1RIVH

Anti-cocaine antibody m82g2 complexed with meta-oxybenzoylecgonine
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
223
structure length
220
Chain Sequence
EVTLQESGGGLVQPGGSMKLSCAASGFTFSDAWVDWVRQSPGKGLEWVAEIRNKANNHATKYTESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCTSVPQLGRGFAYWGQGTLVTVSAASTTPPSVYPLAPGSGGAGSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTQVDKKIVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carving a Binding Site: Structural Study of an Anti-Cocaine Antibody in Complex with Three Cocaine Analogs
rcsb
molecule tags Immune system
molecule keywords Fab M82G2, Light Chain
total genus 43
structure length 220
sequence length 223
ec nomenclature
pdb deposition date 2003-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rivH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rivH02
4NQDA 1M7DA 5IHUH 3VXMA 5C1MB 1T80A 5FYLH 3CFDB 4RGNC 4QHLA 1RIVL 5J11B 3QEHA 4NQDD 5GZOD 4HIHA 4PJEB 3VXSA 1RQ5A 3MQIA 3GMQB 2NW3A 4IDLA 3VGAC 1EGJH 4TVPE 1N2RA 2F53D 1B0GB 5T33H 3BMWA 4NM4L 1MLBA 2GJ6A 3L3DB 4KJWC 3RVTC 3S5LA 3HG1A 3UJJL 5F9JA 1FZOA 1XCTA 3VFSB 4D0DB 1T1YB 5FYJD 3FO0H 5GGVH 4I9WD 4Z0BH 5MEOA 2P1YA 2YPKA 2ENSA 4LNRA 1ACYL 1N3NB 3TV3L 2H9GB 2JB6B 3AXLB 3C5SB 5JW4N 3PP3K 5D2NE 3WIHL 4OCXH 3RWJB 1OTUD 5AYUL 2ED8A 4U1NB 2V9TA 5SX4I 1Q9WB 4HFUL 2VL5A 3VXRE 4PTTB 1SEBB 4YX2L 5A40E 2IFFH 4TRPL 1FYHB 1BFSA 1B90A 2CIIA 3SDDD 2R0ZL 1SYSA 1DLHB 3CVHB 4GRWF 3LN4B 4M7KH 3OKMA 1OGAE 4QCIA 4C57C 4ZNEE 2N7BA 1GYAA 2AJZB 3BPOB 4QHKJ 4O51A 1N4XH 1MFDH 3UPRA 3GMMA 5GGUB 4GG6A 4Z7WE 2OTPA 4LSSL 1T3FA 3CVHL 1SJVA 4IMLA 1YQ2A 1RZJL 3AY4A 2DLFH 1LP9F 2ORBH 3OXRB 5IB1A 5E2UL 3AM8C 5IBTL 4UB0L 1ES0A 1FVDA 1HH9B 2BNRE 3HNSL 3QT2A 2R4SL 4KTEL 5DRXA 3LEXA 2HA1A 3MUGB 1M4KA 3CDGA 3SJVB 5J9PA 3FOMB 2XICA 4LHUA 2JJTA 3W0WB 3WLBB 5D8JL 4BZYA 3KNBB 3EOTL 3CUPB 5EU6E 5JHDB 5E6IA 2D7QA 4H25A 4PRDA 1FH5L 4NQCD 5K9OA 1RHHB 5LGJA 1J1XL 4H5SA 3JTTB 3C6SA 1EO5A 3IJYB 1Y6MR 1AGEA 3PDOB 5HDQL 4P2CG 3VRIB 4UOJA 2R0KL 3MRQB 3IJHA 4MCYB 3KPNA 1R3HA 3VFVA 2DDQL 2VLRE 5C3LD 4OF7A 1EXUA 1LP9E 1PQZA 3KPNB 5KAQF 1MOEA 5B8CC 2HKFL 2HMIC 4Y5VC 5SX5H 3OAZK 1DL7L 1NFIB 5D2LE 1SBSL 3IAQA 4NP4L 1FFQA 2XA8H 3ULUC 4RMUA 2MTPA 2J6EA 1Q72L 1QHOA 1GC1H 4U6HB 1RHHA 5LGJB 1A0QH 1IGJA 1NDMB 1T5WA 1UZ6E 5I8OH 1NUFA 2OTUA 5FAAA 1BVLB 3RWIB 4C56B 4U4BA 1IM9B 4MA8H 3WUWG 1HDMA 5I1IL 5C0AD 3WS3B 1EVUA 3K3QA 5EUKA 1I9RL 1I8LA 5DMIH 3PV6A 2GY7B 4N9GA 5T5FL 3RBGA 3A6CL 2B5IC 3EGSA 1CG9A 4NO2A 4MCZB 3QZWA 4P9HH 2Q86A 3T2NH 5GSVA 1V7NL 4FOMA 4JCMA 3LS5L 5EZOL 4OCNC 4NO0B 4U1IA 3GSWB 2O5ZL 3TO4C 1LWRA 2CDFA 5KAQG 4H1LB 3ESUF 5AZ2H 3U2SA 1ZWIA 4F7MB 5E99H 2YMXH 5E8NB 5E00B 1R3IH 1AGFB 3QWRD 1Q0XH 5EU3B 1Z5LA 3VG0H 4W4OC 5JPNB 4O5LL 3SCMB 4RIRB 5GRUL 2FL5A 1QKZH 1MCHA 4LSQH 3QO0B 2XQBL 1KLUA 2DLIA 4XMKH 1AY1L 1JZ6A 3TESA 5E0QA 2WIMA 1E27B 1NMAL 1BQLL 3WHE0 5IR1B 2ED9A 4H0HB 5J13B 4JFPB 3B9KA 5A16A 1ONQA 3MRRA 4QLRA 1KT2A 4JN2B 5I1DB 4PJBE 3RWJA 1RZKH 1TCRB 4ZPVA 1N59B 5B8CA 3MRMB 2R9HD 1EUUA 3U0TA 3MRHA 4KKCC 4M43H 4WIQA 3WFDL 4XMLL 4GFTB 2I27N 3H2WA 2C3VA 3EO0B 4P9MH 2PF6A 5FV2A 4KKAC 3DPBA 3VFGH 4AEHL 4P4KC 3OR7A 5BOZG 2XY1A 3QIUB 2JCCE 3MLSL 5T3ZD 4YXKH 4GBXC 3HUJF 5J1SC 2CRZA 1DBML 5F6IC 3S96B 2DAVA 4GBXA 1TNMA 3FFDA 4ZAKA 2CMRH 1MLCA 5E1AA 4JM2B 3OAUH 1E4KC 5BQ7A 2G5BB 1CD1B 2DM3A 3V4UL 1TPXB 1NH6A 3U36A 3H42H 3VGAB 4EIGB 3TPUA 3HC4L 4JG0H 3SGDH 4UZGA 1LK3L 5KSAB 3MV01 4LCIL 2H6PA 2VKWA 1I85A 5H8DA 2GK0B 1FAKT 4IOSD 4JAMB 4XZUB 1KTLA 3L5WA 1L9NA 4I8DA 1DDHA 3MLYL 1G0DA 4ZS6C 4LP4A 3UBXA 1RSFA 4Y88A 3O3DA 1DBBH 3PQYD 4ZFOA 1KFAL 3QULA 1IGTA 1N5YL 5HGDA 1TETH 1FZJB 3IDNB 2EDTA 2VTFA 1NGYB 1BJ8A 3O6LL 4PRPB 3AB0B 3ZKXB 4OCLC 4KZDL 3TPKA 4HJ0C 5AAMA 4U1JA 3Q3GB 3LKNA 1AFVH 2AP2A 2YC1A 3PGCB 5IOPA 1LO0L 4J7RA 1BZ9B 4F7TB 1CDHA 2VAAB 4O2FB 2ZUVA 2WP3T 2XXMB 1CL7L 1CFVH 5GS1C 3SDAA 3CGTA 3IFLH 4NWUL 1JPTH 3BIBX 5GS0D 2DS4A 1H8SA 1Q94B 3ME0A 5IGXH 3X12B 1MCDA 4L5FH 3IRZA 3DX9B 1U8KB 1OP5H 3AREA 5CEZE 1MUJB 1KC5L 5FYJL 4X6DE 3MNWB 5KOMC 1IC7H 1IKFH 5C2BL 4QXUH 4KTDH 2KUTA 1ADQA 2BVTA 4G9FD 2VQTA 4C4KO 3MUY1 5DMKA 4B7LA 4JCLA 1B2WL 2VLME 2NY0B 4JDZA 1MCSA 1IQWH 4KV5F 5KS9A 3HE6D 1CDGA 1MAML 2NX5A 4ZS6D 4PRNA 4MAYB 2P5EA 4XGZB 1ZLVK 4K9EC 3TYGH 1L0YA 3RNKB 5FHBH 1IM9D 2HH0H 2VZ1A 2DMKA 4JJ5B 2FEEL 1KCUH 4IIQB 1CLCA 2Y23A 4WHYH 5IBUB 1MPAL 4YDIH 1KPUB 2YD6A 3T1FA 2J8UE 5T3ZE 3VXSE 1P6AB 5IJVA 4XP5L 2FJFA 2QQQA 3G5XA 3KPRE 4Y4HC 3VXTB 2UWEF 4Z7VA 5FA4B 5T5FH 5F3HA 3T3MF 1PKQB 1VFBB 4NNXA 4Z9KB 1PSKH 1KPRB 2ICEA 5IV2A 4PJ9C 1D9KB 3HC3H 3CSGA 1W0WB 5BZWB 3TYFB 4LPXA 1AO7A 6FABL 1YQVL 3QH3A 4ZDHA 5EU3A 4MNQA 4OZFB 4PJIB 2OLDA 3ILQC 5BRZB 4F7MA 2EO1A 4MMZC 4OCYH 5C86A 1H5BB 4OD1L 4Z7NF 4LSQL 3U83A 5TPWL 3IFPA 5FB8A 1V05A 1U3HD 4HAFA 2QLVB 3LV3B 3LKSB 1T1XB 4CVXA 1U8JB 4JREB 5BJTB 2B1AH 4HS6A 1MIEH 4QRUB 5DJYA 5BS0B 4KVNL 4FG6D 1F58H 1QSFE 3HFMH 5CJOH 5J89A 3GMRA 4ZXBA 1DBKH 3RY4A 3VWJA 4JRYE 3LKPA 3NGBB 2HT3D 5JA9A 3DWTA 5EB9A 3V95A 3AS2A 2XNAB 5DD0H 5SWZE 2AI0L 5I8CB 3OV6A 4X7TA 3ARBA 4OSUH 5HHMD 4LLMA 1QLRB 1I7TB 5DFVC 5MENA 2QSTA 4ZAKB 3HMXL 4NZTL 4WDIB 3BZFA 1DBMH 2DF3A 3KLHD 1SY6H 2WWMC 2O5XL 3GBML 2F54A 1NCWL 4F7PA 4LSUL 1SJHA 2CK0L 1FL5B 4HT1H 5D7JA 1MHCB 4APQD 1U42A 1EFQA 3QEQB 1B9ZA 3M1BB 4JKKA 5L6YH 2PETA 2CUMA 2C26A 3H3KA 4PG9A 2ATKA 1WWCA 1Y18A 1VPOH 2WNGA 2VQUA 2WBJA 4UTAL 1UWXH 2J3SA 1JP5A 2JIXA 4OF0A 5CJOL 1LK2B 2IGFL 4ZFFA 2Q8AL 3PWUB 3UX9B 3CU7A 1HWGB 1JYNA 3OAYH 3WIFB 5C09B 3T0EE 2C4XA 1AD9A 4GMSL 1BWMA 1HSAA 5HVWA 3MC0A 4FXKB 5AYQA 2J88L 3BPLC 1NANI 2R2EB 3OKOA 1R24B 4LKCB 4OT1L 2NXYB 2DL2A 3ARGC 3UTTB 1OARL 3ORJA 4JEGB 3EYOA 1CICA 1MCWW 2C7UA 1UM4L 1HDMB 5EU6D 4DQOL 1A2YB 1FJ1B 3L5XL 4E42A 1BOGB 4WHDA 3QHFL 5DR5H 2G5RA 2APFA 5D7IE 35C8H 1HHKA 2YD9A 2GUOB 3RRQA 5C0BA 1NLDL 2XXCB 5H2BB 2HP4A 4DN4H 1AGBB 3KPRB 4MDJA 4DZBA 3QZWB 2WUBH 4F58L 3KLAA 4JE4B 1S7RA 3V4PL 3QISA 3QIWB 5I19H 1QD0A 3C08L 2GJJA 1EHXA 2JJSA 3EJJX 4WEUD 1NGZA 1YNLH 2JJVA 4LCWB 1FIEA 1T66C 3D48R 4A6YB 3DUHA 2M1KA 1P5UA 1I1YB 5DFWH 3I50H 2BY1A 4DGYH 1AR2A 2OTUB 1CGUA 1HHIB 3RWIA 3TVMB 4DVRH 1QFUH 3Q5OA 3ARDB 1OY3B 3GFUA 5C08D 3FONB 5FYLE 2FX7L 3WFEL 3LPWA 1KNOB 4X4ZA 4XMKL 1NBZB 1MJUH 3K80A 1U92B 2DICA 3QCUH 2A74B 5JW4Q 3FB7A 4OLVL 1OTTD 2BFVL 3MJ9H 2X4PA 5E8DL 1QKZL 1FFPA 3SO5A 3V52H 3EYFB 2Q3ZA 2P24B 2EYSA 5BS0E 2DLHA 4TNVF 3FTGA 4DKFH 1L7IL 3MV9A 4NC2B 1LO3H 2OJEB 2F74A 4F2MA 5AG8A 3K1DA 3RDTC 1S3KL 5EWIL 3TNNA 4P3CH 5FUZH 3GI8L 1ZA6A 5DQDL 3V7AG 1R3KB 1WC7A 5C0AA 3TBSB 3T4YA 2KBGA 3M17A 1RZGB 3WFBH 3VXUA 4KDTC 4EI6A 2NY7H 3UTSB 1X5LA 5JMRA 4NQUA 2FJHB 3O81A 5D1XB 1I7ZA 4YQXH 4QCIB 2XTLA 1XT5A 5DRNB 1T04A 4W70A 3ARRA 3C9NA 3BEVB 3JV6B 3MV7A 2A0LD 3IB4A 3KR3H 4HWUA 4D8PA 5EFIA 1FL6A 1EK3A 5J56B 1OAQH 3FQXB 3HE6B 2PXYC 3C9NB 1RZJH 4ETYA 2VUOA 5ELIA 3QUMA 1P9MC 3C6LB 3V6ZA 5EPMA 1CYGA 3C5ZA 4NHCL 2CLZA 4U1SB 4BM7A 3MA9L 4R97B 3C60B 5DRWB 2FGWL 5CZKA 5IW6A 1BBDH 1D5MA 2CLRB 2H2PD 5FUZL 1RAMA 1QG3A 1FSKB 1CGTA 2XWJA 4OUUB 5DHYA 1D9KC 1YEIL 3L95B 4FFVC 4KI5C 4MXWL 4RMTA 4PGEB 4OZGB 5E94A 3P4OB 1CDCA 5IFAH 1SJHB 4XAKD 2OJEA 3EKCA 5CP7B 3UTTE 4OIAA 4QRQB 3PIQB 3E1F1 3UC0L 1GGIL 1R0AL 5DZLA 3UYRL 1U8OA 2OL3H 3QG7L 4XCNA 2VL5B 1R3LB 5GHWL 4AH2B 3S7GA 3JWDC 4YXHL 2M26A 3BJ91 1R5VB 4YDKH 1YEDB 1VENA 1CQKA 1YY9C 1OAZH 4IIQA 3V8OA 4L4TA 5CFHA 5FB8B 5CJ5A 2HJKA 4HLZG 3FJTA 3VRLF 2OS7A 2P5WD 2MCPH 5CCKL 5I2IB 1CGXA 4LCWE 4K3HA 1I8IB 4URTB 3F7VB 1JNHB 4LLWB 5LJYH 4NWUH 4X4XB 3SOBH 2R2HA 1KPRA 5IV2B 1G9ML 4JQVA 4BSJA 3STLB 4FQJH 3VI4F 3LD8B 5HY9B 5DC0A 2W38A 4F9PC 2XN9D 2PXYA 5HJ3B 2I9TB 1CGVA 3KGRA 2H41A 5IVOA 2MHAB 1IQWL 3DLQR 3OPZL 4BQCA 2AJZA 4AIXA 1GGIH 1ED3B 5C09D 2ZCLH 1J10A 4NQTA 5I8EA 4H26B 4PG2C 1L7TH 3HNVL 5D6DA 5KS9F 4KDTA 1KPVA 3SJVD 1JYWA 2PO6C 4XBGA 5K9JH 3JWDL 3K2UH 4HKBA 2AXFB 2NZIA 1C12A 4Z78A 5C07E 1KFAH 1TVBA 2IMMA 4F7TA 4FMKA 4OZHF 5L7XH 3VG9C 3ARFC 4APQB 1UKQA 3MGTA 4X83A 4NPYA 4XPFL 5I1HL 5TDNB 3Q0HA 5JHLH 3OJMB 4QO1A 4F33A 1F3DJ 1KTDA 3LD8C 1C1EH 1QFWL 2IADA 1LO0H 1KLGA 3IDNA 4YAQA 1FLRL 5D7SH 1MJ7L 4NOBA 3PWPA 2YUWA 4PRNB 4LSTL 2DLFL 4M8VA 1EEZA 3CFBB 5MERA 2VJXA 4Y5VB 4JFEE 3RPKA 1DUYB 4HUVB 1TJHH 5EC2B 1X4XA 5ECJE 1I7TA 1IZJA 1T2XA 1JFQL 1HXMA 2AJSL 2FGZA 3LQAH 4JFDA 4M1CC 5JORA 1EAPB 3GB7A 2A83B 3MLVH 4S1SL 4LSDA 4Z7UA 1R5WB 1PBYA 3BZ4A 1DN2A 4XP9H 3QWOB 4WWKB 5GRJH 3O3BA 5L2JB 3UTQA 3ULVC 1I1FB 4YO0A 3V0WH 3HZVB 1MI5E 3F6IA 2EDBA 4XBEH 3CFEA 3B43A 5DJAB 4X6FA 4PJHB 5CGTA 3E2HC 5E2JA 1S7WB 2DQTH 1F4HA 2VR4A 1G9EA 4ISVB 1FV1A 3DVFA 4XNMA 2V5RA 4KU1A 3U9PH 3ULUE 4B50A 3SKOA 1KIPB 2QADD 1RVFH 4K7FB 3LQZA 3O45B 1FZMB 5JR1L 4OF5A 2GJZA 3QQNA 3WNLA 3EYUH 1ROWA 5H94A 2FRGP 1RK1B 1AO7B 4R4ND 2LTQB 1H3XA 4TNWK 1LO2L 3CPLA 4Z0BL 5FGCE 5J11C 2VLKB 1FFOB 4I4WA 1TJHL 1B0WA 5D2LA 5TH2B 4LU5H 2A73B 3ULVL 4M9PA 3FMGH 3R06B 4K23H 4ELKA 4PJEF 2VDQH 3VD4A 1LDPL 5J7CC 5IKCA 1G7IA 3DV6B 4HEPG 4X9HA 4JPWL 4V1DB 1PEWA 5KSAA 1NAMA 4DEPC 2QQNH 3RKDD 2Q8BL 1A6WL 2IEPA 2XPGA 1P1ZB 4GT7A 1R5IB 3UTQB 3UYRH 4NZRL 3LEYH 4R3SA 5HI4D 3PDDA 2E27H 1B4JL 5DDHB 3IF1B 1VEPA 1U91B 3H7LA 3QDGE 4IRZL 3SDXF 5GRUH 3W9DA 1YNTB 4XVUD 5JW3L 2VDOL 1T0MB 3RPIA 2LTQC 1BJMA 3DRTA 2IG2H 4HC1L 5KG9B 1JRHL 1DEEB 2BRQA 2XWTA 2RB8A 1F4XL 2CKBH 3GSVA 2DKMA 5HBBA 2QQKL 1UXWB 3C8HA 3UCRA 2LAGB 1NMBH 4PRHB 3FAWA 5SWSA 2ZZUT 4G5ZL 1NGQL 3TIDA 5CGMA 4OTXL 4LSTH 5ESVB 4PJ5A 1Z6JT 1KJ2A 2OR7A 3DVNB 4OZGA 3S5LG 2ED7A 1FG2A 4L8SB 1RK1A 5TE6L 3HG1E 3KWWB 4KI1A 2VDQL 4JFEB 1H5BC 3T4AB 2Q76B 1KJ2L 4PRIB 5A43C 1AJ7L 5EU5B 1WJ3A 4JANA 1M7IB 4JM2F 4XTRC 4H1LG 4IRJB 4JZJC 2JCCB 4U6XB 4WW2B 3QNYB 5D1QB 1VHPA 2I60H 5MEPA 2BNQB 4OZIF 2HMID 4ISVA 2ITDA 5B4MC 1SM3L 3VXRA 2Y07L 2BXZA 4ESKA 3KXFE 2AV1A 4JFQA 1BFVH 4XVTH 4ODTL 1LDSA 3CUPA 4CDHA 4MA1C 4JJHA 4NOFA 4NKMA 1MAKA 1M71B 4YHZH 1WSST 4HGWA 3BZ4B 4PJ5E 1EFXB 2YR3A 2W59A 3P0VL 5KSAD 1HYSD 1VEOA 2PYEE 4IBLT 2A6IA 1INQB 2X4QA 1FVCA 1A1OB 1JF6A 5I74C 2HFGH 2DWDB 4MWFA 4GRLD 3Q1SL 4CJ0A 4XZUA 4KXZI 4PD4J 4S0SD 3BH8B 3UTPE 4LPUA 3W11D 4RBPK 5JDSB 1B6UA 3DV4B 5ERWA 3GI9L 2AK1L 5I8KL 3I75B 4L5FL 2R69L 1RULH 3VH8G 5MENE 5IW3A 4PY7A 2BNRD 1QRNE 4EXPX 2NY0C 4H5SB 5AD0B 5CLWA 2O5ZH 4F58H 4N8VA 5F7YC 1CDBA 2AJYL 2X1OA 2YZ8A 1VFMA 4HS3B 1GAFH 4HK0B 1CFQA 1MNUH 2EXYC 4DKEL 1ZLWH 3BUYA 3CXDL 3GO1H 2HT3C 4KJQD 4HK0A 2VIRA 2YD5A 4QTHB 4JQXC 3CU1A 1TTFA 3B9DA 4XBGB 3MV7B 1J86A 1ULVA 5JHDA 4LIQH 4LNRB 4RIRA 1C16A 4OZHB 1T04B 3GMLA 2P8LA 5EIVA 4XXDA 5JOFA 1KB5A 3PHQB 1YEJL 3SHSA 1HKFA 5IEKB 4I18A 3MJGX 4NNYB 1ZGLM 3PWJB 4HPOH 4S10A 4MA7L 2I9TA 3GKWL 4NQXA 3C6LA 5I18H 1T1WA 4XNYH 5JIPA 4BZ2L 3LPGA 4MNHB 1TZGH 1FVEA 5DUML 5F9AC 4Q97A 4NQXB 2VAJA 4M1GH 2P47B 8CGTA 7FABL 4HF5H 3V4UH 5H37G 2EDOA 2KZWA 4HHAB 4JDTH 3FN0H 3EOTH 4PJAB 1IM3A 1F11B 4U1NA 3DHMA 4QYOA 4WW1B 2DWEA 5ESQA 3RY6A 3RWEB 3TFKC 1B0RA 4KK6C 4OM0L 1G6VK 1NGXB 4HDIA 4N90E 3RDTD 4TOYH 3VE0A 1MCPL 4ZUTB 3SY0B 5T1LB 1LNUA 3O2DL 3LH2L 1A7NL 3QHZH 5JUEL 2C1OB 3MODL 5CD5D 3BGFC 5D1QA 1IBGH 3LN9A 4N0FB 3BQUC 3L3KB 5DJ6A 1X9QA 1NC4B 5IG7B 5INDB 1F58L 2WSKA 4KI5E 4FQ2L 2X5PA 3SKJL 2NY1D 5CBEA 1E28B 3RVXC 1ZANH 4NQVB 1AHWC 5DC9B 4PYHA 3GSNA 3O8XC 1BP3B 3O6FD 3DROA 4WI8A 3HE6C 1IAIL 4ZUTA 5EBGA 3WFEH 4LL9A 3ARBB 2A9NH 3DVIA 1R0AH 5HDBF 5DRWA 5IW6B 2EC9T 3CMOH 4XPBL 5J1TC 2FLBT 5ICZB 4X7EC 5E2VL 2LU4A 3RX5A 4AIZA 2OP4L 4F7EB 2DOCA 5T1KD 5TF1L 3WN5C 3RIAF 4P2OC 2HTLD 4LQ1A 4HWBL 5CEYA 3BP4B 3O6KL 1JGUL 5LBSL 3TBTB 4LRIC 3DSFL 2LV4A 5D7JC 2WZPD 2EE2A 5C71A 4JRYB 3QFDA 3AFLA 2XG5A 3HNSH 1JYVA 5JXEA 4N0UB 2XQYG 3LZFH 1P2CA 3IF1A 1LE5B 1CU4L 4PJBA 5HHOE 1JPSL 2JIXD 3UBXG 4D2NA 2MWCA 4PJIE 1AIFB 1A02N 5IROC 5ILTH 1RFDH 4YHLL 4NO3B 5IEKA 1VEMA 2CR3A 2VXTL 1NCUA 4R2GB 3SKMA 3D3VE 3CJJA 4N8CH 2E5EA 4HK3J 4OZFG 2EH8L 1VDGA 3NCJL 3QDAA 3CSYB 5KZCB 4RGOH 2ICWB 4LHQB 1ITBB 5DTFB 4UOW0 1YPZF 1VFBA 2DKUA 4KVCH 4NNXB 3GUTB 1H3PL 1RZ8A 5EU4B 5FUCE 2ZUSA 3PV7A 2P43B 5TH2A 1RZJC 3NIGF 3D3VA 1A6ZB 4X0KB 4D9LH 4R96A 5DD0L 2IANE 2ZCKL 3DVNA 4GKNA 5TQ2L 4G6FB 1SBSH 4NO0D 2X4OB 4G7VH 4LLMB 5HHXL 1KPUA 5K9JL 2X41A 3BP6A 2GJ6D 3MR9B 3SKNA 1K3IA 4A2LA 1XCTB 3G6JF 4NRZB 4R3SB 4NKOB 4H0GA 2VDPL 1MHEB 3E0GA 5BV7H 1W2KT 1NGPH 1T5XB 4M61B 2PTUA 2P5EB 2IAMA 4YR6B 4PJAE 4Z8FH 4NKQB 1MQ8A 1ORSB 3QEQE 2AV7B 2CR6A 2YEZA 5D1QC 3WHE1 3JWOC 3CFDA 1YJDC 4PV8B 2Y6SD 2HT4D 2JE8A 1Z0MA 4DN4L 4OCWL 4UU9A 5D8JH 2HFEB 3H42L 4YFDB 5IJKC 1YQVH 1ZT1A 4XRCB 1I8MB 5I0ZA 3STBA 3ZKMC 3RI5K 3VA2C 4POYA 3OKLA 3CX5K 5C0BB 3ULUH 4XNXL 4TULH 1XGPA 1C7SA 1E4WL 3S37H 4FQQB 5DURD 4HZLA 3KHQA 5HVHC 1KACB 3NABH 1MFCH 4MAUL 1KIQB 1PX4A 1HHHA 4JO3H 3ZDYF 1A7BA 4JRXE 4P5TB 5T3ZH 1EEZB 2YA2A 3CFBA 3GJEA 2NXYC 4HPOL 1KXTB 2OXHA 4OQTH 4TSAH 3RWFB 4XCEA 5GQBA 3MROB 3VRJB 1AHWA 1I1AB 3ILQD 2PYFA 3WD5L 1JZ4A 1NCDH 1Y0LB 2QQLH 1KB5L 4C83A 1XIWC 1CFSA 5GIRA 5IQ7L 2NPLX 1PY4A 2NY5H 2NZ9D 3D25A 2EYTB 2OM5A 3Q5TA 4R0LA 4NT6A 4WHTA 1CFSB 5GIRB 2ATPA 5I1AB 2AJVL 3VWKA 1CDUA 3W11C 1GCFA 3G5VB 4HJJH 2FCBA 3KYKL 1H0DA 2CK0H 4HT1L 5I73C 2R2CA 4FQ1H 1YYML 4IRSD 1HSBA 3HE7A 3MFFA 4GRWE 5E9DA 4OCXL 3FFCE 3Q2CA 5JZ7C 4BZ1L 2W9LA 3VWJC 1OAYL 4X4ME 1ACZA 4PP2A 3QWQB 1SHMA 1V7NH 3UPCA 3OXSA 1AXSB 4XNUH 2D31A 3TVMC 3ULVE 3GMNB 3DBXB 5DMIL 4MJIE 3RWHB 1MEXH 4MX7B 4KUZH 3KJ6L 2PW1A 5FUOL 1PX3A 1SMAA 5F1NA 2E6PA 3S88L 4CMHC 1UZ6F 2B0SH 4TQEH 4RFOL 1P4BH 1I8KA 4XHJD 5LXGH 1JV5A 1K4DA 2WWKT 3T3PE 2PTTB 3CCHA 4EN3A 1NEZG 3QDJD 4ZSOB 3WNMA 4CL7A 5F6HI 4IMKC 3PL6D 4HWEH 1CZ8H 4YHPA 5I0DA 4MQSB 1IJ9A 2Z4QB 2D2OA 3IGAB 1XF5B 2HTLC 2FBOJ 1FAIH 5IP4A 1KJVB 1SQ2N 3W81A 3K2MC 5BO1H 4XH2B 4YNYB 4NM8L 4F3FB 3D39D 4YC2B 1FNEB 4LAJH 4K2UL 3B3IB 5DRZB 4RWHA 4M62H 4QOKD 1T83A 4APQA 1B88A 4ETQB 1JHLL 1M6OB 1RJYA 4XX1G 5D1XC 3L7EB 3VFOA 2DQEH 3BYTA 1IGTB 4WENB 1ONQB 3MRRB 2H26B 1MREL 2VDKH 4PREA 3MNVA 4U2ZA 2EXWC 1QFUL 2VISA 3MV9E 5IVZB 5KVFL 4XI5C 2H8PB 3ULUL 1OAZL 1Z5LB 4ZYKB 2EC9U 1RULL 4CW1B 2FL5B 5EORL 1GPOL 1A6AB 2WP3O 4ZUSB 1DQDH 3B4NA 3QPXH 4UQ3B 3RKDC 4MD4B 1F6AA 5HYJB 2UY6A 3R1GL 2Y4SA 4AYFA 4LEOA 1MCIA 3U7YH 4KRNA 4X6EA 3O3BB 4V2CB 1QSZA 1A0QL 4NO0A 4XCEB 4ONHB 1GGBH 2AJXH 3HNTH 2PN5A 1FYTA 2Z4QA 4X99B 5F21B 3TBTA 3WFZA 4AEFA 4PJHA 3CFCH 3HCVB 4PRBB 3GRWL 4JFYB 2DIBA 2C3HA 2NY4D 1CS6A 1HYRC 4NM8H 1MIMH 5I1LB 3KVQA 5B39A 3TBWA 4YHZL 2NMSA 5HHXH 4E41A 3SDXA 2Z35A 1RV6X 2ZCLL 1SEQH 4QHUA 5TJWK 3LEYL 2BMKB 1AGDA 1KLFA 2IMNA 4U1HB 1CD1A 4JO2H 3PGFH 3JWNC 4PGEA 2EIBA 5T1KA 1XF2A 3C5JB 2V5TA 1KLGB 3RNQA 5C0EA 1WFNA 2A1WL 4QXTB 5IROA 1FCGA 1KT2B 4JN2A 1SY6L 4LQFH 2JTDA 1D5ZB 2DJSA 3C5ZC 1S9VA 4PP2B 3EOBA 1L0QA 5DO2D 1I3RA 3QCVL 3C09B 3IS0X 1WISA 3RJQB 3ULUD 3HMXH 5EU4A 5JXAL 4ODXA 3IVKA 1KCSL 3DO7A 4Z7QE 3AVEA 5E9DB 5MEQB 5E4EC 3S36H 5L6YL 5K33A 1RIUH 2AABH 3WIHH 4POZC 1NDGB 5T1LA 1GZPB 4HFWA 3CSYA 4QHNA 3MR9A 5LWYH 5ADOH 1KNOA 2VL4A 1WLHA 5EFIB 3HE7D 4N0YH 1G7HA 4RFNB 3LB6C 3QQ9D 1RZKC 4JFDD 2GSIA 4NQEE 3W0WA 2W60B 3QJFB 1JNNL 2R0LH 1EBPA 1GZQA 4BH8B 4R96B 3MRJB 4KHTH 3L7FB 2MHAA 4U1LA 4IHOB 4BELD 3UJTL 5DEZA 4I1NB 4Q58C 4MJ2A 3HE6A 1T6WA 2E6JA 5FA3A 1CXEA 1D3CA 5J12C 1GGCL 1KLUB 3QG6A 1UM4H 2E8ZA 1WBYB 2MKLC 4JVPA 3RGVD 3X17A 4TSBL 5ACZB 1I3GH 2V17H 1UM6L 4GOSA 3QEGH 5K9KB 2X4NA 4X98B 3QUZA 3P0VH 5DVNA 4XMPL 1ADQL 1NBVH 3RZCA 3EW3B 3SGKA 2GCYB 1UB6A 4PJFF 5GGUA 1JVKA 1NCBL 5BRZE 1JGLL 2AK4D 4WFFD 4HBCL 4WV1B 3OAUL 3SDCD 4WCYL 1OWRM 3CH1A 3D0LA 3BDBA 2ERJB 5I19L 2FYYA 3X11B 2MCPL 4M9OA 1MFBH 3EYOB 1JE6A 5GGQH 1E28A 2R0WH 1KYOJ 1LK3H 4KUZL 1KELH 1A6PA 4GG6F 2PR4H 1XF4A 5D5MF 2IH1A 1TZIB 3IJHB 3GBMH 5JR1H 4OZ4A 3DTXB 1QSFB 3C8DA 5C09A 3OF6D 1N5AA 2Z8SA 1N3NA 2CUHA 4UQ2B 4NQED 5JIIA 4WU5A 3VE0B 5K9OB 1QQDB 4PB9H 3U7WH 3X11A 1N5AB 1TCMA 1S9WA 2NY5C 1XAUA 1CTNA 1JL8A 3KNBA 4EKXA 3TZVA 4RSVA 4FABH 4Y4HA 4LPTA 1VADB 5LAXA 4M3JA 4LOUD 4ZXBC 2BVUA 2R29L 1FSKC 4GSDL 4I0PA 3EDJA 4HBCH 4WTXA 2JB5L 3MUHL 4K7PX 2C1PA 3S36X 2Z8WC 3T77A 3KLSA 4XWGL 4Y16A 1OP9A 2OR8A 3QXUA 2X4NB 4X98A 5HGHB 1D5XB 2B39A 2Z93A 1F8TL 2NW3B 3GMQA 1J0JA 4HJ0D 2BJMH 2VDLH 5EZLA 1IRAY 1N64L 1UM5H 5EO0A 2WUCL 4LDLB 1BIIB 3AB0C 3MOAL 4EBQL 1ZVYA 3OX8A 3VXMB 4FTVD 1BQSA 4P23A 3UPRB 2A77L 4L4TD 1ZHNB 5DO2C 3EFDL 3BKCH 1A3RH 1U8MB 4NKMB 1T4KB 4P57B 4U3HA 2WBJC 1X4ZA 2J8UA 4XC1H 4U0RB 3G6JA 3ECBB 5EC1B 2C4FU 4RMVA 5ALCL 2P8LB 1AKJA 2RHEA 1WAAF 4JFOB 1YN7A 3ALPA 3JVGC 1AJ7H 4GAFB 3S4SA 3ILPB 5I15L 1XGRA 3LDBC 1PGRB 1RUKH 1A5FL 4LP5A 4G6ML 3RWDA 1WC7B 5AZ2L 2NY6D 2Y25A 2XKNB 3NACH 1U8NA 2A6DB 2ZKHL 3IFPB 3G9AB 3WDIA 4PRHE 25C8L 2FBJH 2MKWA 5IBUG 5KVDL 3SO3B 5FOBB 5FCSH 1N7ML 2HAZA 3QFJB 3IDIA 5F1OB 2I07A 4R26H 1DFBH 1KB5B 3TO2A 1KSRA 4HMCA 3RUGE 3Q6FA 3O3AA 2APXA 3S37X 2D9CA 4EQ3A 4PJDB 2JJTC 5L8KB 1S7TA 3ARQA 4OV5A 3TNNB 2FX9L 3SPVB 2RCSH 2XNAA 2LAAA 3DURB 4LAQH 4KKAD 3TVMA 3T3PF 4KMQA 5IQ7H 3CLEL 4GKZA 1S7XA 1L9MA 1NC2D 2XY2A 3U7AA 1TZIA 4BUHA 1WAAE 3RPIB 3UAJC 2EECA 5DUBB 3MLTB 3W39B 1P4LA 2Q7YB 2BZDA 5F7FA 2AXGB 2I9LB 4RAHA 3LV3A 1KV3A 1GGUA 3AM8A 3QIWA 3CXHJ 4ONHA 5BVJB 4EUPH 3D18B 4LKXA 5D70H 2E9JA 5E6IB 1N7MH 3RVWC 4K23L 1UCBH 2ZNXA 4PJXA 1U9KA 1F42A 1WK0A 3MRLB 1GJIA 2OZ4L 1CIDA 1MCLA 4Z7UE 2Y7QA 4YFLF 3VXSB 2X6MA 1CICC 1RIUL 5IFJB 5JQ6H 4EDXA 1T7XA 2QR0B 1OAYH 1JGUH 1RJLB 4M6OH 3ROLB 3UTTA 4F37F 1E4KA 3VFRB 4MHHG 4PJCE 1IGIH 3BWAB 4RQQA 1JGEB 1FPTH 4UT9L 1IGML 4KUCF 1TJIH 2ADGB 1G1YA 2F8XC 4HGWB 2GTWA 3PWNA 3QRGH 5HHNB 2Z31A 2V5SA 3NZHL 1BX2B 4XHJC 5H35B 4ZTPH 4Z95H 4JPVH 2IALB 2VXVL 4HCRL 3T3ME 4P23C 3MRCA 3BOVA 2VZSA 4OF3A 1DLHA 3CVHA 4KQ3H 4LLUA 3IXTA 3V0AC 3T2QA 1G7QA 2F5BH 5DD6A 5I1JL 5L0QB 1QR1A 2P44B 4PY8I 1AGCB 1OGTB 4NO5A 5JHDD 1S7WA 1IC4L 2X1XR 1K2DA 2AEIT 1M6OA 2VZVA 1DR9A 1FAIL 5FO9B 4LMQI 4JG1H 3AAZA 3L9RB 5C0IB 3TN0A 3MBEB 3RVVD 4J3XA 3OHXA 3AC0A 5FGSA 4WVRA 1QRNB 4K3DH 1OAUL 2A6JB 3IGAA 3T0VA 2H1PH 4PUBL 5F9DC 4E0RA 4MX7A 1UH2A 2DQUH 2VB5A 1LE9B 5EORH 1UEMA 3TJEL 4YGVB 1QFWI 5IB5B 3TV3H 1ACYH 2OSLB 1XIWD 4HUKB 1GRWA 1UACH 4YBHA 2VYRE 4P5KB 3ESVF 4XB7A 3S35H 4YIQA 5I71C 5BV7C 1RIHH 2PCPA 3NAAL 3ZKNC 1TQBB 4XPGH 2NY3C 4R90L 2QKIB 3G6AB 4Q6IA 3HR6A 1QSED 1CLZH 4Z7OE 2ZCHL 3EYSH 4AJ0A 3Q1SH 3CX2A 5I17A 2X4RA 1CE1L 3NH7L 4XWGH 1QA9A 2WW8A 5F96H 2F53A 4V1DA 5DT1L 3T0EB 1EA9C 1F2XK 2AEWA 4Z0XB 1LEIA 3DYPA 3MOAH 1QR1B 4JFXA 2DQIL 3HI5H 4F37K 4TVPD 4AM0B 5KBNC 2ESVB 4PJIF 3ZTNH 4AIOA 5I1CH 4NWTL 5DJ0A 3QIBA 2QQLL 4QKXB 1I1FA 1DQQA 1P84J 4YO0B 4ZMAT 1CVRA 4JY5H 4S1RH 4JM4L 3QH3B 1KG0B 4NHUB 3ULVH 3W2DH 2FATH 3HZKB 4HIJB 4LU5L 3H9SD 2VXTH 4DVBB 4Y19D 3LAFA 2IAND 5K59E 1D5BB 5IFHH 5CWSB 1UYWH 2QBWA 2EEAA 3MMEB 5F3HB 5JORB 4M7ZB 3SGKC 1KCSH 5B3JE 5C07B 2AERT 3DUSB 3G5XB 3W9EA 3GNMH 3PE9A 1N6VA 3L7EA 3ZKND 3LPFA 4RZCA 1X5HA 4ODWA 2AS5M 2PXYD 1MJ8L 1A3QA 3VH8B 5CIPH 4DGVH 3MREB 5IESL 3WJLA 5HHOB 5I66B 4MQ7B 1MWAB 4DZ8A 5IMKB 4XWOD 1MCOL 3GHEL 2RIKA 2VSDA 3SBWC 4P5MB 4EI5B 2DQCH 4O4YH 1ETZB 1VCAA 4PJ9D 3WJJC 4LPYA 5GZOC 3VXQB 3CK0L 1IAOB 1A4KA 3WCYA 1N5YH 2V7HA 3RWHA 5KSUA 5TDNA 1G9MC 4NRXA 4PP1D 3MJ9L 5E8DH 5C0IA 2X4SB 4QT5A 1NAMB 4RZCB 4UILH 2VABA 4OGZA 3HNVH 4NC0B 1JV5B 4BFBD 4Q9CA 4LVNB 5IB4B 1EO8H 2DQHH 4OQ1A 3GUTA 3PP3H 1KENH 5CP7A 1P7QA 3WXVH 2D0HA 4G7VL 5TDOB 2D3VA 1UWEL 4JO4L 4HIJA 4HUXA 3NGBC 1HHJA 5J1AB 1VGEH 2E7CA 5ITBH 3O3AB 4TUJA 2X40A 2BHUA 1X7QB 1DQQB 3MSPA 1RZ7H 3IFLL 3TO4A 5J8OA 1ZS8A 4WY7H 2DI9A 4EXKA 3P30H 5SX5K 3QUXB 3WUWB 3HRPA 4NT6B 4YNYA 3UTSE 1G6RH 2Q87A 5KVFH 1OHQA 3GSWA 4QRPD 3ZLQC 2VRAA 4RQQB 5CKAA 5CBAB 4YHIA 2Q7NA 4QTIL 1K8DB 2G9HA 4S1QH 3P9MB 1DEDA 4Q9QL 4LVOB 4P2QB 4DUXA 5KVGH 5L8LB 3B9KD 3NTCL 1I8IA 4M00A 4U1GB 4LRNH 5ISZD 2J8OA 5DJAA 5HYSA 1K4DB 4OBSA 3MRLA 3ZDYE 1O0VA 3GMOB 4QGYA 2OMNA 3VWKC 1PEZA 3OMZA 35C8L 4IOIA 3TLRA 3ARWA 3X3FH 1KJMA 1VFAB 4JHZA 1R5WA 4N0RA 1B4JH 4FRWA 1VACA 2HFGL 4HJGB 5KSAC 3OL2A 2Z92A 4ORGB 2WLZA 4KROB 3REVA 5D72H 1GGTA 4WUUE 3SE3A 1GGBL 1A7QH 1Z0NA 3NFPA 1KIQA 1FCCA 1A22B 4AH2A 4LPWA 5IB3A 1V7ML 4K3EH 4OCMC 1DUYA 1JWUA 3CC5A 5F9OH 4LIQE 4BQ8A 2UUDK 1MIML 2NY2B 3BDYL 1CLOH 3EJZC 3JV5A 3VRIA 1RUQL 5I73B 4JDVA 3JSSA 2E3VA 4PBXA 3JTTA 4XTRD 4M8QA 1OF2A 4L8DB 3FT4B 3D0VA 1LO5A 1RIHL 5DD5L 5GGQL 5B22A 4PRPE 3RFZC 4AEIH 5FDWB 1J0ZA 3L9RA 1QSFA 4D9QE 1PY9A 2UVFA 4P4RB 5BW7A 4NUGH 1DQLL 4N1HB 3RY6C 2BVEA 3DIFB 4HHAA 5GISL 3U0WL 5TE7L 3NIGE 3P9LA 2W0FB 4P2QD 5HVFB 2OL3L 4P5TC 2WWMD 3INUL 3WO3B 5GHWH 4LLUB 1XGRB 5A3ID 3SE8L 3FHAA 5BO1L 1J8HE 3N1QC 1V3KA 1CN4A 2HJLA 3CMGA 4OM1H 3O3EA 4RWYH 3GJFB 4NKDA 3MZTA 1CE1H 4FQLH 2XTJB 4UDTB 3CDGB 3SJVA 1MIEL 2APVA 3HG1B 5IR1A 2DQFA 5F96L 1L0XA 1QBLL 2XRAL 5EDXA 2NR6C 5JW3H 3VFRA 3IXAA 4PRIE 4PS4L 4KHTL 4LLQB 1P7QD 1OAKH 4U1IB 1F4WH 2HG5B 2UZXB 3OKKB 2VDLL 5EOCL 4XC3L 1CICB 4ZSOE 1WCBA 3TCLB 3U9UB 4L8CB 1HCVA 3OSKA 4JPIA 3IDGB 4MA7H 3IDJB 3NA9H 4LFHG 4LKCA 5M95B 4X7SH 2AEPL 2HG5A 5JLZA 1S7VB 5C0ND 4UUJB 4Z5RA 1HOCB 5HGGS 3FTGB 3BKMH 1NLBL 4PGCB 1F4AA 5MP6H 5F1IB 5DHVH 2FZ3A 4RMWA 1ZWIB 4LSUH 1QVOA 3FB8A 2NYYC 4L4VD 4CVZB 4XNXH 5JW5A 3ULSB 1JPTL 4YBLC 4LBEB 3ULVF 3DETD 4MJ6A 3F65A 3VMPA 4FFZL 2OR9L 4PLOB 3INUH 3IDMA 1U95A 1FGVH 2FECL 2EYRB 1BQHA 1QACA 2EDQA 4NQSA 4RFOH 5C92A 1LO5B 2B1HH 3FB5B 1W8OA 4QTHA 2ZJSL 3FRPG 4GW1B 4UINL 5IVXE 3SQOH 3QO1B 5F9JB 3OB0H 3MLTA 3W39A 2WQRA 3BPNB 4X7DC 4OCRH 3S3JA 3FRUB 3U6RB 1CIUA 2DLGA 4LARL 1Y6NR 1W72H 1KGCD 1RUPH 4M1DH 5EBLA 2DYPD 3K46A 4OLUH 3QR2A 3X3GL 3OWEA 5MENB 4GAGH 4DFIA 4ZPTA 3C60C 4Z77A 3RAJH 2HLAA 3ZSTA 1F4WL 3V5HA 2VE6B 1NMAH 1YEJH 3MV11 1W0VA 1D5MB 2CLRA 1S8DA 1RZIA 2OP4H 2BVYA 1LEGA 5KN5B 3D69B 3CLEH 4PB0L 5B39B 1NFDA 1PYWA 1F11A 3ZZ1A 4JHWH 2F58L 1I1AC 4LGRB 5LGHL 1MCFA 3C6SB 3WXWL 4EZMA 5EBMA 4QRRA 1FE8H 1CR9L 4S1DD 1WBYA 4QOKE 5DYOA 5I1KL 4UUJA 4DGIL 4X4YA 4Z5RB 5D93B 4KGJA 5GZND 4U7SA 1WV7T 1OCWH 1ZLUK 1VB9A 4MNQD 4ODUA 4ZFZB 3U30B 1BLNB 1YPZE 4G42A 2GI7A 3SOBL 3WLBA 3N1GC 4WI4A 2KQMA 1J7VR 4LVHC 2GUOA 2QSVA 5D96C 4HIIB 3LZFL 3QNZA 4XVUC 1KCRL 2FLRT 4JFQB 5I6XC 5HYJE 1QYGH 5T3XH 2V2WB 1LO2H 4M6NH 2O93L 5EOQH 2X2YA 3PWVB 3O4LD 3BYYA 4UNTA 1V8HA 4OZHA 1G7MA 3WL9B 4HUXB 1T3FB 5AZEH 3KAAA 3BGAA 2C1PB 3E3QC 1CI5A 4DEPB 5GS0C 1QHPA 2Z93B 3DO7B 1U3JA 3I6KB 4J3SA 4ODHH 3PWJA 2FJFB 3D6GA 1VADA 3QUXA 4MJID 2IQAA 43C9B 5TDPA 3GI8H 4OT1H 3BP5A 3BJLA 2RCSL 5DT1H 1YEKL 4ZQKA 5T3XD 5IWLC 1P7KB 1A4KB 5EN2B 3W9DB 4PRHA 1CWVA 2EDKA 1TETL 4D0CA 4N8VB 3FO9A 4MJ5B 3GKWH 5HDLA 2W0FA 4NGHL 1AC6A 1TVHB 1DSFL 4ZUVA 5J06A 4DWHA 2IPKB 4QRSA 3O0RH 3VGFA 5HPMA 1N2RB 1H15A 4QRPA 2IQ9H 5JLZB 3T0WA 5IB2B 5ABDE 5DMKB 5E4EB 3SDYH 4LHUD 3CH1B 3QP3A 4I0KA 2UYLA 3TO4D 2O5XH 3KR3L 4PY8J 1MCJA 3U7YL 3WFHA 1WITA 3A67L 1WWWX 3I9GL 1OF2B 1EJOL 5IBLC 2FO4B 2IH3B 3O8XA 4XNQB 3B2VH 4MDJB 3PJSB 4WO4C 3NN8B 4X5WA 1R5IA 3BP7B 3M8OH 3QEUB 4GMTL 4RX4D 4OD3H 3TJEH 1MHHA 4IS6A 2EIZA 2I24N 2Z91A 3ZHDA 1ND0B 4NUGL 1INDL 2AW2A 3V6FA 2WWKO 4NN5B 1ZLUH 4IEFB 3MV8E 3RIAK 3TGXA 1HIML 5HHQA 4RAUB 4FQCL 4M43L 1U3ZA 2FD6L 2BJML 2A6IB 5CGYD 1N6UA 2BSRB 4Y4FA 4KDWA 2WBJD 5HDBE 3F7YA 1TMCB 1Q38A 2NR6D 4HC1A 4L4JA 3VXRD 1ZSDB 1EERB 4C58B 3AGVA 5ESAB 5FYKU 2JCCA 3VWKB 3BMVA 4CAGA 4BSVB 3KXFB 4L8BA 3PWUA 3BH9B 1IFHH 2AJVH 1DJSA 4JB9H 1GC1C 4IIQC 4HCRH 2HVKB 1A6UL 2AJUL 4D94A 3N9GL 4L3EE 4MZ2A 3QNYA 1NFKA 4Y4FB 3DXAB 4H20L 4J23A 5BCAA 5JDSA 1G0XA 1GIGH 4PREB 1UEYA 1YPZB 1JN6A 4KAQL 3VD5A 3BZFB 1DEEA 5D7JD 4POUB 2IANB 2HT2D 3ALXA 3PL6C 4EDWH 3T1FB 1XGTB 2IF7A 2IPUG 1NKOA 4P9HC 4PJBF 3QA3B 4QRRD 5KSUB 1XF2B 1JFQH 4QTIH 1EFXA 1D6EA 2ARWA 5J6GB 4Q9QH 1T20B 1P7QB 4YAQB 3SN6N 1M71A 1OD9A 3QA3A 1U8LB 3GMOA 4Y4FD 4YPGB 4I48B 3TVMD 5DK3A 3N85L 4YHOH 2XTJD 4PGDB 5GRYA 4XP1H 5D2LF 1OM3L 3VFMA 2AXJA 5I8OL 1LE9A 1RURH 3LKSA 2VXSH 1G7IB 5DZOA 4WU7B 2BXYA 4KY1H 1NMBL 1X5KA 1EEUA 5BMFH 3BO8A 1DVFC 2XWBB 4F9LA 4Z7OF 4HH9B 3IXTB 5J6GA 5I1HH 1H3PH 1L4IA 3MV7E 1F4XH 4DKAA 5LKNA 4J8RA 3HFML 2SEBA 3MYJB 1HKLL 3ETBF 3IRPX 3QXDA 4R4FH 5DGQA 4MNQB 3T2PA 4PLJD 4UILL 4RGNB 4N5ED 3DV6A 1JPFA 1YEEL 1A1MA 3IU4H 5IGXL 4FZ8H 4M7JH 2WBKA 3O2DA 1IKNA 1NCNA 4HBQA 5JIHA 4MVBC 4JM2C 2I26N 2G2RB 3LS5H 5SWQA 3V7AE 1KJ2H 4XAKE 1U93B 3FQWB 4NM4H 4BZ1H 1U8HB 2LQRA 4N8PA 5E8PB 5D6DC 4HWZB 4UT7H 4HUNB 4WY7L 5BXFA 5IW1A 3D39B 2DQDH 5I9QC 5IHZB 3RUGB 8FABB 4PJDE 5HYEA 3BN9C 4NN7B 4GAJH 4N0UA 1J87A 1P7HL 4FG6C 3BEWB 1XF3B 3IYLW 4YFLI 3BGFB 1AI1H 2HN7A 4GG8B 1MQKH 4NCDA 4Y19E 1QFWM 4I0PD 1WTGT 2F8OA 2D7MA 3GSNL 1MCRA 2RAMA 3UDWC 2VITB 4PJCB 4X6CA 3L3HB 1T7VA 1HKLH 4R4FL 1S9YA 2WUCH 3GRWA 4Y5YA 2EO9A 9CGTA 4GLRH 4M93B 2DTML 3MRPA 4FA8A 3BSZL 2BSTA 3UC0H 1MVUA 1PLGL 2QJDA 4UT6L 4OV5B 4LHUG 2H32H 2B20A 4PV8A 3FL7A 3VGGA 5GPRA 2XI9A 1F3RB 2AKRB 3IFNH 4K7FA 1F00I 2IQAB 1A4JB 3HC3L 3MBEA 4TNVK 4N0FA 5L2KE 5HYQB 3DMMB 3FMGL 1LMKA 1IVLA 5DEFA 1OT1A 4J3OC 4KRLB 3ARFB 4APQC 5JO5A 5IM7B 4DOHB 2GTZB 1SJEB 1ORQA 5EUOA 3QUYA 4WHYG 2I25N 3MV8D 4J1UA 1E6OH 3UJIL 1ZOXA 2DI8A 1EHLH 1MWAL 1NL0L 1WEJH 2YS4A 3VU2A 5DWUH 2CLZB 2NNAB 3TH3T 5DFVD 5J13C 3ZT5A 2DYPA 5FKAA 1UJ3A 4FNLH 4KUCD 4CVZA 4C83B 5I30L 3F7YB 3WO4C 1G6RL 2CH8A 2GQHA 3M45A 3PWNB 1WIUA 1RZGA 2BK8A 5HI3D 1EAPA 1FVDB 1HH9A 1OD7A 2VXUL 3O4LE 3O3DB 5TE4H 2X9XA 5HY9A 1NBQA 5CILL 1D7FA 4IRZH 3NFSH 5HYJD 1NANH 1OL0A 5KOVC 1ADQH 1NBVL 3TBVA 4F15C 3EOYG 1KTLB 2FJHA 4OQTA 1NAML 2PW2A 3EYSL 3QI9B 3QEUA 1LO3L 4H1LA 3T0EC 2HTKC 3PWPB 4QY8A 4X9BA 5AUMA 4YXLL 1LE5A 1YEHL 4U6HA 3QZWG 1QNZL 2D9QB 3NFNA 4PJAF 4E41D 3B9AA 2WIIA 4HXAH 3HPLB 4BUGA 1QBBA 3OR6B 4J3UA 4PJ8A 4W81A 5F7DA 1I7RB 1UQSB 3MODH 4X6CE 1WFOA 4YDLB 5IMLA 2HRPL 4G6JH 3B5TA 3V4VH 3UXFA 2ESVE 3MFGB 5KS9E 1Q0YH 1CGSH 4WW2F 4YWGH 5I71B 4KROD 1FBIL 2D0FA 5F1SA 4TUOA 5C0FA 3A6BL 4N8VG 3D18A 4OCWH 3UDWA 5D7KE 4G9FB 4Y4HD 3L1OH 1OW0A 5T3XL 4MJ4A 5C0FB 1S7QB 5FYLL 2X4OA 2YHGA 1TJGH 5GSRB 3IETA 5IEHA 3UMTA 1KCLA 1T03H 4HCRA 2A6KB 1CICD 1IAIH 4HPYH 5DRXB 12E8H 1N64H 5FOBA 2HKFH 3TYGL 1ZEAH 3PDOA 3ZKQD 3HG1D 2FECI 3IDJA 1NLDH 3OTTA 4WGWB 4HS8H 2W0PA 4P2RA 1RZKL 5HGBB 3HUJA 1FIGL 2IBZY 4I77H 5I2IA 4XMPH 1CFNB 3BIKA 4M5ZL 4L1HA 4GJTB 5C2UB 3IETB 2IBZX 1OP5K 4FQLL 2ZG1A 3G5ZA 3TP4A 4IOIB 4K94H 3WO4B 3LKQA 1F6FB 2VDRH 4ONOA 4S0TD 3MLUH 3QXWA 2ZWLT 4YK4B 4OZFH 4ELMA 5KSBB 4WFGD 2XFXB 1DBJL 3F6LA 3G04B 1KC5H 2F5AH 3QDGB 5FYJH 3QI9D 5ANME 3WE6A 5CD3B 5DUBA 2BSSA 3MV8A 4JZJB 3BFOA 2HLFD 5E2WL 1MHCA 2Q8AH 3VI4E 5MEQA 1GZQB 4BH8A 1GAFL 4EN3C 4FTVB 4GG6B 3FFCB 4WV1C 5F6HJ 3QDJB 2FBJL 4UNVA 5FFLA 2CSPA 3ZHLA 3TC9A 5DFTA 1KN4L 4R4BA 2IJ0C 2YXMA 4JHAH 3T4YB 3CZJA 3VFUA 4ZPTB 4YPJA 3FT4A 5F7NC 1QLRA 1S7QA 5D93C 1ZE3C 3BI9X 2ZJSH 1QR4A 4HMDA 4MLSA 1MLBB 5IG7A 5F44A 4GAYA 3L3IB 4L9LA 1PVHA 5BV7B 5AG9A 2WQ8A 4KJYB 3O6LH 1I3RB 1V7MH 1DN0B 1BQUA 4UNUA 2V17L 5C0BD 1JRHH 4PJ8C 4HC1H 1VFUA 1W72B 5JNYA 4D8PB 3I6LE 1FVCB 5KTEH 3U46A 5C0RH 3P0YL 3S4SB 2BSTB 4YHML 4F57L 5ESQB 3ARDA 3WSQL 1VSCA 4L8DA 2DD8H 1CD8A 4NGHH 3VWJB 5E2TL 4CBPA 1NFDF 2OI9B 1D6VL 4HUWA 4KK8D 4Y2OA 1A6TB 2EZ0D 1JWSB 1XZ0B 2VWEC 1HI6B 2XPGB 5FUOH 1JPSH 4X6CB 5DJXA 5J9PB 2ARJA 3HS0A 3VDAA 1IEHA 4CKVX 2C4FT 5ILTL 4NIKB 3BH8A 4TVPL 3O2DH 1FVEB 3V0VA 1BD2B 1RU9H 4JPIB 3KPSB 2VLRB 4HWNA 4ZYKA 2F74B 3VXPB 3KPLA 5FK9A 3GNML 3HAEG 4MYWB 4P2QE 3DGGA 4G9FE 4WI3A 1M7IA 1BECA 3B2VL 3S98A 5HXMA 3BGMA 4HWBA 4UIKL 4I0PB 3QYCA 2ZUQB 3P4NB 5IHZA 4I13B 4GRMB 2B4CL 3MXWL 3QUKA 3P11L 3GJFA 4KMTL 1QSEB 4P4KD 3ZDXE 1ZS8B 3WJLC 3WIFA 3MCG1 4DN3L 3JV4A 1D9KA 1X5AA 4U6TA 1IC5H 4WI5A 3LY6A 3UROR 3C8KA 3QHTC 3CVHH 3F7QA 4G9DA 4XP6H 5GJSH 1FZKA 1FYTD 3UBXI 3U82B 5IM7A 2R1WA 3MRJA 4RRPG 1YYLL 2NX5B 3VD3A 4X80L 4D0BB 1IT9L 4IOFC 4WJ5B 4OGYH 1J1OL 2X7LB 4PGDA 3D0VB 4NFBA 5A2KH 3TO4B 4MS8D 3RNKA 4PLJC 1MRFH 4W6YB 5T1DH 3P77B 4QHNB 2ITCA 1ZA3B 4YBQD 3WHXB 3TIDB 5DMYA 2B0SL 1BIHA 2F15A 1UZ8A 3L3OA 4PY7B 5AYUH 5TGBA 3B9KC 2WINB 4UV4L 6FABH 1UXWA 4XXCC 3WFCH 4AEEA 1GHFH 5E8EB 4BA8A 4LSVH 4Y5XA 1Q0YL 2W0KA 2IANA 2IPTH 1VKXB 1RMFH 5E8EA 5KVDH 1HZHH 5ICYA 4GAJL 3PHOA 3NTCH 4WHCA 5F1NB 1A1MB 2YD4A 2ZUWA 1FGNL 3H3PL 4WTZA 4YE4L 4YDLC 1J8HB 3GM0A 4HEME 3SGEI 3P3YA 4HQQH 1MFDL 3OXSB 2W60A 4UINH 2XTJE 3I6GA 4F33B 5B4MD 1WQVT 3VMNA 4M48H 1G7JA 4S2SA 5DJYB 2IWGA 1YZZA 2YRPA 2A1WH 2QSQA 4P46C 5TQ2H 2ESVA 1K8DA 3QDMA 4HUUB 5BMFL 5JPMA 4QRRE 4ZFOB 2NTFB 3CVIL 3LQAC 3NVQA 3TA3B 4B41A 4NZJA 2Q3AA 4P49A 3EZ8A 4LVNC 1FG9C 4BH7B 2O61A 2R2BA 5HI5D 4YHYC 4RGMC 5ESVA 1J5OH 1ZGLA 4QRTA 1LVEA 4NZUL 4BH7A 4G8FA 1MHHB 4KK8C 3L6FA 1EGJA 3QWRA 3GB7B 3KPSE 1QO3B 3HNTL 1AD0B 5FO8A 3O6FB 1O5DT 4TOYL 4OM0H 4HIEB 1G6RB 3E6HA 2VKXA 5IK3B 1MJ8H 3MJ7A 5J6HA 3C5ZD 1T0NB 4JFYA 2XIDA 4N5UA 3RWGB 1QSEE 2GAZA 3H9HB 2HYMA 2EKSB 3OQ3B 5DD1H 4OFDA 4NQEA 5ITFA 2G5BA 4NN6B 5FHAH 1ZT4B 2FX8L 1TNNA 3V5KB 3P77A 2IADB 1JNLL 2YRLA 1FFNA 1Q9KB 5ID1B 1I3VA 3MCKA 4WCYH 1YMMD 2NY4C 2J88H 2X1QA 3TN0B 4X80H 1JK8A 4NZUH 1FNGB 4GS7C 3X13A 1P84K 1PJ9A 2IPKA 2F8VA 5JOPE 1YNKH 4X5LA 5F7UA 5C0AE 5KTEL 5EA0L 4GKSB 4YGAB 1D5IH 1NAMH 3MZGB 2DL9A 3P73A 3C8KB 4FP8L 1NEZA 1MRCH 4MDIB 1K6QL 4Y89A 4X6DB 4YZFF 3FOLA 5DRZA 3ULUF 4XNZC 4GQ9L 2EDHA 1F02I 4UIKH 3O6ML 2W92A 1R3JA 2FGWH 4JZOA 4PR5B 3LQZB 1A6VL 4NQCA 5E70A 2B4CH 2VNCA 4M4RA 4ZUWB 2ICCA 4FQHB 1ZLVH 3WIIH 4N8CL 4HUUA 3DUUA 3MLWL 3KPLB 4QNPF 4N9GB 5DD6B 3S97C 4X4YB 5D9SB 2H2SC 1E6OL 5ADPH 3JV6A 2ATPB 1JWSA 4OLZL 1CFTB 2ZOKB 4YPGA 1AIFA 2QSCL 5CEZL 4RAVA 3BXNB 3DX8B 4LASL 4KK9D 3MJ8A 4DKFL 1ZAGA 3DO3A 3QFJE 5GGSY 1U3YA 2BNQD 3EFDH 3ET9F 4ZUUA 1NDMA 4P2RB 5JXEC 2PCPB 2ZUXA 1DQMH 1WUNT 4WNQB 4Z7VE 3V6OA 4Q2ZB 3RJDA 1XF1A 4M5YL 5JA8B 3REWB 2WV3A 5D72L 5T1DL 2ICWJ 4LLDB 4WWID 4N9OB 3I6KA 4HUVA 1BM3L 5EBLB 3BSZH 5DA4A 2J1KA 3VFNA 1J1OH 1LEGB 1X6NA 2BC4A 4JY4A 3B9EA 3HS0B 2N56A 1FRGH 1IFHL 4RMSA 5D4QA 4JFFA 2JCCF 2R23A 1O7VA 3GSQA 3P4MB 4WWKC 4PGJA 1MCQA 2CRIA 1AQDB 4K71B 2DRUA 1MJJB 3L95A 2Z8RA 4LCUB 4PRAA 2V2WA 2EDJA 3DHJA 1MLCB 5E1AB 1UC6A 2AV7A 5KJRH 1GVIA 1KCRH 1DVFA 4F9LC 5JNYB 4YE4H 2XOTA 1FNHA 1TCRA 1HIMH 2X70A 1FO0B 3H0TB 4JPVL 3QUKB 3DTXA 1TVBB 4TULL 3KDMA 5DD1L 4NFCA 1ZLWK 3I50L 4X7FC 3EOAA 3EFFB 5CUSH 5L8JB 1GOHA 3OR6A 4FZEH 3LIZH 3VD9A 1JUFB 1KJ3L 4ELMB 2YSSA 4ALAL 5CZVL 4ZPVB 5BOPA 1SVZA 3ISWA 1A9BB 5DRNA 2VZOA 4XVJH 2VR9A 3KPSD 4IS6B 1IM3B 3MRKB 4HF5L 1NCDL 3IDIB 4AENB 3I84A 1EMTH 2MCG1 1HOCA 2HFEA 1XR8B 3MOBL 1LILA 1QFPA 4X4XA 3VXUD 3IJSA 3DX6B 1XIWB 4MQTB 4HD9A 3RVTD 5DSCB 2DB8A 5IB2A 1T1WB 3WSQH 3VW3L 4Y7MA 1LO4H 2UY7A 3QIUA 1IMHC 4NC1C 5CIPA 4L4VE 4NO3A 3LH2H 5FECB 4J6RL 4BSWB 5KSBA 3ARUA 4M03A 4RGND 4Y4HB 4IRSB 5B38G 3D69A 3VFTA 1IGFH 1QSFD 3EYQD 1QP1A 1GPOH 3HB3D 1FNFA 2FX9H 3T65A 3GSUA 1DQDL 3KJ6H 4P3DA 3U79A 3LIZL 4PJ7E 1FORH 1JHTB 1I8LC 3PWLA 3VGBA 3F5WA 3IVKB 5F88B 4J12A 3HPLA 3Q6GL 4P5TD 2DN7A 3VFNB 5F7DB 5DS8B 5GGSB 5DVMA 3BIAX 4PV9A 1LD9A 5IIEB 3OKKA 3T04D 1K5NA 1UWGH 4YHKL 1A7OL 3QDJA 4F9PA 2HLFC 4CMMA 5I1IH 3HLAB 2P8MB 4Z18A 1AO7D 5LQBL 1MH5B 2CXKA 4Y19B 1IAKA 3C5ZB 4HS8L 1XGUA 2OBGA 2YOCA 2W65B 3QUYC 2YPLD 1JGVH 1U6AL 1RY7B 2YWZA 3IKCB 1ZEAL 5L88H 5CEYB 2M2DA 4OGYL 4ZFGL 2QV2A 4JQVC 1ITCA 2BDNH 2V9RA 3BEVA 4U1MA 3RVWD 5I1GL 4JVWA 2XZAH 3L7FA 1K3ZA 4EI5C 2NW2B 3VXUB 4LSPL 4FQXA 1ZHNA 1I7UB 2P8MA 5CCKH 3G08A 1HHKB 4OD1H 4QF1A 2Q76A 5ADPL 1NBYA 2NY1C 4QWWD 3RVXD 5HGBA 4R7DB 3R0NA 4CN4A 2AQ2A 4K7PH 5IW1B 1A6AA 3IS1X 3TA3D 1EJ6A 1HH6B 3OJDA 2FR4B 2XZCH 4XVSL 1AXTH 4FABL 4TUJB 4IRJD 5MEPB 2VLMD 1ORQB 2HJLB 3OKMB 4PJGB 3ZYZA 5IVZA 3V9FA 5M94B 1S9KC 2AEQH 3GMPA 2LVEA 1F4YL 3JTSA 2W1NA 4RMQA 4LEXL 5C6TL 4ODVL 5F88A 4FXKA 4W6WB 4WGVB 1UJ3B 3U4AA 5E9DE 3EO9L 1KJ2B 4WNQA 4HK3N 2GSIB 2SEBB 3MYJA 3FONA 2XA8L 3DSNA 2JB6A 1H3VA 3AXLA 4Y4FC 1OB1A 1IAOA 4Q6IC 3O11B 3PABB 4JM4H 1MCKA 3N50A 3N1MC 1LO4L 5DQJB 3BO8B 3SDXB 5F7HA 3MUJA 2QTEA 1SEBA 4CN1A 5SWSD 4NQEB 3QJHB 1BM3H 5FECA 3P0YH 1I7RA 2J8HA 3CSBA 1B0GA 3KYNB 3I6LD 4N68A 3MNZB 3PWPD 3MA9H 4ODWB 1IQDA 2AKRA 2XG4A 3QRFM 1P9MA 4DOHE 4JFHE 4S1QL 4F15B 3NFPB 2HKHL 4OD3L 4ZOAA 4GMTH 4P9HL 4OKDA 2H3NB 3LB6D 4U7KA 5ICXB 5I66A 3AREB 1Z3GL 3VG9B 1CE6B 2X4UA 4LGPB 3P30L 3LEVH 4QXWA 3O3EB 1YNLL 3FZUD 3V4VL 1MEXL 3Q5YA 3DUSA 1JN6B 2GSGA 1RUML 5F9WC 2B5IB 4MSWA 1T0PB 2V7NB 5IB4A 4RISL 3DJ9A 5DJ8A 2DBLH 4JM2D 4JFXB 4LSRH 1XF3A 4NQCB 1WGOA 1FNGA 4MB4A 4IRJA 3T0DA 1IC4H 1XR9B 1XGQA 1YEHH 5TF1H 1AFVL 1QA9B 1YEKH 1VGEL 3WMSA 5ITBL 3WUWA 4KRPC 4PG9B 5HSFA 5F8QC 2P5WB 4GUPB 4F3FA 4NUJA 3BD3A 1DBJH 4O9HH 1I3GL 2BNUA 4KJQC 4JPKL 2EH7H 3X14A 3AROA 3MRPB 1XF5A 3H9SE 5DEFB 5IBLD 3WDHA 1H3UA 4J3VA 5E95B 2UUDH 4X6FB 4M93C 2XQYK 2W0LA 3KPOB 2BOCB 5ID0B 2L0DA 3BT2L 3KWWA 3KXFD 1T20A 4H1LH 4M6OL 5DI8B 4K9EL 2EH8H 1KN4H 1OGAA 4DW2H 1C5DA 1F6LL 5DI8A 5KSBF 1KUMA 4E41B 5ITFB 3DRQA 5IESH 4FHBD 1ETZA 5TQ0H 4DAGH 3BZDA 4NJ9H 1FPTL 1HZHL 1G7PB 5FKPA 3RWGA 4AY0A 5KVEH 2AV1B 3LQMA 4NN6C 4OJFL 3FO1B 5DLML 3SE9H 3C09C 3EDEA 3CFJB 4EEEA 2ZSWA 4D3CH 2BNQA 5IF0A 3LRSA 3NIFE 4JKWA 3O6FA 5HYIA 1TPXC 3W9EB 3E3QE 1X3DA 2VZUA 1GOGA 1I85C 4K71C 1XCQB 1NLBH 4G9DB 2QL1A 4ZS7H 5HD8C 1BD2D 4R2GC 4TPRH 4K55A 5LVEA 3DYOA 3MGTB 3FFCD 1KEMH 3JV4B 1YJDH 2VXQL 3EHBD 1N4XL 3MRGA 4XPAH 4R6UA 3MBXL 5FO9A 5FEBA 5I1EH 5KSBE 3WNNA 3CVIH 1FZJA 4PS4H 4ZTOH 1ZVSB 5FGRA 5D5MB 5ESAA 2HFFB 2HVJB 3ARZA 2BOCA 3QNXA 1FNAA 3JXAA 4PFEA 1G7QB 4MXQC 2AXFA 4CU6A 4LHJB 4H8WC 3MRBA 4UAOC 1U58B 4TSCH 2H26A 1I9JL 2HFFA 2HVJA 1A14L 1VKXA 3DI3B 4FQPA 2UZYB 2VLKA 2VABB 5KG9A 2DMCA 3L1OL 3HI1A 2Z91B 2LE9A 1BF8A 1CXLA 4GW4B 1HH6A 4RGOL 1Q9OB 2YUXA 4GG6E 3NACL 5IVXA 3BQUB 5C0CB 1BVKA 4MGXA 5JQHC 2FO4A 2IH3A 2P46B 2YMXL 4XNQA 3MGAA 1CXHA 5CUSL 3BP7A 2PTVA 1CF8L 3GSRB 4Z7NE 3I6GB 2GW5A 1ZT4A 3ROLA 4XPGL 1QSVA 4OGAC 3HRZA 3RTQB 1IQDB 4JHBA 4PJHE 4OI7A 4EDXB 3DXAE 1HXYB 3IDYC 4DFHA 4NQCE 1P4LB 2IAMB 4YR6A 4NN5C 4YIQB 1TVHA 4GBXD 1G6RA 3E6HB 5IK3A 1IAKB 4LLYA 4XP4H 1T7ZA 3IDUA 3BPNC 4KVNH 2ADFH 4XPAL 5I1EL 2BVPA 5I18L 3TPUB 4OFYA 2D31B 2AXHA 1G7LA 5CP3H 2Q1EA 1YN6B 2V2TB 1W72A 4C55A 2ITCB 4Y5XC 2XN9B 3GSNB 4Q0XL 1Q94A 4PV9B 3BP5B 1ZXQA 3OZ9L 3RY5A 2R39A 2VWEE 4F7CA 1YA5A 2QHLA 1HSBB 1YYLH 1G9MH 3DXAA 5F8RC 1GOFA 2FHFA 2GFBA 3B6SA 3E6FA 2CMRL 2I5YH 3WKML 5EA0H 5JDJA 1QFOA 1NCCL 2ID5A 5F7EL 1IE5A 2BSRA 1G7MB 3WIHA 4NJAH 1PSKL 2P5WA 4GUPA 3K8LA 5D96B 4DAGL 1A7NH 1NGXA 5HI5C 5DQ9A 5JUEH 3BP6B 2BP3A 3EAKA 3UZVB 3HPJA 4JRWA 4HUWB 4WW1A 1IGMH 3QDHA 4UT9H 4XNZB 2MPAH 5J57B 1UA6H 4EOWL 3RQ3A 5D71H 2GTWB 2UWEE 1JTOA 5SWSE 4P2OB 3EGSB 5F7MC 1F13A 3QDMD 3PHOB 1JZ5A 3GK8L 1JBJA 3TZVD 2RFXB 1KPVB 3QEQD 5GZNC 3IDGA 2FHBA 3TH4T 5C7XL 4HJJL 5JPNA 2J4WL 3I3BA 5DQDH 1Z9OA 2EDXA 2EZ0C 4JPKH 1E4XH 3ECBA 3S34L 5E00A 5GRJL 4JO1H 4TVSa 1YEFH 3SPVA 3E2HB 2DTMH 1TXKA 4OZGF 3K4DA 5DQJA 4MJ5A 4U3CA 3Q48A 2VO5A 2A9ML 1PDKA 2PYEA 4ZFGH 4U1MB 43CAA 2MFNA 1SYSB 4KTDL 2VLKD 4F2MB 1N0XH 2BOBB 3O2VL 1WZ1L 2EEDA 1JNHA 1SYVB 4LLWA 5CBEB 5AWNL 3GGWB 4QRRB 2D03L 4IRSC 3I85A 2UV3A 1NCTA 4N0YL 1Q9WA 1I1YA 2BY0A 3CDYA 2FEDC 2L4OA 5D7LE 4XI5D 4HFUH 1A6WH 5EBWA 1H3TA 1IEAA 3V79C 4U6VL 5C6PB 4OIBA 3MO1A 1S7RB 4OD2B 1ZHLA 4UQ2A 5I8EB 3E8UH 5JW4R 4LBEA 4M48L 4M7LT 1AQDA 2BSED 2DWEB 5DEGB 4EN3D 4RGMB 5DGRA 3TO2B 4LF3A 3A0OA 3F7RA 3SE4C 2ADGA 3WKNA 4K8RH 3FOMA 3Q6GH 1U36A 2A77H 3BWAA 5F1IA 3GDBA 2X10A 1S3KH 1Z9LA 2BERA 3HZYA 3PIQA 3FFCA 5EWIH 5F97E 4AEHH 2FJGA 3NCBB 3HN3A 2XZZA 4L1DA 1DBKL 3HZYB 2X4QB 2XWJB 1J11A 1AGFA 4K94L 5FA3B 3L5XH 1AE6L 4JFZL 4L3ED 5DJXB 4G80B 3MLUL 4XPBH 3B83A 2IBGA 3I02B 1I7ZB 1X5YA 3O8XD 1QZ1A 4LKXB 4JB9L 1U8MA 3L3GB 4P57A 1FNLA 3K0WA 1I3UA 4W6XB 5DYOB 4PGCA 3THMH 3VXNA 3BQUD 5C0CD 1Y18B 3FQXA 4X6CF 3KG5A 4WFFE 2C9AA 3UTOA 5C0AB 3TBSA 2JJWA 4P4KA 1NFDB 1PYWB 3MJ6A 4L3EB 4F7EA 1DQLH 1B4RA 4C56D 2D0GA 4LVOC 1ZHKB 4C4KT 1TTGA 4PTUA 2VE6A 4PLNC 3WLWC 4ZOEA 1ZT7B 4K7PL 1A4JA 3MLPA 4DJMA 1MFCL 4MAUH 1MWAH 4KRMB 4M8QB 4PJFE 4J1UB 5SV4A 4UDTA 2E7LC 1S5IH 1JMZA 4K94C 4OUUA 1NBZA 3KPTA 2RQ8A 1BEYL 3BWUC 3C5JA 4AQ1B 3RKPA 1KEGL 4V2BA 5F7WC 2AEQL 3BW9B 1BAFL 2ARJQ 3MRQA 4MCYA 4QEGA 3S35X 3GMRB 4ZXBB 1OARH 1R3HB 1U8QA 2YA1A 1X6LA 1GSMA 4POZD 5IHLB 2R1XB 3DRTB 4QXGH 3OZ9H 2MNUA 5HGAA 2Z92B 2A9NL 1T1XA 5LQBH 1N0XL 4KGLA 2H2PC 2CUIA 3IJSB 2HTKD 3JUZA 3BXNA 5CZXC 3U4BL 4YHKH 3EJYC 2DJUA 3HMWH 2J8UB 4M6ML 1HEZA 3L3HA 3QIUD 4Q9BA 1Q0XL 4AENA 2DD8L 4B5EA 5T3XE 1XH3A 5IMMA 4OZFA 4JY4B 3UO1L 4MQXD 3QI9A 1U3HB 4FQCH 5F70A 1OSZB 1A9EA 4MXVE 3PF2A 1IL1B 1JF5A 3GIZL 3HI1B 4RDQF 4PIRF 4CUCA 4WUUB 4PJ5D 4U31A 5KW9H 5CBAA 4TTGA 3S9DB 2A6KA 1FFPB 1D5BA 2ZG3A 4WO4A 4UT7L 5F9WB 3NCJH 1J0KA 2XN9A 3VDBA 3GJFH 1FBIH 3TYFA 2EDEA 5E8PA 5D7IB 2VR5A 2OMBA 4HKZB 2ZOKA 1KBGL 4ODSL 1HHJB 3GBLA 5J1AA 4QOKA 2WBJB 1MCBA 1RI8A 3SCMD 1DL7H 4HG4K 4TUOB 5EBWB 5DUMH 2DQJL 3RGVB 2ZG2A 1LHZA 4KK5D 5TFSL 4HULB 3M1BA 7CGTA 3T0BA 4WFHE 1GIGL 3K2UL 1NDGA 2XT1B 3JWDH 1XF4B 1DVFD 1JTPA 4RFEA 4ELME 1CR9H 4XC3H 4P2RD 1NCBH 1PKOA 3MBXH 3MRFA 4KK6D 5DJ2B 5DHVB 5JMOC 4J8RB 4JHWL 3O9WA 1OOAA 1EMTL 1HE7A 1FQ9C 3FOLB 4HH8A 1I8KB 1U2CA 3K7UA 3SGJA 3RUGA 3DXAD 2FX7H 5EZIH 3REVB 2XKUA 3H9ZA 3MREA 1JGDA 4QXUL 3BQUA 5C0CA 2W91A 2WMPA 4N1CA 3HC4H 1N8ZB 3ROOA 2B7DT 2C7UB 3V8CA 3TBWB 5D6CB 4AEIL 2Z31D 4OAWB 4NRXB 1KGCE 4WI7A 3FQUA 2IBBA 3DX7A 5TFSH 2DQGL 3OKDA 5DK0B 1FFNB 1Q9KA 4FQHA 2GK2A 1RJYB 1BHGA 2X4TB 4A6YH 1CF8H 2JF1A 1XGTA 1NCAH 3T8XB 4KMTH 4J3TA 1A3LH 4JGMA 5HYJA 2MOVA 2VDML 4G8GD 3T8XA 3QUXC 4MAYD 1T0NA 4NBZB 3QEGL 3KLDA 1BFTA 3QG7H 2EKJA 3AU1A 5IHUL 1BD2E 5A2FA 3IFNL 1QLEH 3O4OC 4GKOA 2DQTL 4Q6YA 4Z0XA 2ZSVB 4JFZH 3FO1A 2RGSA 3ARTA 2HRPH 5L7XL 2AEPH 3QIWD 3C2AH 4X6DF 1A7OH 2FHCA 3DARA 1V5JA 4BSVA 1BBDL 2A38A 1XEDA 3QWOA 4WWKA 2IAMD 1HN1A 3FO0L 5GGVL 1DANU 1CLZL 3BGMB 5DD3H 2BVPB 2H32A 5ADOL 1A1NB 5GGTH 3NAAH 4KJPD 1FH5H 2Q6WB 2DQCL 4Q74A 1TJIL 3UTZB 3TN0C 1OSZA 2AK4B 3SQOL 3S96A 3T0EA 2NXYD 5DF0A 4FQQA 4PG2A 2Y06L 4CVXB 5H37H 2EIZB 1INDH 3QUYD 3RVUD 3QPXL 1U91A 5KS9B 4P59H 3MOQA 4E5XB 2VDMH 1U8LA 5I9QB 1BEYH 3O8XB 1MCCA 1ZT1B 4XRCA 4ZO9A 2Y36L 4I3RL 3NIDF 4Z7WF 1DBAL 5LCVH 3G6JE 4CJ1A 3DNKA 3K8KA 4GRWH 3CH8A 5BRZA 2UZIH 4EUPB 1ORSA 4UQ3A 3ZKMD 4NHUA 1F97A 4RFEB 3EDDA 4MMXC 5F1KC 1MPAH 4GRWB 5BVPL 3U4BH 3FQWA 3RGVA 1TVDA 1E27A 4WFED 5L2KD 5FO7B 2V7NA 4QRQA 5LGHH 4K2UH 3MRBB 5E6ID 2AJUH 3L3IA 4L9LB 3RTQC 3SE4A 2WINA 1K6QH 2F9BT 3WXWH 5DTFA 1YJDL 2VXQH 3SDAC 1MY7A 4MJIB 1X5FA 4WUUD 5C6WH 5HHNA 1TENA 5FF6B 4TPRL 4XCCH 4U1JB 1A6ZA 1MFEL 1JNJA 3SDXE 4ZAKD 5J0BA 5DJCB 1OLLA 2FIRT 5MI0C 4FQXB 1KJVA 1KTKE 4R90H 1IL1A 5F3BB 4JO3L 1V3JA 1RJLA 5CP3A 1IGIL 1CG9B 1AGCA 1OGTA 3MPCA 4MSWB 3WLWD 4Y4KC 3F7PC 5ANMB 3CFJA 1AI1L 3MNZA 1CBVL 5I6XB 4UI2A 3W82A 1DBAH 5L9DL 1NJ9B 1J0YA 4NKOA 1WT5C 4M6NL 4R0LC 4K8RL 1UXSA 4MB5A 1FDLL 4NYLB 4PD4K 2NCMA 2FWOB 4OBRA 4OFIA 3G5ZB 3FO9B 1CXIA 5FHBL 4AT6A 5F9OL 2YBRB 3WJJA 3F58H 3ES6A 4XB8A 1EEYA 5J4MA 1I8MA 1IGYA 2AI0H 5EO0B 4FQ1L 4DUWA 3O4OB 4TSBH 4NZDA 1U8QB 3QIBD 4JG1L 5FOJA 1T89A 4M5YH 1VGKA 3LMJH 3AAZB 5DS8A 3PHSA 3O0RL 3D85B 1PD6A 3QJHA 3L3KA 3MBED 2NY5L 1UFUA 1YC7A 4QRSB 1HQ4B 3U36B 2A6JA 3LKNB 4OIIH 4F57H 1X4YA 1T2QH 3SKNB 4GW5B 2HT2C 3MRCB 3MO1B 1QOKA 5J3HC 1SY6A 1NQBA 3U46B 1EAJA 2YPVH 3RDTA 5EU6B 2MQ0A 5TDPB 2AABL 1QSEA 2AJYH 4ZG1A 3QXAB 4P99A 2HWZH 2Y5EA 4LHUB 5LWYL 1F2QA 4X6BA 2B1HL 4LNVA 5DJ8B 3VGHA 25C8H 3LSOB 1U8PB 3UEZA 1F4YH 2NY4B 3CXDH 3BP4A 3KLAB 3LN5A 4A6YL 3ALWA 2FJGB 2KPNA 3G6JB 1OQXA 1YECH 1K4CB 1YN7B 4O2EB 4OFKA 1CGWA 3PWVA 4LCWD 1UB5B 4R8WH 5IQ9B 1CE6A 1UT9A 2X4UB 2I07B 1WT5A 3VA6A 2FIKA 1OQOA 2VDRL 4Y16C 5DMGC 4O2EA 5ALBL 1HWHB 3B8YA 1AO7E 1J88A 2IG2L 4M5ZH 4RBPH 5BZDA 4Y5YC 5KSVA 2QR0A 2VLKE 1YNKL 5KANG 1BD2A 4ODUB 4ZFZA 1F45A 4HWBH 3FFDB 2B4CC 1J8KA 1WCBB 3ZTNL 5I1CL 1YEFL 4M7LH 1FL6B 4M61A 4PB0H 4HLJA 1Q1JL 5GS1A 3FRUA 1T7YA 4I18B 3RTQD 3EYFA 4HKXB 4CADA 2L7JA 4TRPH 2C3VB 3HLAA 1KIRB 5C0GB 5FM5O 2JIXB 3FHQA 1XMWA 1B0RB 1TQBC 4LOUC 5F93C 1CFNA 3BIKB 4P23B 1N59A 4YHNA 1WZMA 3IDMB 4KVCL 5FUCC 3GJFK 5KVEL 1K8IA 2GTZA 5GRVK 4LRNL 3KS0H 1IC7L 1OAXH 1KXQE 4B53A 3FCTB 2JKXA 1UJ3C 4LLVA 3G5YA 3DMMA 4RGNE 1C5BL 3IU3A 1ZVHA 3C5SA 3QAZB 1P5VA 2CJUL 2VLJA 2FYYB 4WUKH 1MAJA 4PJ9B 1S7TB 1CXFA 3TCLA 3U9UA 3MLWH 3QUZC 4L8CA 1EHAA 5MHSE 1H9VA 3VFSA 2NTSP 4YHNB 5T33L 3I2CL 3TN0D 3RZWA 3ILPA 5I8CA 4NBYB 3QIBC 4YDVA 3U1SH 3G04A 3E8UL 4NKIH 1BZQK 1OVZA 4PTUB 3V6OC 3C2SA 3D39E 4MJ6B 1PQZB 2CDFB 3ES6B 4IJ3B 5K9KA 3VRLE 3WFBL 3ULSA 4OLEA 1QPPA 2RBLA 3NCCB 2J5LC 2K7QA 3HKFA 2YSSB 4N0CD 4NO2B 5L88L 1PLGH 3VXOB 3O41B 5ACMA 4JLRA 2BX5A 1U8PA 3VW3H 4Y2DB 4FZ8L 4YK4C 5MEND 4UV7L 1EZVY 2BNQE 2DYPB 5FKAB 5T1MB 5F89B 4IHOA 4C59B 3HMWL 4Y4KD 4MXQD 4X8XA 1MH5A 4F7CB 3RP1A 4I18C 1HNFA 4FFWD 5IQ9A 1BBJB 4LPCA 5TF0A 5D1XD 1YY9D 3GSXB 5A3IC 3EHBC 4XX1E 5DUPL 1AP2A 4XPHL 1R3KA 4GLRI 5E56A 2OK0H 5BXFB 2ZKHH 4Z7QF 1JUFA 4PJ5B 1MJUL 1NFIA 2ITDB 3UJIH 2R8SL 3LN5B 2G9HB 2R23B 2NLJA 3GSQB 4RA3A 5CHNB 5C6TH 3VFWA 4DGVL 5K9QG 1YECL 3GK8H 1FORL 2VLJB 3D87B 5FO7A 1EIBA 4MD5A 2Y5TB 2DQDL 4UMGA 1MF2L 4LLYB 2YWYA 4OZ4B 5I16B 1JPFB 1NKRA 3MXVL 5IEHB 5L2KB 4PTTA 3FO2A 3H9SA 3QO1A 2J7LA 4L8SA 4LCCC 2DM4A 4YEFA 1EX0A 1JI2A 1P6FA 2CIKB 5C0DB 2EC8A 1WVZA 4LCUA 4FP8H 3NPZB 4PP1C 1KCUL 3OKEA 4Y5YB 4P3CL 1CLOL 1MI5A 3GSOA 1C7TA 1J5OL 2F5BL 5I1JH 4D0DA 1RUQH 4RAVB 1N0LA 4CU8A 4BSWA 1INEH 5AWNH 3TBYB 4F7PB 4R2GD 1P1ZA 1JWUB 3CC5B 1OCWL 3DVGB 2I5YL 3WKMH 1HILA 3HI5L 4MD0A 5CJBA 2BVOB 4JO1L 2VN7A 4ENEC 1KYOK 4G3YH 1J1XH