1RIVH

Anti-cocaine antibody m82g2 complexed with meta-oxybenzoylecgonine
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
223
structure length
220
Chain Sequence
EVTLQESGGGLVQPGGSMKLSCAASGFTFSDAWVDWVRQSPGKGLEWVAEIRNKANNHATKYTESVKGRFTISRDDSKSSVYLQMNSLRAEDTGIYYCTSVPQLGRGFAYWGQGTLVTVSAASTTPPSVYPLAPGSGGAGSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTQVDKKIVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carving a Binding Site: Structural Study of an Anti-Cocaine Antibody in Complex with Three Cocaine Analogs
rcsb
molecule tags Immune system
molecule keywords Fab M82G2, Light Chain
total genus 43
structure length 220
sequence length 223
ec nomenclature
pdb deposition date 2003-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rivH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rivH02
5JW3H 3MCG1 4PV9B 3IDMB 1U92A 1VB9A 2IBGA 3MCLH 5FYJH 4KMQA 5KSBB 2GAZA 3JVGC 4R6UA 4O4YH 4LVNB 3SN6N 4H1LA 4K71C 2Z8VC 3W0WE 3RVUD 12E8L 1TVHA 5ALBL 5A3ID 3T4AA 5GRXG 2A6JA 2HT3C 3H7LA 3G6AB 3LKQB 2AJUL 5C6TH 1IGYA 4X9GA 5LQBH 5BV7L 1DVFB 1P4BH 1XMWA 4M62L 3MYJA 4HMEA 1MHEA 3GSRA 2KZ1B 1FL6B 1KPRA 4N0UE 3O0RH 5GIRA 2ENSA 5E99H 3OKMB 3CFBA 1DJSA 3MNZB 1OP5H 4QF1B 4AEFA 2APFA 3I6KA 1BBJB 4WI3A 2GTZA 1KTDB 2Y23A 4OZIE 3RTQD 4F2MA 5IWLA 2AABH 3QCUH 1L0XA 5E24E 1MI5A 4N0UA 2ZOKA 4PR5B 4MD5A 5TQ2H 5E7FA 3T0BA 1HQRA 3QWOA 4XBPA 1K2DA 4PRBB 1FNSL 1NEZG 3MODH 3VFNA 2QL1A 3LOWA 2GT9B 2O5ZL 4Q58C 4OBSA 3VXMA 4TRPL 1E4KC 1RZJH 2GJJA 4GW1B 3ULUD 1BQSA 3WIIL 4G7YL 4I0PD 3TA3A 3U9PH 4G43A 5J3HC 1JHTA 3MOBL 4XNUH 1M7IB 4F7MA 3MNWB 5IFHH 1QRNA 5I75B 1I8IB 3V4PL 5HYSA 3GI9H 2X9YA 5TDPB 1MVUB 1QSEE 3FAXA 2PTUA 4UBDC 1P5VA 2XA3A 3BQUA 4DKEH 3HMWL 3B3IB 3UTTD 2EDWA 2OXGA 1RHHB 1D5IL 5TDPA 3VD9A 2V9RA 1VFUA 2XKNA 3BE1L 5H35B 3OX8A 3QXAA 2IWGA 2XKUA 5I19L 1EHXA 1QRNB 4IDJL 4UV4H 5E7BA 3GMQB 2IMNA 1E4WL 4MCYB 5I9QB 3LKSB 5IG7A 4MLSA 4TSBL 3MRIB 3S9DB 2NXZD 1T5WB 4Y5YB 2ZP0T 3ARDD 4JPWH 1BZ7B 2CSPA 2VDOH 2JB5H 3LKRA 5GS2H 4Y4FD 1PD6A 4GBXB 2NNAA 2OP4L 1K2DB 3SGJA 1KLGA 3QJFA 4XHQA 1CFVL 4UZGA 1LO5B 4UT9H 2EZ0C 4LLAA 3MLXL 3VGEA 1H3WM 5FO9B 5DK0B 3IFOA 5F9AC 3VCLB 2L7UA 4CU8A 1I7RB 3MNZA 3KNBA 3JWOC 4NM4L 2X05A 3P9LA 4QEGA 2AXFA 1KXTB 1FH5H 5JA8B 4JY6A 5L8KB 2DMCA 3QUZB 1H0DA 1KPRB 5E95B 3GRWH 3QUMA 4JHAH 4ZUUB 1MHEB 1J87A 5TH2B 3JZ7A 2EXWC 1IAIL 3D39D 4X8JB 1MQKL 1Z5LA 4IRJC 3MREA 4OTXL 5DRNB 3PHOA 2VITA 5HYIA 4LHUD 2HTKC 1I1AD 3MPCA 1NH6A 5T3XH 3BP5A 4Z95L 4KH2A 3V6OA 1LK3L 4IS6A 1JHKH 4H1LB 1U3ZA 2AXGB 3IETB 4IJ3B 2MMXA 3PDDA 1UH2A 3H9HB 5C0DB 2Y5TB 4NZRL 5F7UA 2DKUA 1KCSH 5ADOH 1QSFE 3FJTA 1I7UB 2R4SL 5BVJB 2YSSA 3RY4A 4NQTA 4YIQA 2BOBA 4JFED 1ZT1A 4FTVB 1EERB 3QUXC 1MRFL 4AL8L 3MBXL 3QDJD 1JPFB 1U8OB 1I8MB 4ZSOE 4NZJA 4KHXL 4P2OC 4HCRA 1T2QL 1A6UL 2IBZX 3D69A 1DDHB 1G6RL 4QXUH 4HGKC 3LN4B 4L3EA 4S1SH 1QPPA 3FT3A 4LDLB 4TULH 1G84A 1DQLH 3UTTE 1KIQB 1X5ZA 1HXYB 5DRWA 4NRXB 5IFAL 1AQDA 2AJXL 1RZKC 2P5WA 3U1SL 4PJXA 1OPGH 1VA9A 2E7LA 4NO0A 4QHUA 4HIEA 3D0LA 4OKVB 3O3DB 3HPJA 1RIVH 4X9HA 5HGHB 3BH9B 2AEIT 4U6XA 1JWSA 4K3GA 2R0LL 2NW2A 3RWDA 1CBVH 2YUVA 1U8JB 2X6MA 3ESVF 1FRGL 1LO0L 4Z7OF 2GUOA 3KYOA 3LAFA 1NJ9B 1DVFC 2VDML 4JDTH 2XNAA 4KJQC 4Z7NE 4OLZH 2ARJQ 3ULVL 3BEWB 4FQJL 4FXKB 1SJHB 2CIKB 2FGWH 5IMLB 3OGCA 1PYWB 1RY7B 1KSRA 4OZGE 3IDYC 5ACZB 1NCBH 1RZFL 4GLRH 1KCSL 3VRJB 4X6BA 4G8IA 5FCSH 1FL3A 4K3EL 3T0EE 1X9QA 4GFTB 1R5VB 4NBZB 4XPTH 4XGZB 3L3DB 1PY9A 3OQ3B 3LV3B 3SBWA 5I76B 5EA0L 2FB4L 4K3JL 3BKMH 4NWUH 4D9LH 4PJAA 4ODVH 1C5DA 3AS2A 3WSQH 3EYSL 1LE5B 3DX9A 1WEJH 3KPPA 5I2IB 4R90H 4QXGH 3RWHB 3FTGB 1F11B 3AREB 4WFFE 1YMMB 4BZ1H 4OF0A 1BQLH 3EO9L 5DJ8B 4ZSOB 3QEUB 2BSED 3F62A 5JUEL 1UM5H 1GPOH 2EDYA 1EV2E 3IDXH 3LY6A 4NN5C 4IRSD 1FBIH 3DECA 1URLA 2XKSA 5TGBB 3MGOA 2CLVB 5FGSA 4EN3D 5BRZE 2NY5L 3P4NB 1OAZH 2BNQE 1DQMH 4LHQB 5BJTB 1E4KA 4GRWE 5INCA 2DBJA 4ONGL 3W82A 4RMQA 1CFBA 4LSPH 1BJ1J 1SM3H 1FO0B 1EEQA 3DXAA 5KZCD 3SKJL 1U3YA 1I9IL 4R0LC 3MBXH 1A7QL 4N5ED 1AO7D 3HE6A 1S8DB 2D0GA 1I7ZB 1G9ML 1O7SA 3WV0A 1KJ2H 2ICWI 1HHHB 1Q9KB 4H5SA 5ID1A 1OTTC 4WGWB 1PG7H 4PRPD 1BREA 1MHCA 3U6RA 5HYQB 2Z91B 3CK0L 5JPMB 5DJXA 1KGCE 2XPGA 3STBA 1J0IA 2D7OA 2UZYB 2MHAB 5IESL 1UT9A 4JLRB 4HXBL 1RZJL 5EOTB 2PW2B 1MAMH 2XNAB 1T1WB 4NQDE 5GQBA 1RQ5A 3VE0B 2D7QA 4O00A 1ZTXL 3TBSA 2H3NB 2ZUTA 3TN0C 5IMOB 3IXTB 1WZMA 5EU6D 1JK8B 1D5XA 3MRPB 1XIWC 4ERSL 1SMOA 5FYJU 3GSNH 2XACC 3V5HB 2ILLA 3WHE1 4F3FA 3MLTA 4NFCA 2VQUA 2YC1B 3BP4B 3GI9L 3MRBB 3TIDB 3VI4E 5KSAB 1AC6A 3DRTB 4NN7C 3VI3F 4CVUA 1RK0B 2VE6B 2O26U 2VAAA 4UT7H 3QDMD 1J0JA 4KTDL 1QLFB 2O5YH 3LRHA 1EMTH 3MBEC 4I4WB 3FT2A 4OV5A 3FT3B 3MXVL 1ACYH 1SM3L 4M7JH 2D03L 4Z0XB 1C8PA 3PV6A 2R0ZL 3EGSA 5HXMA 3UJJL 4U6YB 1OB1B 1Q9WB 3AU1B 1KELH 5E08H 2R2HA 2OTUA 1VACB 4Y2OA 4GRLC 5EU5B 2DI8A 3PWVB 4DEPB 4LVHC 1JGDA 2JB5L 1RUPH 1R3LA 1YN6A 1NLDH 1NGQH 4GXUN 3HCVA 5DJAA 4DQOL 4EI5A 1XF3B 3LDBC 4AY0A 2IQ9H 3R06A 3O3AB 3EFFB 3IF1A 3PL6A 3WFZA 1M7XA 1X4YA 1AKJB 3D39E 2R69L 3MXWL 3H9ZA 5C0DA 4PRHD 1XGTA 2EE9A 2IADA 3WS3B 2JCCB 3EJZD 1JHLL 1OSZB 1DBJL 2BOCA 1KENL 2Z4QA 4OZFA 3UAJC 4PRHA 3GRWL 1RZ7H 4UOW0 4PJXF 5AAMA 4R3SB 4M7LL 1J0ZA 2I5YH 4U3XA 3SDAD 1IEAB 5CEXA 1PG7X 3L5HA 2VDPH 5SX5K 4KI5D 5TE7L 4TSAL 3MX0A 1JGEA 5K93A 3F5WB 2AJVH 3IFPB 3WXWH 3L5IA 3GGWB 1K8DA 5ANME 2EIZA 1HYSC 1BBDL 1Q9LA 5DURB 2GJ6B 4Y2DA 3ZDXF 4M7LT 4NZTL 5E9DD 3KNBB 4NDMB 1IGJB 1W0YT 2JELH 3VU2A 4ODTL 3FCTB 2ERJB 3REWA 1KGCD 1OAUH 4DZ8A 1A6TA 4JHZA 4BSVA 3DO7A 4LRNH 1L7TL 4MQ7B 4E0RA 1ITCA 1MCPL 1G6RA 2DQTL 2MOVA 5JIKA 5SWZE 4BK4A 3WNMA 1MLBB 4UIKL 2PYFB 1AD9A 3MV8B 1BM3L 5L2KB 2IH3B 4AT6A 4CUCA 3MV9E 1C08B 1QFPA 3TF7C 1T2QH 3HE7D 4YK4C 4XP1H 1I3VA 4EUPG 2HVJB 1N26A 2VOTA 4U2YA 2BVTA 3UBXI 3K80A 4NN5B 1YMME 5E1AA 5IG7B 1QNZL 3LKSA 2W60B 4F8TA 2WBKA 3GMQA 5C0EA 5GZNC 1IGCH 5I17A 4OGXH 4MHHI 4K23H 3WO3B 4FQ2H 4HEPG 4WW1B 4FFVD 5I1HL 3QNZA 4PRID 4HC1A 1A5FL 3NPZB 4G9DA 3KXFE 2BVQA 4XNYH 4PRIA 3D87B 1CLYL 4OUUA 2A1WL 4NT6A 4WEBH 4L4VA 2YPLE 2BHYA 4GJTB 1CBVL 3SDXF 4RMUA 2WAHA 3T2NH 4DK6A 4RMSA 4L3AA 1NPUA 4OCYL 3WFBL 2VZSA 4P23C 2FEEI 5EZLB 4LU5H 5JR1H 5KJRH 1FNGB 4HMDA 4M48L 3ULVH 3GJEA 3MLRH 2HFEB 1J7VR 1BEYH 3DGGA 3QDMB 2FJGA 1A1NA 1GGBL 1I8LC 1NCBL 1RZFH 2R2EB 4Y4FC 5AD0B 1MJ7L 1ZHLA 2QR0B 2Z93A 3MCKA 4XPFL 3C2AL 4AIXA 4JG0H 3E2HC 5DUML 4Y5XC 3CVIH 4IHOB 2Z31C 5I74C 3JV4A 3MNVA 1T1ZA 1T3FB 1LEGA 2VDRL 3T1WA 2R39A 1CFQB 3GDBA 4ZTPH 3OL2A 1U8PA 3TZVD 1K4CA 2FGZA 3LSOA 4FG6D 1QNZH 1EZVY 3DMMB 1CLCA 4ZDHB 3S37L 5E8EA 1AGDB 1GPOL 1I3RB 1K3IA 4M1DH 3W5MA 1FN4A 3TBWA 4X6FB 5DUBA 1WQVT 5LG1A 5SWSA 3C2SA 1W72A 3EOBA 3EJYD 1NAMA 4PP1C 4UDUB 3T0WA 4NWTH 2A6JB 3UTOA 4X7TB 2ITDA 2FRGP 3G5ZA 5SWSD 2APVA 5J06A 5JXEA 4NFDA 4JRXA 2DLEA 3TYFA 2J8UF 1NCWL 1N3NA 3LKPB 1G1CA 5C86A 1TCRA 2ZCHL 4JRYA 3WUWG 2LTQC 3V0VA 1ACZA 3V4VH 1BP3B 4S1RH 2J8OA 4FABL 4CMHB 5ILTH 1I8KB 3LEVH 3S6CA 2QQKL 5DEZA 3TC9A 3CLEL 4V1DE 1Q9OB 5FO8A 1DQDH 2LAAA 2CDFB 2VLKD 3HI6H 2HVKB 2EYRB 4JPWL 2Y6SC 4XXDA 3H3PL 1OAYH 2FHBA 1EXUB 5BO1H 3CD4A 4KUZL 1R5WB 2PYEB 1CZ8H 1XR9A 1XR8A 2A0LD 3HR5A 5AZEH 3VXSD 4NQSB 2L4OA 5LCVL 4L4JA 1I1AC 4HFUH 1KIPA 1YEFH 2E8ZA 4R2GC 3TO4B 3QEGL 1T20A 3QHZL 3UBXA 4FQXA 3ULVF 4TPRL 2AW2A 5GGUB 4UOJA 1TZGH 1MRDL 1S9WA 1YQVH 4U6VL 2CPCA 3U0TA 5GRUH 1YNKH 4CJ1A 3LEXA 5EFIB 4LCYB 3NOIA 1XCQB 4WI9A 3EOYG 5J8OA 3MLTB 1TJGL 4LCCA 4HKJA 4RBPK 4I48A 1R3HA 3VRIA 4JDZB 4H0IA 5GSVB 3VXUD 5DS8B 1RZ8B 2A1WH 4WEBL 4FQHB 4X4ZA 4XPHH 3QPQD 5BXFB 4FQPA 3VXUA 1FGNL 2VDLH 4DTGL 5EOTA 1EEUA 4I0PB 2M2DA 1UXSB 2BNRB 5I8KH 1FNLA 4LGSB 5J3HD 3HLAA 2RB8A 5HGAA 5IVXE 3S7GA 1NGYB 5EU7C 4J3TA 1MFAH 1A1MA 1AP2A 3UYOD 3V4VL 5JW4N 4LHUG 4PJFB 4M6NL 3W2DH 4X7SH 4XAWH 1B88A 5HYQA 3VFMA 3MXVH 5BS0A 3S34H 1V3LA 4NQDB 5GGQL 2DL9A 5SWZB 2WWMC 3HUJF 1JNLH 2BVOB 4NQUA 2XZQH 2YD9A 3GSXB 4OZHA 3LD8C 1UGNA 4EDWL 1DP0A 3KJ6H 3DSNA 4KVNH 5A2IH 2LVCA 1ZMYA 3U46A 1KBGH 1SY6H 3QT2A 4KTEH 4Z77B 2YRZA 4S1DD 1UJ3C 3DXAB 4KPHH 3Q6FB 1NC4A 4Z0BH 4LNVA 5LCVH 4DGYH 4PLKC 1KTLB 5LVEA 4KXZH 2VSCA 3EJYC 3DSFH 2FYYB 3BAEL 1TDQA 1RZ7L 5KSUB 1M71A 2OL3B 4TRPH 2VL5A 3EDEA 1MCWM 1CDGA 4PJEF 1H5BA 3C8HA 3ZKMD 2IALB 3SGJC 3OBAA 4KUCF 3V8CA 5EBMB 3LRGA 3N1QC 1FDLL 4X80L 3DO3A 3DUUB 5C92A 3C8KB 1D6VH 3GMOA 2ZUUA 4WY7L 4KDWA 4PB0L 1KTLA 2VLKE 4YBLB 3MO1A 5BZDB 5I18H 3AS0A 4OLWL 3UDWA 1KN2L 4U1NA 1WWBX 2YPKA 4ORZC 4JREC 1U8IB 1YMMA 3QFJA 4ODWA 2YZ1A 1W0WA 3OKYA 3N1FC 3P30L 4Y5XA 3T0DA 4WVRA 3IYLW 3PABA 1XT5A 3QO0B 4GH7B 4ZFZB 5DC0A 4IMLA 2YD6A 2OJEB 2DJUA 2XZCL 1F42A 2GY5A 4P2RB 3NIGE 5D1XA 2JCCE 4BZ2L 3W2DL 2QSCL 3VFMB 3D39B 2ICCA 4JHAL 2F8OA 3AXLA 4X6BB 3O8XB 3CVHA 1Y6MR 5MENE 2Y06L 4AQ1B 5CBEA 5D6CA 1WEJL 2OQJB 4WO4B 2X41A 5DMGC 4XP1L 2VDKH 3U48A 5C9KA 3IAGC 1P4LB 1MJ8H 4JFDA 5FGBC 3RVUC 2P8MA 3L3JA 4H8WH 3NFNB 3MLXH 1UWEL 3S4SG 5EOCH 2E8YA 4O02H 4ZQKA 4KXZI 4JPVL 3D2UB 5HDQH 3V6FB 3W11D 1B2WH 1BPVA 3QUZC 4U1MA 5T3ZD 3MA9H 4MHHG 4WTWA 3KGRA 3V0WH 3U2SA 3DXAE 4MX7B 1GGCL 2YA2A 4LCYA 3D2UD 2HFTA 1R0AH 1A5FH 1FZJA 5GS2D 4WW2A 2BMKB 1CN4A 3M17B 5FKAB 1OAXH 2YMXL 1WAAA 4Y4FB 5F3BA 1CGSH 4AM0B 4HIHA 3C5JB 5J1AA 3TO4A 3VI3E 5D93C 1Q0XL 1B9ZA 4EUPH 1MWAL 2Z31B 5I71B 1AD0B 5LBSL 2NMSA 4ZTOL 1R5WA 3T1FB 4I77H 1YJDH 2Z31A 3I02B 4D0DB 4A6YL 5ENWA 4LRIC 3BN9C 4XTRC 4WI6A 4N8CH 1FL5B 4WEMB 1AGFA 5E6IC 5FYLL 4XBGB 1BVKB 2ZPKL 3K1KC 1EJOL 4FQIH 2HFGL 3TCLB 3N0PB 3VXSB 4YHZL 4FZ8L 4OD3H 4JZJB 4KHXH 1TCRB 1JV5B 5DJCB 1C1EL 3RVVD 3TYFB 2Z35A 3W81A 8FABA 5L2KD 4ENED 3ULUH 4JKMA 5MP6L 4R7NA 2CRZA 3SDAC 1BD2B 2K1MA 1HSAA 1WF5A 4U1SA 3RWFB 2E7CA 2Q7YB 1K5NA 3D1MC 3NCBB 4UDUA 3UAJD 4UB0H 5DRNA 1T6WA 3OJ2C 4QRPD 1KEGH 4CMHC 1C12A 3CDYA 2F19H 3MR9B 3OKDB 4Y2DD 3JWOH 3PGDB 3JWDH 5CBEB 1H0DB 3X11A 4OCMC 3UTSE 1T4KA 5HY9B 1MCOH 4I2XE 3WSQL 1FP5A 1T1ZB 1T3FA 4M7ZC 4MDIA 1X6NA 5AG8A 2P7TB 2IPKA 1ZS8A 1SHMA 2QR0A 2Z93B 2R4SH 2XI9A 2XWTA 3DBXA 5I6XC 4ZOAA 4ZTOH 1IGIL 3H0TA 4FRWA 4Q2ZB 5F97E 4OF5A 1F3DJ 4YR6A 2COQA 1UJ3B 4X5WB 1YPZF 5T3ZH 3LKRB 1TVBB 1WTGT 3MLVH 5ECJE 1NCAH 4GXVH 4Z9KB 3WFDH 3EAKA 4H26B 4MNGB 1RULH 3DUUA 4HS8H 5ELIA 2MQCA 4FG6C 1IILE 4M00A 1VADB 4OLVL 1ZT4A 4QWWD 2XA8H 2A6KA 1IKNA 4N90D 2FBJL 1NGXB 1KIUA 4F37F 2NX5A 4NWUL 5EO0B 1VFAB 1PLGL 1HYSD 1T83C 2WUBL 2DQFB 2VKXA 2ZUXA 4W4OC 4OD1L 4FFVC 3QDJE 2DDQH 3E0GA 5EU7E 2VR5A 3B9EA 1JGVL 4QHKI 1JRHL 2VLKA 3H9SE 3TVMB 2BXZA 4O58H 4ELMB 1XF5A 1CICB 2DRUA 1NMCB 7FABL 3CXHK 1BF2A 3R4DA 5JQ6L 1UM5L 3QUKA 4HXAL 3EYVB 4Z77A 4HEME 3ULVC 3U4AA 2BC4B 2FIKA 2W0FA 3VXPA 5IVNA 5DVLA 35C8H 1Q1JL 1M7IA 2Q8BL 5KN5A 2VMFA 5MENA 1RSFA 1T21B 4D9QD 1MCNA 1LO2L 2VXSH 4N9OB 3G5YA 1J1OH 1KEML 2GT9A 4DUXA 2IAND 2XZAH 3D0VA 4UT6H 3B9KD 5EBWB 4ZPTA 1CG9A 5D1ZA 1E27A 1OCWH 1MFAL 4MD5B 2IH3A 3B5HA 4OI8A 3I9GH 3GSOB 3KPTA 4Z7OE 2R4RL 1IAIM 3G6DH 4F2MB 1WGOA 3BDBA 3PQYD 2YXMA 4EQ3A 3SPVA 4JG1L 5MI0B 5IJVA 4YHZH 1PKOA 3BPCB 1IGJA 2FX9L 2C3XA 5E00B 4JRWA 1JMZA 4GXVL 3FO2B 4YZFE 4PGCA 3VXTA 3HA0A 2VLJA 4QRRE 1DVFA 3S5LB 2XTJC 5J9PB 5ABDE 1WISA 1NGWB 2BSSB 3EOAA 1KB5L 4MZ3A 4PJBA 5F88A 3RX7A 4C55A 2HKHL 32C2B 1JTPA 1R3IL 2PXYB 1KFAH 2DLHA 3TEUA 3HR5B 5D5ME 3TJHC 2EKJA 4ZXBD 1FLRH 1R3KB 2Y6SD 1XH3A 2R0KL 2F53E 5IW1A 1J5OL 1BD2D 3EFDH 4FS0A 2F58H 1XGPA 1DR9A 3V7AE 3VRLF 1N0LA 2X40A 3PL6B 4JY5L 3ARGD 1OD9A 3A6CH 3BXNA 1EXUA 1A6WL 1FZMB 2HT2C 4XXDB 2Q8BH 5T33L 5L0QC 5J89A 4MWFA 2X4OA 3NTCH 1C7SA 4WU5A 1TIUA 4MWFB 2NY0B 1BZQK 2VISB 1FFPA 3DV4A 3H6JA 5BRZD 4O2EA 1A14L 4JFOA 5CLWA 4F37K 3O9WB 1XGPB 1OCWL 3DRQB 5ID0B 2XYCA 1KPVA 3ULUE 3BPNC 5IBTH 5J11C 4ZOCA 1SBBA 3RPKA 3L3GB 3DI2B 4Z7VB 1MNUL 2HH0L 2OS7A 4LEXL 1NGXA 2AJUH 3S36H 5F88B 2OX5A 4UUJB 4EQ2A 1MJJB 1T1YA 1X5JA 1W72B 2BCKA 3E6HA 3O2VL 3MV01 3IDNA 3ZHKA 2VLJB 3FFCE 5C2BH 3GMRA 5C0RH 1HKLH 4XBEH 1RJZA 3CFKB 3FKUS 3VGDA 1EVUA 2R15A 5E8EB 4HJGA 2IQAA 5IQ7L 2A6DB 2DJ4A 3DHMA 3LPWA 1D5XB 3VGAC 3ELAT 3BIKB 2Y36H 4PV8A 4MXQC 1YEEH 3JV4B 2J6EA 3MNVB 4MDIB 4FXLA 5DLML 1WCQA 2FNBA 2DWEB 2FR4A 4IRJA 4HCRL 1E28A 3LIZL 2EYSB 3PWPD 1FNSH 2XQYK 3GSVA 3I6LE 4K07A 4GG6A 1A9BA 5DJXB 4NOFA 3OKDA 4HT1L 1P84J 3RI5F 2IH1A 3BKCH 3SE8H 4F7PB 4YDVA 4G80B 3PP3H 1QO3A 5E6YA 1VEPA 5IW6A 4OGXL 4LVNC 1N5AB 1ZVHA 3RWFA 3RL1A 2IPTL 1Q0YL 1QSFB 4RFOL 4HPYL 1QR1A 1BZ9A 2DJSA 4WTZA 5ERWA 5KS9F 4S10A 3LQAL 3MRKA 3VXSA 4YBQC 3S98A 5CJOH 25C8H 4K3HA 3DX8A 2Q76B 2JK5B 2CR6A 3EJZC 3GSNB 1M6OA 1Q72L 1UYWL 3KHOA 2VR4A 3I02A 4D0DA 4QT5B 4PJCA 5B4MD 5HHQA 1UQSA 2UUDK 4TQEH 1PZUB 3PGCB 2UZIL 5HDBE 4X4MA 3E6FB 2WLZA 3L1OL 1UB6B 1TVBA 4XAKE 3OAYH 4MD4B 4NYLB 4AL8H 4KRPD 5EIVA 1A7NL 3C5JA 5FOBA 1DCLA 1JNNH 3S5LG 4OJFL 1SMAA 3RA7H 5GGRY 3CU1A 1N4XL 4WDIA 5C6WH 3O11A 1IM3B 1DFBL 5T5NG 5I9QC 2J88H 2CD0A 1AR1C 3D3VE 4EBQL 2X4UA 4NKDA 3UROR 3THML 5IT2H 1GGTA 1ZAGA 1MELA 1VESA 3D25B 4P2QA 1Z0NA 3WJLC 4Y2DB 3PQYB 3U30B 4S0TD 2D3VA 1BFOA 4NBYB 4UV7L 1EIBA 1NAMH 2NPLX 4QRTB 3S35X 1JNLL 3TJEL 4JFDD 3MLVL 3MR9A 4FXKA 1PKQB 5GRWA 4MA1C 2R0WL 2X89A 3HAEG 3DVNA 2E27H 4M4PA 3P0GB 3QXVA 1KJ2L 3T0EB 3G04A 1UA6H 3BO8A 2WWKO 2Q7YA 2YPLB 2DBLL 1BD2A 4Q9RH 3CVHB 3PQYA 4U6XB 4DGYL 2Q87A 3QHFH 4JN1H 1JN6A 4DAGL 2IADB 3RGVD 2NY2B 1JWUA 4QHMA 5EO1A 5D1XB 4OM1L 1ZKAA 4PPTA 4BYHA 4NKQB 4ZFFB 2EDDA 2HP4A 3R06B 1BVKA 2OR7A 2P5WB 1I4FA 4TQEL 2X7LB 3K3QA 4K94C 4Y0GA 4Y4HD 1K8IB 5A2LH 3IB4A 3GUTA 2A9NL 5I1IL 3PWUB 3UZVB 3NH7L 3MRHA 1KN2H 2PTTA 4DOHE 2Z31D 3P77B 1OB1A 5FUZH 3GMOB 4K7PY 1N7MH 2HG5A 3RRQA 3KYKL 1DDHA 3F7YA 6FABH 4EOWH 2D31A 2CKBH 1VGKB 4PTUB 2R56L 3QIBA 3UYRL 4X7EC 1M6OB 2BSTB 2XZCH 1HI6B 5TDOB 5CINL 4G8FA 1QLFA 4JKPL 4BELD 4DVBA 3BVNA 1BIIA 2UWEF 4OCLC 3C8DA 4BQ6A 4HIIA 2WK2A 3MOBH 1I1CA 3IDXL 1MRCL 3QQNA 4MJ6A 3REVA 1RURL 2AJ3A 3ZE1F 3RI5K 1JFQH 4Q6IA 5KANG 3V5HA 3Q6GL 4XRCB 2LU7A 3HFML 2Y07H 4ZUTB 3U0PA 3B2VL 1ERNA 5L2KE 4IRZL 5CKAA 3NFNA 4O02L 3UPAA 1E4XI 2F53D 2EO1A 1UM4L 1VHPA 1I85A 3L3IA 2DQIL 2PW2A 5CGTA 3KPLA 5SWZD 1WT5A 1FFOA 3OAUL 5GGSA 5FK9B 1NFDE 1LEKB 3SJVE 1AR2A 5I1JH 4ZUUA 4PJFA 4YFEA 5T1KB 3TM6A 2A0LC 3RJDA 5I1AB 1BFOB 2XWJA 2AXFB 4WGVB 5JPMA 5F6HJ 3C5ZD 4I5BA 4L5FL 5E8OB 3KLHD 4FZEH 1I7RA 2VC2L 1TJGH 3D25A 4LP5A 3FQTA 2ZG2A 4MSWB 2WP3T 2OP4H 5CJ8A 2VDNL 2YD2A 3G9VA 1LO4H 3I84A 4UQ2A 3NCYP 4PRPE 3RDTD 3UJTH 3DV6B 2FJHA 2E7HA 2BJMH 4OB5L 4LSTL 4YQXL 5C0CB 1OLZA 4LCCB 3ULUF 5DFTA 4WTZG 5KAQF 1T7XA 5HHNA 2JCCF 3S37X 1T89A 4KZEH 3RP1A 4RNRB 4FFYH 2JF1A 2CMRL 3GB7A 4HS3A 4ODBD 5EBLB 1CVRA 1T20B 2PETA 1S7WB 1EZVX 5A16B 1H5BB 5E70A 4JPIB 3GI8L 4G7VH 3I3BA 1EVTC 4ODUB 5HJ3A 5FUCC 1S5HB 1QKZH 2DWDB 2CRMA 3NPSC 4V1DD 2CLZB 5ETUA 4U7KA 4RAVA 2Q3ZA 3BQUB 3KPQA 4P5TD 4GKSB 1FC2D 4P4KC 4G8EB 1XZ0B 1NC4B 3Q6FA 3VDBA 2VISA 5HYSB 5AUMA 4YHPB 3IU3B 3EDKA 4PJCF 3OZ9H 3KS0H 1P4IH 1YEGH 4OZHB 4JM2B 1FSKC 1IC5H 3MLWH 4C4KO 4NO0D 5C6PB 1NBYA 1C5DB 1CE1H 4CRPA 3C08H 1IC4H 3P40A 3B9KC 4HWUA 1R3KA 4TSCH 5H37G 3MUY1 1S7SA 4ZNEA 1OSPL 4MJ5A 2HYMA 5TF1L 1FVEB 4XBPB 32C2A 4MXWL 5ACZA 5HI4C 2AS5M 3EOAB 4HZLB 2YBRA 1RUAH 4RFEB 5F8RC 4U1LA 5D1QD 5CINH 3TESA 4KK8C 5IB1B 3VXUB 2R29L 1CXLA 2XFXB 3FFCB 2WUCL 1MFNA 1U8JA 5JHDB 1MPAL 3GSNL 1U58B 4IRJD 2C26A 2KL6A 3V79C 1G0XA 1A6ZA 4D9RD 1NANI 3MRFA 1UWXH 4PY8J 2R8SH 5IJVB 15C8H 2DN7A 5D4QA 2NY3D 2XN9E 5E2TH 4PJ9C 3R1GL 4YGAB 4LLUB 1B4JL 3A67H 4G9FE 1UM4H 3MCKB 1ZHLB 4EUPA 1NKRA 1OAQL 1T1YB 1PFCA 4HZLA 1JGVH 4OF7A 4XMLH 1T03L 5CJ5A 4GG6F 1WWAX 3QDMA 1TVHB 5D1ZB 1GIGH 4O2CB 1HN1A 5F3HB 2QQLH 1ZTXH 1W72L 2NY1B 5DSCB 4FTVE 1S5IL 1NEUA 2ESVB 4HXAH 8CGTA 4Q6IC 3K81A 4X6CA 1TLKA 5ISZE 1F8TH 2LVEA 3EBAA 3QIBD 1A9EB 2OK0H 4NN7B 5LXGH 2P5WE 5MENB 1YEGL 3R0NA 4L4VB 1KYOK 1FFPB 3SBWC 2EDOA 3PE9A 4J3SA 1QSED 4M61A 4B7IA 3O41B 5LWYH 2BVQB 3CXDH 5I1LB 3J8F7 2V9QA 1QLEH 3GMLA 1CICA 4NM8L 2VXTH 5I71C 1DUZA 2EH8H 1YY9D 3KPSE 4PJ5D 3SE4A 4HPOL 3CFJA 4WW1A 1G9NH 5DFVC 1MWAH 3PWPB 3CFEB 5DSCA 2G60H 2GSIB 1XGRB 3QFDA 1VFAA 3JUYA 1EGJH 2NYYC 5EO0A 4JPIA 2V5MA 2H8PB 5A16A 2VKWA 3G5ZB 4KI5C 5D7LA 3IKCA 4J4PC 2VITB 1NGWA 2FHCA 3T3MF 3D9AH 3V0AC 3HUJB 3P9WB 1CVSC 1QKZL 2HVJA 4IOIA 5HYJA 1DBKL 2DQGH 15C8L 4RCAA 4IOFC 1J1PL 2HN7A 1RZJC 5J7CC 3FO2A 4AEHH 2R23A 3TBYA 1QFWM 1EEYA 3PNWA 5HPOA 3GSQB 1LEGB 4ZO6A 2WINA 5DGQA 4AZ8A 7CGTA 1KV3A 4ZAKB 2DQTH 1IGMH 3REWB 4M7LH 1WWCA 3OPZL 4HGWA 3UTQA 5E2VH 4W68A 2ZUVA 5I1AA 1K8DB 4ZPTB 3CSPA 4EXPX 2P24A 4MJ5B 4OV6F 3GJEB 1NCAL 4NJAL 5K33A 1K85A 4M03A 3O2WH 4HIJB 3QDGE 2G75A 2XA8L 3HE7A 3RX5A 3T8XA 3LB6D 1BVZA 3BZEA 1NBYB 3GBMH 3ZE0F 4D0BB 2AI0H 4OI9A 4NM4H 4NO5A 3PGFL 3U4BH 4OZFB 2XQBH 3T2PA 3BSZL 4R7NB 3MFGB 3IU3A 4F7TB 4J2XA 1YY8A 4WO4D 5GGTH 5DC4B 4HBCL 5DD0L 4G8EA 1NANH 1K6QL 4JFEE 5D9SA 4V1DB 3IF1B 4GKSA 5C08D 4ELMA 1BFSA 4HIIB 3RVTC 4OKDA 3SDXE 2ADJB 4DVBB 4FQLH 4HS6B 4ODVL 3ARBA 5CLTA 1T7YA 4WUUD 5ENWB 4WENB 3HB3D 4DUWA 2NX5B 3MNWA 5EU5A 2D31B 1JHTB 2IFGA 4HS3B 4HF5H 5CHNA 1KJ2B 3QA3A 2WWMD 3OKKB 2B1HH 3FQNA 5CMAA 1AD0A 5AZ2H 5I1JL 1AY1H 4XMKH 2JLLA 3ULUC 2D03H 2JJSA 1Z3GH 4OV5B 5IB4A 5J1AB 3ARZA 1ZHNA 2LU3A 4FZEL 4GRWH 4AEEA 5LJYH 5L2KA 3IFLH 2BMKA 3M17A 3P11H 3QDHA 4P59L 1Y0LA 3PDGA 1G9NC 4MQ7A 4DZ8B 5DQDH 5ICZA 3RU8H 2ICES 3C09B 3B9KB 4F3FB 1NGZB 3FQTB 2I07A 5JHDD 3MV7E 1G9NL 2VZOA 2BVPB 4X0KB 5F1IB 3VXRD 3RHWF 2XWJB 4MA7H 5F71A 2JE8A 2HT3D 5MERA 4LPVA 3WLBB 1LEKA 1BEYL 5MEOB 3BW9A 1INQA 4LNRA 1R3IH 4HSQA 5TJWK 5EUOA 5CSBA 5BVPL 3I50H 4U05A 2HA1A 3I9GL 4OZHE 4PREA 4J3OC 1RULL 1JZ4A 3QR2A 1ZEAL 4CU6A 3K2MC 2X1QA 1HSAB 1YEJL 1T7ZA 5F1IA 2GAZB 2NY1C 4JG1H 1D9KB 2FO4A 3WS3A 1JV5A 4Q6IB 2XY2A 4LASL 1I1RA 3IDMA 3BGFC 1AKJA 3O3AA 3LEVL 3AGVA 1IM3A 1FRGH 5E94A 2FGWL 3U82B 1W0WB 4YJZL 1AGFB 1IEHA 4HK0A 5CGMA 3WHXA 1X5AA 2E6QA 1Q8MA 4PJIB 2NXZB 4NYLA 3HNSH 1JGDB 4U1NB 1QQDA 1VGKA 1FNAA 4MDJA 1OGAA 1YZZA 5IBTL 5B4MC 3KHQA 3BGMA 1CWVA 4J3XA 1KJ3L 2FZ3B 3P4LA 4N8VG 1KJ2A 3QA3B 2OL3L 3OXRA 3BPLB 2VXQH 2V17H 1NCWH 2ZUYA 2ZJSL 1KNOB 5C0AE 1IAKB 4IM8A 3MGOB 1QTYT 3ZDYF 4MXVF 4QHNB 1KCUL 2NTSP 3EDJA 4FABH 4Z7WF 4MAYC 1RUAL 3HTLX 4AMKH 5IV2A 4LHJB 5D7LE 4YDIH 1C7TA 1XAUA 5C1MB 3GO1H 1GHFH 2NYYD 2PKDA 3L6FB 1CU4H 5T1MA 3SY0A 5GISH 5FM8A 4QTHA 3EYFA 3ZE2F 3IFNH 2EXYD 4J4PA 1FBIL 5CIPA 3IXTA 4RGMB 5CEYA 3HMWH 2HT4D 3KPPB 4D0BA 3BJLA 1S78D 3RVWD 1MQKH 2GJ6D 4G80A 3GBLA 1UWXK 3LV3A 4XNYL 3QJHA 2VDQL 4HD9A 1R5VA 5BS0B 2OZ4A 4C56E 4DAGH 3FQXB 1A9BB 3PHSA 4RDQF 4QRTA 2FECI 4PBVC 4W4NA 1UB5B 3FQXA 1FYTE 3HC3L 5KW9L 3ROLA 3BEWA 4I0PA 4L29B 3TA3D 5F7EL 1JTTA 1V7ML 1RZGB 4U1GC 4PRNA 1AGEA 3QNYA 4YXHH 4KQ4L 5ID1B 2ADIB 2DYPD 4DN4H 1A7OH 5DMYA 3QEQE 3KPSD 4PJ5E 3X14A 1S8DA 1IZKA 5DDHA 1EO8L 4LMQE 5GSVA 2WINB 2E3VA 1KCRL 5IGXH 1BGXH 1GL4B 3BH9A 5JO5B 4LSRH 3IJSB 3MLSH 1S9VA 5FOBB 5CD5C 4WUKH 3F58H 3QRGL 4G5ZH 1YPZE 2HMIC 4NO0B 1EAJA 1XCQA 3PP3K 4U1KB 1I9RL 1RJZB 3LEXB 4HXBH 5EFIA 4HJ0D 3GMRB 3BAEH 1UB6A 5KOMC 3HUJA 5GS3A 2ZSVB 3NIGF 5BJTA 5A2KH 5FA4B 5EWIH 1FV1A 4HAFA 4OZHF 4PJCB 1YN7A 1EGJA 4ZAKC 3MV9D 5LGJA 4HJJH 1DBMH 2NY6D 4YWGH 5EO9B 2CK0H 2FYYA 4ELMF 2ZG3A 3SDXB 3QP3A 4WCYH 2GITA 1JPST 1JGLL 4F7EA 3FL7A 2ICWJ 5D7KD 3QEUA 1GOHA 2DQGL 2H26B 4R4BA 1MFCH 2RCSH 4PRAB 3WHXB 5C08A 1PGRB 5BV7H 4XCCH 2ZCLH 5CJOL 2BOBB 3GSXA 4P2OD 3N1PC 3DX7B 5D7JC 3GBNH 5I1GH 4L4VE 2B39A 2R2CA 1N5AA 3P3YA 3V0VB 5GXBB 4LPWA 1U6AH 3GMNA 3IAPA 4FQJH 3LD8B 3C09C 3BI9X 4PJ8D 3MV8D 3D18B 2ESVA 3EIFA 3A0OA 3TJEH 4H25A 4LAJH 1AP2B 3I3DA 4NJ9L 5DVNA 3GSVB 1D6EA 3UPRB 5E2UL 2YD8A 4HW6A 4TOYH 4GKNB 2WQRA 3QCUL 3DVIA 5EUOB 3MV7B 5J9PA 2WLYA 4LNRB 2EYSA 1JNNL 1E28B 1X5LA 4GMSL 4DJMA 2FR4B 4YFLF 2DIJA 4NFBA 4L3CB 3FT4B 2VLMD 5MERB 1RZ8A 1EEZA 5DS8A 3W11C 2QKIB 2CH8A 2HRLA 2ZNWA 2GJ6E 1DQTA 1R3HB 2R9HD 1MAKA 1U8PB 4XC3L 4J6RL 1H3UA 4YX2L 4DGIL 2FJFB 5DXWA 3FO1A 3IDJB 5DD0H 1X5HA 1I9JL 1SJVA 4N9GA 4OKVA 3ZSTA 4XP4H 3WKML 1V3JA 5FYKE 3CAFA 1SBSH 2BVYA 3RWIB 1UWGL 2RFXA 4U1LB 4PGBB 5DEGB 3BH8A 5FFLA 4B41A 3Q3GA 2XRAH 4K9EH 1OVZA 2WM0A 1MJ8L 1E27B 2APXA 2VXVL 1FGNH 2VDLL 3QH3A 1XR9B 4KWUA 1TNNA 1V3MA 1KCVL 4M1DL 3IAQA 5IM7B 4Y1AE 5AZ2L 2ED9A 3ARVA 4JO2H 3V4UH 4MJID 2YD5A 5ISZD 2J5LB 3DV4B 4KTYA 2VIRA 2EYRA 3CC5A 1PDKA 4KRPC 3RIAF 3ZTJH 3VWJC 4YGVA 1MRCH 2NXZC 1KFAL 5KG9B 3MRRB 2ADJA 1SVZA 2AP2A 5E5UB 3OJVC 1AXTH 4ZS6C 1ZLSL 3VGGA 3EFDL 3TVMA 5MP6H 4P3WA 3VA6A 1YY8B 1OGAD 2OJZL 1S5HA 3NA9H 3MUGB 4G6KH 1FFQA 2FL5B 3VD7A 2R29H 2AEQL 5B21A 2HJFA 3WXVL 3OR7B 4FMFA 1YJDL 4XB7A 4Z7WA 5D7KE 2A6KB 5C0JB 4MA7L 4PJBB 2W60A 3FFDB 1JRHH 3EOBB 4CGTA 2BNRE 5BVPH 3VH8A 5TH2A 4OGYH 4ODXA 5F96H 4P57A 5L8LB 3GJFB 5J4MA 3HAEH 1F6AA 2NY4D 3QUZA 4HUWB 4ERSH 2QBWA 2M1KA 3QXWA 5C0CA 1S7XA 3WFCH 1VFMA 3DBXB 1OAQH 2EDJA 4NP4H 4RGMC 3WCYA 1CLYH 1OAKL 2P7TA 3HFMH 1QYGL 4ZUVB 2RR3A 4IHOA 4BSVB 3DO7B 1A6TB 1BAFH 4I0CC 4ZUVA 3IVKA 3DUHA 1QFHA 4MSWA 4ZOBA 3V6BR 4S0SD 1T22B 4LKXB 4NDMA 1INEL 4LKCB 1A7QH 1CTNA 2GJ6A 1F8TL 5DA0B 4HUWA 4YHOL 3IS0X 2VLME 1A3RH 1CG9B 1IJ9A 3LEYL 1QBMH 3P0YL 5CJXA 4ODXB 4KMTL 5GGSB 4DKFL 1UEMA 4PJAF 3VH8B 4KV5F 4EIZC 4M7ZB 3L5JA 3WFHA 2A73B 4L5FH 3B9VA 2Y06H 4OGZA 3UCRA 2KKQA 5BMFL 1DLFH 4PY8I 1YEHH 1HINH 2HJFB 1A6UH 5DO2D 4LLMB 1OSZA 1YPZA 1DE4B 3EYVA 1GH7A 1OARH 4UIMA 4AJ0A 4M6NH 1U92B 2NQCA 1P53A 3QG6B 3MJ7A 2AJ3B 4AMKL 1XF3A 1CDBA 5IBLD 3FMGL 4AH2B 1WITA 2QEJA 4YHYC 1KLUA 1ZA6B 4PUBH 4DGVL 1F3JA 1HI6A 3E8UH 5TDOA 2DQFA 1KT2B 3SDDC 4R0LA 4FNLL 3PJSA 3D3VA 2Z8RA 1LHZA 1KBGL 5EN2B 1X5IA 4JFFD 4G6JL 4Q0XL 3WDJA 1ZT4B 3HG1E 1NDGB 4NBXB 5I8OL 4J3VA 1RMFL 2M8XA 5KZCB 4JGUA 4WHCA 4OD1H 4Z0XA 4C56A 1Q0XH 4YO0B 5DD6A 1SVCP 3BRGC 5DK3A 3PWUA 1IGML 1IZJA 3WL9B 2X4PB 3WUWA 2OR8A 3MLUL 4YR6B 4U0QB 4XNZB 1DN0B 5F3BB 2WNGA 3O6FB 4LIQL 4PGBA 3EYQD 5FKAA 1I4FB 4MD0A 2YEZA 2APWA 2AKRA 5FDYA 1UCBL 2DF3A 1FSKB 1LK2B 5DZNA 3KLHC 1JIBA 1FZJB 4E0RB 4F15C 3DRTA 2K3TA 5HHPB 1EPFA 3E1F1 5DZLA 4KKBD 1U91A 1X3DA 2HJKA 2PW1B 4QF1A 3MTRA 4JQVC 1A6ZB 3FN0H 3V7AG 2DQUL 3D2UA 4U3CA 5GIRB 3LQAC 1GVIA 2VZVA 2YPLA 3BD3A 3KJ4B 3GGWA 3PGDA 1EEZB 4RGOH 3BO8B 4BSWB 5F1NA 2HLFC 4JFXA 2XFXA 4KK9C 3F5WA 4U0RC 4F57H 4Y7MA 4PRIE 4RISL 5C3TA 3ULUL 4DN3L 1DSFH 5KVGH 4X9FA 2X4RB 5IKCA 1IFHL 4WU7A 2Y7QB 3G6AA 3U1SH 2MHAA 4WO4A 1DLHA 1FVDB 2OQJA 3T4AB 2A74B 3H3KA 5DVKA 4YHML 1DBML 4MB3A 3SGDI 3BD5A 1F6LL 1E4JA 1J18A 2EEBA 1JYXA 3ARQA 3U6RB 1S3KH 2IAMB 4Q6YA 4ODSL 4MAUH 3B9AA 3CDGA 5HPMB 2DLIA 5FAAA 1I7ZA 4TUJB 2K7PA 3U0WL 1IVLA 2DIAA 3HE6B 4WDIB 3IGAA 4JFQA 3C60D 5E2WH 1UA6L 1JPSH 4NCC2 4NIKB 4HKBA 4YHPA 2IFFL 1T0MA 3MRQB 5D1ZC 4NQCE 2CDGB 3BWUC 1NDMB 4JE4B 2Q6WB 4L8SB 4WEUD 2E9BA 5BV7C 3F7VB 3RGHA 1F4XH 5B39G 3TO4D 1DBBL 2PCPA 4XNMB 3SOBL 1UQSB 3T3PF 4ODUA 2GK0B 2CUIA 1J8HD 3F6IA 1FGVL 3T0ED 3BQUD 1CGSL 2OL3A 4QRPA 4KTEL 3RBSA 2DQJH 2NY6C 2Q76A 3LS4L 1ZGLM 1HWHB 5JLZA 4BSJA 4XVTL 4K8RH 1I9EA 4OLYL 4RNRA 4Z0BL 1WZKA 1DUYB 1FO0H 1TETL 4GAJL 5C0BA 1BX2B 1U95B 3INUH 3MRKB 1QG3A 1MHHB 2EDNA 3MRBA 4J4PD 4EIGB 2YC1A 3BP4A 4PJGE 3TT3H 2PYEE 2UYLB 4L8CB 1CDCA 1QUNA 4HV8B 1MJUH 5C0ND 4GG6E 5FYJE 1TITA 1S7QB 2DYPB 3M8OL 3FQUB 2FEEL 3IRPX 5ANMB 3SCMD 2EH7H 1OM3L 3VE0A 2ADIA 1X7QB 4RMVA 2AQ3A 5ITBL 3U9UB 5ICYB 2FH6A 2IH1B 1A7RH 1MFDL 2HWZL 5JQHC 3X17A 4G8IB 3VRJA 5D6CB 1MF2L 1NL0L 3CSYB 5GS0D 5T1KA 3CSYA 4OM0H 4Y19E 3B2VH 5IMLA 2Q3AA 4UT7L 2ZKHH 4L4TD 2FCBA 3QJHB 4NGHH 3U9UA 5BXFA 5EZIL 1FYTD 2VLRE 2XQBL 2IBZY 5CSZB 5FEBA 4FQHA 3IU4L 4GKOA 5GGTA 3WJJC 2MQ0A 1ZXQA 3QUYC 1CQKA 2WIMA 2NW2B 1EHLH 5IIEB 2DTMH 1F4XL 4L9DA 4PJ9A 3ARDB 3U0PB 3QFJB 1QR4A 4ODWB 4ZUTA 1XGQA 1K6QH 1CFTA 3FO0H 3FRPA 3CK0H 3EYFB 2Z92A 5HVHB 5KVMC 4P2OB 4KY1H 2YXFA 2OYPA 4PJ9D 3MZGB 4JJ5A 3L6FA 1FO0A 4QHUB 3CFKA 2VC2H 1LQSR 5GGSY 1BIIB 1X5GA 3LS4H 3RGVA 5C0GB 4R97B 4UUJA 1HXYA 3L5WB 2P5WD 2BSTA 3AB0B 3P4NA 3WLWD 2CLRB 2FD6H 4KK9D 2WZPD 5IUSA 1CICD 1PKQE 1YEIL 4CN4A 4PTTB 1HIMH 2A9ML 3MXWH 1FC1A 1B0RB 3ZHDA 5IVXA 1EHAA 4EKXA 4D3CL 4NQCD 3C6LC 5EU6B 2PTTB 4KU1A 1OWRM 1QQDB 5E6IA 1CIUA 1I8MA 3UEZA 1KACB 4ETQA 1JPSL 1ODAA 4KK5C 5CCKL 3U46B 3WN5C 2X7LA 3QUYA 4FTVA 1CXHA 1ZT1B 2LU4A 3LZFH 25C8L 2XTLA 5DWUL 1IKFL 1D5MB 1UVQB 3ISWA 3UC0L 4ZNCD 5J56B 1LE5A 2ZUSA 2RJMA 1NL0H 3OG4B 5IJKA 3CDGB 4JRYB 4L4VD 3MRCB 2AXGA 2CKBL 3IETA 4A6YH 1FL3B 2VWEC 1A3RL 4WHYH 5EB9A 4APQA 2A74A 4HC1L 1EO8H 2NY1D 1F6FB 2E9JA 3K7UA 2BSSA 2CIKA 2D4FA 1FYHB 4N8CL 5FYJD 3BW9B 3KWWB 1GYAA 4FZ8H 5HYEA 3BKYL 4M5ZH 1JGUL 2QSTA 2HFGH 4N1HB 4LAQL 4GAJH 5TDNB 1BQHA 1T89C 4WNQB 4ZDHA 2ITCA 1AI1L 1YQVL 4U6VH 1OSPH 2BVPA 3B4NA 4GBXC 4HH9B 1IBGH 3DROB 3MJGX 4PRDB 2WBJD 4P2QB 1NFDF 1DBJH 2IAMC 4JR9H 3QXDB 2ESVE 4HIEB 1P7KB 5ICZB 3TNMB 5JOFB 3TZVA 2R4RH 2WP3O 3VWJD 1ADQA 3UJIH 3C5ZA 2AKRB 2BNUA 2H2SD 1UFUA 4XNUL 5DQJA 2ARJA 3SJVD 3O6FC 1J10A 1LO5A 5CEZD 1KIQA 1ZHNB 1EDQA 1WFOA 3DGGB 4Y4KC 2XTJE 4MA8L 4KK8D 5C0IA 5D96C 3BZDA 5DD6B 1XR8B 3OJMB 4C56B 1OP3K 4XP9L 5DD1H 4WUUB 2D7NA 4EOWL 3FQNB 1KJVB 4LP4A 2V2WB 4MJ4A 5H94A 4U7MA 2ADFL 2FHFA 3BDYL 4XWOC 4FQXD 1JCKA 3VGBA 5ESAA 4OFDA 3RAJL 1XF4A 2K9UA 4S1QL 5E9DE 1TPXC 3NFSH 2H32H 2JK5A 3QXAB 1MAJA 2EXWD 3GO1L 4ACPA 1A8JH 4AH2A 1HQ4B 4P46B 5JDSA 3VFUA 5CUSL 4KZEL 4B53A 4P9HC 2F58L 4J3UA 1CFVH 5DTFB 3ALXA 2V2TA 4UIMB 4G6AD 1PG7L 4F7TA 3KLSA 4WFHD 4NKIL 4BUGA 4NO5B 4X7TA 2QJDA 1QLEL 1QO3B 5KVGL 1HIML 2A9MH 1MSPA 4X8JA 4NC2B 5MHSD 2DDQL 4F9PC 4ZFOL 1A6VH 1V8HA 1D3CA 1MAML 5F9WC 3SDCC 4A6YB 4XP4L 3QUMB 1I3RA 4V2BA 3QPXL 1UJ3A 1IL1B 1KJMB 4JY6B 3TIEB 1HCFX 5F93C 3P9LB 1N5YH 4QRUB 4LKCA 1JYVA 5F8QC 3BP7A 2VJXA 1IM9D 5IFJB 4OLWH 2GTZB 5IFJA 2H1PH 4FQ1H 3N85H 1DEDA 3I6KB 3FCTA 5D2LA 1G7HA 1IM9A 4N0FB 5FM4A 3H42H 1EMTL 1M05B 3VWKB 4OCNC 1FAKT 1G7MA 5JPNB 5L6YH 3EZJB 2SEBA 4OQTA 4X5XB 1D5BA 3QJFB 4U6TA 2EIZB 3ME0A 2FDBP 3Q0HA 2HN7B 4JHWL 4P57B 1ZV5A 3FB8A 1O7VA 1IRAY 1SYSB 5GS0H 1MREL 3MYJB 3U7WH 4WFEE 4E42A 1XEDA 5FGRA 4IOFD 1KELL 4WW2C 1C5CL 2LFGA 3IKCB 1K5NB 2YD7A 4MS8D 5C0JA 5M94B 4Q9BA 2PYED 4NT6B 3O4OC 3OR7A 4LAQH 1S7UB 2VDNH 4DWHA 3L3GA 4PRIB 5HGBA 3CFEA 4LCCC 5F44A 5EBGA 5KSBA 3HNVH 1KPVB 2VLRA 3S8WA 2IQ9L 3PV7A 5DD3H 3T2QA 4IMKA 3PHQA 4HWBA 3O3BB 1T66D 3QI9B 3HCVB 5DJAB 1I9RH 5D8JL 1EK3A 2OI9C 1QLRA 1NCUA 4LSQH 2UUDH 3JWDC 4L3ED 5FYLD 5KSBE 4HPYH 4JANA 1GJIA 2AJXH 1VACA 2P46B 3BXNB 4O2FB 1Q9WA 2PO6B 4OZ4B 2VB5A 1YNLL 5E1AB 3BEVA 5IM7A 3HG1D 3VXMB 3VMPA 1INDH 3QH3B 5EU4B 4TSAH 1G7JA 4TNVF 5DR5L 3FT2B 3RAJH 5FDWA 1HQRB 2DM7A 3Q3GB 3ILQD 1D7FA 2AXJA 5DEGA 4DW2L 5A1AA 4N0UB 1P9MA 3EHBC 2R1YB 4H1LG 4NM8H 5HHOD 1EFXD 5EOCJ 1GOGA 3TZVB 4OLZL 4MX7A 3UP1A 1QBML 3IDJA 4P2CG 4M93B 2FJFA 4BUHA 2DTML 4ORGB 3CFBB 3HMXL 4UTAL 1JK8A 3V6FA 3S36L 4D9LL 3WNLA 3A67L 4OCSH 5TDNA 3O6ML 1FL6A 4TSCL 3PP4L 1AQKL 4PGJA 3F58L 3IFPA 4G5ZL 4M5YL 1WWWX 1M7DB 4KI1A 3WIHH 5KANI 3I6LD 1YYLH 1SY6L 1LK3H 3RWJA 1GIGL 2BFVH 4XPGH 2GW5A 2BXYA 2WBJC 3NIDE 3MJ9L 4AG4L 4JO3L 3T3PE 4RA3A 5T3XD 4BQCA 4MNQA 2UV3A 4PRHB 3O8XA 1CD8A 3QULB 1YEIH 1HH9B 2F19L 1XGTB 3BQUC 2OSLB 4WV1A 4JPKH 4ZODA 4P4KB 1JJUA 5E4EB 4LQFL 2N7BA 4N0YL 4LFHG 2DQEH 4Q97A 3I50L 1CT8B 3F12A 1KC5H 3N85L 4FQ1L 1WBXB 4MJ2A 4PJ5B 5B8CB 2DQHL 5AWNH 2D7MA 4QLRA 1R24B 1OAZL 5D70L 5T1DH 4HT1H 1XZ0A 3PWVA 4HPOH 5A43C 1XGUB 3V52H 2FX7L 2ZG1A 3GBNL 3UC0H 2N7AA 1AJ7L 3SDXA 4Y5YC 4GAYB 5ETUB 3G6JE 4LL9A 3LKNA 3VFSA 1ZLUK 2DWDA 2KH2B 3EGSB 2VZ1A 3B5TA 5BW7C 1S7TA 1W2KT 1T6VN 4RAUA 4RRPG 4P5KA 4M6MH 1HH6A 2D7PA 3MROA 5DJ6A 5C9JB 1GZPB 4L1HA 2DL2A 1VADA 4PLKD 3L5WA 3QUXA 5CZKA 5EZOL 3GB7B 2Q20A 3E2HB 5I30L 4PLJD 1F58L 3VGFA 2I60H 3JXAA 2VE6A 2DLTA 2UVFA 5I75C 2LV4A 4JJ5B 5BS0E 4NNPH 4KKBC 5D5MF 5I1EL 1B4RA 2X10A 3SKMA 4POZD 4H20L 5D6DA 4M1GL 3ZKXB 4DCQA 1Z6JT 4WUUE 1LO3H 2G9HB 4Q2ZA 3QZWB 3ARDA 1CE6A 4X5LA 1QVOA 3WE6B 1G7IA 1KF9B 1ZS8B 1G9MC 1WSST 2BVOA 1TJHL 3MQIA 2H3NA 2CK2A 4JKPH 5C8JA 4D2NA 5B39B 2OZ4H 2GQHA 5B3JF 5I76A 3MC0A 3RNQB 1ZSDA 2F54A 4CMMA 5DHXB 4YZFF 4X83A 5DMKB 4PJ7E 1A22B 1BWMA 4OJFH 1A64A 5CBAA 1MI5D 4BK5A 4LVOC 5C2UB 5J57B 2NZIA 3OGCB 4ZS6D 4OBRA 5FK9A 3O6LH 1C16A 4URTB 1JMXA 3LN5B 1HEZB 2XZAL 5ICYA 1AFVH 1GGUA 5EUOE 4H5SB 2FATL 1DEEA 5C6TL 1AIFB 1A6WH 4NNXA 2WSKA 5LGHH 1QPXA 3KYMB 3RWDB 4JDZA 3ZDZE 1T80A 1JWSB 3V52L 1W0VA 4NRYB 3RWCA 2ZZUT 4AEIL 2V9TA 1J9CT 2YA0A 3D0LB 3ZKQD 2DKSA 1U36A 3CZFB 1UZ8A 3SE9H 4FQLL 1DUYA 4UV7H 5C0BB 2DQDH 4DZBA 4AENB 1RK1B 2ERJC 2ZOLA 1AXTL 4XWGH 2EDBA 4H88L 4GBXD 1AQDB 1NBVL 4YEEA 1P2CA 1FL5A 1YYLL 1MEXH 4G8FB 2NR6C 5TE4H 4KGJA 4JN1L 4Z7UE 3GJFK 2B1HL 5TGBA 4Q9RL 3UX9B 3VD5A 3DURB 2HG5B 5IB2B 4OZGA 3MFFA 3RHWK 3P77A 3BGMB 3S35H 1FPTH 3D69B 5J6GB 4MNQE 3QAZB 4MDJB 2W0LA 1X5XA 1CDUA 2VABB 5FB8A 2Q6WA 5GRJH 2EECA 2HVKA 4YHYB 2CDFA 1FORL 1FFNA 1WC7A 2YUWA 4AM0A 1KC5L 2I9TA 2ZWLT 4Y4FA 1ZA3A 1W8OA 4ZUWB 2IANE 1CK0H 3BX7C 2P8LA 5HI3C 5J13B 3TBVA 3QXUA 3PWNA 1RHFA 3AROA 2Y5TA 4GKZB 2YD4A 3SDAA 3U7YL 3L3DA 3NCFB 1NBZB 2W9DH 3K4AA 3MLZH 4ODTH 4IMKC 5I8OH 1D5IH 4BQ9A 1QZ1A 6FABL 4NKMB 3X3FL 1W8NA 4IS6B 3SDDD 1U3JA 1WZ1H 4PJDF 4NSKA 1BJ8A 4YLQT 4WU7B 4JFDB 3MREB 3OF6D 1P4LA 4PGDB 1INQB 4ZPVA 4XX1E 4JFXB 5CD3A 4ZYKA 4HWBL 4GUPA 4ZFGH 1IQDA 3O6KL 1YA5A 5HVWA 3QIWC 4XWOD 3EOTH 2PO6C 3P4OA 1ITBB 5F89A 3MGAA 2I07B 3CPLA 2BSRB 1NUDA 5HHPA 2DLFH 2AVGA 5FO9A 3O2DH 3HZVA 3MV9A 4OCRL 3WKNA 1RJYA 4YDJA 5FM5M 1AKJD 5IP4A 5IF0A 4NRXA 2A2QT 3GKWL 3O6FA 2X42A 1QSZA 1C5BH 1DN0A 4M7JL 1HYRC 2YPKB 1HDMB 1U8NB 4MD4A 5ITFA 3NZHH 1VFBA 5CEZE 5CP3H 4QRPE 3CU7A 5EC1A 4XXCC 1LGVA 5BZDA 5EZLA 1YEJH 3V6OE 4LSVL 3KVQA 2H6PA 5HHOE 3C6LA 2B0SH 5GHWL 4M1CC 3IJHB 1Q1JH 4QT5A 5FYKH 4JFFA 5F9OL 3CMGA 3JTTB 4R0LB 5KSUA 4U0RB 1X5YA 4XPAL 4KKNA 3ARBB 5TFSH 2MPAH 3RUGF 1RHHA 1RIHH 2OM5A 4YIQB 2BY2A 1MFBH 5LGKA 3RGVC 1RZKL 1IARB 2WBJB 4PP1D 4NZRH 3G08A 3IFNL 4PYGA 1PBYA 3GIVB 2C9AA 4HKXA 1OOAA 1CXIA 3LRSA 4EI6A 1NCCL 5L9DH 1IAII 1VGEH 1DBBH 3G6DL 3IDGB 5D1XC 2X44D 3ES6B 2W9EL 5SWZA 4MA1B 2NTFA 3CSGA 5ADPL 3FQRB 1LILA 5D5MA 1F3DH 1GGYA 2OR9L 3MJ9A 1FPTL 3VFNB 3QCTH 1KB5A 3S37H 3KYNA 2FECL 2P24B 4JPVH 4HULB 2LABA 4EZMA 4XCCL 4JHBA 5AYUL 3QDME 4R2GD 2BRQA 1UXSA 4BH7B 1RU9H 3PDOB 4R2GB 3TO4C 3WBDA 4RGND 5JW4R 2NZ9D 1JHLH 1SYVB 2DWEA 4JVPA 4XH2A 1G7QA 4CN6A 5FF6B 5F72S 5HDLA 3T0AA 4EXKA 3BIKA 3OJDB 4N0YH 1HNFA 1PSKL 5HHVH 4GQ9H 3L3OA 2NW3B 2A6DA 3ZL4H 1RIVL 1RIUL 1ND0A 2W65A 4D9QE 5E4IA 1F6AB 2C4FU 4GBXA 3RU8L 3GSRB 3VA2C 5HYJB 5JW5B 2NX5E 1UH3A 1QYGH 3SGDH 1EA9C 3LS5H 4OM0L 1UXWB 1IGYB 5CEXB 2XG4A 1LMKA 4KQ3L 1MJJA 2IPUG 4NZTH 3NAAH 2MPAL 4FQXB 5FHBL 3H3PH 3G5XB 2YPVH 3HZYB 1A7OL 1DQDL 2F8VA 2VYRE 2Z4QB 3RY6C 2GSIA 1FGVH 4PD4K 3IXAB 3LEYH 1XF2A 4FN0A 2LE9A 4YUEH 1OQOA 3TN0B 3T04D 5TQ2L 2DBLH 3SGEH 3HC0A 1IT9L 3EFFA 3TV3L 4XNQB 2GSGB 4EI5B 4MJIB 3MRRA 1MCCA 4IDJH 5I1LA 1Q9OA 5IW3A 4M8VA 1E6JH 1R3LB 2O5ZH 3B9DA 3ZT6A 4M61B 1I8IA 3U4BL 2QQLL 3NCYS 4EDXA 1CL7L 3T2NL 2FO1A 2VIRB 2HKHH 4F7MB 4G7YH 2EICA 3AU1A 2CIIB 4MVBC 4C83B 2BNQD 3FQWA 2FIRT 3LKPA 3MLRL 4Q9QL 5IW1B 3IJYB 3HR6A 5DF0A 5GHWH 1ZHKB 4U4BA 4O2CA 5F3HA 3SO3B 3BZFA 5E5MA 4XHJC 2ITDB 1A0QL 4HFWB 3I6GB 1JNJA 2ZOKB 4XNXH 5K59F 4AYFA 5DEFA 1WCBA 5T5NF 4LVHB 2R56H 1UG9A 1CGYA 5KSAA 1MIEH 4J23A 4CVWA 2ORBH 4X9BA 3DTXB 3MRNA 1IBGL 4ESKA 5IEHA 2FLRT 2RHEA 1LE9A 3LSOB 1WLHA 5CP7B 2V7HB 2VERN 2F54D 1CFQA 1HHJA 4HQQH 1JPGA 1ZGLA 3QRFM 1OP5K 1A3LL 4OFYA 3SPVB 3DVFA 4RZCB 4FXGA 4K2UH 1BVLA 3CX2A 1Q0YH 1GXEA 2F8XC 5E8PA 4OLVH 5AD0A 2BDNH 4XC1L 5DI8A 1JUFB 5JHDE 4IRZH 5DUPL 3EYUH 3L7EA 2IF7A 4LSDA 1CF8H 2P4AB 5DD1L 3DYPA 3LKOB 3D0VB 4P2RE 3N1MC 1OAKH 3DX6A 5K9JL 4LMQI 2P1YA 2DICA 5F7WC 3RVXD 1TFHA 4YX2H 4ZD3H 5IHBA 4PV9A 5E8DL 5GS0C 2Y36L 3RDTC 4HHAA 4KKLC 2VLLA 5I8EA 2GCYB 5K9QG 1NGPL 4LK4A 2HLFD 5I1DB 1VKXA 2NY0D 4KV5E 3GSWA 5K9OA 4UOW1 4WY7H 3S3JA 3V5DA 3K1DA 5I1CH 4RAVB 1BLNA 4HX1A 3VMNA 5C0BE 5HVGB 3EJJX 3ARRA 1T1XB 4OGAD 2GTWA 3ARGB 3FONA 3VGHA 4F9LC 2ZUWA 3WFEH 3MODL 1XF1A 2OMNA 3C5SB 2XN9D 4PJXE 4R26H 5ICXA 1FFRA 3B8SA 5FA4A 1SEBA 4MNGA 2X09A 4P5TC 1YMHA 5GGRA 4RMWA 2JB6A 2QSCH 4NO3B 2H32B 3H7BB 3O4LE 4FFZH 3U4EB 4CU7A 1AR1D 5CJXC 5E08L 4NP4L 2AJSL 1S9VB 4LPCA 3IDUA 4NQED 3VXNB 2HFFB 4WI8A 3DV6A 4JZNA 2DQJL 3VFOB 5DDHB 1XGYH 4PJAB 4PJEE 3BT2L 1U8QA 2X1WL 5I19H 1H3VA 4KI5E 4GOSA 4JQXC 1UB5A 2PUQT 5E8NB 3KDMA 3PUCA 4P46C 1CFSA 1FVCA 3T0XA 1ZGLP 4O4YL 5L7XL 4QY8B 1A7NH 1HHKB 2Y25A 4U1JA 3RKDD 5JHLH 3BKML 4YEFA 6CGTA 4EEEA 3L95B 3TO2B 2VO5A 5E03A 4NRZA 1L6ZA 1JTOA 5C07A 1DFBH 5IEKB 3O3EB 4G8GD 4UI2A 3HRZA 4JM2F 4HUVA 1UH4A 2J4WH 1KULA 4ZAKD 1ZWIB 2JCCA 2XICA 3PWPE 4R4FH 1U8HA 3MACL 3OSKA 4QTHB 4YBQD 5DJCA 3M07A 1U8MA 1YUHB 4RIRB 2JELL 4OIIL 5KVFL 1RIHL 4I77L 1X5FA 3QIWD 3DLQR 4KHTH 4RIRA 4FQCH 5BO1L 1H8NA 5F7LB 1ZT7B 3IU4H 5L9DL 5HD8C 3HE6D 2HTLC 1WBYA 3WIFB 1EAPA 4X6DF 2NY5H 3R1GH 4QRQB 1TNMA 5J1SC 5DUPH 5MEQA 5I15L 4MXVE 4HIXH 1DANU 1K4DA 3BUTA 2R2HB 3TVMD 3Q1SL 3QYCA 5C07B 1DLFL 1EJOH 4UBDD 3GSUA 4IIQA 4TVPH 4WI7A 2EDRA 1U0QA 3L95A 4ONHA 3CIQA 4YAQA 3LB6C 3JV6B 5FGCE 2OCFD 3SDCD 3GUTB 1NFIB 1SJXA 3RZCB 3SCMA 2Q8AH 3PG2A 4F7CA 1UCBH 3HNTH 5DFWH 3FMGH 2H2PD 3L5XL 1U8LB 3GKZA 4PJBE 1F02I 4XZUA 2YSSB 3OKLA 3AC0A 2VN4A 3JWOL 3MOQA 9CGTA 4QRRA 3H9SB 8FABB 2AJVL 3O4OB 3VFOA 4BKLA 3ZZ1A 4U1MB 1HSBB 2FO4B 3O6LL 5GPRA 4Z76A 3NABL 4LCUB 5BQ7B 2OL3H 2HTKD 3JV5A 1H3PH 1KXQE 1QACA 4N5UA 1H3TA 1FYTA 3OXSB 2ESVD 4R96A 4G9FB 4NO3A 3L7FA 1IAOB 1YECH 3G04B 3PHOB 5GGRB 1KTRL 5JOEA 4D9RE 3K74B 3MGTA 4F15B 4KROD 2PF6A 3A6BH 3P0VL 3Q5YA 4OCYH 3WFBH 3PGFH 2WV3A 4P23B 5C7XL 2WW8A 3C5SA 3WEXB 5A2FA 3H2WA 2WANA 1S9YA 3CH1B 2Z91A 2AV1A 5E9DB 3FONB 2J8UE 3O45A 2X4UB 4OCWL 4JKKA 1HHHA 5DK0A 3KLDA 5EH1A 3C2AH 4C54A 2VH5L 4GSDH 1P1ZA 5CP3A 1OTTD 3NGBC 1FNHA 1B6UA 4LPTA 4PRPB 5FA3A 1PY4A 1GZQA 4WFGD 1J88A 4OZIA 3F65A 3L9RA 5HYJE 1QBLH 5BZWA 2EC8A 2G2RA 4YHIA 4CN1A 1JYNA 4P0DA 3I3EA 5E4EC 4OSUL 1OTSD 1AHWB 3VWKD 4Z7QE 3OHXB 4QNPE 3LKOA 4UINH 2VR9A 5FYJL 3FO0L 4TTDC 5TPWH 1M71B 1LO2H 1E4XH 2F54E 1F13A 1F58H 3CJJA 3OX8B 3P11L 4MA3A 2GFBA 4TNVK 1EH9A 2C7UB 4TVPE 2BHUA 4TN9A 4EN3B 5L88H 4XP9H 2ORBL 1AC0A 2ICEB 4MMXC 4Z8FL 1LVEA 4KJQD 3WN5A 1UC6A 4OAWB 5HD8D 2C1OA 1N6UA 5EUKB 1JPGB 4ZUSA 3EO9H 1ZGLB 3RWHA 1G0YR 1E6OL 2V7HA 5L0QB 1EFXA 3W9EB 3HMXH 4UTAH 1MCSA 1MJ7H 3MRDA 4PJDA 4XP6L 4O51B 4UU9A 5HI4D 4Z6AT 4HJJL 4YWGL 4DKAA 3W9DA 1LP9B 2G75B 4TNWF 4KK5D 4OCXH 4HIJA 4JRXE 5GJTH 3ET9F 4MNGE 3IS1X 4K8RL 5I30H 4PRBA 4XC1H 3NBNA 4KDTA 2LAGB 4HF5L 2F15A 5T5FL 3UTQB 5DA4A 1IE5A 3HC4L 4AQOA 1Y18B 1UEYA 4TUOB 3SO5A 2BNRA 1MI5B 3PWJA 4H20H 3BPLC 4WFED 2X4TB 3KXFA 4Z7WE 4Z7VE 3RX8A 4Y5VA 5L2JB 1KTDA 3MA9L 2AJYL 4LBEB 1AXSA 3K2UH 1IGIH 3CZJA 4ZAKA 3FRUA 1OPGL 2J1KA 1CE1L 5M95B 2IMMA 4HKZB 1HZHH 4M43L 5HGHA 3RVWC 2CKNA 1JZ8A 2HRPH 3HPJB 2BNQB 1OTUC 4PLJC 2PNDA 2KPNA 1P7HL 3W5NA 5T33H 2R1WA 1B0WA 1N7ML 2VXQL 5EZJB 4JFYA 5F21B 3IDNB 1ZLWH 1MLCB 3O8XC 5I0ZA 2ZUQB 1JZ6A 2VAJA 5DRWB 1NBQA 1RJLA 2EXYC 3BESR 4PJHB 3OG6B 3E3QC 4YHNB 3HMXA 3TN0D 3RY5A 3WFEL 4Y1AD 4Z8FH 3IRZA 4RISH 3OKOB 1H15B 1I9JH 3QHTC 1RJLB 3VDCA 1P7QB 3RZWA 3MRMA 1IGTA 1MLCA 3O9WA 2R1WB 1HK6A 1J8HA 3BP6B 3RBGA 3T77B 1QSEB 2FB4H 4K3JH 2W65B 5TF0A 3WUZA 4HFUL 4P99A 4WU5B 2ATPA 4OD3L 4UAOC 1I3GH 3HPLA 3GIZH 4JFZH 4Y19B 3TYGL 1YEHL 2J12B 3BZ4A 1NBVH 4HZAA 5FGBA 1NC2D 5TQ0L 1U2CA 1QEWB 5CWSA 4JO4L 2JTDA 5IQ7H 2UY7A 3B2UD 3H9HA 1G7LB 4YXLH 3QAZC 3PWJB 4JRXB 4LLYB 1Y18A 5EORL 1Z9LA 4PJFF 3S35L 1CLOL 2AK4B 4K7FB 4BQBA 2EZ0D 3C6SA 4M4RA 5DJDB 3NIDF 5GGVY 3P2TA 2Y9RT 1RI8A 1NAMB 4MAYD 3BUYA 3PIQB 4G6JH 4Q0XH 5DUBB 3MV7D 5DLMH 4X6FA 1GGIH 1LP9A 4LLUA 1RIUH 1VCAA 2V5YA 4POZC 1AGDA 3FFCD 4NNYA 3HB3C 5T3XE 3RTQA 4WI2A 4KVCH 3WXVH 5EULV 4DQOH 5B3NA 3W0WB 4ZUSB 3VFRB 3MLUH 3BPCA 3UDWC 1U58A 3C87A 5JHDA 2G5BB 4QXWA 3IFOB 2R69H 4LPYA 4PP2B 3F7PC 4NKOB 3BFOA 1BQHG 1C5BL 5IB1A 1II4E 2GFBB 4M9PA 1T2XA 3U9PL 4FFYL 4RFEA 3QPXH 3C60C 5H2BB 2P5EB 2IG2H 2JJTA 4GRLD 5K59E 1MFEH 4YHLL 3DWTA 3QIWB 2EDTA 2HFEA 5EBWA 5GRYA 1J5OH 4JZOB 1NFDA 3SJVA 5JMRA 3U30C 5J13C 2L0DA 4E5XA 1T5WA 4Y5YA 3LCYA 5DK2B 4DVRL 3C6LB 5DRXB 1FG2B 4HG4J 3S36X 2R0LH 2R1XB 2ADGA 3X3GL 4PYHA 2WMPA 4JM2A 4J1UB 2CKBB 2X4NB 5DQ9B 4CDHA 4X6DB 2YWZA 2YUZA 4S1SL 4Y16B 5FA3B 1F4YH 4QGTA 1A4JA 2HJLB 3ALWA 5C09B 1RJYB 4YDJB 3C08L 3UTZB 5AEAA 3QNZB 5IFAH 1CLOH 1MH5B 5IBUG 2VLKB 3ZT7A 3T09A 3KLAB 4K7PH 3G6JF 3O45B 5HYFA 3ARFA 1Z9OA 5F89B 1NUFA 5EA0H 1NSNH 1HCVA 3P4OB 3QISA 5I17B 1UKSA 3WEXA 5HGDA 4I2XB 3MBEB 4R90L 5EBLA 4G43B 4PG9A 3TA3B 3JTSA 4LCWB 5J12C 4LOUD 4MXWH 5DD3L 2AXHA 3ARXA 5I1KH 4PJDE 1RD6A 3SQOH 2XV6B 2P8PB 2FD6L 3LQZA 1R5IB 4P9MH 4KC3B 3L7FB 1A3LH 1UACL 1ED3A 5IVZB 4X5WA 3SDDA 2JKXA 4GG8A 5JIHA 5C7XH 4BM7A 3H0TB 3KPRE 4A2MA 1DQJB 2JJTC 3Q5OA 2FJHB 1JF1A 4FNLH 4O9HL 3FRPG 4NQEE 1VPOH 5F9DC 3LIZH 1NLDL 1LD9A 3I75B 5FO7A 1J05A 3VJ6A 3X13B 1CF8L 1P5UA 1BBJA 3AMKA 1PVHA 3OKLB 3MSPA 5SV4A 3BKJL 5JA9A 3ZL4L 3FB6B 2MCPH 4YC2B 4OFIA 4I5BB 1MOEA 1AGBB 3ARYA 3OKMA 5HHXL 3RVTD 1Q9LB 3X11B 2MKWA 3GNML 4LLDA 1T5XB 4YAQB 3V0WL 2JIXD 5EU3B 1WTLA 1BQLL 5IQ9A 5IMKA 3V6OC 1V7NL 4GXUM 4ZFOB 2EH7L 4IIQB 4JFDE 3L3IB 4Z7UF 4Y4HA 1H9VA 4U3HA 3VD3A 1FJ1B 1A7RL 1MFDH 1YNTB 3LQAH 4L9LA 4XVSH 3WXWL 4UINL 2A9NH 3D85D 2HLAB 3BGAA 3ILPB 3O6MH 4KROC 4IOSD 4JZJA 3AM8A 3WIHA 3HI1A 1LDPH 4AENA 5F9WB 3SDCB 1G6RH 1H3XA 5JZ7C 2VLRD 3FZUD 2IANB 4J6RH 4NN6B 4XBGA 3M1BB 5DYOA 4XPGL 3BVNB 5HI5C 4U1IA 3QDGD 2EIBA 2G60L 1DSFL 1YN6B 4NOBA 1ZWIA 4JFPB 4OIBA 4NQCB 4C59B 1IKNC 4L9LB 4JKLA 4PTUA 3ZDYE 5JW3L 1R3JB 1RURH 1Z9MA 2OTUB 2ZPKH 1UWGH 5D1QC 2QQNH 4U6YA 3RWEB 2H45A 1WICA 3ARUA 4ZFOA 5DR5H 3LN5A 3TO2A 4MAUL 5IQ9B 3CX5J 1C16B 1JFQL 1V5JA 3HNVL 3QUMH 5BRZA 5C0AB 1MVFA 2HKFH 4KPHL 1ZANL 3KPSB 3MA7A 3TV3H 4I4WA 4HIHB 4D0CB 2CO6B 5FECA 5E8NA 4NQXA 4NUJB 4JO2L 3V4UL 3PL6C 5JIPA 1OF2A 4MCZB 5E56A 2PR4H 5ADOL 4WW2B 3TPUA 3QDJB 2AJYH 1OY3B 1RK0A 2VUOA 3P73B 2VDMH 4JDTL 1J05B 4Y88A 2EKSA 3U2SB 2XIDA 2QQKH 1J1XL 4KRLB 2OTWA 1JWUB 4QHMB 1FQ9C 4Z5RA 7FABH 1UJTA 2OMBA 4KRNA 1SY6A 4G6FD 3SGEI 3VXNA 1U3HD 4R4NC 4DCQB 4LLWB 2B8OT 5IMOA 2NXYC 3SKMB 3U4EA 5DJ0A 5CCKH 5J1TC 3TBSB 5JW4Q 3ZKMC 5D71L 5CJQL 4JM2C 4NZUH 4CVZA 3T2OA 2JB6B 3KR3L 4LSSL 3DVNB 1FO0L 1X4XA 1YEKL 4YQXH 3MLSL 5BMFH 1BJMA 4RWHA 1TENA 1REIA 3QHFL 3W39A 5HHME 3HAEB 3RUGB 5HGDB 1IGFH 1TZGL 4OIIH 4XCFL 3WO4C 5KVFH 4HJ0C 3MUHL 4OM1H 3STZB 5GGTL 3HS0A 1CGXA 4XHJD 3ARFB 3CLFH 5CFHA 5GZOD 5IT2L 1LNUA 1TZHB 4RFOH 3K0WA 2DQEL 2OJEA 1CIDA 4HQQL 4XTRD 2NX5D 3WFCL 4F58L 3GM8A 4M6OL 4KJWC 1PLGH 3WIHL 4P4RA 4WWKD 1E6JL 2XN9B 5ALCH 4OFKA 3TNNA 1NMAH 1IAMA 5T1LB 1TZIB 4L1DA 4AIZB 1OW0A 3EDDA 3KYKH 3STLB 3I85A 5INCB 1FG2A 2F5BL 3LHPH 3PGCA 3KPMB 3OMZA 1DQQB 2GY7B 4YXHL 3OB8A 3SKJH 4GT7A 4M8QA 2KQMA 1JUFA 1U93B 3DX8B 5E2JA 5I16A 4X4XB 2X9WA 1G0DA 4KKCD 3C60B 4ZOEA 5DHYA 1ORQB 4X7DC 3SE4C 1X6LA 3KPNB 4UT6L 1UENA 4M62H 5CJQH 2EDKA 4Y2DC 2IBBA 3VFRA 1A1OB 4H8WC 1QR1B 3FTGA 3WD5L 1HHGA 3ECBB 1FIGL 1J11A 2VQ1A 4PS4L 3A6BL 3P0VH 2ID5A 1PQZB 1EBAA 2NY0C 4M6ML 3CFDA 4UNTA 3E8UL 4YDVB 4F7PA 2E6PA 4OQTL 2R1YA 5EC2B 1MCHA 4WCYL 2FWOB 3RQ3A 5HHOB 1CDYA 2BDNL 3AS3A 5HGAB 5CD5D 2FEDC 4QOKD 5C0FA 4ODSH 5KSVA 1LP9F 4JM4L 3MRLB 2GUOB 3KYOB 2XRAL 1CDJA 4K9EL 4OZ4A 2DMBA 4FQQB 3RPIA 4PG2A 5DVOA 3VRIB 2N56A 4DK3A 1NC4D 4I48B 4POUB 4K9EC 4HKJB 3JVGA 1SQ2N 3QSKB 1LEIB 1S5IH 4P5TB 3B6SB 4NO2A 4HJGB 4IEFB 2Z8WC 1RZIA 1NC2B 1RU9L 3T4YA 3HI5H 4RFNC 3KPRA 4K8RC 3D85B 4KUCD 4S2SB 4TOYL 3GK8L 4JGMA 4KJPD 3M45A 3N1GC 3MLPA 3MRMB 2XOTA 3IXAA 1P7QA 1XF2B 4JDVA 4HIXL 5GZND 4HCRH 3S96A 4N0CC 3VFWB 1AFVL 3PP4H 1L9NA 3QI9D 1J0KA 4PJEB 1ZVSB 3HG1A 2EEAA 3C9NB 1DBAL 2RGSA 5KVEH 3S96B 1OP9A 1OD7A 4NQVA 4OLYH 4JN2A 2JJWA 3RKDC 5AG9A 3D85A 2UWEB 3DUSB 1MCWW 1FHGA 3EHBD 4PB9L 3SKOA 3QFJD 4QGYA 5GGQH 1B2WL 5JR1L 5KJRL 1PW3A 1JZ7A 1JPFA 5D7JD 4IRSB 1F5WA 3UTPD 2XZQL 1I8KA 2X4OB 2IPTH 3M8OH 4L4TE 2CMRH 3OJDA 3VWKA 1S7VA 1CXEA 4PJ7B 1G7HB 4N0FA 1D5ZB 5D2LB 3BD4A 1WJ3A 4BFEA 2NY3B 4P23D 5TE4L 4OFPA 1VSCA 3G6JA 2VDQH 2X4TA 1N3NB 4I18C 5T1DL 4O5LL 2EYTB 4PJGB 5EIQA 2EDEA 5KVDH 1KXVC 3MRGB 4MAYA 4KROB 5D1XD 4HUMB 2XQYG 2J6EL 1ADQL 4F80A 3OR6A 4YH6A 1N8ZB 2FSEB 2NCMA 4ZTPL 3TBTA 3QIUC 2X4QB 4NQEA 4GAGL 5DT1H 4HWBH 5D7IB 1Z5LB 4UTBH 1I1FB 2YK1H 3H8NA 4LRNL 1CCZA 1A6AA 1M4KA 4X98A 2NTFB 4PJDB 3GFUA 4UIKH 4PGCB 4KUZH 3VXTB 3IDYB 1N2RB 3IDGA 4NWTL 4FFWC 3LRSB 1CS6A 2XXMB 2W9DL 3GIVA 4OAWA 5C09D 3QO1A 1YEFL 4U6HB 3VFPB 4BZYA 5GS1A 3V6ZA 2CJUL 1ORSA 1UM6L 2BY1A 4G8GA 5D72H 1TVDA 2NY7H 3NCMA 4XMPL 4QXGL 3RZCC 1RUQL 4QOKE 3GSOA 4Z7NF 4K71B 4X4XA 5I16B 4F8QA 1U93A 2A77L 2KDGA 3TPKA 4CADA 1KLGB 2FJGB 5F96L 3WO4B 5JUEH 1EUUA 5KBNC 4FQ2L 3QQ4B 3BN9D 1KEGL 1BZ7A 1FNGA 1QRND 3HZMB 1VENA 3ILQC 4PUBL 1NAML 5FYKL 3MRIA 5I66A 4XB8A 2V2WA 4WV1C 5GJSL 5IB5B 1F97A 4P3DA 5M7QA 2AEPH 3NA4A 5KN5B 3BHBB 5T1LA 3FB5A 1H8SA 4I3GA 4KKAD 2NXYB 2X70B 3DVGA 2BVUA 1HDMA 2JJUA 5IB3A 2FIKB 2W0FB 4NGHL 1GZQB 3VXPB 1F2QA 3J7HA 5I0DA 4G9DB 2WQ8A 2YD1A 5IF0B 5I1GL 4L8BA 2UZIH 4LFHD 4YPGA 2ZCLL 1GRWA 4OQ1A 1LWRA 1XF5B 1ORSB 1ADQH 5IHLB 5I8CB 1HXMB 3MMEA 1MVUA 4JFEB 4U6HA 3VFPA 4POYA 2VN7A 2BSRA 1GGCH 2ICWA 3WJLA 3BDXA 4GAGH 4PRDA 5DT1L 2EO9A 4I3RH 3SQBA 2YPVL 5D1QA 2FX8H 4KI5F 4R7DB 3SDYH 3TCXA 1FZOB 2B0SL 2D4DA 5F7YC 3O2VH 4XI5C 2DD8H 3VG9B 4GUPB 2O5XH 5KVEL 4P2QD 2OTPA 3HN3A 4GS7B 4JB9L 1U3HB 4ZPVB 4PJAE 3THMH 4XPHL 3R8BB 4ISVA 3X12A 5KS9B 4K23L 1JI1A 3E3QE 4PJFE 4CBPA 1RV6X 4PB9H 3QCVL 1S9XB 3AM8C 1A7PH 5DMGD 4G9FD