 4K2UH 5HYJA 1QSEB 1MSPA 3G5VB 3SOBL 1RIVH 3RL1A 3HAEH 2WANA 2HFGL 4XP4L 5CLWA 3MOAL 3O4OB 3GMMA 4NOBA 4MHHI 1KXVC 3RVTC 2AV1A 4J8RA 3T8XA 5FYKL 1A7NH 3S5LG 3BEWA 2C4XA 1XR9B 4P57A 4IRJB 4QCIB 5EZJA 3IU3B 1AD9B 3OXRB 3C2SA 4PJ5E 4X7DC 5F70A 1MIML 4BQ9A 1KCSH 2QADB 5FO7B 3FO9A 2DJSA 1YNKL 2BFVH 3LSOA 5CZXD 5DQDL 3S36X 4KKCD 4KK9D 1PEZA 3B6SB 1X6LA 1B2WH 4RDQG 3QRGH 3IU4L 1Z9SA 2EDRA 2NYYC 3RJDA 5B4MD 4NGHL 4AYFA 2VDMH 4AG4L 4TRPL 5KS9E 2JF1A 3NN8B 1LNUA 5I71C 1T21A 1FORL 4UQ3A 2GK2A 2Z93A 4GXVL 4MB4A 3ZTNH 1AI1L 4HH8A 1JPSL 2IMNA 3B3IB 4CL7A 2LU3A 3BP6B 3TBWB 1S7SB 5E9DA 1XCTA 3KLSA 4PLKC 1XF5A 2G60H 1IQDB 3O11B 4EI5B 1VPOL 1I7TB 1KNOA 2ZOLB 3VXUE 3K4DA 4P2RD 2F5AH 1IGFL 1AH1A 2AV7B 3MV8B 5LAXA 1UWXK 3ZTJG 3CZFA 4POZD 2FO4A 3ZKMC 4Z5RA 3D85B 1UG9A 4PR5B 5HGHB 1P6FA 1U95A 5J1TC 2EYTB 3H6JA 2V9TA 4HC1H 3WO4B 1E6JH 4L8DA 4RMWA 3BPNB 4ZS6D 3FT3B 2XYCA 4LLDB 3O45B 3U4BH 3OV6A 4RFEA 5D2LF 3TO2A 3QO1B 5HHNA 5CD5D 1QBMH 2HKFH 3O8XA 5EU6B 3W5MA 4TSAL 4HIHA 1NBQA 3DWTA 2HRPH 4RWYH 3D0LB 1PBYA 1G7IA 5IKCB 3VCLB 1T4KB 2DQHH 2FDBP 3NIFE 5D1ZC 3HA0A 2WLZA 1QYGH 3MRGA 1UWGL 1BZQK 3R06B 1J0JA 2EE2A 4O2FA 5I1CH 4MNQE 4OTXL 2RCSH 2X4RB 1UXSA 2NY7L 3TPUB 3DVGB 4BSWB 2W60B 3QEGL 4MNHA 1U3ZA 2FCBA 2DQTH 4UT7L 4RZCA 3SE9H 4N0CD 2VLJB 3C6LD 3MRMB 3U4EB 1WT5C 2VDPL 2HN7A 3K81A 3KPRB 1LO0L 4PRPB 1BIIB 3HC0B 4KAQH 4FRWA 2LVEA 4D9RD 5HTSA 7FABL 1LE5B 3IDGA 1HN1A 1AO7E 1OAZH 3KJ6L 4ZOEA 3TN0C 3KDMA 2Q7YB 3U7YH 1CFNB 4YHLL 4WI9A 5GRUH 5C70A 4HK0B 1N7ML 1BF8A 4LKXA 4Q97A 3CK0L 5TQ2L 3IRPX 2OR9H 2EIBA 1GGUA 5C3LD 3CFKB 3MCKA 4IRSD 3BVNA 2C1PA 2VDQH 1MFAL 1MELA 2JKXA 1BBJB 2IBZX 2I26N 5DMIL 2H26B 4OJFH 2VDRL 4KHTH 3WIFB 1A7BA 5D70L 5JIPA 3OPZL 4Z7OE 4CMMA 4X9GA 1FYTE 4XPFH 1WF5A 2YK1H 3NOIA 1MHCA 2VSDA 4NOFA 1NAMH 4WFHE 2MSPA 5EUOB 4JPKH 1ZLWK 4ZNEA 3E6HA 5DK3A 5IFJA 4QOKA 3ZMRA 4XVUC 1FG2B 2BNRD 4P4KC 5EA0H 1L6ZA 3U30C 3SY0A 3HUJE 2KZ1B 3O6LH 3SBWC 1X44A 1G0DA 3U36B 2F9BT 4UB0H 4MSWB 5C07D 3GBMH 3VXMD 1AY1L 3QUMB 1CLOL 4Y4FD 2PYFA 4I2XB 5C0GA 1YQVH 1JN6B 5IW1A 5EG6C 5T3XL 4KJWD 3ARTA 3DETC 4M03A 4U31A 1WC7A 5IJVA 1NCWL 3JWOL 3UMTA 4XAWL 4JFEA 3TA3C 4Q2ZA 2Q8AL 4WU7A 4O2CA 3RDTD 1AD0A 4UIKL 1N0XH 1MWAB 1U8PA 1ZVHA 4P2RB 2Z92B 5JPMB 3GJFB 2YEZB 5GISL 4YPGB 1LHZA 5KSBB 3Q48A 2UVEA 2ED9A 5E94B 3ILPA 4BQCA 4MB5A 4NKOB 5GGSY 5JIKA 5T1KD 4NBXB 3ZE0E 3TYGH 1ACYH 3BO8A 3CSPA 4GRLC 2Q86B 1J18A 2J1KA 1Q9OB 3QJHB 4QKXB 2FSEA 2K3TA 3HMWH 2YZ8A 1FDLH 3CNKA 5JXEC 5I18L 4KROC 2LFGA 5FYJD 4MJ2A 4JFFD 5E2VL 5E2UL 2APBA 3CPLA 3MROA 1QSFA 1EH9A 5DGQA 1GGCL 5GGSB 1PYWA 2BDNH 1NGPH 2EC9T 2J4WH 1P84J 4I0PA 2L0DA 4NHUA 5IHZA 5IGXH 5BQ7B 2Q1EA 3J8F7 1YY8B 3ULUD 1G9MH 4TNVK 5DVMA 5H2BB 4NKIH 2IWGA 4XNQB 1F6FB 1R5WA 4C4KO 1D5MA 2BVTA 3JSSA 5DVKA 43C9B 4JPIB 1EBPA 5F96H 3TZVD 5AG8A 4AY0A 4PJGB 1CIDA 1AP2A 3C6LB 3W39B 1BQHB 2FL5A 4R9HA 4YXKH 4J4PD 1NBVH 4X8JB 5DLMH 4M7LL 2BHZA 3OKOB 4XBPB 3FAXA 5E4EC 1YEFH 5EBLB 4PRNB 3MUJA 4KC3B 4KKAD 2XPGB 4XHQA 3KPQB 4HKXA 1CFQA 3HPJB 3KWWB 1MAJA 3P4MA 4P2QD 2IJ0C 35C8L 4OZGE 4R97B 4JM2C 4MXWH 1LEGB 1SEQH 2JCCB 2QSCH 4IRSB 4S1RL 5EOCL 5ISZD 5KOVC 3LEYL 3N50A 3MNVA 5GGVY 1C5DB 4HSQA 3K7UA 2G75B 1OF2B 3MRNB 3JVGA 1RK0B 1YYML 1YPZE 4KJYB 5IK3A 4BFEA 1KCUH 1UXWA 1CZ8L 1MCWW 3RWCB 2NR6D 5DR5H 1RHHB 5C0DB 5KOMC 2PTVA 4JGUA 5IMLB 2BNRB 4FMKA 1ADQA 1NGXA 3VFTB 4U6XA 2COQA 5T1LA 4EUPB 1CR9L 1F2QA 3QNXA 2AXJA 1DQDL 1Y18A 1AR2A 2HFEB 4MJ6A 4NQVA 5CINH 1RIUL 1CXEA 2VABA 4ZXBC 3X14A 3M1BB 1MFBH 4C4KT 1T0MB 3VXMB 3QIUD 4EIGB 4Y4FB 4YNYB 5D7KD 1XZ0B 4YH6A 3DTXA 3X11B 4OD2B 4EKXA 5JQ6L 4G6FD 2BRQA 4DKEL 3EOAB 2AXGA 1INQA 3RZCD 2DOCA 2N1KA 3QIWB 3O0RH 2EDWA 5DUBB 4XMLH 4OZ4B 2DQCL 1DBKH 1S78D 1FGNH 2CLVB 3RDTB 4PV9A 4HZLA 2XKUA 3EIFA 3GB7B 3FONA 2B1AL 1V7ML 3DMMD 3LKNA 3TVMA 3MSPA 5MI0B 4U1GC 4O51A 1SMOA 3CFCH 4HF5L 3QEQE 4ZUWB 4YX2H 3UCRA 5AG9A 4K07A 4RFNC 3QQ3B 3QWOA 3SKOA 3LS5L 1IZJA 2UZIH 4NRXA 4NM8H 3VFNB 1I1FB 3C5ZB 1UB5A 1NEZG 1JVKA 1D5BB 3DV4B 2NY6D 3G08A 2UVFA 3UTZB 4GKSB 2XA8L 4R7NA 1F4YH 4X8XA 1XGQB 2NY5C 3KPNA 2AABH 1FNFA 1NFDA 3HRPA 4JFFB 2R1XA 2PNDA 5FYKU 3WSQH 1FC2D 1BEYH 4KJPD 1QSZA 1K8DA 4CADA 3QJFB 4WI3A 3FOMB 3BRFA 4UOW0 1QBBA 3MPCA 4YFDB 3E2HB 4EDWL 3FRUB 5C71A 2DQJH 2W9EH 3TO4A 1MCDA 2H8PA 5E7FA 3WL9B 2NX5E 1F4XL 1T20B 1PQZA 4L9LC 1FH5H 5BV7B 5I15L 2AI0L 5KSAA 5E2TL 5GS2H 4F33A 4IBLT 4PJ5D 1G1YA 3TZVB 4G8IA 4HXBH 1JPFA 4HZAA 4KH2A 2D03L 4F8TA 3BW9A 3VFMB 4OZIF 4MA1B 3KGRA 4AEEA 2X89A 2G9HA 3BYYA 4EQ3A 5L2JB 4LASL 3O4LE 4PJEF 3NH7H 1NMAH 4GG6A 4Z7VA 5CP3H 4DAGL 2NLJB 4ZFOL 1SBBA 4OLYH 2RB8A 3MLTA 4P2QB 1X5ZA 4AH2B 5F9WB 4EXPX 5HYSB 3O6FC 4HIIA 3ZKNC 2W65B 4F9LA 1CGUA 5HVHC 4HWEH 1WAAA 3ARBC 1ZKAA 4Y89A 5T33H 4WW2C 3C8HA 5E99L 3UTOA 5I76B 3OR6B 1N59A 1WZ1L 2AK4A 4J2XA 3NABL 4A6YB 4CVZA 1U8LB 4LCCA 2DS4A 6FABH 1U6AL 3CDYA 3T1FB 3FT4B 2X1XR 3JV6B 4WEBL 1S7QA 1Q0YH 1KJ2A 3T3ME 3GSUA 3DIFB 5IW6B 4PRHE 3W82A 4UT6L 5ID0B 1AE6H 2OS7A 4TQEL 3QB7C 1GZPA 3HNSH 5I74C 1I7UA 1CG9A 3LEXB 4B5EA 2ZJSH 3ZHKA 3V6ZB 1A1OA 4DWHA 5LCVL 1ZK9A 3QIUB 1H3PL 5KW9H 1P1ZB 3TBSA 1R24B 1SBSL 3JZ7A 3ILQC 3GMRA 4WU5B 2ERJC 3RKDC 2EDXA 4TPRL 4G6FB 4FQCH 4KGJA 5IR1A 1A7QL 4G7YH 2H32A 4Z0BL 1RZ8B 2E9JA 3RZCB 4DN3H 1KB9J 5E1HB 4WENB 3S34H 2DBJA 1A3LH 1QOKA 3BKMH 1VGEL 3IJYA 4MNQD 5I30L 1KB5L 3DMMB 4PJDB 1HHHB 3FFCE 2ESVE 1CDHA 1GGIL 2OJZH 5ALBL 2D9QB 3P9LB 4OM0L 2B2XH 3TPKA 1MEXH 4JN1L 3DGCR 4MJ5A 1TVBB 3MACL 2Q3ZA 4APQA 3WJLC 1I1AA 2WQ8A 5B8CC 4N8VA 2QQLL 3TJHC 3WN5C 2FZ3A 1WK0A 3OKLA 3KG5A 2NXZC 3PGFL 5FDWA 4PJCF 1EGJL 4YAQA 4M5YH 3FAWA 1MY5A 2NY6B 3EYFB 2JTDA 1NBYB 3CSYA 4F9PA 1MF2H 5GGVL 4D0DB 4JB9L 1BPVA 2PF6A 4L4VA 4TUJA 1JJUA 4JFHE 5ESVA 4HJGB 4HUUB 1F45A 2C26A 1TPXB 1L4IA 1MRFL 1P7KA 1OAQL 3EZJB 3PWJA 2CKBA 4HGMA 4L8BB 4ZO7A 1L7IL 3BN9C 3NCBB 4LVHB 4MDIB 4L8SB 1IAOA 3HZYB 1NDMA 4N9OB 2H6PA 5E8PA 2BP3A 3ZYIA 2JIXB 1S9YB 1VB9A 1WCQA 2VKWA 4M3KB 5B21A 1FYTD 3LD8C 5CD3A 1T0PB 1RMFH 4PJ5B 3PHQB 2ZUVA 4WFHD 1KOAA 3C2AH 2X7LA 1AKJD 3V9FA 3D69B 3F7YB 5DJAB 4M1GH 1YEKL 3FQXB 2IPUG 5FYLH 1Y6KR 1UM4H 3WHE0 4OAWB 1IE5A 5KS9B 5KN5A 4JCLA 3MJ9L 1IMHC 5K59E 4YDVA 2WBWB 3B5HA 5DSCA 5D5MF 5I1DA 4LQFL 3FB8A 4FA8A 3MRCA 1MVUB 1XF1A 4PJHF 1YNTB 4G9FA 3MCLL 3MLVH 3OAYK 4RMSA 1ZS8B 1XR8B 1ADQH 4EN3C 3P4OB 4MZ2A 3QPXL 5IFAH 5CEXB 3P2TA 2I5YH 3TNMB 1A4KA 4GT7A 3L7FA 4K7FB 4X0KA 2X70A 1A6VH 4HQQL 5FGSA 3V0AC 4B53A 3KPOB 1U91B 4JZNA 4NKDA 4PTUB 5IBUB 1X6NA 2FEDC 1E4XL 3RIFF 1GVIA 5HBBA 2FB4H 2HVKB 3TWCL 1CD1A 2YD1A 5BMFH 4R2GC 5I2IB 1QLRA 4MLSA 3HZKA 2GAZA 5EB9A 1OM3L 1BFOB 4HGWB 4M7JL 4U1NA 1ZHLB 1IGMH 3MC0A 2WWMD 1NPUA 5SWQA 5MERA 4ESKA 3Q3GA 1UA6H 2UWEE 4KVCL 4YEFA 1IEBA 1OP5H 2B1HH 4H88L 5DD5H 3VW3H 3SO3B 4XPAH 3BDXA 2IMMA 1KJ3L 1MQKH 4MNQB 2XKNA 3LPGA 3TV3L 3MNWB 1K4DB 3QZWB 2YPLA 3VI3E 4DW2L 1YY9C 1PSKL 3LQAL 4MD5A 2BMKB 4KPHL 4UDUB 5BVJA 1RVFH 4Y5VB 3WFDL 1EX0A 2AK1L 3RWIB 4RIRB 5E24E 5E2WH 4LRNL 3V0WL 3EYOB 4Q9RL 5C9KA 2P8LA 3DHMA 1F2XK 3DPBA 3NFNB 4LCWA 4M3JA 5DFVD 3IETA 2FEEI 4NM4H 1YC8A 4DVRH 4UQ2A 3VXNB 3VA2C 1Z5LB 4L3EE 1L9NA 3QIBC 1U93A 2CO7B 3RIAF 2C3XA 1IFHH 1JP5A 3C5SB 5DHVH 4WRLA 4HS8H 1A3RL 1H8OA 5FHAL 4MQXC 4JY5H 1BF2A 2ADGB 4NO3A 1NCBL 3MRIB 3N1PC 2APTA 4TVPH 5D96B 3VD4A 5FKAB 4N1EA 1DQJA 3MRQB 5J6GB 1YEHL 2VLLA 2V9QA 2BVOA 4JDZA 1D9KA 2R1WA 3MOBH 4GKNA 4KV5F 5L0QB 1NH6A 3W11C 1MPAL 2X40A 4X7TB 1MI5A 3MBXH 4LPVA 1SYVB 2IBZY 5IOPB 2GITA 4RBPK 1FYTB 3PHOA 4XP1L 3AM8A 5DD1H 3BI9X 4W81A 1B0RA 3QFJA 4TULH 3WDHA 2VE6B 2ORBL 5EZOL 3UTSA 3KXFA 1AKJB 1OLZA 2OL3L 2GTWA 2D4FA 1U8OB 3TP4A 3ZDYF 3MLXH 4W6XB 2AJYL 4YHZL 1SEBA 1T3FA 3HUJB 4YBQC 1WUNT 5EC1B 4OIIH 3GSNL 5FM5M 1VA9A 3O41B 2Q8BL 3DUUB 3GSRB 3MBEC 1A7OH 4PJ9D 1IL1B 2AEPL 4O9HL 4HFWA 3OXSB 3FN9A 4I77H 1FFOA 2E8YA 4ELKB 3DO7B 2VZ3A 4WHCA 1H5BA 4LAQL 3V79C 2VN7A 1CXIA 1DSFL 1KJ2H 3MRDA 4J3UA 3BZ4A 3VXSA 1S7XB 3ARGC 1F5WA 1VENA 1YUHB 2Z35B 4P3DB 3L95B 4X98B 1RUKL 3QEQD 4L5FH 3FO2B 5TE4L 2HAZA 5J89A 4HIJA 4UOW1 3D3VA 4OQ1A 3P30H 3GKZA 3MYZA 4N0UA 2HKHL 1IILE 2R0WL 1ZHKA 4XTRD 4D3CL 1T03L 4F2MA 2O5ZL 2APFA 1ZHBA 4YIQA 3R4DA 5JOPE 2CO6B 3SCMC 2YZ1A 4YDIL 4FTVA 5IROC 3UXFA 4M5ZH 2EDNA 3H9YA 3UZEA 1LEIA 3NPSC 4OCMC 1FGVL 2BHUA 3RY4A 1HXMB 2N7AA 4WHYH 1NCTA 4UAOC 1YC7A 3SKMA 1KEML 4P5TD 3U1SH 2Z31A 4TOYH 5TDNA 3G6DL 1YEEH 1A6TA 5J12C 3MJ8B 1LO5A 5GGQH 4BQBA 2W9LA 2YN3A 2GCYB 2NPLX 4OV6F 1CE1L 4XVJH 5I1EH 4PG9B 3L3OB 4FS0A 4DQOH 2VXVH 4TTDD 2NX5D 5EOTA 1BP3B 5ETUB 2C9AA 4IJ3B 3N0PB 3S4SB 1QSEA 2DM3A 3SDAD 3G5VA 2AAVA 1RIHH 3HE6D 1TQBB 1FVCB 3DV6B 1ND0B 3BEVB 1OTSC 1RFDH 3C6SB 3MXWH 1LO2L 3SDCD 3GSVB 1CXHA 4BSVB 5H35B 3K2UL 3VFVA 1DR9A 2CRIA 2EH7H 2V9RA 5L8LB 2H9GA 1XR9A 4H20L 3O4LD 4IRJA 4NP4H 5E6ID 4QCIA 1AD9A 3MOQA 1MNUH 3OXRA 1RUAH 1FSKC 3PDDA 1QRKA 5I8CB 5FO7A 4O2EB 1MHEB 1NJ9A 5C7XH 4M43H 4OZGB 1KBGL 3WXVH 3IXTB 3B8YA 4K9EC 1A8JH 1U41A 3B6SA 4XMKH 1DL7L 5T3ZL 4WHYG 3ALPA 5D8JL 4KXZI 5DYOB 1LQSR 1MAMH 2IPTL 2UZXB 2EEDA 3AY4A 2W1NA 3M8OH 3NN8A 2GTZA 3VJ6B 2APWA 4NCC1 2DM4A 4HFUL 1CLYL 2AEQH 1KCRH 1FO0H 4QGYA 2YPKB 3MXVH 4YHYC 4M6OL 1YPZB 4UIMB 1ZSDA 3BP6A 3TBWA 2Z8WC 1A5FL 1N64H 2QSQA 1O7VA 4MA8L 3IAGC 2V5SA